WorldWideScience

Sample records for vhf radiotelephone receiver

  1. Design and Development of VHF Antennas for Space Borne Signal of Opportunity Receivers for Cubesat Platforms

    Science.gov (United States)

    Deshpande, Manohar; Piepmeier, Jeffrey

    2015-01-01

    Design and Development of VHF Antennas for Space Borne Signal of Opportunity Receivers for Cubesat Platforms. Space borne microwave remote sensors at VHF/UHF frequencies are important instruments to observe reflective properties of land surfaces through thick and heavy forestation on a global scale. One of the most cost effective ways of measuring land reflectivity at VHF/UHF frequencies is to use signals transmitted by existing communication satellites (operating at VHF/UHF band) as a signal of opportunity (SoOp) signal and passive receivers integrated with airborne/space borne platforms operating in the Low Earth Orbit (LEO). One of the critical components of the passive receiver is two antennas (one to receive only direct signal and other to receive only reflected signal) which need to have ideally high (>30dB) isolation. However, because of small size of host platforms and broad beam width of dipole antennas, achieving adequate isolation between two channels is a challenging problem and need to be solved for successful implementation of space borne SoOp technology for remote sensing. In this presentation a novel enabling VHF antenna technology for Cubesat platforms is presented to receive direct as well as reflected signal with needed isolation. The novel scheme also allows enhancing the gain of individual channels by factor of 2 without use of reflecting ground plane

  2. Design VHF Antennas for Space Borne Receivers for SmallSats

    Science.gov (United States)

    Deshpande, Manohar

    2017-01-01

    Space borne microwave remote sensors at VHF/UHF frequencies are important instruments to observe reflective properties of land surfaces through thick and heavy forestation on a global scale. One of the most cost effective ways of measuring land reflectivity at VHF/UHF frequencies is to use signals transmitted by existing communication satellites (operating at VHF/UHF band) as a signal of opportunity (SoOp) signal and passive receivers integrated with airborne/space borne platforms operating in the Low Earth Orbit (LEO). One of the critical components of the passive receiver is two antennas (one to receive only direct signal and other to receive only reflected signal) which need to have ideally high (>30dB) isolation. However, because of small size of host platforms and broad beam width of dipole antennas, achieving adequate isolation between two channels is a challenging problem and need to be solved for successful implementation of space borne SoOp technology for remote sensing. In this presentation a novel enabling VHF antenna technology for Cubesat platforms is presented to receive direct as well as reflected signal with needed isolation. The novel scheme also allows enhancing the gain of individual channels by factor of 2 without use of reflecting ground plane.

  3. 47 CFR 80.911 - VHF transmitter.

    Science.gov (United States)

    2010-10-01

    ... MARITIME SERVICES Compulsory Radiotelephone Installations for Small Passenger Boats § 80.911 VHF..., measured at the power input terminals to the transmitter, and the output power of the transmitter, terminated in a matching artificial load, must be measured at the end of 10 minutes of continuous operation...

  4. Development Of VHF (240-270 MHz) Antennas For SoOp (Signal Of Opportunity) Receiver For 6u Cubesat Platforms

    Science.gov (United States)

    Joseph, A. T.; Deshpande, M.; O'Neill, P. E.; Miles, L.

    2016-01-01

    The main goal of this research is to design, fabricate, and test deployable VHF antennas for 6U Cubesat platforms to enable validation of root zone soil moisture (RZSM) estimation algorithms for signal of opportunity (SoOp) remote sensing over the 240-270 MHz frequency band. The proposed work provides a strong foundation for establishing a technology development path for maturing a truly global direct surface soil moisture (SM) and RZSM measurement system (Figure 1) over a variety of land covers with limited density restrictions. In SoOp methodology, signals transmitted by already existing transmitters (known as transmitters of opportunity, in this case the Military Satellite Communication (MilSatCom) System's UHF Follow-On program) are utilized to measure properties of reflecting targets by recording reflected signals using a simple passive microwave receiver.

  5. 46 CFR 169.669 - Radiotelephone equipment.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Radiotelephone equipment. 169.669 Section 169.669 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS SAILING SCHOOL VESSELS... of Less Than 100 Gross Tons § 169.669 Radiotelephone equipment. A separate circuit from the...

  6. Forming and detection of digital watermarks in the System for Automatic Identification of VHF Transmissions

    Directory of Open Access Journals (Sweden)

    О. В. Шишкін

    2013-07-01

    Full Text Available Forming and detection algorithms for digital watermarks are designed for automatic identification of VHF radiotelephone transmissions in the maritime and aeronautical mobile services. An audible insensitivity and interference resistance of embedded digital data are provided by means of OFDM technology jointly with normalized distortions distribution and data packet detection by the hash-function. Experiments were carried out on the base of ship’s radio station RT-2048 Sailor and USB ADC-DAC module of type Е14-140M L-CARD in the off-line processing regime in Matlab medium

  7. Dicty_cDB: VHF264 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF264 (Link to dictyBase) - - - Contig-U16260-1 VHF264P (Link to Original site) VHF...264F 606 VHF264Z 693 VHF264P 1279 - - Show VHF264 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-C/VHF264Q.Seq.d/ Representative seq. ID VHF...264P (Link to Original site) Representative DNA sequence >VHF264 (VHF264Q) /CSM/VH/VHF2-C/VHF...DRRKNIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHFEMPKEDKLPAGCTS

  8. Dicty_cDB: VHF181 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF181 (Link to dictyBase) - - - Contig-U16260-1 VHF181P (Link to Original site) VHF...181F 610 VHF181Z 416 VHF181P 1006 - - Show VHF181 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-D/VHF181Q.Seq.d/ Representative seq. ID VHF...181P (Link to Original site) Representative DNA sequence >VHF181 (VHF181Q) /CSM/VH/VHF1-D/VHF...VKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKVSG DMRYMSCRADEQERGITIKSSSVSLHF

  9. Dicty_cDB: VHF777 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF777 (Link to dictyBase) - - - Contig-U16283-1 VHF777P (Link to Original site) VHF...777F 474 VHF777Z 669 VHF777P 1123 - - Show VHF777 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-D/VHF777Q.Seq.d/ Representative seq. ID VHF...777P (Link to Original site) Representative DNA sequence >VHF777 (VHF777Q) /CSM/VH/VHF7-D/VHF...PNIIGVEHYKVATDVQKILXRI*itsryychfryg*fi *rpksncipcs*dstflittirscprxhqygr*ir*tlrlyq

  10. Dicty_cDB: VHF354 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF354 (Link to dictyBase) - - - Contig-U16260-1 VHF354P (Link to Original site) VHF...354F 617 VHF354Z 721 VHF354P 1318 - - Show VHF354 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-C/VHF354Q.Seq.d/ Representative seq. ID VHF...354P (Link to Original site) Representative DNA sequence >VHF354 (VHF354Q) /CSM/VH/VHF3-C/VHF...no Acid sequence LSSAKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGD

  11. Dicty_cDB: VHF590 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF590 (Link to dictyBase) - - - Contig-U16306-1 VHF590P (Link to Original site) VHF...590F 115 VHF590Z 603 VHF590P 698 - - Show VHF590 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-D/VHF590Q.Seq.d/ Representative seq. ID VHF...590P (Link to Original site) Representative DNA sequence >VHF590 (VHF590Q) /CSM/VH/VHF5-D/VHF5...qlphvlrqlk*sqnfhkkylkkvqeqqq--- ---rwifhrwccfqsthdamyflyqxfgslsw*snlxrpkist*xfyhifghfw*rls*l ss*ipi*lqkwysyv

  12. Dicty_cDB: VHF536 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF536 (Link to dictyBase) - - - Contig-U16531-1 VHF536P (Link to Original site) VHF...536F 255 VHF536Z 685 VHF536P 920 - - Show VHF536 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-B/VHF536Q.Seq.d/ Representative seq. ID VHF...536P (Link to Original site) Representative DNA sequence >VHF536 (VHF536Q) /CSM/VH/VHF5-B/VHF5...ti*mlhliskvmtvh*mslslfyggyfl*lsi*llwnysig qvvvcliksikxerllkstmt--- ---*erlcl*ilxlvsichf

  13. Dicty_cDB: VHF730 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF730 (Link to dictyBase) - - - Contig-U15767-1 VHF730P (Link to Original site) VHF...730F 569 VHF730Z 718 VHF730P 1267 - - Show VHF730 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-B/VHF730Q.Seq.d/ Representative seq. ID VHF...730P (Link to Original site) Representative DNA sequence >VHF730 (VHF730Q) /CSM/VH/VHF7-B/VHF...QEKRIPVLNSMDANDSINKKA RISWPDGFKYFFVDNQAGDSESAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQXFN DVSYPV--- ---lhvvvvkxvhtlpvnvnqivhf

  14. Dicty_cDB: VHF649 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF649 (Link to dictyBase) - - - Contig-U11031-1 VHF649P (Link to Original site) VHF...649F 562 VHF649Z 671 VHF649P 1213 - - Show VHF649 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF6-C/VHF649Q.Seq.d/ Representative seq. ID VHF...649P (Link to Original site) Representative DNA sequence >VHF649 (VHF649Q) /CSM/VH/VHF6-C/VHF...PNTPPTIKIELPSQSILKPSGQLKK*x* Translated Amino Acid sequence (All Frames) Frame A: i*qlvchlsivlfhhqviyphvlklekhf

  15. Dicty_cDB: VHF527 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF527 (Link to dictyBase) - - - Contig-U16260-1 VHF527P (Link to Original site) VHF...527F 571 VHF527Z 456 VHF527P 1007 - - Show VHF527 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-B/VHF527Q.Seq.d/ Representative seq. ID VHF...527P (Link to Original site) Representative DNA sequence >VHF527 (VHF527Q) /CSM/VH/VHF5-B/VHF...AKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQXRGITIKSSSVSLHF

  16. Dicty_cDB: VHF294 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF294 (Link to dictyBase) - - - Contig-U16441-1 VHF294P (Link to Original site) VHF...294F 573 VHF294Z 215 VHF294P 768 - - Show VHF294 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-D/VHF294Q.Seq.d/ Representative seq. ID VHF...294P (Link to Original site) Representative DNA sequence >VHF294 (VHF294Q) /CSM/VH/VHF2-D/VHF2...ssfst*scisfttfry*gfsdctfr*fhfn**RFWFNMEQCII QWVMFYS--- ---DCHVSIKKFFKWWQRLDRWCCXXXSCXXXSWWFWFPTFLRIQISNXXY*k

  17. Dicty_cDB: VHF690 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF690 (Link to dictyBase) - - - Contig-U11064-1 VHF690P (Link to Original site) VHF...690F 199 VHF690Z 419 VHF690P 598 - - Show VHF690 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF6-D/VHF690Q.Seq.d/ Representative seq. ID VHF...690P (Link to Original site) Representative DNA sequence >VHF690 (VHF690Q) /CSM/VH/VHF6-D/VHF6...vllksqsknqyl*hlikslidfinif*hgmhqiyhqrkkn*nq *k--- ---rrwfpr*rernhhfqlc*sts*rgcryw

  18. Dicty_cDB: VHF273 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF273 (Link to dictyBase) - - - Contig-U11514-1 VHF273P (Link to Original site) VHF...273F 644 VHF273Z 678 VHF273P 1302 - - Show VHF273 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-D/VHF273Q.Seq.d/ Representative seq. ID VHF...273P (Link to Original site) Representative DNA sequence >VHF273 (VHF273Q) /CSM/VH/VHF2-D/VHF...ctr*ccnvkdwchyssrl*syrs*ts*nrsifidr*iftsh*kdw**s llwfsnetr*skmcchcnwckhflwscckfstrnrrtwssssys*kywslly*fhrhlg

  19. Dicty_cDB: VHF243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF243 (Link to dictyBase) - - - Contig-U16423-1 VHF243P (Link to Original site) VHF...243F 580 VHF243Z 334 VHF243P 894 - - Show VHF243 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-B/VHF243Q.Seq.d/ Representative seq. ID VHF...243P (Link to Original site) Representative DNA sequence >VHF243 (VHF243Q) /CSM/VH/VHF2-B/VHF2...AATCNAGATATTCCAGATTGGTTTGAAAAGATGG TACA sequence update 2002.10.25 Translated Amino Acid sequence ifihadkff*RISHF

  20. Dicty_cDB: VHF134 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF134 (Link to dictyBase) - - - Contig-U16260-1 VHF134P (Link to Original site) VHF...134F 533 VHF134Z 404 VHF134P 917 - - Show VHF134 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-B/VHF134Q.Seq.d/ Representative seq. ID VHF...134P (Link to Original site) Representative DNA sequence >VHF134 (VHF134Q) /CSM/VH/VHF1-B/VHF1...cid sequence LSSAKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHFEMPKE

  1. Dicty_cDB: VHF892 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF892 (Link to dictyBase) - - - Contig-U16260-1 VHF892P (Link to Original site) VHF...892F 140 VHF892Z 417 VHF892P 537 - - Show VHF892 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF8-D/VHF892Q.Seq.d/ Representative seq. ID VHF...892P (Link to Original site) Representative DNA sequence >VHF892 (VHF892Q) /CSM/VH/VHF8-D/VHF8... Translated Amino Acid sequence TIKSSSVSLHFEMPXEDKLPAGCTSHEFLINLIDSPSHVDFS--- ---ELTASPNILEPIYLVEITAPENAIGGI

  2. Dicty_cDB: VHF479 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF479 (Link to dictyBase) - - - Contig-U11426-1 VHF479P (Link to Original site) VHF...479F 629 VHF479Z 691 VHF479P 1300 - - Show VHF479 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF4-D/VHF479Q.Seq.d/ Representative seq. ID VHF...479P (Link to Original site) Representative DNA sequence >VHF479 (VHF479Q) /CSM/VH/VHF4-D/VHF...EKNPQEWRWSGGFFVDSISDYVVKSRNTERPDHDSLLF HVNIKEKQGTHFIRIPLSSKESPPYIIQNDTQFKISFFQRDSPENIDYIEPKEKLCYGWD EPSAEYVL

  3. Dicty_cDB: VHF754 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF754 (Link to dictyBase) - - - Contig-U16531-1 VHF754P (Link to Original site) VHF...754F 526 VHF754Z 624 VHF754P 1130 - - Show VHF754 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-C/VHF754Q.Seq.d/ Representative seq. ID VHF...754P (Link to Original site) Representative DNA sequence >VHF754 (VHF754Q) /CSM/VH/VHF7-C/VHF...ixnkmqwlkmlqvk*killk*ekvvslgiiftipf--- ---flvsichfnchc*itfccsrwnnlxllxfldsryllqw*

  4. Dicty_cDB: VHF461 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF461 (Link to dictyBase) - - - Contig-U11551-1 VHF461P (Link to Original site) VHF...461F 646 VHF461Z 261 VHF461P 887 - - Show VHF461 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF4-C/VHF461Q.Seq.d/ Representative seq. ID VHF...461P (Link to Original site) Representative DNA sequence >VHF461 (VHF461Q) /CSM/VH/VHF4-C/VHF4...TTAAATTATTAAAAATAGTAAATAAAAAAAA sequence update 2002.10.25 Translated Amino Acid sequence fyfifenfkthfhiiffl

  5. Dicty_cDB: VHF781 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF781 (Link to dictyBase) - - - Contig-U16440-1 VHF781P (Link to Original site) VHF...781F 452 VHF781Z 680 VHF781P 1112 - - Show VHF781 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-D/VHF781Q.Seq.d/ Representative seq. ID VHF...781P (Link to Original site) Representative DNA sequence >VHF781 (VHF781Q) /CSM/VH/VHF7-D/VHF...vlkmmmlkf*xixftr*r Frame C: glldinkleeiik*rfhlfylfl*rlllayhfhkilfqlisktaligsnfnhyiqikmim y*l*iqdqrmf*kdqqmvv

  6. Dicty_cDB: VHF435 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF435 (Link to dictyBase) - - - Contig-U16260-1 VHF435P (Link to Original site) VHF...435F 616 VHF435Z 703 VHF435P 1299 - - Show VHF435 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF4-B/VHF435Q.Seq.d/ Representative seq. ID VHF...435P (Link to Original site) Representative DNA sequence >VHF435 (VHF435Q) /CSM/VH/VHF4-B/VHF...AKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHF

  7. Dicty_cDB: VHF553 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF553 (Link to dictyBase) - - - Contig-U16433-1 VHF553P (Link to Original site) VHF...553F 122 VHF553Z 533 VHF553P 635 - - Show VHF553 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-C/VHF553Q.Seq.d/ Representative seq. ID VHF...553P (Link to Original site) Representative DNA sequence >VHF553 (VHF553Q) /CSM/VH/VHF5-C/VHF5...ed Amino Acid sequence syhfylfiy*IIIYLLNYYLLSCVNYLPINFNILYIY--- ---YVINLTLDGDNVNGFPKTVTVKPAPSXEQXYAEGEGLVKVF

  8. Dicty_cDB: VHF163 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF163 (Link to dictyBase) - - - Contig-U11129-1 VHF163P (Link to Original site) VHF1...63F 611 VHF163Z 654 VHF163P 1245 - - Show VHF163 Library VH (Link to library) Clone ID VHF1...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-C/VHF163Q.Seq.d/ Representative seq. ID VHF1...63P (Link to Original site) Representative DNA sequence >VHF163 (VHF163Q) /CSM/VH/VHF1-C/VHF1...nt alignments: (bits) Value VHF163 (VHF163Q) /CSM/VH/VHF1-C/VHF163Q.Seq.d/ 2357 0.0 VHM584 (VHM584Q) /CSM/VH

  9. Dicty_cDB: VHF444 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (Link to library) VHF444 (Link to dictyBase) - G20601 DDB0204337 Contig-U12392-1 VHF444P (Link to Original...site) VHF444F 579 VHF444Z 213 VHF444P 772 - - Show VHF444 Library VH (Link to library) Clone ID VHF444 (Link...tsukuba.ac.jp/CSM/VH/VHF4-B/VHF444Q.Seq.d/ Representative seq. ID VHF444P (Link to Original site) Representative...Representative DNA sequence >VHF444 (VHF444Q) /CSM/VH/VHF4-B/VHF444Q.Seq.d/ CAAAAGAAATAAATAATTATGCCATCA...significant alignments: (bits) Value VHF444 (VHF444Q) /CSM/VH/VHF4-B/VHF444Q.Seq.d/ 1479 0.0 VHA836 (VHA836Q)

  10. Dicty_cDB: VHF338 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF338 (Link to dictyBase) - - - Contig-U14303-1 VHF338P (Link to Original site) VHF3...38F 208 VHF338Z 685 VHF338P 873 - - Show VHF338 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF338Q.Seq.d/ Representative seq. ID VHF3...38P (Link to Original site) Representative DNA sequence >VHF338 (VHF338Q) /CSM/VH/VHF3-B/VHF3...significant alignments: (bits) Value VHF338 (VHF338Q) /CSM/VH/VHF3-B/VHF338Q.Seq.d/ 1296 0.0 VHK267 (VHK267Q

  11. Dicty_cDB: VHF394 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF394 (Link to dictyBase) - - - Contig-U16260-1 VHF394P (Link to Original site) VHF3...94F 563 VHF394Z 417 VHF394P 960 - - Show VHF394 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-D/VHF394Q.Seq.d/ Representative seq. ID VHF3...94P (Link to Original site) Representative DNA sequence >VHF394 (VHF394Q) /CSM/VH/VHF3-D/VHF3...nt alignments: (bits) Value VHF394 (VHF394Q) /CSM/VH/VHF3-D/VHF394Q.Seq.d/ 1776 0

  12. Dicty_cDB: VHF340 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF340 (Link to dictyBase) - - - Contig-U11939-1 VHF340P (Link to Original site) VHF3...40F 113 VHF340Z 506 VHF340P 599 - - Show VHF340 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF340Q.Seq.d/ Representative seq. ID VHF3...40P (Link to Original site) Representative DNA sequence >VHF340 (VHF340Q) /CSM/VH/VHF3-B/VHF3...Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF340 (VHF340Q) /CSM/VH/VHF3-B/VHF3

  13. Dicty_cDB: VHF329 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF329 (Link to dictyBase) - - - Contig-U16260-1 VHF329P (Link to Original site) VHF3...29F 618 VHF329Z 633 VHF329P 1231 - - Show VHF329 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF329Q.Seq.d/ Representative seq. ID VHF3...29P (Link to Original site) Representative DNA sequence >VHF329 (VHF329Q) /CSM/VH/VHF3-B/VHF3...s CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF329 (VHF329Q) /CSM/VH/VHF3

  14. Dicty_cDB: VHF187 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF187 (Link to dictyBase) - - - Contig-U16363-1 VHF187P (Link to Original site) VHF1...87F 549 VHF187Z 707 VHF187P 1236 - - Show VHF187 Library VH (Link to library) Clone ID VHF1...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-D/VHF187Q.Seq.d/ Representative seq. ID VHF1...87P (Link to Original site) Representative DNA sequence >VHF187 (VHF187Q) /CSM/VH/VHF1-D/VHF1...* Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF187 (VHF1

  15. Dicty_cDB: VHF368 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF368 (Link to dictyBase) - - - Contig-U12673-1 VHF368P (Link to Original site) VHF3...68F 597 VHF368Z 746 VHF368P 1323 - - Show VHF368 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-C/VHF368Q.Seq.d/ Representative seq. ID VHF3...68P (Link to Original site) Representative DNA sequence >VHF368 (VHF368Q) /CSM/VH/VHF3-C/VHF3...ikfpknkii*nki k*nkiky Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF368 (VHF3

  16. Dicty_cDB: VHF348 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF348 (Link to dictyBase) - - - Contig-U13926-1 VHF348P (Link to Original site) VHF3...48F 539 VHF348Z 473 VHF348P 992 - - Show VHF348 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF348Q.Seq.d/ Representative seq. ID VHF3...48P (Link to Original site) Representative DNA sequence >VHF348 (VHF348Q) /CSM/VH/VHF3-B/VHF3...ksxvlmliltck Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF3

  17. Dicty_cDB: VHF312 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF312 (Link to dictyBase) - - - Contig-U15897-1 VHF312P (Link to Original site) VHF3...12F 543 VHF312Z 483 VHF312P 1006 - - Show VHF312 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF312Q.Seq.d/ Representative seq. ID VHF3...12P (Link to Original site) Representative DNA sequence >VHF312 (VHF312Q) /CSM/VH/VHF3-A/VHF3... 4.0 %: extracellular, including cell wall 4.0 %: plasma membrane 4.0 %: peroxisomal >> prediction for VHF31

  18. Dicty_cDB: VHF375 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF375 (Link to dictyBase) - - - Contig-U16260-1 VHF375P (Link to Original site) VHF3...75F 432 VHF375Z 670 VHF375P 1082 - - Show VHF375 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-D/VHF375Q.Seq.d/ Representative seq. ID VHF3...75P (Link to Original site) Representative DNA sequence >VHF375 (VHF375Q) /CSM/VH/VHF3-D/VHF3...pperekv*pqksqiltnstknskqfkshxsfqr*xsnlkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF3

  19. Dicty_cDB: VHF190 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available F0-ATPase putative regulatory protein IF1 (if1) mRNA, complete cds; nuclear gene for mitochondrial produc...VH (Link to library) VHF190 (Link to dictyBase) - - - Contig-U12594-1 - (Link to Original site) VHF1...90F 581 - - - - - - Show VHF190 Library VH (Link to library) Clone ID VHF190 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF1-D/VHF190Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF190 (VHF190Q) /CSM/VH/VHF1-D/VHF190Q.Seq.d/ ATTTTTCATTTTAAAAA

  20. Dicty_cDB: VHF331 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF331 (Link to dictyBase) - - - - - (Link to Original site) VHF3...31F 609 - - - - - - Show VHF331 Library VH (Link to library) Clone ID VHF331 (Link to dictyBase) Atlas ID... - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF3...31Q.Seq.d/ Representative seq. ID - (Link to Original site) Representative DNA sequence >VHF3...31 (VHF331Q) /CSM/VH/VHF3-B/VHF331Q.Seq.d/ AACTCTCGAGTGCAAAAAAAGTAAAGTACAAAATGGTTAATTTCA

  1. Dicty_cDB: VHF709 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF709 (Link to dictyBase) - - - Contig-U15897-1 - (Link to Original site) - - VHF...709Z 602 - - - - Show VHF709 Library VH (Link to library) Clone ID VHF709 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF7-A/VHF709Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF709 (VHF709Q) /CSM/VH/VHF7-A/VHF709Q.Seq.d/ XXXXXXXXXXCGTCCAA...vestir Frame B: ---sknfttrsrlqlccsfnglxpr**rw*tnrqhyhg*cksiwsssfnlsryyw*yrcs ilpqiq*kwchhsnlpiw*wsflyhf

  2. Dicty_cDB: VHF236 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF236 (Link to dictyBase) - - - Contig-U14303-1 - (Link to Original site) - - VHF...236Z 611 - - - - Show VHF236 Library VH (Link to library) Clone ID VHF236 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF2-B/VHF236Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF236 (VHF236Q) /CSM/VH/VHF2-B/VHF236Q.Seq.d/ XXXXXXXXXXTGCCATT...VQKISQELKHLT*tfvsylvlk Frame B: ---plvicc*ninvlhfveilsxhglay*xhcfplvlv*fqilsrmiqs

  3. Dicty_cDB: VHF140 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF140 (Link to dictyBase) - - - Contig-U15309-1 - (Link to Original site) - - VHF...140Z 518 - - - - Show VHF140 Library VH (Link to library) Clone ID VHF140 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF1-B/VHF140Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF140 (VHF140Q) /CSM/VH/VHF1-B/VHF140Q.Seq.d/ XXXXXXXXXXCCGATAA...EDYINMQIKQLENSENSQELIQKLNEHLSEYKASVEEIKHNVQNN Frame C: ---iixvtlmlflqngilhfigviil

  4. Dicty_cDB: VHF507 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF507 (Link to dictyBase) - - - Contig-U11594-1 - (Link to Original site) - - VHF...507Z 541 - - - - Show VHF507 Library VH (Link to library) Clone ID VHF507 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF5-A/VHF507Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF507 (VHF507Q) /CSM/VH/VHF5-A/VHF507Q.Seq.d/ XXXXXXXXXXTACCAAT...nvhsmiwihvglxlvigx*sncfvttsfikst mmvllcstftmllkpsixwivvsmkkyf*clemnxhfw*sviki*knv

  5. Dicty_cDB: VHF321 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF321 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) VHF...321F 617 - - - - - - Show VHF321 Library VH (Link to library) Clone ID VHF321 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF321Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF321 (VHF321Q) /CSM/VH/VHF3-A/VHF321Q.Seq.d/ AACTCTCGAGTGCAAAA...VIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHFEMPKEDKLPAGCTSHEFLINLIDSPGHVDFS SEVTAALRVTDGALVVIDC

  6. Dicty_cDB: VHF866 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF866 (Link to dictyBase) - - - Contig-U16600-1 - (Link to Original site) - - VHF...866Z 388 - - - - Show VHF866 Library VH (Link to library) Clone ID VHF866 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF8-C/VHF866Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF866 (VHF866Q) /CSM/VH/VHF8-C/VHF866Q.Seq.d/ XXXXXXXXXXAAGCAGC...Frame C: ---qhnnifklafptiknftgvpmxfvmtnegdnlgnftvkthfakffstyyscgeaghh yfdsccn*y*qkqgckfhs*h*xkssrr*lcfxqnwfi

  7. Dicty_cDB: VHF155 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF155 (Link to dictyBase) - - - - VHF155P (Link to Original site) VHF155F 587 VHF1...55Z 643 VHF155P 1210 - - Show VHF155 Library VH (Link to library) Clone ID VHF155 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1...-C/VHF155Q.Seq.d/ Representative seq. ID VHF155P (Link to... Original site) Representative DNA sequence >VHF155 (VHF155Q) /CSM/VH/VHF1-C/VHF155Q.Seq.d/ ATTCTCGATACTGGAA

  8. Dicty_cDB: VHF392 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF392 (Link to dictyBase) - - - - VHF392P (Link to Original site) VHF392F 568 VHF3...92Z 375 VHF392P 923 - - Show VHF392 Library VH (Link to library) Clone ID VHF392 (Link ...to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3...-D/VHF392Q.Seq.d/ Representative seq. ID VHF392P (Link to ...Original site) Representative DNA sequence >VHF392 (VHF392Q) /CSM/VH/VHF3-D/VHF392Q.Seq.d/ AACTCTCGAGTGCAAAA

  9. Dicty_cDB: VHF366 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF366 (Link to dictyBase) - - - Contig-U12131-1 | Contig-U13633-1 VHF3...66P (Link to Original site) VHF366F 590 VHF366Z 544 VHF366P 1114 - - Show VHF366 Library VH (Link to library) Clone ID VHF3...131-1 | Contig-U13633-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-C/VHF3...66Q.Seq.d/ Representative seq. ID VHF366P (Link to Original site) Representative DNA sequence >VHF366 (VHF3...66Q) /CSM/VH/VHF3-C/VHF366Q.Seq.d/ AATAATTTATTATTATTATTAATAAGTAATAGAAATAAAAGATGGAACCAATTCCAGATA

  10. Dicty_cDB: VHF310 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF310 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) - - VHF3...10Z 625 - - - - Show VHF310 Library VH (Link to library) Clone ID VHF310 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF310Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF310 (VHF310Q) /CSM/VH/VHF3-A/VHF310Q.Seq.d/ XXXXXXXXXXTCGTCAA...omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF310 (VHF310Q) /CSM/VH/VHF3-A/VHF3

  11. Dicty_cDB: VHF315 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF315 (Link to dictyBase) - G20600 DDB0169270 Contig-U12450-1 VHF3...15P (Link to Original site) VHF315F 216 VHF315Z 353 VHF315P 549 - - Show VHF315 Library VH (Link to library) Clone ID VHF3...ontig-U12450-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF3...15Q.Seq.d/ Representative seq. ID VHF315P (Link to Original site) Representative DNA sequence >VHF315 (VHF315Q) /CSM/VH/VHF3...-A/VHF315Q.Seq.d/ ATTAAAAAACTTCTTACTTGGACACCCCTTTTATATATATAAATAAAAACTTCTAAATAT AAATCCCA

  12. Dicty_cDB: VHF381 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF381 (Link to dictyBase) - - - Contig-U16508-1 - (Link to Original site) - - VHF3...81Z 645 - - - - Show VHF381 Library VH (Link to library) Clone ID VHF381 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF3-D/VHF381Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF381 (VHF381Q) /CSM/VH/VHF3-D/VHF381Q.Seq.d/ XXXXXXXXXXCAACCAA...ignments: (bits) Value VHF381 (VHF381Q) /CSM/VH/VHF3-D/VHF381Q.Seq.d/ 1223 0.0 VHP767 (VHP767Q) /CSM/VH/VHP7

  13. Dicty_cDB: VHF210 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF210 (Link to dictyBase) - - - Contig-U12400-1 | Contig-U16431-1 VHF...210P (Link to Original site) VHF210F 613 VHF210Z 636 VHF210P 1229 - - Show VHF210 Library VH (Link to library) Clone ID VHF...400-1 | Contig-U16431-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-A/VHF...210Q.Seq.d/ Representative seq. ID VHF210P (Link to Original site) Representative DNA sequence >VHF210 (VHF...210Q) /CSM/VH/VHF2-A/VHF210Q.Seq.d/ AATAAAATGATAAGATCATCAATAAAAAATAAAATAACAACAACAAAAAGTTTATCATGT

  14. Dicty_cDB: VHF575 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF575 (Link to dictyBase) - - - Contig-U15481-1 | Contig-U15981-1 VHF...575P (Link to Original site) VHF575F 586 VHF575Z 397 VHF575P 963 - - Show VHF575 Library VH (Link to library) Clone ID VHF...81-1 | Contig-U15981-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-D/VHF...575Q.Seq.d/ Representative seq. ID VHF575P (Link to Original site) Representative DNA sequence >VHF575 (VHF...575Q) /CSM/VH/VHF5-D/VHF575Q.Seq.d/ ATAATAATACAAAGAAGAAATGAAAAATATAAATAATAAAATTTTAAAGATTTTTATTCT

  15. Dicty_cDB: VHF296 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF296 (Link to dictyBase) - G23392 DDB0187414 Contig-U12449-1 VHF...296P (Link to Original site) VHF296F 241 VHF296Z 482 VHF296P 703 - - Show VHF296 Library VH (Link to library) Clone ID VHF...ontig-U12449-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-D/VHF...296Q.Seq.d/ Representative seq. ID VHF296P (Link to Original site) Representative DNA sequence >VHF296 (VHF296Q) /CSM/VH/VHF...2-D/VHF296Q.Seq.d/ GATTATCAGAAAGATTACATTATGAAATTATACCAGATTGTATTAAAATTATTGAAAGCT CAAAACAA

  16. Dicty_cDB: VHF436 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF436 (Link to dictyBase) - - - - VHF436P (Link to Original site) VHF436F 618 VHF...436Z 699 VHF436P 1297 - - Show VHF436 Library VH (Link to library) Clone ID VHF436 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF...4-B/VHF436Q.Seq.d/ Representative seq. ID VHF436P (Link to... Original site) Representative DNA sequence >VHF436 (VHF436Q) /CSM/VH/VHF4-B/VHF436Q.Seq.d/ AACTCTCGAGTGCAAA

  17. Dicty_cDB: VHF158 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF158 (Link to dictyBase) - - - - VHF158P (Link to Original site) VHF158F 608 VHF...158Z 693 VHF158P 1281 - - Show VHF158 Library VH (Link to library) Clone ID VHF158 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF...1-C/VHF158Q.Seq.d/ Representative seq. ID VHF158P (Link to... Original site) Representative DNA sequence >VHF158 (VHF158Q) /CSM/VH/VHF1-C/VHF158Q.Seq.d/ AACTCTCGAGTGCAAA

  18. Dicty_cDB: VHF847 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF847 (Link to dictyBase) - - - Contig-U15351-1 | Contig-U16514-1 VHF...847P (Link to Original site) VHF847F 478 VHF847Z 709 VHF847P 1167 - - Show VHF847 Library VH (Link to library) Clone ID VHF...351-1 | Contig-U16514-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF8-B/VHF...847Q.Seq.d/ Representative seq. ID VHF847P (Link to Original site) Representative DNA sequence >VHF847 (VHF...847Q) /CSM/VH/VHF8-B/VHF847Q.Seq.d/ TATGATGTTCCACTTATAATTCAAACGGTTGCCAATAATAAATCAACAAAACTCANTCTT

  19. Dicty_cDB: VHF272 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF272 (Link to dictyBase) - - - Contig-U15754-1 VHF272P (Link to Original site) VHF...272F 515 VHF272Z 603 VHF272P 1098 - - Show VHF272 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-C/VHF272Q.Seq.d/ Representative seq. ID VHF...272P (Link to Original site) Representative DNA sequence >VHF272 (VHF272Q) /CSM/VH/VHF2-C/VHF...id sequence (All Frames) Frame A: ixfssq**wnkkd*mihy*eiligrigvpm*vidngqlfvkimvvnhgptfhtimldhvh idgqrivlvdfvidfkifv*v*hf

  20. Very Compact and Broadband Active Antenna for VHF Band Applications

    Directory of Open Access Journals (Sweden)

    Y. Taachouche

    2012-01-01

    Full Text Available An active receiving antenna with small size consisting of a monopole loaded with a transistor bipolar is presented in this paper. A transistor is used in order to miniaturize the receiving active antenna size in VHF band. The vertical size of the structure is equal to λ/175, where λ is the wavelength at the lower frequency of the bandwidth. Despite the very small size of the antenna, the frequency bandwidth is very wide and the gain is suitable for FM application with sensitive receivers.

  1. 47 CFR 80.1007 - Bridge-to-bridge radiotelephone installation.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Bridge-to-bridge radiotelephone installation. 80.1007 Section 80.1007 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND... Bridge-to-Bridge Act § 80.1007 Bridge-to-bridge radiotelephone installation. Use of the bridge-to-bridge...

  2. PMSE Observations With the Tri-Static EISCAT VHF Radars

    Science.gov (United States)

    Mann, I.; Tjulin, A.; Häggström, I.

    2013-12-01

    The polar mesospheric summer echoes (PMSE) are generated in the ionosphere at roughly 80 to 90 altitude by electron irregularities in the presence of charged solid particles and PMSE are most likely observed when ice particles form onto nanodust. PMSE formation is an important part in understanding mesospheric processes, but is also an interesting example for dusty plasma phenomena occurring in space. To investigate the phenomena that lead to formation of PMSE it is helpful to study the radar reflectivity of the mesosphere at different angles. PMSE were previously studied at different aspect angles in order to better understand the scattering process. Another way is observing PMSE from multiple sites simultaneously. During this summer the EISCAT radars that are located in Northern Scandinavia could for the first time be used for tri-static observations in the VHF band and we carried out observations during three subsequent days in June 2013. The radar signal was transmitted in zenith direction with the EISCAT VHF antenna near Tromsø (69.59 deg N, 19.23 deg E) and the scattered signal was measured from Tromsø, Kiruna (67.86 deg N, 20.44 deg E) and Sodankylä (67.36 deg N, 26.63 deg E). Zenith observations were simultaneously carried out with the Tromsø UHF radar (933 MHz). Other groups have previously reported the observations of PMSE simultaneously with the EISCAT VHF and UHF radars, but with a much lower occurrence rate for the UHF. UHF observations made during this campaign are dominated by incoherent scatter. The VHF system in Tromsø detected PMSE for a large fraction of the observation time. The VHF receivers in Kiruna and Sodankylä were pointed at typical PMSE heights above the Tromsø transmitter and detected radar reflections at the same time and altitude as the Tromsø radar. These observations are among the first tri-static observations of PMSE. Preliminary results from the campaign will be presented and discussed.

  3. Dicty_cDB: VHF476 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uences producing significant alignments: (bits) Value VHF476 (VHF476Q) /CSM/VH/VHF4-D/VHF476Q.Seq.d/ 198 2e-...46 own update 2003.10.17 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value...e 2008.10.29 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value (Q54AX5) R

  4. 47 CFR 22.719 - Additional channel policy for rural radiotelephone stations.

    Science.gov (United States)

    2010-10-01

    ... applied for or been granted an authorization for other rural radiotelephone channel pairs in the same area... grade of service (blocking probability), and the applicant demonstrates that there will still be...

  5. First wind shear observation in PMSE with the tristatic EISCAT VHF radar

    Science.gov (United States)

    Mann, I.; Häggström, I.; Tjulin, A.; Rostami, S.; Anyairo, C. C.; Dalin, P.

    2016-11-01

    The Polar Summer Mesosphere has the lowest temperatures that occur in the entire Earth system. Water ice particles below the optically observable size range participate there in the formation of strong radar echoes (Polar Mesospheric Summer Echoes, PMSE). To study PMSE we carried out observations with the European Incoherent Scatter (EISCAT) VHF and EISCAT UHF radar simultaneously from a site near Tromsø (69.58°N, 19.2272°E) and observed VHF backscattering also with the EISCAT receivers in Kiruna (67.86°N, 20.44°E) and Sodankylä (67.36°N, 26.63°E). This is one of the first tristatic measurements with EISCAT VHF, and we therefore describe the observations and geometry in detail. We present observations made on 26 June 2013 from 7:00 to 13:00 h UT where we found similar PMSE patterns with all three VHF receivers and found signs of wind shear in PMSE. The observations suggest that the PMSE contains sublayers that move in different directions horizontally, and this points to Kelvin-Helmholtz instability possibly playing a role in PMSE formation. We find no signs of PMSE in the UHF data. The electron densities that we derive from observed incoherent scatter at UHF are at PMSE altitudes close to the noise level but possibly indicate reduced electron densities directly above the PMSE.

  6. Dicty_cDB: VHF729 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ences producing significant alignments: (bits) Value VHF729 (VHF729Q) /CSM/VH/VHF...4-A/CHC421Q.Seq.d/ 139 9e-33 own update 2002.12.27 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value... 139 2e-29 1 dna update 2008.10.31 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value

  7. From ultrafast spectroscopy to bidirectional molecular switches: DHA/VHF

    Science.gov (United States)

    Schmidhammer, U.; De Waele, V.; Buntinx, G.; Riedle, E.

    The photoconversion from dihydroazulene (DHA) to vinylheptafulvene (VHF) is governed by two mechanisms: The ring opening proceeds on the excited energy surface on the picosecond time scale. It is followed by an intemal conversion to the VHF ground state that is accelerated by the presence of a conical intersection in the case of cyclopenta-DHA. This conical intersection hinders the photoinduced back reaction from the final VHF products. However, we successfully photoconverted the cyanophenyl-VHF-cis back to the DHA with a second delayed pulse. This opens the route to the development of bistable DHAs.

  8. An analysis on the mid-latitude scintillation and coherence frequency bandwidth using transionospheric VHF signals

    Energy Technology Data Exchange (ETDEWEB)

    Juang, Zhen [Los Alamos National Laboratory; Roussel-dupre, Robert [Los Alamos National Laboratory

    2008-01-01

    An analysis was perfonned on the mid-latitude scintillation and coherence frequency bandwidth (Fcoh) using transionospheric VHF signal data. The data include 1062 events spanning from November 1997 to June 2002. Each event records FORTE satellite received VHF signals from LAPP located at Los Alamos, New Mexico. Fcohs were derived to study scintillation characteristics on diurnal and seasonal variations, as well as changes due to solar and geomagnetic activities. Comparisons to the VHFIUHF coherence frequency bandwidth studies previously reported at equatorial and mid-latitude regions are made using a 4th power frequency dependence relationship. Furthennore, a wideband ionospheric scintillation model, WBMOD, was used to estimate Fcohs and compared with our VHF Fcoh values. Our analysis indicates mid-latitude scintillation characteristics that are not previously revealed. At the VHF bottom frequency range (3035 MHz), distinguished smaller Fcohs are found in time period from sunset to midnight, in wann season from May to August, and in low solar activity years. The effects of geomagnetic storm activity on Fcoh are characterized by a sudden transition at a Kp index of 50-60. Comparisons with median Fcohs estimated from other studies validated our VHF Fcohs for daytime while an order of magnitude larger Fcohs are found for nighttime, implying a time-dependent issue in applying the 4th order power relationship. Furthermore, comparisons with WBMOD-estimated Fcohs indicated generally matched median scintillation level estimates while differences do exist for those events undergoing high geomagnetic stonn activity which may imply underestimates of scintillation level by the WBMOD in the mid-latitude regions.

  9. Dicty_cDB: VHF823 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uences producing significant alignments: (bits) Value VHF823 (VHF823Q) /CSM/VH/VH...186Q.Seq.d/ 86 1e-16 own update 2009. 4. 4 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value...-13 1 dna update 2008.10.31 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value

  10. 47 CFR 22.727 - Power limits for conventional rural radiotelephone transmitters.

    Science.gov (United States)

    2010-10-01

    ... radiotelephone transmitters. 22.727 Section 22.727 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED... this section. (a) Maximum ERP. The effective radiated power (ERP) of central office and rural... circumstances. Frequency range (MHz) Maximum ERP (watts) 152-153 1400 157-159 150 454-455 3500 459-460 150 (b...

  11. Measurements methodology for evaluation of Digital TV operation in VHF high-band

    Science.gov (United States)

    Pudwell Chaves de Almeida, M.; Vladimir Gonzalez Castellanos, P.; Alfredo Cal Braz, J.; Pereira David, R.; Saboia Lima de Souza, R.; Pereira da Soledade, A.; Rodrigues Nascimento Junior, J.; Ferreira Lima, F.

    2016-07-01

    This paper describes the experimental setup of field measurements carried out for evaluating the operation of the ISDB-TB (Integrated Services Digital Broadcasting, Terrestrial, Brazilian version) standard digital TV in the VHF-highband. Measurements were performed in urban and suburban areas in a medium-sized Brazilian city. Besides the direct measurements of received power and environmental noise, a measurement procedure involving the injection of Gaussian additive noise was employed to achieve the signal to noise ratio threshold at each measurement site. The analysis includes results of static reception measurements for evaluating the received field strength and the signal to noise ratio thresholds for correct signal decoding.

  12. Dicty_cDB: VHF145 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF145 (Link to dictyBase) - - - Contig-U15430-1 VHF145E (Link...) Clone ID VHF145 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15430-1 Ori...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116984 |AC116984.2 Dictyos... theta DNA for complete sequence of nucleomorph chromosome 2. 48 2e-07 2 ES451909 | PREDICTED: similar to PI...al 16.0 %: nuclear 8.0 %: vacuolar 8.0 %: endoplasmic reticulum 4.0 %: cytoskeletal >> prediction for VHF145

  13. Broadband VHF observations for lightning impulses from a small satellite SOHLA-1 (Maido 1)

    Science.gov (United States)

    Morimoto, T.; Kikuchi, H.; Ushio, T.; Kawasaki, Z.; Hidekazu, H.; Aoki, T.

    2009-12-01

    Lightning Research Group of Osaka University (LRG-OU) has been developing VHF Broadband Digital Interferometer (DITF) to image precise lightning channels and monitor lightning activity widely. The feature of broadband DITF is its ultrawide bandwidth (from 25MHz to 100MHz) and implicit redundancy for estimating VHF source location. LRG-OU considers an application of the broadband DITF to the spaceborne measurement system and joins the SOHLA (Space Oriented Higashi-Osaka Leading Associate) satellite project. The SOHLA satellite project represents a technology transfer program to expand the range of the space development community in Japan. The objective is to get SMEs (Small and Medium sized manufacturing Enterprises) involved in small space projects and new space technologies. Under the cooperative agreement, JAXA (Japan Aerospace Exploration Agency) intends to contribute to socio-economic development by returning its R&D results to society, and SOHLA tries to revitalize the local economy through the commercialization of versatile small satellites. According to the agreement, JAXA provides SOHLA its technical information on small satellites and other technical assistance for the development of the small satellites, SOHLA-1. The prime objective of the SOHLA-1 program is to realize low-cost and short term development of a microsatellite which utilizes the components and bus technologies of JAXA’s MicroLabSat. SOHLA-1 is a spin-stabilized microsatellite of MicroLabSat heritage (about 50 kg). The spin axis is fixed to inertial reference frame. The spin axis (z-axis) lies in the plane containing the solar direction and the normal to the orbital plane. LRG-OU takes responsibility for a science mission of SOHLA-1. To examine the feasibility of the DITF receiving VHF lightning impulses in space, LRG-OU proposes the BMW (Broadband Measurement of Waveform for VHF Lightning Impulses). BMW consists of a single pair of an antenna, a band-pass filter, an amplifier, and an

  14. Broadband Grounded Vertical Antennas for 30-180 MHZ (VHF)

    Science.gov (United States)

    2013-10-18

    antennas are well known for their broadband gain (monocone, bicone ) but are never combined with a monopole. An eccentric combination of broadband...DATES COVERED 00-00-2014 to 00-00-2014 4. TITLE AND SUBTITLE Broadband Grounded Vertical Antennas For 30-180 MZH (VHF) 5a. CONTRACT NUMBER 5b...18 Attorney Docket No. 102536 1 of 17 BROADBAND GROUNDED VERTICAL ANTENNAS FOR 30-180 MHZ (VHF) STATEMENT OF GOVERNMENT INTEREST

  15. Anechoic chamber for VHF and UHF bands

    Science.gov (United States)

    Morikawa, Takao; Sugiura, Akira; Harima, Katsushige; Masuzawa, Hiroshi

    1995-06-01

    Built in 1969, the anechoic chamber of CRL has been used to the fullest by researchers in many fields such as EMI, EMC, antenna design, standard of electric field intensity, and type approval testing. In particular, in the early days of space development in Japan, many satellite-born antennas were developed in this anechoic chamber. However, a quarter of a century has passed since its construction and deteriorated performance due to superannuation sometimes caused difficulties in experiments conducted in the chamber. In 1993, CRL constructed a Measuring Facility for Radio Research (MFRR) and the anechoic chamber for VHF-UHF bands was remodeled as one of the sub-facilities of MFRR. The remodeling work included full replacement of the electromagnetic shielding, absorbers and measurement system. Since the remodeled anechoic chamber is being used not only for EMI tests but also for other purposes, a full-anechoic chamber has been adopted. In addition the chamber has been designed for the frequency range between 30 MHz and 10 GHz. After the remodeling work, the performance of the chamber is greatly improved. The average shielding factor is better than 85 dB for all frequency ranges and the unwanted reflection characteristic is -30 dB for frequencies above 1 GHZ. This paper summarizes the remodeling work, and the specifications and performance of the remodeled anechoic chamber.

  16. Ultimate VHF Broadband Interferometer Zen KAWASAKI and Manabu AKITA

    Science.gov (United States)

    Kawasaki, Z.; Akita, M.

    2013-12-01

    Lightning Research Group of Osaka University (LRGOU) has been developing an interferometer for thunderstorm monitoring during these two decades. When LRGOU initiated this project, many related scientists claimed that LRGOU's system was a time of arrival and it must be a sophisticated TOA system. However the key technology of the system were broad band and digital data processing, and it is named the VHF broad band digital interferometer (BDITF), because the phase difference of Fourier components played the very important role. Then the BDITF finally has been realized as a quasi-real time lightning monitoring system, and LRGOU has been operating their BDITFs around Osaka area. Since the BDITF captures the VHF impulses associated with lightning discharges by amplitude triggering, it occasionally misses one of the bi-directional leader progressions because of relatively small amplitude VHF impulses mainly emitted by positive leader tips. All of high density of VHF pulses associated with recoil leaders may not be recorded. Then the ordinary BDITF is able to be accepted as the practical operational system, but from the aspect of science it has been sioriously expected to be improved its performance. To overcome the difficulty New Mexico Institute of Mining and Technology (NMIMT) and LRGOU have started the joint project, and a continuous recording system for digital signals is adopted [M. Stock et al, and M Akita et al,]. The field campaigns have been conducting in New Mexico and in Japan, and successful observations are accomplished. The algorithm to identify individual VHF pulses associated with lightning discharges from back ground noise and/or artificial noise, the dispersion of phase differences for all Fourier components is examined. In case by of small dispersion it is concluded that analyzed VHF pulse has high possibility to be emitted by lightning discharges. This interpretation means that the recorded VHF pulse shape might maintain without deformation during

  17. VHF signal power suppression in stratiform and convective precipitation

    Directory of Open Access Journals (Sweden)

    A. J. McDonald

    2006-03-01

    Full Text Available Previous studies have indicated that VHF clear-air radar return strengths are reduced during periods of precipitation. This study aims to examine whether the type of precipitation, stratiform and convective precipitation types are identified, has any impact on the relationships previously observed and to examine the possible mechanisms which produce this phenomenon. This study uses a combination of UHF and VHF wind-profiler data to define periods associated with stratiform and convective precipitation. This identification is achieved using an algorithm which examines the range squared corrected signal to noise ratio of the UHF returns for a bright band signature for stratiform precipitation. Regions associated with convective rainfall have been defined by identifying regions of enhanced range corrected signal to noise ratio that do not display a bright band structure and that are relatively uniform until a region above the melting layer.

    This study uses a total of 68 days, which incorporated significant periods of surface rainfall, between 31 August 2000 and 28 February 2002 inclusive from Aberystwyth (52.4° N, 4.1° W. Examination suggests that both precipitation types produce similar magnitude reductions in VHF signal power on average. However, the frequency of occurrence of statistically significant reductions in VHF signal power are very different. In the altitude range 2-4 km stratiform precipitation is related to VHF signal suppression approximately 50% of the time while in convective precipitation suppression is observed only 27% of the time. This statistical result suggests that evaporation, which occurs more often in stratiform precipitation, is important in reducing the small-scale irregularities in humidity and thereby the radio refractive index. A detailed case study presented also suggests that evaporation reducing small-scale irregularities in humidity may contribute to the observed VHF signal

  18. VHF signal power suppression in stratiform and convective precipitation

    Directory of Open Access Journals (Sweden)

    A. J. McDonald

    2006-03-01

    Full Text Available Previous studies have indicated that VHF clear-air radar return strengths are reduced during periods of precipitation. This study aims to examine whether the type of precipitation, stratiform and convective precipitation types are identified, has any impact on the relationships previously observed and to examine the possible mechanisms which produce this phenomenon. This study uses a combination of UHF and VHF wind-profiler data to define periods associated with stratiform and convective precipitation. This identification is achieved using an algorithm which examines the range squared corrected signal to noise ratio of the UHF returns for a bright band signature for stratiform precipitation. Regions associated with convective rainfall have been defined by identifying regions of enhanced range corrected signal to noise ratio that do not display a bright band structure and that are relatively uniform until a region above the melting layer. This study uses a total of 68 days, which incorporated significant periods of surface rainfall, between 31 August 2000 and 28 February 2002 inclusive from Aberystwyth (52.4° N, 4.1° W. Examination suggests that both precipitation types produce similar magnitude reductions in VHF signal power on average. However, the frequency of occurrence of statistically significant reductions in VHF signal power are very different. In the altitude range 2-4 km stratiform precipitation is related to VHF signal suppression approximately 50% of the time while in convective precipitation suppression is observed only 27% of the time. This statistical result suggests that evaporation, which occurs more often in stratiform precipitation, is important in reducing the small-scale irregularities in humidity and thereby the radio refractive index. A detailed case study presented also suggests that evaporation reducing small-scale irregularities in humidity may contribute to the observed VHF signal suppression.

  19. VHF volume-imaging radar observation of aspect-sensitive scatterers tilted in mountain waves above a convective boundary layer

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    2005-06-01

    Full Text Available Thin stable atmospheric layers cause VHF radars to receive increased echo power from near zenith. Layers can be tilted from horizontal, for instance by gravity waves, and the direction of VHF "glinting" is measurable by spatial domain interferometry or many-beam Doppler beam swinging (DBS. This paper uses the Middle and Upper atmosphere (MU radar, Shigaraki, Japan as a volume-imaging radar with 64-beam DBS, to show tilting of layers and air flow in mountain waves. Tilt of aspect-sensitive echo power from horizontal is nearly parallel to air flow, as assumed in earlier measurements of mountain-wave alignment. Vertical-wind measurements are self-consistent from different beam zenith angles, despite the combined effects of aspect sensitivity and horizontal-wind gradients.

  20. From VHF to UHF CMOS-MEMS Monolithically Integrated Resonators

    DEFF Research Database (Denmark)

    Teva, Jordi; Berini, Abadal Gabriel; Uranga, A.

    2008-01-01

    This paper presents the design, fabrication and characterization of microresonators exhibiting resonance frequencies in the VHF and UHF bands, fabricated using the available layers of the standard and commercial CMOS technology, AMS-0.35mum. The resonators are released in a post-CMOS process cons...

  1. An HF and lower VHF spectrum assessment system exploiting instantaneously wideband capture

    Science.gov (United States)

    Barnes, Rod I.; Singh, Malkiat; Earl, Fred

    2017-09-01

    We report on a spectral environment evaluation and recording (SEER) system, for instantaneously wideband spectral capture and characterization in the HF and lower VHF band, utilizing a direct digital receiver coupled to a data recorder. The system is designed to contend with a wide variety of electromagnetic environments and to provide accurately calibrated spectral characterization and display from very short (ms) to synoptic scales. The system incorporates a novel RF front end involving automated gain and equalization filter selection which provides an analogue frequency-dependent gain characteristic that mitigates the high dynamic range found across the HF and lower VHF spectrum. The system accurately calibrates its own internal noise and automatically subtracts this from low variance, external spectral estimates, further extending the dynamic range over which robust characterization is possible. Laboratory and field experiments demonstrate that the implementation of these concepts has been effective. Sensitivity to varying antenna load impedance of the internal noise reduction process has been examined. Examples of software algorithms to provide extraction and visualization of spectral behavior over narrowband, wideband, short, and synoptic scales are provided. Application in HF noise spectral density monitoring, spectral signal strength assessment, and electromagnetic interference detection is possible with examples provided. The instantaneously full bandwidth collection provides some innovative applications, and this is demonstrated by the collection of discrete lightning emissions, which form fast ionograms called "flashagrams" in power-delay-frequency plots.

  2. Layered Polar Mesospheric Summer Echoes Observed with the Tri-Static Eiscat VHF

    Science.gov (United States)

    Mann, I.; Anyairo, C.; Häggström, I.; Tjulin, A.

    2014-12-01

    Polar mesospheric summer echoes (PMSE) are strong radar echoes that are typically observed at 50 to 500 MHz. They are often discussed in the context of dusty plasma studies and linked to e.g. the existence of charged ice particles, neutral atmospheric turbulence and atmospheric stratification. The PMSE are observed at mesospheric temperature minimum when ice particles form, though the exact path of formation is still a topic for research. Mesospheric smoke particles that are assumed to form after or during the meteor ablation process possibly contribute to the formation of the ice particles. For understanding the formation of the radar echoes their variation with scattering angle is an important parameter. We analyze PMSE observations with the tri-static EISCAT VHF radar (224 MHz) during one day in June when PMSE were observed almost continuously from 7:00 to 13:00 UT. The radar signal was transmitted and received in zenith direction with the EISCAT VHF antenna near Tromsø. The receivers in Kiruna and Sodankylä were pointed at typical PMSE heights above the Tromsø transmitter and detected radar reflections at the same time and altitude as the Tromsø radar. The altitude of the PMSE changed with time and the extension of the echoes in altitude was smaller toward the end of the observation. These observations are among the first tri-static observations of PMSE. The observations suggest that the scattering process underlying the PMSE occurs over a broad range of scattering angles. Based on the observations we will show that the spectral width of the received echoes is most likely determined by the variations within the observed volume rather than by the scattering process. The observed frequency shifts suggest a layer structure and horizontal motions that vary with altitude. UHF (933 MHz) radar observations were carried out in parallel, they display predominantly incoherent scatter and an electron density typical for the altitude. Some other studies, have in

  3. Phase and coherence analysis of VHF scintillation over Christmas Island

    Directory of Open Access Journals (Sweden)

    E. B. Shume

    2014-03-01

    Full Text Available This short paper presents phase and coherence data from the cross-wavelet transform applied on longitudinally separated very high frequency (VHF equatorial ionospheric scintillation observations over Christmas Island. The phase and coherence analyses were employed on a pair of scintillation observations, namely, the east-looking and west-looking VHF scintillation monitors at Christmas Island. Our analysis includes 3 years of peak season scintillation data from 2008, 2009 (low solar activity, and 2011 (moderate solar activity. In statistically significant and high spectral coherence regions of the cross-wavelet transform, scintillation observations from the east-looking monitor lead those from the west-looking monitor by about 20 to 60 (40 ± 20 min (most frequent lead times. Using several years (seasons and solar cycle of lead (or lag and coherence information of the cross-wavelet transform, we envisage construction of a probability model for forecasting scintillation in the nighttime equatorial ionosphere.

  4. Complementary code and digital filtering for detection of weak VHF radar signals from the mesoscale. [SOUSY-VHF radar, Harz Mountains, Germany

    Science.gov (United States)

    Schmidt, G.; Ruster, R.; Czechowsky, P.

    1983-01-01

    The SOUSY-VHF-Radar operates at a frequency of 53.5 MHz in a valley in the Harz mountains, Germany, 90 km from Hanover. The radar controller, which is programmed by a 16-bit computer holds 1024 program steps in core and controls, via 8 channels, the whole radar system: in particular the master oscillator, the transmitter, the transmit-receive-switch, the receiver, the analog to digital converter, and the hardware adder. The high-sensitivity receiver has a dynamic range of 70 dB and a video bandwidth of 1 MHz. Phase coding schemes are applied, in particular for investigations at mesospheric heights, in order to carry out measurements with the maximum duty cycle and the maximum height resolution. The computer takes the data from the adder to store it in magnetic tape or disc. The radar controller is programmed by the computer using simple FORTRAN IV statements. After the program has been loaded and the computer has started the radar controller, it runs automatically, stopping at the program end. In case of errors or failures occurring during the radar operation, the radar controller is shut off caused either by a safety circuit or by a power failure circuit or by a parity check system.

  5. The first operation and results of the Chung-Li VHF radar

    Science.gov (United States)

    Chao, J. K.; Kuo, F. S.; Chu, Y. S.; Fu, I. J.; Rottger, J.; Liu, C. H.

    1986-01-01

    The Chung-Li Very High Frequency (VHF) radar is used in the dual-mode operations, applying Doppler beam-swinging as well as the spaced-antenna-drift method. The design of the VHF radar is examined. Results of performance tests are discussed.

  6. Lightning VHF radiation location system based on short-baseline TDOA technique — Validation in rocket-triggered lightning

    Science.gov (United States)

    Sun, Zhuling; Qie, Xiushu; Liu, Mingyuan; Cao, Dongjie; Wang, Dongfang

    2013-07-01

    A lightning VHF radiation location system based on short-baseline time-difference of arrival (TDOA) technology is newly developed. Based on the orthogonal 10 m-baseline antenna array with four identical broadband flat plane antennas, this system receives the lightning broadband VHF radiation signals and calculates TDOA between antennas in order to determine the location of lightning radiation sources in two dimensions (elevation and azimuth). To reduce noise and improve estimation accuracy of time delay, a general correlation time delay estimation algorithm based on direct correlation method and wavelet transform is proposed. Moreover, parabolic interpolation algorithm is used in the fractional delay estimation to improve the time resolution of the positioning system. In this paper, a rocket-triggered lightning discharge and a cloud lightning discharge are analyzed respectively, combining with simultaneous observations of high-speed camera and fast/slow electric field changes. The results indicate that the TDOA location system could effectively map the lightning radiation sources in 2 dimensions and are in a good agreement with the high-speed video camera images.

  7. Range imaging observations of PMSE using the EISCAT VHF radar: Phase calibration and first results

    Directory of Open Access Journals (Sweden)

    J. R. Fernandez

    2005-01-01

    Full Text Available A novel phase calibration technique for use with the multiple-frequency Range IMaging (RIM technique is introduced based on genetic algorithms. The method is used on data collected with the European Incoherent SCATter (EISCAT VHF radar during a 2002 experiment with the goal of characterizing the vertical structure of Polar Mesosphere Summer Echoes (PMSE over northern Norway. For typical Doppler measurements, the initial phases of the transmitter and receiver are not required to be the same. The EISCAT receiver systems exploit this fact, allowing a multi-static configuration. However, the RIM method relies on the small phase differences between closely spaced frequencies. As a result, the high-resolution images produced by the RIM method can be significantly degraded if not properly calibrated. Using an enhanced numerical radar simulator, in which data from multiple sampling volumes are simultaneously generated, the proposed calibration method is validated. Subsequently, the method is applied to preliminary data from the EISCAT radar, providing first results of RIM images of PMSE. Data using conventional analysis techniques, and confirmed by RIM, reveal an often-observed double-layer structure with higher stability in the lower layer. Moreover, vertical velocity oscillations exhibit a clear correlation with the apparent motion of the layers shown in the echo power plots.

  8. Miniaturization for ultrathin metamaterial perfect absorber in the VHF band

    Science.gov (United States)

    Khuyen, Bui Xuan; Tung, Bui Son; Yoo, Young Joon; Kim, Young Ju; Kim, Ki Won; Chen, Liang-Yao; Lam, Vu Dinh; Lee, Youngpak

    2017-03-01

    An efficient resolution for ultrathin metamaterial perfect absorber (MPA) is proposed and demonstrated in the VHF radio band (30-300 MHz). By adjusting the lumped capacitors and the through vertical interconnects, the absorber is miniaturized to be only λ/816 and λ/84 for its thickness and periodicity with respect to the operating wavelength (at 102 MHz), respectively. The detailed simulation and calculation show that the MPA can maintain an absorption rate over 90% in a certain range of incident angle and with a wide variation of capacitance. Additionally, we utilized the advantages of the initial single-band structure to realize a nearly perfect dual-band absorber in the same range. The results were confirmed by both simulation and experiment at oblique incidence angles up to 50°. Our work is expected to contribute to the actualization of future metamaterial-based devices working at radio frequency.

  9. Extraction of forest stand parameters from CARABAS VHF SAR images

    Energy Technology Data Exchange (ETDEWEB)

    Walter, Fredrik [Swedish Univ. of Agricultural Sciences, Uppsala (Sweden). Centre for Image Analysis

    1999-10-01

    Methods for extracting stand-wise forest parameters from CARABAS VHF SAR images have been developed and evaluated. CARABAS is a unique airborne synthetic aperture radar (SAR), developed by the Swedish Defence Research Establishment. It differs a lot from ordinary microwave radars by using wavelengths between 3.3 and 15 m, making the image intensity highly correlated to stem volume. Furthermore, by providing its own illumination source, the sensor operates independently of daylight and weather conditions. Empirical regression models have been developed for relating backscattering amplitude to stem volume, stem diameter, and tree height. To make comparison between CARABAS image data and forest parameters effective, a fully automatic geo-coding algorithm was developed. Image texture features have also been investigated. By using the variogram as a discriminating feature, CARABAS images and aerial images were segmented into homogeneous regions. Furthermore, a method for discriminating recently clear felled areas from forested areas, combining information from Almaz-1 SAR images and SPOT panchromatic data has also been developed, serving as a comparison to the main work of this thesis. For forest stands at near-horizontal ground, the results for estimating stem volume, stem diameter, and tree height from CARABAS image data are very satisfactory. The root mean square errors for the estimates are comparable to subjective ground-based inventories for dense forest stands. The methods and algorithms described in this thesis have been developed towards an operational remote sensing tool. Altogether, significant potential for mapping of forest characteristics exists using the CARABAS VHF SAR sensor 57 refs, 14 figs, 7 tabs

  10. Letter to the Editor: Complete maps of the aspect sensitivity of VHF atmospheric radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    1999-08-01

    Full Text Available Using the MU radar at Shigaraki, Japan (34.85°N, 136.10°E, we measure the power distribution pattern of VHF radar echoes from the mid-troposphere. The large number of radar beam-pointing directions (320 allows the mapping of echo power from 0° to 40° from zenith, and also the dependence on azimuth, which has not been achieved before at VHF wavelengths. The results show how vertical shear of the horizontal wind is associated with a definite skewing of the VHF echo power distribution, for beam angles as far as 30° or more from zenith, so that aspect sensitivity cannot be assumed negligible at any beam-pointing angle that most existing VHF radars are able to use. Consequently, the use of VHF echo power to calculate intensity of atmospheric turbulence, which assumes only isotropic backscatter at large beam zenith angles, will sometimes not be valid.Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; turbulence; instruments and techniques

  11. PENUMBUHAN LAPISAN TIPIS SILIKON MIKROKRISTAL TERHIDROGENASI DENGAN TEKNIK HWC-VHF-PECVD

    Directory of Open Access Journals (Sweden)

    Ida Usman

    2012-02-01

    Full Text Available Telah dikembangkan teknik HWC-VHF-PECVD (Hot Wire Cell Very High Frequency Plasma Enhanced Chemical Vapor Deposition untuk menumbuhkan lapisan tipis silikon mikrokristal terhidrogenasi (mc-Si:H. Dari hasil penumbuhan lapisan tipis yang dilakukan, teknik HWC-VHF-PECVD memperlihatkan laju deposisi yang lebih tinggi dibandingkan laju deposisi lapisan tipis yang diperoleh dari teknik PECVD maupun teknik VHF-PECVD konvensional. Berdasarkan hasil pengukuran XRD dan SEM, lapisan yang diperoleh pada temperatur filamen yang rendah masih berstruktur amorf. Indikasi yang mengarah pada pembentukan lapisan tipis berstruktur mikrokristalin mulai terlihat pada temperatur filamen ≥ 500oC, dimana puncak-puncak di fraksi spektrum XRD untuk orientasi kristalin tertentu mulai terbentu, sejalan dengan pembentukan butiran-butiran kristalin dari hasil foto SEM permukaan lapisan-lapisan tersebut.

  12. Observations of mesosphere summer echoes with calibrated VHF radars at latitudes between 54°N and 69°N in summer 2004

    Science.gov (United States)

    Latteck, R.; Singer, W.; Kirkwood, S.; Jönsson, L. O.; Eriksson, Håkan

    2005-08-01

    Mesosphere Summer Echoes (MSE) have been observed with 50-MHz VHF radars at middle (MSE) and polar latitudes (PMSE) for more than 20 years. The occurrence and seasonal variation of these radar echoes as well as their dependence on solar and geomagnetic activity are mostly studied basing on relative signal strength measurements (signal-to-noise ratios). The latitudinal dependence of the appearance and intensity of mesospheric summer echoes is still an open question as the widely used relative signal strength observations are determined by the atmospheric properties as well as by the individual radar characteristics. The use of absolutely calibrated echo powers allows a system in-depended comparison of mesospheric summer echoes observed at different sites by different systems. We present two different radar calibration methods. One applies a noise source to calibrate the receive path of the radar only, a second uses the radar signal itself to calibrate the complete transmitting and receiving path of the radar system. Both techniques and the same calibration hardware have been applied to the ALWIN VHF radar at Andenes/Norway (69°N), the ESRAD radar at Kiruna/Sweden (68deg;N) and OSWIN radar at Kühlungsborn/Germany (54°N). The sensitivity of the different radar systems and the seasonal and diurnal variation of the occurrence of mesospheric summer echoes at different locations are discussed on the basis of radar backscatter cross-sections.

  13. A VHF Class E DC-DC Converter with Self-Oscillating Gate Driver

    DEFF Research Database (Denmark)

    Andersen, Toke Meyer; Christensen, Søren K.; Knott, Arnold

    2011-01-01

    This paper describes the analysis and design of a DC-DC converter topology which is operational at frequencies in the Very High Frequency (VHF) band ranging from 30 MHz − 300 MHz. The presented topology, which consists of a class E inverter, class E rectifier, and self-oscillating gate driver, is...

  14. VHF SoOp (Signal of Opportunity) Technology Demonstration for Soil Moisture Measurement Using Microwave Hydraulic Boom Truck Platform

    Science.gov (United States)

    Joseph, Alicia; Deshpande, Manohar; O'Neill, Peggy; Miles, Lynn

    2017-04-01

    A goal of this research is to test deployable VHF antennas for 6U Cubesat platforms to enable validation of root zone soil moisture (RZSM) estimation algorithms for signal of opportunity (SoOp) remote sensing over the 240-270 MHz frequency band. The proposed work provides a strong foundation for establishing a technology development path for maturing a global direct surface soil moisture (SM) and RZSM measurement system over a variety of land covers. Knowledge of RZSM up to a depth of 1 meter and surface SM up to a depth of 0.05 meter on a global scale, at a spatial resolution of 1-10 km through moderate-to-heavy vegetation, is critical to understanding global water resources and the vertical moisture gradient in the Earth's surface layer which controls moisture interactions between the soil, vegetation, and atmosphere. Current observations of surface SM from space by L-band radiometers (1.4 GHz) and radars (1.26 GHz) are limited to measurements of surface SM up to a depth of 0.05 meter through moderate amounts of vegetation. This limitation is mainly due to the inability of L-band signals to penetrate through dense vegetation and deep into the soil column. Satellite observations of the surface moisture conditions are coupled to sophisticated models which extrapolate the surface SM into the root zone, thus providing an indirect estimate rather than a direct measurement of RZSM. To overcome this limitation, low-frequency airborne radars operating at 435 MHz and 118 MHz have been investigated, since these lower frequencies should penetrate denser vegetation and respond to conditions deeper in the soil. This presentation describes a new and less expensive technique for SM as well as RZSM direct measurement using Signal of Opportunity transmitters. Being less expensive and needing only passive simple RF receiver, the SoOp concept has the potential for being used for space borne applications, thus providing global SM and RZSM measurements. This study will describe

  15. Testing VHF/GPS collar design and safety in the study of free-roaming horses.

    Directory of Open Access Journals (Sweden)

    Gail H Collins

    Full Text Available Effective and safe monitoring techniques are needed by U.S. land managers to understand free-roaming horse behavior and habitat use and to aid in making informed management decisions. Global positioning system (GPS and very high frequency (VHF radio collars can be used to provide high spatial and temporal resolution information for detecting free-roaming horse movement. GPS and VHF collars are a common tool used in wildlife management, but have rarely been used for free-roaming horse research and monitoring in the United States. The purpose of this study was to evaluate the design, safety, and detachment device on GPS/VHF collars used to collect free-roaming horse location and movement data. Between 2009 and 2010, 28 domestic and feral horses were marked with commercial and custom designed VHF/GPS collars. Individual horses were evaluated for damage caused by the collar placement, and following initial observations, collar design was modified to reduce the potential for injury. After collar modifications, which included the addition of collar length adjustments to both sides of the collar allowing for better alignment of collar and neck shapes, adding foam padding to the custom collars to replicate the commercial collar foam padding, and repositioning the detachment device to reduce wear along the jowl, we observed little to no evidence of collar wear on horses. Neither custom-built nor commercial collars caused injury to study horses, however, most of the custom-built collars failed to collect data. During the evaluation of collar detachment devices, we had an 89% success rate of collar devices detaching correctly. This study showed that free-roaming horses can be safely marked with GPS and/or VHF collars with minimal risk of injury, and that these collars can be a useful tool for monitoring horses without creating a risk to horse health and wellness.

  16. Molecular Switching in Confined Spaces: Effects of Encapsulating the DHA/VHF Photo-Switch in Cucurbiturils

    DEFF Research Database (Denmark)

    Petersen, Michael Å.; Rasmussen, Brian; Andersen, Nicolaj N.

    2017-01-01

    complexes, the kinetics of the thermal VHF-to-DHA back-reaction is accelerated, while in CB8 inclusion complexes, the kinetics is slowed down as compared to the free photo-switch. The effect of the CB encapsulation of the photo-switch can be effectively canceled by introducing a guest that binds the CB more...... strongly. According to DFT calculations, a stabilization of the reactive s-cis VHF conformer relative to the s-trans VHF appears to be a contributing factor responsible for the accelerated back-reaction when encapsulated in CB7....

  17. Development of a Coherent Bistatic Vegetation Model for Signal of Opportunity Applications at VHF UHF-Bands

    Science.gov (United States)

    Kurum, Mehmet; Deshpande, Manohar; Joseph, Alicia T.; O'Neill, Peggy E.; Lang, Roger H.; Eroglu, Orhan

    2017-01-01

    A coherent bistatic vegetation scattering model, based on a Monte Carlo simulation, is being developed to simulate polarimetric bi-static reflectometry at VHF/UHF-bands (240-270 MHz). The model is aimed to assess the value of geostationary satellite signals of opportunity to enable estimation of the Earth's biomass and root-zone soil moisture. An expression for bistatic scattering from a vegetation canopy is derived for the practical case of a ground-based/low altitude platforms with passive receivers overlooking vegetation. Using analytical wave theory in conjunction with distorted Born approximation (DBA), the transmit and receive antennas effects (i.e., polarization, orientation, height, etc.) are explicitly accounted for. Both the coherency nature of the model (joint phase and amplitude information) and the explicit account of system parameters (antenna, altitude, polarization, etc) enable one to perform various beamforming techniques to evaluate realistic deployment configurations. In this paper, several test scenarios will be presented and the results will be evaluated for feasibility for future biomass and root-zone soil moisture application using geostationary communication satellite signals of opportunity at low frequencies.

  18. A system for mapping sources of VHF and electric field pulses from in-cloud lightning at KSC

    Science.gov (United States)

    Thomson, Ewen M.; Medelius, Pedro J.

    1991-01-01

    The literature concerning VHF radiation and wideband electric fields from in-cloud lightning is reviewed. VHF location systems give impressive radio images of lightning in clouds with high spatial and temporal resolution. Using systems based on long and short baseline time-or-arrival and interferometry, workers have detected VHF sources that move at speeds of 10(exp 5) to 10(exp 8) m/s. The more slowly moving sources appear to be associated with channel formation but the physical basis for the higher speeds is not clear. In contrast, wideband electric fields are directly related to physical parameters such as current and tortuosity. A long baseline system is described to measure simultaneously VHF radiation and wideband electric fields at five stations at Kennedy Space Center. All signals are detected over remote, isolated ground planes with fiber optics for data transmission. The modification of this system to map rapidly varying dE/dt pulses is discussed.

  19. Investigation into the Effects of VHF and UHF Band Radiation on Hewlett-Packard (HP) Cesium Beam Frequency Standards

    National Research Council Canada - National Science Library

    Dickens, Andrew

    1994-01-01

    This paper documents an investigation into reports which have indicated that exposure to VHF and UHF band radiation has adverse effects on the frequency stability of HP cesium beam frequency standards...

  20. Investigation into the effects of VHF and UHF band radiation on Hewlett-Packard (HP) Cesium Beam Frequency Standards

    Science.gov (United States)

    Dickens, Andrew

    1995-01-01

    This paper documents an investigation into reports which have indicated that exposure to VHF and UHF band radiation has adverse effects on the frequency stability of HP cesium beam frequency standards. Tests carried out on the basis of these reports show that sources of VHF and UHF radiation such as two-way hand held police communications devices do cause reproducible adverse effects. This investigation examines reproducible effects and explores possible causes.

  1. Comparison study of Lightning VHF interferometric and LF time-of-arival maps

    Science.gov (United States)

    Kudo, A.; Stock, M.; Kawasaki, Z.; Ushio, T.

    2016-12-01

    Lightning discharges radiate broad band frequency electromagnetic waves from ULF to UHF. Using sensors which detect this radiation is an effective technique to detect lightning flashes, even if they are in a cloud. If multiple sensors are present, a lightning flash can be located using various techniques. At low frequencies, the power radiated by lightning is very high, but because the wavelengths are long, the location resolution is somewhat low. At very high frequencies, the wavelengths are much shorter allowing for much better location resolution, but the power radiation is also much lower, making it more difficult to detect. The VHF band is a good compromise between good location resolution, and good detection efficiency. One technique to locate VHF signals from lightning is interferometry. Using this technique, the signals arriving at three or more VHF broadband antennas are coherently combined to produce an image of the lightning flash. The current generation broadband lightning interferometer being developed in Japan by RAIRAN and the University of Osaka called Lightning Interferometer via VHF Emission (LIVE). Currently, LIVE is installed in Kaizuka, a city to the south of Osaka, near Osaka Bay to observe Japanese summer lightning. In the current study, we are comparing the high detail, 2-dimensional lightning maps produced by LIVE to the lower detail, 3-dimensional maps produced by a low frequency time-of-arrival system called the Broadband Observation network for Lightning and Thunderstorms (BOLT). In order to better compare the data, a new GPS timing device is being developed for LIVE to allow high absolute timing accuracy without sacrificing one of the 4 high speed digitizer channels. The objectives of the study are to better understand Japanese summer lightning, and to prepare for a future campaign as part of the GLM validation study.

  2. Bias-Voltage Stabilizer for HVHF Amplifiers in VHF Pulse-Echo Measurement Systems

    Directory of Open Access Journals (Sweden)

    Hojong Choi

    2017-10-01

    Full Text Available The impact of high-voltage–high-frequency (HVHF amplifiers on echo-signal quality is greater with very-high-frequency (VHF, ≥100 MHz ultrasound transducers than with low-frequency (LF, ≤15 MHz ultrasound transducers. Hence, the bias voltage of an HVHF amplifier must be stabilized to ensure stable echo-signal amplitudes. We propose a bias-voltage stabilizer circuit to maintain stable DC voltages over a wide input range, thus reducing the harmonic-distortion components of the echo signals in VHF pulse-echo measurement systems. To confirm the feasibility of the bias-voltage stabilizer, we measured and compared the deviations in the gain of the HVHF amplifier with and without a bias-voltage stabilizer. Between −13 and 26 dBm, the measured gain deviations of a HVHF amplifier with a bias-voltage stabilizer are less than that of an amplifier without a bias-voltage stabilizer. In order to confirm the feasibility of the bias-voltage stabilizer, we compared the pulse-echo responses of the amplifiers, which are typically used for the evaluation of transducers or electronic components used in pulse-echo measurement systems. From the responses, we observed that the amplitudes of the echo signals of a VHF transducer triggered by the HVHF amplifier with a bias-voltage stabilizer were higher than those of the transducer triggered by the HVHF amplifier alone. The second, third, and fourth harmonic-distortion components of the HVHF amplifier with the bias-voltage stabilizer were also lower than those of the HVHF amplifier alone. Hence, the proposed scheme is a promising method for stabilizing the bias voltage of an HVHF amplifier, and improving the echo-signal quality of VHF transducers.

  3. First wind shear observation in PMSE with the tristatic EISCAT VHF radar

    OpenAIRE

    Mann, Ingrid; Häggström, I.; Tjulin, A; Rostami, S; Anyairo, CC; Dalin, P

    2016-01-01

    (c) American Geophysical Union, reprinted with permission. Article also available at source: https://doi.org/10.1002/2016JA023080 The Polar Summer Mesosphere has the lowest temperatures that occur in the entire Earth system. Water ice particles below the optically observable size range participate there in the formation of strong radar echoes (Polar Mesospheric Summer Echoes, PMSE). To study PMSE we carried out observations with the European Incoherent Scatter (EISCAT) VHF and EIS...

  4. Bias-Voltage Stabilizer for HVHF Amplifiers in VHF Pulse-Echo Measurement Systems.

    Science.gov (United States)

    Choi, Hojong; Park, Chulwoo; Kim, Jungsuk; Jung, Hayong

    2017-10-23

    The impact of high-voltage-high-frequency (HVHF) amplifiers on echo-signal quality is greater with very-high-frequency (VHF, ≥100 MHz) ultrasound transducers than with low-frequency (LF, ≤15 MHz) ultrasound transducers. Hence, the bias voltage of an HVHF amplifier must be stabilized to ensure stable echo-signal amplitudes. We propose a bias-voltage stabilizer circuit to maintain stable DC voltages over a wide input range, thus reducing the harmonic-distortion components of the echo signals in VHF pulse-echo measurement systems. To confirm the feasibility of the bias-voltage stabilizer, we measured and compared the deviations in the gain of the HVHF amplifier with and without a bias-voltage stabilizer. Between -13 and 26 dBm, the measured gain deviations of a HVHF amplifier with a bias-voltage stabilizer are less than that of an amplifier without a bias-voltage stabilizer. In order to confirm the feasibility of the bias-voltage stabilizer, we compared the pulse-echo responses of the amplifiers, which are typically used for the evaluation of transducers or electronic components used in pulse-echo measurement systems. From the responses, we observed that the amplitudes of the echo signals of a VHF transducer triggered by the HVHF amplifier with a bias-voltage stabilizer were higher than those of the transducer triggered by the HVHF amplifier alone. The second, third, and fourth harmonic-distortion components of the HVHF amplifier with the bias-voltage stabilizer were also lower than those of the HVHF amplifier alone. Hence, the proposed scheme is a promising method for stabilizing the bias voltage of an HVHF amplifier, and improving the echo-signal quality of VHF transducers.

  5. 2-D inner-shelf current observations from a single VHF WEllen RAdar (WERA) station

    Science.gov (United States)

    Voulgaris, G.; Kumar, N.; Gurgel, K.-W.; Warner, J.C.; List, J.H.

    2011-01-01

    The majority of High Frequency (HF) radars used worldwide operate at medium to high frequencies (8 to 30 MHz) providing spatial resolutions ranging from 3 to 1.5 km and ranges from 150 to 50 km. This paper presents results from the deployment of a single Very High Frequency (VHF, 48 MHz) WEllen RAdar (WERA) radar with spatial resolution of 150 m and range 10-15 km, used in the nearshore off Cape Hatteras, NC, USA. It consisted of a linear array of 12 antennas operating in beam forming mode. Radial velocities were estimated from radar backscatter for a variety of wind and nearshore wave conditions. A methodology similar to that used for converting acoustically derived beam velocities to an orthogonal system is presented for obtaining 2-D current fields from a single station. The accuracy of the VHF radar-derived radial velocities is examined using a new statistical technique that evaluates the system over the range of measured velocities. The VHF radar velocities showed a bias of 3 to 7 cm/s over the experimental period explainable by the differences in radar penetration and in-situ measurement height. The 2-D current field shows good agreement with the in-situ measurements. Deviations and inaccuracies are well explained by the geometric dilution analysis. ?? 2011 IEEE.

  6. Structure, optical properties and thermal stability of HfErO films deposited by simultaneous RF and VHF magnetron sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, H.Y. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Nanjing University of Posts and Telecommunications, School of Tongda, Nanjing (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); He, H.J.; Zhang, Z.; Jin, C.G.; Yang, Y.; Wang, Y.Y.; Ye, C. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Zhuge, L.J. [Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Soochow University, Analysis and Testing Center, Suzhou (China); Wu, X.M. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Chinese Academy of Sciences, State Key Laboratory of Functional Materials for Informatics, Shanghai Institute of Microsystem and Information Technology, Shanghai (China)

    2015-01-23

    HfErO films are deposited on Si substrates by simultaneous radio frequency (RF) and very high frequency (VHF) magnetron sputtering technique. The content of the doped ingredient of Er and the body composition of HfO{sub x} are, respectively, controlled through the VHF and RF powers. Low content of Er doping in the HfErO films can be achieved, because the VHF source of 27.12 MHz has higher ion energy and lower ion flux than the RF source resulting in low sputtering rate in the magnetron sputtering system. The structure, optical properties and thermal stability of the HfErO films are investigated in this work. Results show that the doped content of Er is independently controlled by the VHF power. The oxygen vacancies are created by the Er incorporation. The hafnium in the HfErO films forms mixed valence of Hf{sup 2+} and Hf{sup 4+}. The HfErO films are composed with the structures of HfO{sub 2}, HfO and ErO{sub x}, which can be optimized through the VHF power. At high VHF power, the Hf-Er-O bonds are formed, which demonstrates that the Er atoms are doped into the lattice of HfO{sub 2} in the HfErO films. The HfErO films have bad thermal stability as the crystallization temperature decreases from 900 to 800 C. After thermal annealing, cubic phase of HfO{sub 2} are stabilized, which is ascribed to the oxygen vacancies creation by the Er incorporation. The optical properties such as the refractive index and the optical band gap of the HfErO films are optimized by the VHF power. (orig.)

  7. High-resolution observation of field-aligned irregularities in the ionosphere using multi-frequency range imaging of VHF atmospheric radar

    Science.gov (United States)

    Chen, Jenn-Shyong; Furumoto, Jun-ichi; Su, Ching-Lun; Chu, Yen-Hsyang

    Field-aligned irregularity (FAI) in the ionosphere is a topic of interest to atmospheric radar community. In addition to the field-aligned characteristic, quasi-periodic (QP) appearance of FAI echoes has been observed frequently by very-high-frequency (VHF) atmospheric radar. The occurrence range of QP FAI echoes changes with time, and the slope of range versus time can be positive or negative, depending on occurrence time of the echoes. Several mechanisms responsible for the QP FAI echoes have been proposed, e.g., modulation in altitude by a passing atmospheric gravity wave, semidiurnal neutral-wind variation, and so on. Owing to the finite pulse length of radar in observation, the range resolution of measurement is limited within hundreds of meters. In view of this, the range imaging (RIM) using multiple frequencies has been employed to improve the range resolution of measurement. The multi-frequency technique transmits a set of slightly different frequencies sequentially during each radar pulse, and the radar returns at different transmitting frequencies are received, respectively. With adaptive retrieval algorithms for these radar returns, it is capable of resolving the echo structures at meter scale in the range direction. RIM has been employed in the lower atmosphere successfully. In this study, the performance of RIM for FAI was first carried out with the Middle and Upper atmosphere Radar (46 MHz; 34.85(°) N, 136.10(°) N; Japan) and the Chung-Li VHF radar (52 MHz; 24.9(°) N, 121.1(°) E; Taiwan). Some initial results of high-resolution FAI echoes within the range gate will be shown.

  8. Luminous phenomena and electromagnetic VHF wave emission originated from earthquake-related radon exhalation

    Science.gov (United States)

    Seki, A.; Tobo, I.; Omori, Y.; Muto, J.; Nagahama, H.

    2013-12-01

    Anomalous luminous phenomena and electromagnetic wave emission before or during earthquakes have been reported (e.g., the 1965 Matsushiro earthquake swarm). However, their mechanism is still unsolved, in spite of many models for these phenomena. Here, we propose a new model about luminous phenomena and electromagnetic wave emission during earthquake by focusing on atmospheric radon (Rn-222) and its daughter nuclides (Po-218 and Po-214). Rn-222, Po-218 and Po-214 are alpha emitters, and these alpha particles ionize atmospheric molecules. A light emission phenomenon, called 'the air luminescence', is caused by de-excitation of the ionized molecules of atmospheric nitrogen due to electron impact ionization from alpha particles. The de-excitation is from the second positive system of neutral nitrogen molecules and the first negative system of nitrogen molecule ion. Wavelengths of lights by these transitions include the visible light wavelength. So based on this mechanism, we proposed a new luminous phenomenon model before or during earthquake: 1. The concentration of atmospheric radon and its daughter nuclides increase anomalously before or during earthquakes, 2. Nitrogen molecules and their ions are excited by alpha particles emitted from Rn-222, Po-218 and Po-214, and air luminescence is generated by their de-excitation. Similarly, electromagnetic VHF wave emission can be explained by ionizing effect of radon and its daughter nuclides. Boyarchuk et al. (2005) proposed a model that electromagnetic VHF wave emission is originated when excited state of neutral clusters changes. Radon gas ionizes atmosphere and forms positively and negatively charged heavy particles. The process of ion hydration in ordinary air can be determined by the formation of complex chemically active structures of the various types of ion radicals. As a result of the association of such hydration radical ions, a neutral cluster, which is dipole quasi-molecules, is formed. A neutral cluster

  9. Observations of Mesospheric Turbulence by Rocket Probe and VHF Radar, Part 2.4A

    Science.gov (United States)

    Royrvik, O.; Smith, L. G.

    1984-01-01

    Data from the Jicamarca VHF radar and from a Languir probe fine-structure on a Nike Orion rocket launched from Punto Lobos, Peru, have been compared. A single mesospheric scattering layer was observed by the radar. The Langmuir probe detected irregularities in the electron-density profile in a narrow region between 85.2 and 86.6 km. It appears from a comparison between these two data sets that turbulence in the neutral atmosphere is the mechanism generating the refractive index irregularities.

  10. VHF radar observation of atmospheric winds, associated shears and C2n at a tropical location: interdependence and seasonal pattern

    Directory of Open Access Journals (Sweden)

    A. R. Jain

    Full Text Available The turbulence refractivity structure constant (C2n is an important parameter of the atmosphere. VHF radars have been used extensively for the measurements of C2n. Presently, most of such observations are from mid and high latitudes and only very limited observations are available for equatorial and tropical latitudes. Indian MST radar is an excellent tool for making high-resolution measurements of atmospheric winds, associated shears and turbulence refractivity structure constant (C2n. This radar is located at Gadanki (13.45° N, 79.18° E, a tropical station in India. The objective of this paper is to bring out the height structure of C2n for different seasons using the long series of data (September 1995 – August 1999 from Indian MST radar. An attempt is also made to understand such changes in the height structure of C2n in relation to background atmospheric parameters such as horizontal winds and associated shears. The height structure of C2n, during the summer monsoon and post-monsoon season, shows specific height features that are found to be related to Tropical Easterly Jet (TEJ winds. It is important to examine the nature of the radar back-scatterers and also to understand the causative mechanism of such scatterers. Aspect sensitivity of the received radar echo is examined for this purpose. It is observed that radar back-scatterers at the upper tropospheric and lower stratospheric heights are more anisotropic, with horizontal correlation length of 10–20 m, as compared to those observed at lower and middle tropospheric heights.Key words. Meteorology and atmospheric dynamics (climatology; tropical meteorology; turbulence

  11. Books Received

    Indian Academy of Sciences (India)

    VG Bhide. Shekhar Phatak and Associates. 1998, Rs.80. Books Received. Biotechnological Methods of. Pollution Control. S A Abbasi and E Ramasami. Universities Press. 1999, Rs.1S0. The Penguin India Career Guide,. Vol 2, The Scien~es. Usha Albuquerque. Penguin Books. 1996, Rs.250. Fixed Points. Yu A Shashldn.

  12. Books Received

    Directory of Open Access Journals (Sweden)

    Murat Akser

    2014-10-01

    Full Text Available In 2014 we have received a variety of books onc inema and media from these publishers: Bloomsbury Academic, Cambridge Scholars Publishing, Continuum, Edinburgh University Press, Focal Press, Intellect, Paradigm, Peter Lang, Routledge, University of California Press, Wayne State University Press.

  13. Books Received

    Indian Academy of Sciences (India)

    Books Received. Challenge and Thrill of Pre-College. Mathematics. V Krishnamurthy et al. New Age International. 1996, Rs.220. Mathematics for Science. S M Uppal and H M Humphreys. New Age International. 1996, Rs.17S. Physics for Engineers. M R Srinivasan. New Age Publications. 1996. Statement about ownership ...

  14. Measurements and simulation of ionospheric scattering on VHF and UHF radar signals: Channel scattering function

    Science.gov (United States)

    Rogers, Neil C.; Cannon, Paul S.; Groves, Keith M.

    2009-02-01

    The design and operation of transionospheric VHF and UHF radars requires knowledge of amplitude and phase scintillation due to ionospheric scattering. Phase coherence is of particular importance where long coherent integration periods and large bandwidths are required. A thin phase screen, parabolic equation based, Trans-Ionospheric Radio Propagation Simulator (TIRPS) is described. Modeled channel scattering functions (CSFs) are compared to experimental VHF and UHF data derived from the Advanced Research Projects Agency Long-range Tracking and Instrumentation Radar on Kwajalein Island (9.4°N, 166.8°E). TIRPS quantitatively reproduces the experimental results, including the quasi-parabolic profile observed in the measured CSFs under strong turbulence conditions. Variations in the simulated CSF with ionospheric phase screen parameters are also presented. Under conditions of high integrated strength of turbulence (CkL), a low phase spectral index (p = 1), indicating relatively dense small-scale irregularities, produces pronounced range spreading. Conversely, when the spectral index is high (p = 4), indicative of strong focusing/defocusing by large-scale irregularities, there is increased Doppler spreading and, when the outer scale of irregularities is large, a greater likelihood of asymmetry of the CSF about the zero Doppler axis.

  15. PMSE strength during enhanced D region electron densities: Faraday rotation and absorption effects at VHF frequencies

    Science.gov (United States)

    Chau, Jorge L.; Röttger, Jürgen; Rapp, Markus

    2014-10-01

    In this paper we study the effects of absorption and Faraday rotation on measurements of polar mesosphere summer echoes (PMSE). We found that such effects can produce significant reduction of signal-to-noise ratio (SNR) when the D region electron densities (Ne) are enhanced, and VHF radar systems with linearly polarized antennas are used. In particular we study the expected effects during the strong solar proton event (SPE) of July 2000, also known as the Bastille day flare event. During this event, a strong anti-correlation between the PMSE SNR and the D-region Ne was found over three VHF radar sites at high latitudes: Andøya, Kiruna, and Svalbard. This anti-correlation has been explained (a) in terms of transport effects due to strong electric fields associated to the SPE and (b) due to a limited amount of aerosol particles as compared to the amount of D-region electrons. Our calculations using the Ne profiles used by previous researchers explain most, if not all, of the observed SNR reduction in both time (around the SPE peak) and altitude. This systematic effect, particularly the Faraday rotation, should be recognized and tested, and possibly avoided (e.g., using circular polarization), in future observations during the incoming solar maximum period, to contribute to the understanding of PMSE during enhanced D region Ne.

  16. VHF/UHF radar observations of tropical mesoscale convective systems over southern India

    Directory of Open Access Journals (Sweden)

    K. Kishore Kumar

    2005-07-01

    Full Text Available Several campaigns have been carried out to study the convective systems over Gadanki (13.5° N, 79.2° E, a tropical station in India, using VHF and UHF radars. The height-time sections of several convective systems are investigated in detail to study reflectivity, turbulence and vertical velocity structure. Structure and dynamics of the convective systems are the main objectives of these campaigns. The observed systems are classified into single- and multi-cell systems. It has been observed that most of the convective systems at this latitude are multi-cellular in nature. Simultaneous VHF and UHF radar observations are used to classify the observed precipitating systems as convective, intermediary and stratiform regions. Composite height profiles of vertical velocities in these regions were obtained and the same were compared with the profiles obtained at other geographical locations. These composite profiles of vertical velocity in the convective regions have shown their peaks in the mid troposphere, indicating that the maximum latent heat is being released at those heights. These profiles are very important for numerical simulations of the convective systems, which vary significantly from one geographical location to the other. Keywords. Meteorology and atmospheric dynamics (Mesoscale meteorology; Convective processes – Radio science (Remote sensing

  17. Molecular Switching in Confined Spaces: Effects of Encapsulating the DHA/VHF Photo-Switch in Cucurbiturils.

    Science.gov (United States)

    Petersen, Michael Å; Rasmussen, Brian; Andersen, Nicolaj N; Sauer, Stephan P A; Nielsen, Mogens Brøndsted; Beeren, Sophie R; Pittelkow, Michael

    2017-09-18

    Confinement of reactive chemical species uniquely affects chemical reactivity by restricting the physical space available and by restricting access to interactions with the solvent. In Nature, for example, confined protein binding pockets govern processes following photoisomerization reactions and the isomerizations themselves. Here we describe the first example of a dihydroazulene/vinylheptafulvene (DHA/VHF) photo-switch functioning in water, and we show how its switching behavior is strongly influenced by supramolecular interactions with a series of cucurbit[n]uril (CB) host molecules. In CB7 inclusion complexes, the kinetics of the thermal VHF-to-DHA back-reaction is accelerated, while in CB8 inclusion complexes, the kinetics is slowed down as compared to the free photo-switch. The effect of the CB encapsulation of the photo-switch can be effectively canceled by introducing a guest that binds the CB more strongly. According to DFT calculations, a stabilization of the reactive s-cis VHF conformer relative to the s-trans VHF appears to be a contributing factor responsible for the accelerated back-reaction when encapsulated in CB7. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  18. Frequency Reuse, Cell Separation, and Capacity Analysis of VHF Digital Link Mode 3 TDMA

    Science.gov (United States)

    Shamma, Mohammed A.; Nguyen, Thanh C.; Apaza, Rafael D.

    2003-01-01

    The most recent studies by the Federal Aviation Administration (FAA) and the aviation industry have indicated that it has become increasingly difficult to make new VHF frequency or channel assignments to meet the aviation needs for air-ground communications. FAA has planned for several aggressive improvement measures to the existing systems, but these measures would not meet the projected voice communications needs beyond 2009. FAA found that since 1974 there has been, on the average, a 4 percent annual increase in the number of channel assignments needed to satisfy the air-ground communication traffic (approximately 300 new channel assignments per year). With the planned improvement measures, the channel assignments are expected to reach a maximum number of 16615 channels by about 2010. Hence, the FAA proposed the use of VDL Mode 3 as a new integrated digital voice and data communications systems to meet the future air traffic demand. This paper presents analytical results of frequency reuse; cell separation and capacity estimation of VDL Mode 3 TDMA systems that FAA has planned to implement the future VHF air-ground communications system by the year 2010. For TDMA, it is well understood that the frequency reuse factor is a crucial parameter for capacity estimation. Formulation of this frequency reuse factor is shown, taking into account the limitation imposed by the requirement to have a sufficient Signal to Co-Channel Interference Ratio. Several different values for the Signal to Co-Channel Interference Ratio were utilized corresponding to the current analog VHF DSB-AM systems, and the future digital VDL Mode 3. The required separation of Co-Channel cells is computed for most of the Frequency Protected Service Volumes (FPSV's) currently in use by the FAA. Additionally, the ideal cell capacity for each FPSV is presented. Also, using actual traffic for the Detroit air space, a FPSV traffic distribution model is used to generate a typical cell for channel capacity

  19. Disturbance-induced responses of VHF and satellite tagged harbour seals

    DEFF Research Database (Denmark)

    Andersen, Signe May; Teilmann, Jonas; Dietz, Rune

    2014-01-01

    ABSTRACT 1. The response of individual harbour seals (Phoca vitulina) to controlled and sporadic disturbances when hauled out in the Anholt seal reserve, Denmark, was studied. Sporadic disturbances from pedestrians, boats, low-flying aeroplanes and grey seals (Halichoerus grypus) were observed...... in or near the reserve. VHF and satellite transmitters were attached to eight harbour seals to determine post-disturbance and undisturbed behaviour during the pre-breeding period (25 April to 21 May 2008). 2. Both disturbed and undisturbed seals mostly returned to the haul-out site from dusk and throughout...... within 40 km from the haul-out site. The maximum extent of post-disturbance trips, however, varied among individuals and disturbance types, and was strongly correlated with the duration of trips. 3. Disturbed and undisturbed seals used the same areas, suggesting that these areas represent normal foraging...

  20. Graphene-based tunable non-foster circuit for VHF applications

    Directory of Open Access Journals (Sweden)

    Jing Tian

    2016-06-01

    Full Text Available This paper presents a negative impedance converter (NIC based on graphene field effect transistors (GFETs for VHF applications. The NIC is designed following Linvill’s open circuit stable (OCS topology. The DC modelling parameters of GFET are extracted from a device measured by Meric et al. [IEEE Electron Devices Meeting, 23.2.1 (2010] Estimated parasitics are also taken into account. Simulation results from Keysight Advanced Design System (ADS show good NIC performance up to 200 MHz and the value of negative capacitance is directly proportional to the capacitive load. In addition, it has been shown that by varying the supply voltage the value of negative capacitance can also be tuned. The NIC stability has been tested up to 2 GHz (10 times the maximum operation frequency using Nyquist stability criterion to ensure there are no oscillation issues.

  1. Final environmental assessment for vegetation control at VHF stations, microwave stations, electrical substations, and pole yards

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-10-13

    Southwestern Power Adm. operates very high frequency (VHF) and microwave radio stations, electrical substations, and pole yards for electric power transmission throughout AR, MO, and OK. Vegetation growth at the stations must be suppressed for safety of operation and personnel. Southwestern has been using a combination of mechanical/manual and herbicide control for this purpose; Federally- mandated reductions in staff and budgetary resources require Southwestern to evaluate all potentially efficient methods for vegetation control. Three alternatives were examined: no action, mechanical/manual control, and (proposed) a combination of mechanical/manual and herbicide control. Environmental impacts on air and water quality, wetlands, wildlife, endangered species, archaeological and other resources, farmland, human health, transportation, etc. were evaluated.

  2. Simultaneous observation of sporadic E with a rapid-run ionosonde and VHF coherent backscatter radar

    Directory of Open Access Journals (Sweden)

    T. Maruyama

    2006-03-01

    Full Text Available During the SEEK 2 rocket campaign, ionograms were recorded every minute at the Yamagawa Radio Observatory at about 90km west of the region monitored by a VHF (very high frequency coherent backscatter radar. Sporadic E-layer parameters, which include the critical (foEs and blanketing (fbEs frequencies, the layer height (h'Es, and the width of the range spread of sporadic E-traces, were compared with RTI (range-time-intensity plots of VHF quasi-periodic (QP and continuous coherent backscatter echoes. A close relationship was found between the appearance of QP echoes in the RTI plots and the level of spatial inhomogeneity in sporadic E plasma, signified here by the difference between foEs and fbEs. During QP echo events, foEs increased while fbEs decreased, so that the difference foEs-fbEs was enhanced, indicating the development of strong spatial structuring in electron density within a sporadic E-layer. On the other hand, increases in sporadic E range spreading also correlated with the occurrence of QP echoes but the degree of correlation varied from event to event. Continuous radar echoes were observed in association with low altitude sporadic E-layers, located well below 100 km and at times as low as 90 km. During the continuous echo events, both foEs and fbEs were less variable, and the difference foEs-fbEs was small and not as dynamic as in the QP echoes. On the other hand, the Es-layer spread intensified during continuous echoes, which means that some patchiness or corrugation in those low altitude layers is also necessary for the continuous backscatter echoes to take place.

  3. Simultaneous observation of sporadic E with a rapid-run ionosonde and VHF coherent backscatter radar

    Directory of Open Access Journals (Sweden)

    T. Maruyama

    2006-03-01

    Full Text Available During the SEEK 2 rocket campaign, ionograms were recorded every minute at the Yamagawa Radio Observatory at about 90km west of the region monitored by a VHF (very high frequency coherent backscatter radar. Sporadic E-layer parameters, which include the critical (foEs and blanketing (fbEs frequencies, the layer height (h'Es, and the width of the range spread of sporadic E-traces, were compared with RTI (range-time-intensity plots of VHF quasi-periodic (QP and continuous coherent backscatter echoes. A close relationship was found between the appearance of QP echoes in the RTI plots and the level of spatial inhomogeneity in sporadic E plasma, signified here by the difference between foEs and fbEs. During QP echo events, foEs increased while fbEs decreased, so that the difference foEs-fbEs was enhanced, indicating the development of strong spatial structuring in electron density within a sporadic E-layer. On the other hand, increases in sporadic E range spreading also correlated with the occurrence of QP echoes but the degree of correlation varied from event to event. Continuous radar echoes were observed in association with low altitude sporadic E-layers, located well below 100 km and at times as low as 90 km. During the continuous echo events, both foEs and fbEs were less variable, and the difference foEs-fbEs was small and not as dynamic as in the QP echoes. On the other hand, the Es-layer spread intensified during continuous echoes, which means that some patchiness or corrugation in those low altitude layers is also necessary for the continuous backscatter echoes to take place.

  4. Recent Comparisons of VHF Lightning Mapping Using Interferometry and Time-of-Arrival Techniques

    Science.gov (United States)

    Lojou, J.; Cummins, K. L.

    2005-12-01

    As part of Vaisala's technology and applications test bed in the Dallas-Fort Worth area in Texas, we have been operating two overlapping Total Lightning detection networks. One network employs VHF Interferometry (both 2- and 3-timensional instrumentation) and the other employs VHF 3-dimensional Time-Of-Arrival (TOA) techniques. For the first time, these two technologies can be compared and contrasted in a common region where they both exhibit good performance. The aim of the work presented is to evaluate the spatial and temporal "description" of lightning flashes provided by these two techniques, and to compare and contrast the relative strengths of these two approaches for Total Lightning mapping. This study employs data acquired during the summer of 2005. The analysis set includes data obtained by these two networks, as well as cloud-to-ground location data from the U.S. National Lightning Detection Network (NLDN). The spatial extent and vertical profile of sources from individual in-cloud and cloud-to-ground flashes are compared for various storm conditions, with both technologies clearly contributing supplemental information not provided by the other. Leader propagation velocities show a substantially unimodal distribution centered at about 105 m/s for TOA-derived sources, whereas the velocity distribution for sources detected using interferometry exhibit a bimodal distribution with the second mode at about 107 m/s. The most-probable interval-between-sources for TOA-derived sources seems to be a few milliseconds, whereas interferometry produces large populations with intervals near 100 microseconds and 100 milliseconds.

  5. Analysis of the VHF-UHF electromagnetic radiation of lightning: Application to a model of the negative stepped leader propagation

    Science.gov (United States)

    Taudiere, Isabelle

    1991-03-01

    The space and time characteristics of the VHF-UHF radiation from lightning are analyzed on the bases of 300 MHz emission sources, localized in three dimensions by interferometric measurements. The main phases that contribute to the development of intracloud lightning are examined in detail, also using electric field measurements at the lower frequency. This research is complemented by an experimental and theoretical analysis of long discharge (8m) radio emissions generated with both polarities in the laboratory. These investigations revealed that the VHF radiation is associated with the channel reillumination phase accompanying each step in the negative spark. The outcome of this work is the creation of a simple model for the propagation of the negative leader. The current and the radiated field during this phase of the discharge are computed from an equivalent electric circuit using the physical laws governing the variation of resistance. The extrapolation of these results to the case of the stepped leader of natural lightning is discussed.

  6. Meteor head echo altitude distributions and the height cutoff effect studied with the EISCAT HPLA UHF and VHF radars

    Directory of Open Access Journals (Sweden)

    A. Westman

    2004-04-01

    Full Text Available Meteor head echo altitude distributions have been derived from data collected with the EISCAT VHF (224MHz and UHF (930MHz high-power, large-aperture (HPLA radars. At the high-altitude end, the distributions cut off abruptly in a manner reminiscent of the trail echo height ceiling effect observed with classical meteor radars. The target dimensions are shown to be much smaller than both the VHF and the UHF probing wavelengths, but the cutoff heights for the two systems are still clearly different, the VHF cutoff being located several km above the UHF one. A single-collision meteor-atmosphere interaction model is used to demonstrate that meteors in the (1.3–7.2µg mass range will ionise such that critical electron density at 224MHz is first reached at or around the VHF cutoff altitude and critical density at 930MHz will be reached at the UHF cutoff altitude. The observed seasonal variation in the cutoff altitudes is shown to be a function of the seasonal variation of atmospheric density with altitude. Assuming that the electron density required for detection is in the order of the critical density, the abrupt altitude cutoffs can be explained as a consequence of the micrometeoroid joint size-speed distribution dropping off so fast at the large-mass, high-velocity end that above a certain altitude the number of detectable events becomes vanishingly small. Conversely, meteors at the low-mass end of the distribution will be gradually retarded such that the ionisation they generate never reaches critical density. These particles will remain unobservable.Key words. Radio science (instruments and techniques – Interplatery physics (interplanetary dust – General or miscellaneous (new fields

  7. Observations of VHF emissions from 50-mA electron beam injections in the ionosphere that are associated with beam-induced discharges

    Science.gov (United States)

    Goerke, R. T.; Kellogg, P. J.; Monson, S. J.; Franz, R. C.; Nemzek, R. J.; Anderson, H. R.; Potter, D. W.; Denig, W. F.; Szuszczewicz, E. P.; Earle, G. D.

    1992-01-01

    Results are presented of observations of strong VHF plasma waves with amplitudes in excess of 0.1 mV/m (Hz)1/2 associated with 50 mA electron beam injections in the ionosphere. Data from three swept-frequency receivers carried on two daughter payloads are analyzed to determine the emission spectra of the electron beam for various energies and currents. These results were obtained from the rocket-borne experiment SCEX 3, NASA flight 39.002 UE, launched February 1, 1990. The accelerator payload also carried photometers, which measured luminosity at wavelengths of 391.4 and 380.5 nm. Several times during electron gun activity the measured luminosity increased much faster than proportional to the beam current. This nonlinear increase is evidence that a discharge is occurring in the vicinity of the accelerator payload. It is inferred from the uniform distribution of the luminosity around the accelerator payload that the observed discharge extends significantly outside the beam cylinder.

  8. VHF digital ultrasound three-dimensional scanning in the diagnosis of myopic regression after corneal refractive surgery.

    Science.gov (United States)

    Reinstein, Dan Z; Ameline, Barbara; Puech, Michel; Montefiore, Guy; Laroche, Laurent

    2005-01-01

    To perform VHF digital ultrasound scanning and analysis of a case of high-myopic undercorrection in an eye that had undergone multiple surgical interventions for the correction of an initial refraction of -12.00 diopters (D). A 49-year-old woman was evaluated after undergoing three surgical interventions for correction of an initial refraction of -12.00 D in the left eye. Automated lamellar keratoplasty (ALK) was followed by arcuate keratotomy (for induced astigmatism) and surface photorefractive keratectomy (PRK). The residual ametropia on presentation was -6.75 -3.50 x 95 degrees. VHF digital ultrasound scanning and analysis was performed. On ultrasound, the ALK interface was clearly visible. Residual stromal thickness beneath the cap was at least 275 microm. The absence of Bowman's layer indicated the region of PRK. New stroma and nascent stromal layers were differentiated within the flap. Neo stromal deposition and central epithelial hyperplasia were determined to be responsible for the myopic shift, as opposed to biomechanical changes. In this case, refraction, slit-lamp examination, and topography were unable to provide a diagnosis for regression following multiple corneal refractive procedures. By providing layered anatomical mapping, VHF digital ultrasound scanning was able to exclude a diagnosis of ectasia and provide anatomical diagnostic information to explain the clinical observations.

  9. Disturbances in VHF/UHF telemetry links as a possible effect of the 2003 Hokkaido Tokachi-oki earthquake

    Directory of Open Access Journals (Sweden)

    H. Nagamoto

    2008-08-01

    Full Text Available The data on radio telemetry links (for water information at VHF/UHF in Hokkaido are used to investigate the rate of disturbances on radio links (or connection failure and its association with a huge earthquake, Tokachi-oki earthquake on 26 September 2003. Especially, the telemetry links at the Tokachi region closest to the earthquake epicenter, showed a significant increase in disturbances on radio links two weeks to a few days before the earthquake on the basis of analysis during a long interval from 1 June 2002 to 3 November 2007 (over 5 years. We suggest that these severe disturbances in VHF/UHF telemetry links are attributed to the generation of seismogenic VHF/UHF radio noises (emissions. Based on this idea, we have estimated that the intensity of these seismogenic emissions is on the order of 10–19 dB μV/m. Finally, the present result was compared with other physical parameters already obtained for this earthquake.

  10. First results from an iron lidar and a VHF radar at Davis, Antarctica

    Science.gov (United States)

    Luebken, F.; Morris, R. J.; Hoeffner, J.; Kaifler, B.; Viehl, T.

    2012-12-01

    We present temperature measurements at Davis, Antarctica (69°S, 78°E), and compare with simultaneous and co-located radar measurements of polar mesosphere summer echoes (PMSE). The mobile scanning iron lidar of the IAP in Kuehlungsborn was installed at Davis in December 2010. It measures iron densities, vertical winds, and temperatures in the iron layer, i. e. from approximately 80 to 100 km. It is based on probing the Doppler broadened resonance line of iron atoms at 386 nm and can operate under daylight conditions. Typical values for temperature uncertainty, altitude and time resolution are 3-5 K, 1 km, and 1 hour, respectively. The lidar also measures neutral air densities and temperatures in the stratosphere and lower mesosphere. At Davis the lidar has up to now achieved approximately 2700 hours of data which is presumably the largest nearly continuous data set in Antarctica. The mesopause altitude changes throughout the summer season by several kilometers, significantly different from the northern hemisphere summer. Depending on altitude, temperatures can be warmer or colder compared to the NH summer. Temperatures at Davis near 86 km are rather similar to the NH, but they are much colder at higher altitudes. The thermal structure around the mesopause at Davis is closely related to the general circulation in the stratosphere, namely to the transition from winter to summer conditions. Different from expectations we sometimes find the mesopause significantly higher and colder(!) compared to the NH. Furthermore, we find large thermal tides in the summer months with amplitudes of up to 6-7~K, which is much larger than expected from models. The Australien Antarctic Division operates a 55 MHz VHF radar at Davis since February 2003. We report first simultaneous measurements of PMSE and temperatures by the Fe lidar. PMSE are strong radar echoes related to ice particles and therefore require atmospheric temperatures being lower than the frost point temperature

  11. Long-period unstable gravity-waves and associated VHF radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    Full Text Available VHF atmospheric radar is used to measure the wind velocity and radar echo power related to long-period wind perturbations, including gravity waves, which are observed commonly in the lower stratosphere and tropopause region, and sometimes in the troposphere. These wind structures have been identified previously as either inertia-gravity waves, often associated with jet streams, or mountain waves. At heights of peak wind shear, imbalances are found between the echo powers of a symmetric pair of radar beams, which are expected to be equal. The largest of these power differences are found for conditions of simultaneous high wind shear and high aspect sensitivity. It is suggested that the effect might arise from tilted specular reflectors or anisotropic turbulent scatterers, a result of, for example, Kelvin-Helmholtz instabilities generated by the strong wind shears. This radar power-difference effect could offer information about the onset of saturation in long-period waves, and the formation of thin layers of turbulence.

  12. Anisotropy of Doppler spectral parameters in the VHF radar observations at MU and White Sands

    Directory of Open Access Journals (Sweden)

    G. D. Nastrom

    2001-08-01

    Full Text Available Significant differences are found between the mean spectral widths from beams in the meridional plane and in the zonal plane at both the MU and the White Sands VHF radars. The spectral width in the beam directed perpendicular to the prevailing wind is greater than that in the beam parallel to the wind. The magnitudes of the differences in spectral width show a linear relationship with wind speed, with the greatest differences at the greatest wind speeds. The differences in spectral width show a positive correlation with the differences in backscattered power. The anisotropy in backscattered power is well-known and is usually attributed to aspect sensitivity effects. However, the anisotropy in spectral width does not appear to be due to the same mechanism, and while several hypotheses to account for this are considered, including finite range-volume effects, effects from the tilting of isentropic layers, and anisotropic turbulence effects, it is seen that each of these suggestions has its shortcomings.Key words. Meteorology and atmospheric dynamics (turbulence; instruments and techniques

  13. Anisotropy of Doppler spectral parameters in the VHF radar observations at MU and White Sands

    Directory of Open Access Journals (Sweden)

    G. D. Nastrom

    Full Text Available Significant differences are found between the mean spectral widths from beams in the meridional plane and in the zonal plane at both the MU and the White Sands VHF radars. The spectral width in the beam directed perpendicular to the prevailing wind is greater than that in the beam parallel to the wind. The magnitudes of the differences in spectral width show a linear relationship with wind speed, with the greatest differences at the greatest wind speeds. The differences in spectral width show a positive correlation with the differences in backscattered power. The anisotropy in backscattered power is well-known and is usually attributed to aspect sensitivity effects. However, the anisotropy in spectral width does not appear to be due to the same mechanism, and while several hypotheses to account for this are considered, including finite range-volume effects, effects from the tilting of isentropic layers, and anisotropic turbulence effects, it is seen that each of these suggestions has its shortcomings.

    Key words. Meteorology and atmospheric dynamics (turbulence; instruments and techniques

  14. Frequency domain interferometry mode observations of PMSE using the EISCAT VHF radar

    Directory of Open Access Journals (Sweden)

    P. B. Chilson

    2000-12-01

    Full Text Available During the summer of 1997 investigations into the nature of polar mesosphere summer echoes (PMSE were conducted using the European incoherent scatter (EISCAT VHF radar in Norway. The radar was operated in a frequency domain interferometry (FDI mode over a period of two weeks to study the frequency coherence of the returned radar signals. The operating frequencies of the radar were 224.0 and 224.6 MHz. We present the first results from the experiment by discussing two 4-h intervals of data collected over two consecutive nights. During the first of the two days an enhancement of the FDI coherence, which indicates the presence of distinct scattering layers, was found to follow the lower boundary of the PMSE. Indeed, it is not unusual to observe that the coherence values are peaked around the heights corresponding to both the lower- and upper-most boundaries of the PMSE layer and sublayers. A Kelvin-Helmholtz mechanism is offered as one possible explanation for the layering structure. Additionally, our analysis using range-time-pseudocolor plots of signal-to-noise ratios, spectrograms of Doppler velocity, and estimates of the positions of individual scattering layers is shown to be consistent with the proposition that upwardly propagating gravity waves can become steepened near the mesopause.Key words: Ionosphere (polar ionosphere · Meteorology and Atmospheric Dynamics (middle atmosphere dynamics · Radio Science (Interferometry

  15. Frequency domain interferometry mode observations of PMSE using the EISCAT VHF radar

    Directory of Open Access Journals (Sweden)

    P. B. Chilson

    Full Text Available During the summer of 1997 investigations into the nature of polar mesosphere summer echoes (PMSE were conducted using the European incoherent scatter (EISCAT VHF radar in Norway. The radar was operated in a frequency domain interferometry (FDI mode over a period of two weeks to study the frequency coherence of the returned radar signals. The operating frequencies of the radar were 224.0 and 224.6 MHz. We present the first results from the experiment by discussing two 4-h intervals of data collected over two consecutive nights. During the first of the two days an enhancement of the FDI coherence, which indicates the presence of distinct scattering layers, was found to follow the lower boundary of the PMSE. Indeed, it is not unusual to observe that the coherence values are peaked around the heights corresponding to both the lower- and upper-most boundaries of the PMSE layer and sublayers. A Kelvin-Helmholtz mechanism is offered as one possible explanation for the layering structure. Additionally, our analysis using range-time-pseudocolor plots of signal-to-noise ratios, spectrograms of Doppler velocity, and estimates of the positions of individual scattering layers is shown to be consistent with the proposition that upwardly propagating gravity waves can become steepened near the mesopause.

    Key words: Ionosphere (polar ionosphere · Meteorology and Atmospheric Dynamics (middle atmosphere dynamics · Radio Science (Interferometry

  16. Study of CNT growth using nanocatalyst Ag precursor by HWC-VHF-PECVD

    Energy Technology Data Exchange (ETDEWEB)

    Eliyana, Ajeng; Rosikin, Ahmad; Winata, Toto, E-mail: toto@fi.itb.ac.id [Physics of Electronics Material Research Division, Physics Programme, Faculty of Mathematics and Natural Sciences, Institut Teknologi Bandung, Jl. Ganesha 10, Bandung 40132, West Java (Indonesia)

    2015-04-16

    The study of CNT growth has been done by using silver (Ag) nanocatalyst as a guide precursor on corning glass 7059 substrate. The silver catalyst was prepared by the evaporation method by varying deposition time for 50, 25, and 14 seconds. The silver films were then annealed at temperature of 400°C for 4 hours. From Scanning Electron Microscope (SEM) and Energy Dispersive X-ray Spectroscopy (EDX) results the grain sizes are 65 nm, 57 nm, and 33 nm, and also the atomic compositions are 6,06%, 4,52%, and 3,73% for 14, 25 and 50 seconds samples, respectively. The 33 nm samples were then used for CNT growth by using Hot Wire Cell (HWC) – Very High Frequency (VHF) – Plasma Enhanced Chemical Vapor Deposition (PECVD) at 275 ° C deposition temperature and pressure of 300 mTorr. The rf power was varied from 8 to 20 watts, with deposition time for 60 minutes. The methane (CH4) 99.999% was used as Carbon sources. Hydrogen gas (H2) was used to etch the oxide layer formed during the pre-deposition process. The diameter and length for the CNT are 125 nm and 1.650 to 2.989 nm respectively.

  17. On the VHF source retrieval errors associated with Lightning Mapping Arrays (LMAs)

    Science.gov (United States)

    Koshak, W. J.

    2016-12-01

    A common method for retrieving the lightning Very High Frequency (VHF) radio source (x, y, z, t) emission is to minimize a (reduced) chi-squared function that indicates how well the model arrival times associated with the model source represent the arrival time measurements at each Lightning Mapping Array (LMA) site. The Levenberg-Marquardt (LM) algorithm is usually employed to find the minimum of the chi-squared function, and the model source producing this minimum is considered to be the optimal source solution. Because the chi-squared mathematical surface is nonlinear, it is important to feed the LM algorithm an accurate initial guess (xo, yo, zo, to) in parameter space to avoid parameter searches that terminate at a relative minima of the chi-squared surface. Source initialization is commonly performed using a linear retrieval algorithm first introduced in Koshak and Solakiewicz (1996), and further applied in Koshak et al. (2004). Monte Carlo simulations and theoretical inferences both show that source retrieval errors (particularly source altitude errors) increase with horizontal source range. In the present study, the effect of modifying certain elements of the retrieval (i. e., the LMA site locations, the number of sites employed, and the retrieval algorithm characteristics) are examined to assess and quantify associated improvements in retrieval results.

  18. Signal processing techniques for phase-coded HF-VHF radars

    Directory of Open Access Journals (Sweden)

    J. A. Baskaradas

    2003-06-01

    Full Text Available HF-VHF radar techniques are easy to employ and commonly used in geophysical applications. They include deep radio soundings, used for probing the ionosphere, stratosphere-mesosphere measurement, weather forecast and radio-glaciology. Fast algorithms and powerful processors facilitate the development of several kinds of low power radars, but the reduction of the transmitted power has to be compensated by on-line processing of an encoded signal to maintain a favorable signal-to-noise ratio suitable for detection. Moreover, radars have to reconstruct return echoes with different travel times due to various origins (multi-path, adjacent objects, etc.. Such needs can be accomplished by means of signal phase coding and one of the most attractive is the reversal phase code. The composite echo signal must be processed to extract the physical information useful for the measurement considered. In this paper some algorithms used for on-line processing of phase-coded signals will be described, both in time and frequency domain.

  19. Arctic and Antarctic polar mesosphere summer echoes observed with oblique incidence HF radars: analysis using simultaneous MF and VHF radar data

    Directory of Open Access Journals (Sweden)

    T. Ogawa

    2004-12-01

    Full Text Available Polar mesosphere summer echoes (PMSEs have been well studied using vertical incidence VHF radars at northern high-latitudes. In this paper, two PMSE events detected with the oblique incidence SuperDARN HF radars at Hankasalmi, Finland (62.3° N and Syowa Station, Antarctica (69.0° S, are analyzed, together with simultaneous VHF and medium-frequency (MF radar data. Altitude resolutions of the HF radars in the mesosphere and the lower thermosphere are too poor to know exact PMSE altitudes. However, a comparison of Doppler velocity from the HF radar and neutral wind velocity from the MF radar shows that PMSEs at the HF band appeared at altitudes within 80-90km, which are consistent with those from previous vertical incidence HF-VHF radar results. The HF-VHF PMSE occurrences exhibit a semidiurnal behavior, as observed by other researchers. It is found that in one event, PMSEs occurred when westward semidiurnal winds with large amplitude at 85-88km altitudes attained a maximum. When the HF-VHF PMSEs were observed at distances beyond 180km from MF radar sites, the MF radars detected no appreciable signatures of echo enhancement. Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; thermospheric dynamics; waves and tides

  20. Arctic and Antarctic polar mesosphere summer echoes observed with oblique incidence HF radars: analysis using simultaneous MF and VHF radar data

    Directory of Open Access Journals (Sweden)

    T. Ogawa

    2004-12-01

    Full Text Available Polar mesosphere summer echoes (PMSEs have been well studied using vertical incidence VHF radars at northern high-latitudes. In this paper, two PMSE events detected with the oblique incidence SuperDARN HF radars at Hankasalmi, Finland (62.3° N and Syowa Station, Antarctica (69.0° S, are analyzed, together with simultaneous VHF and medium-frequency (MF radar data. Altitude resolutions of the HF radars in the mesosphere and the lower thermosphere are too poor to know exact PMSE altitudes. However, a comparison of Doppler velocity from the HF radar and neutral wind velocity from the MF radar shows that PMSEs at the HF band appeared at altitudes within 80-90km, which are consistent with those from previous vertical incidence HF-VHF radar results. The HF-VHF PMSE occurrences exhibit a semidiurnal behavior, as observed by other researchers. It is found that in one event, PMSEs occurred when westward semidiurnal winds with large amplitude at 85-88km altitudes attained a maximum. When the HF-VHF PMSEs were observed at distances beyond 180km from MF radar sites, the MF radars detected no appreciable signatures of echo enhancement.

    Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; thermospheric dynamics; waves and tides

  1. Effect of solar and magnetic activity on VHF scintillations near the equatorial anomaly crest

    Directory of Open Access Journals (Sweden)

    R. P. Singh

    2004-09-01

    Full Text Available The VHF amplitude scintillation recorded during the period January 1991 to December 1993 in the declining phase of a solar cycle and April 1998 to December 1999 in the ascending phase of the next solar cycle at Varanasi (geogr. lat.=25.3°, long.=83.0°, dip=37°N have been analyzed to study the behavior of ionospheric irregularities during active solar periods and magnetic storms. It is shown that irregularities occur at arbitrary times and may last for <30min. A rise in solar activity increases scintillations during winter (November-February and near equinoxes (March-April; September-October, whereas it depresses the scintillations during the summer (May-July. In general, the role of magnetic activity is to suppress scintillations in the pre-midnight period and to increase it in the post-midnight period during equinox and winter seasons, whilst during summer months the effect is reversed. The pre-midnight scintillation is sometimes observed when the main phase of Dst corresponds to the pre-midnight period. The annual variation shows suppression of scintillations on disturbed days, both during pre-midnight and post-midnight period, which becomes more effective during years of high solar activity. It is observed that for magnetic storms for which the recovery phase starts post-midnight, the probability of occurrence of irregularities is enhanced during this time. If the magnetic storm occurred during daytime, then the probability of occurrence of scintillations during the night hours is decreased. The penetration of magnetospheric electric fields to the magnetic equator affects the evolution of low-latitude irregularities. A delayed disturbance dynamo electric field also affects the development of irregularities.

  2. Simulation of Controller Pilot Data Link Communications over VHF Digital Link Mode 3

    Science.gov (United States)

    Bretmersky, Steven C.; Murawski, Robert; Nguyen, Thanh C.; Raghavan, Rajesh S.

    2004-01-01

    The Federal Aviation Administration (FAA) has established an operational plan for the future Air Traffic Management (ATM) system, in which the Controller Pilot Data Link Communications (CPDLC) is envisioned to evolve into digital messaging that will take on an ever increasing role in controller to pilot communications, significantly changing the way the National Airspace System (NAS) is operating. According to FAA, CPDLC represents the first phase of the transition from the current analog voice system to an International Civil Aviation Organization (ICAO) compliant system in which digital communication becomes the alternate and perhaps primary method of routine communication. The CPDLC application is an Air Traffic Service (ATS) application in which pilots and controllers exchange messages via an addressed data link. CPDLC includes a set of clearance, information, and request message elements that correspond to existing phraseology employed by current Air Traffic Control (ATC) procedures. These message elements encompass altitude assignments, crossing constraints, lateral deviations, route changes and clearances, speed assignments, radio frequency assignments, and various requests for information. The pilot is provided with the capability to respond to messages, to request clearances and information, to report information, and to declare/rescind an emergency. A 'free text' capability is also provided to exchange information not conforming to defined formats. This paper presents simulated results of the aeronautical telecommunication application Controller Pilot Data Link Communications over VHF Digital Link Mode 3 (VDL Mode 3). The objective of this simulation study was to determine the impact of CPDLC traffic loads, in terms of timely message delivery and capacity of the VDL Mode 3 subnetwork. The traffic model is based on and is used for generating air/ground messages with different priorities. Communication is modeled for the en route domain of the Cleveland

  3. Seasonal and diurnal changes in wind variability from Flatland VHF profiler observations

    Energy Technology Data Exchange (ETDEWEB)

    Nastrom, G.D. [Saint Cloud State Univ., MN (United States). Dept. of Earth Sci.; Clark, W.L. [National Oceanic and Atmospheric Administration, Boulder, CO (United States). Aeronomy Lab.; Zandt, T.E. van [National Oceanic and Atmospheric Administration, Boulder, CO (United States). Aeronomy Lab.; Warnock, J.M. [National Oceanic and Atmospheric Administration, Boulder, CO (United States). Aeronomy Lab.

    1996-02-01

    Climatological results are presented on the hourly variance of the wind observed in the mid-troposphere (3 to 9 km MSL). This quantity roughly indicates the energy in the atmospheric wind field for variations with periods roughly less than 1 hour. Observations are from the Flatland VHF research wind profiler, located near Champaign/Urbana, Illinois, well away from significant orographic features. The period of record covers two years, September 1990 through August 1992. The values of the variance of the winds along vertical and oblique (15 degrees from zenith in the cardinal directions) beams are presented versus height, season, time-of-day, and beam pointing direction. It is found that the hourly variance values have approximately lognormal frequency distribution. The mean hourly variance is significantly larger for the oblique wind observations than for the vertical. Mean wind variances also tend to be larger in the east/west steering plane than in the north/south plane. The mean variance generally increases with height, but faster than would be expected if it were due solely to the decrease in atmospheric density, implying the presence of local source/sinks of wind energy. The rate of change with height is noticeably different for the vertical and oblique beams, being much less for the vertical beam, in some seasons even decreasing with height. With respect to season, the mean hourly variance is smallest in the summer and largest in the winter. With respect to diurnal changes, the variance is maximum during the afternoon for spring, summer, and autumn, with the maximum up to a factor of two larger than the minimum. In winter, the diurnal change is much smaller, with little indication of an afternoon maximum. (orig.)

  4. VHF radar observations of turbulent structures in the polar mesopause region

    Directory of Open Access Journals (Sweden)

    P. Czechowsky

    Full Text Available The mobile SOUSY VHF Radar was operated in the summer of 1987 during the MAC/SINE campaign in northern Norway to study the polar mesosphere summer echoes (PMSE. Measurements of the spectral width indicate that two types of structures occur. In general mesospheric layers are bifurcated exhibiting a narrow spectral width and a well-defined aspect sensitivity. However, for about 10% of the observation time cells of enhanced turbulence characterized by extremely broad spectral widths appear predominantly in the upper sublayer above 86 km. Identification and separation of beam and shear broadening allows a determination of the turbulence-induced component of the spectral width. This case study reveals that during several events these cloud-like structures of enhanced turbulence move with an apparent velocity of several tens of meters per second which is almost identical with the phase trace velocity of simultaneously observed waves. Since, at that time, the Richardson number was less than a quarter, it was concluded that these turbulent cells were generated by a Kelvin-Helmholtz mechanism. The horizontal extent of these structures was calculated to be less than 40 km. A general relation between spectral width and echo power was not detected. The turbulent component of the spectral width was used to calculate typical values of the energy dissipation rate at times where narrow spectral width dominates and during periods of enhanced turbulence. In addition, the outer scale of the inertial subrange (buoyancy scale was estimated. For the first time the occurrence and motion of this type of structures of enhanced spectral width is analyzed and discussed in detail.

  5. VHF radar observations of turbulent structures in the polar mesopause region

    Directory of Open Access Journals (Sweden)

    P. Czechowsky

    1997-08-01

    Full Text Available The mobile SOUSY VHF Radar was operated in the summer of 1987 during the MAC/SINE campaign in northern Norway to study the polar mesosphere summer echoes (PMSE. Measurements of the spectral width indicate that two types of structures occur. In general mesospheric layers are bifurcated exhibiting a narrow spectral width and a well-defined aspect sensitivity. However, for about 10% of the observation time cells of enhanced turbulence characterized by extremely broad spectral widths appear predominantly in the upper sublayer above 86 km. Identification and separation of beam and shear broadening allows a determination of the turbulence-induced component of the spectral width. This case study reveals that during several events these cloud-like structures of enhanced turbulence move with an apparent velocity of several tens of meters per second which is almost identical with the phase trace velocity of simultaneously observed waves. Since, at that time, the Richardson number was less than a quarter, it was concluded that these turbulent cells were generated by a Kelvin-Helmholtz mechanism. The horizontal extent of these structures was calculated to be less than 40 km. A general relation between spectral width and echo power was not detected. The turbulent component of the spectral width was used to calculate typical values of the energy dissipation rate at times where narrow spectral width dominates and during periods of enhanced turbulence. In addition, the outer scale of the inertial subrange (buoyancy scale was estimated. For the first time the occurrence and motion of this type of structures of enhanced spectral width is analyzed and discussed in detail.

  6. The relationship between VHF radar auroral backscatter amplitude and Doppler velocity: a statistical study

    Directory of Open Access Journals (Sweden)

    B. A. Shand

    1996-08-01

    Full Text Available A statistical investigation of the relationship between VHF radar auroral backscatter intensity and Doppler velocity has been undertaken with data collected from 8 years operation of the Wick site of the Sweden And Britain Radar-auroral Experiment (SABRE. The results indicate three different regimes within the statistical data set; firstly, for Doppler velocities <200 m s–1, the backscatter intensity (measured in decibels remains relatively constant. Secondly, a linear relationship is observed between the backscatter intensity (in decibels and Doppler velocity for velocities between 200 m s–1 and 700 m s–1. At velocities greater than 700 m s–1 the backscatter intensity saturates at a maximum value as the Doppler velocity increases. There are three possible geophysical mechanisms for the saturation in the backscatter intensity at high phase speeds: a saturation in the irregularity turbulence level, a maximisation of the scattering volume, and a modification of the local ambient electron density. There is also a difference in the dependence of the backscatter intensity on Doppler velocity for the flow towards and away from the radar. The results for flow towards the radar exhibit a consistent relationship between backscatter intensity and measured velocities throughout the solar cycle. For flow away from the radar, however, the relationship between backscatter intensity and Doppler velocity varies during the solar cycle. The geometry of the SABRE system ensures that flow towards the radar is predominantly associated with the eastward electrojet, and flow away is associated with the westward electrojet. The difference in the backscatter intensity variation as a function of Doppler velocity is attributed to asymmetries between the eastward and westward electrojets and the geophysical parameters controlling the backscatter amplitude.

  7. Statistics of 150-km echoes over Jicamarca based on low-power VHF observations

    Directory of Open Access Journals (Sweden)

    J. L. Chau

    2006-07-01

    Full Text Available In this work we summarize the statistics of the so-called 150-km echoes obtained with a low-power VHF radar operation at the Jicamarca Radio Observatory (11.97 S, 76.87 W, and 1.3 dip angle at 150-km altitude in Peru. Our results are based on almost four years of observations between August 2001 and July 2005 (approximately 150 days per year. The majority of the observations have been conducted between 08:00 and 17:00 LT. We present the statistics of occurrence of the echoes for each of the four seasons as a function of time of day and altitude. The occurrence frequency of the echoes is ~75% around noon and start decreasing after 15:00 LT and disappear after 17:00 LT in all seasons. As shown in previous campaign observations, the 150-echoes appear at a higher altitude (>150 km in narrow layers in the morning, reaching lower altitudes (~135 km around noon, and disappear at higher altitudes (>150 km after 17:00 LT. We show that although 150-km echoes are observed all year long, they exhibit a clear seasonal variability on altitudinal coverage and the percentage of occurrence around noon and early in the morning. We also show that there is a strong day-to-day variability, and no correlation with magnetic activity. Although our results do not solve the 150-km riddle, they should be taken into account when a reasonable theory is proposed.

  8. The relationship between VHF radar auroral backscatter amplitude and Doppler velocity: a statistical study

    Directory of Open Access Journals (Sweden)

    B. A. Shand

    Full Text Available A statistical investigation of the relationship between VHF radar auroral backscatter intensity and Doppler velocity has been undertaken with data collected from 8 years operation of the Wick site of the Sweden And Britain Radar-auroral Experiment (SABRE. The results indicate three different regimes within the statistical data set; firstly, for Doppler velocities <200 m s–1, the backscatter intensity (measured in decibels remains relatively constant. Secondly, a linear relationship is observed between the backscatter intensity (in decibels and Doppler velocity for velocities between 200 m s–1 and 700 m s–1. At velocities greater than 700 m s–1 the backscatter intensity saturates at a maximum value as the Doppler velocity increases. There are three possible geophysical mechanisms for the saturation in the backscatter intensity at high phase speeds: a saturation in the irregularity turbulence level, a maximisation of the scattering volume, and a modification of the local ambient electron density. There is also a difference in the dependence of the backscatter intensity on Doppler velocity for the flow towards and away from the radar. The results for flow towards the radar exhibit a consistent relationship between backscatter intensity and measured velocities throughout the solar cycle. For flow away from the radar, however, the relationship between backscatter intensity and Doppler velocity varies during the solar cycle. The geometry of the SABRE system ensures that flow towards the radar is predominantly associated with the eastward electrojet, and flow away is associated with the westward electrojet. The difference in the backscatter intensity variation as a function of Doppler velocity is attributed to asymmetries between the eastward and westward electrojets and the geophysical parameters controlling the backscatter amplitude.

  9. Cut-off low monitoring by the French VHF-ST-radar network during the ESTIME campaign

    Science.gov (United States)

    Caccia, J.-L.; Bertin, F.; Campistron, B.; Klaus, V.; Pointin, Y.; van Baelen, J.; Wilson, R.

    2000-05-01

    In order to investigate mesoscale strato-tropospheric exchanges, the field campaign `Echanges Stratosphère-Troposphère: Investigations à Moyenne Echelle' was conducted in France from late 1993 to mid 1995 and focused on cut-off low events. It involved the French research network of five VHF (Very High Frequency) ST (Strato-Tropospheric) radars deployed in southern France. Observations corresponding to three Intensive Observing Periods are reported here. The radar data analyzed and discussed are time-height diagrams of the aspect ratio (AR), that is, the vertical to oblique beam-returned power ratio, used for monitoring three cut-off low events. In order to discuss the validity of the method, 506 h of radar AR data were compared with time-height diagrams of the static stability and the humidity obtained from synoptic European Center for Medium-range Weather Forecasts model analyses. A dataset corresponding to 297 h of observations is analyzed and discussed here. It is concluded that the AR is a good tracer to document cut-off low events, including tropopause folding identification and the detection of tropospheric air masses of enhanced stability, in dry or weakly humid cases. On the other hand, although the effects of the specific humidity and its gradients on VHF radar echo power could not be extensively investigated, our results suggest that the same parameter cannot be used at mid- and lower-tropospheric levels when the effects of specific humidity significantly reinforce the moist static stability. It is important to take into account these insights in the context of future observing campaigns in which a network of VHF-ST-radars will be involved, and where their role will be to observe and to document the evolution of upper-level features or potential vorticity streamers, or more generally stratospheric-tropospheric exchanges.

  10. Electronic warfare receivers and receiving systems

    CERN Document Server

    Poisel, Richard A

    2014-01-01

    Receivers systems are considered the core of electronic warfare (EW) intercept systems. Without them, the fundamental purpose of such systems is null and void. This book considers the major elements that make up receiver systems and the receivers that go in them.This resource provides system design engineers with techniques for design and development of EW receivers for modern modulations (spread spectrum) in addition to receivers for older, common modulation formats. Each major module in these receivers is considered in detail. Design information is included as well as performance tradeoffs o

  11. Radar efficiency and the calculation of decade-long PMSE backscatter cross-section for the Resolute Bay VHF radar

    Directory of Open Access Journals (Sweden)

    N. Swarnalingam

    2009-04-01

    Full Text Available The Resolute Bay VHF radar, located in Nunavut, Canada (75.0° N, 95.0° W and operating at 51.5 MHz, has been used to investigate Polar Mesosphere Summer Echoes (PMSE since 1997. PMSE are a unique form of strong coherent radar echoes, and their understanding has been a challenge to the scientific community since their discovery more than three decades ago. While other high latitude radars have recorded strong levels of PMSE activities, the Resolute Bay radar has observed relatively lower levels of PMSE strengths. In order to derive absolute measurements of PMSE strength at this site, a technique is developed to determine the radar efficiency using cosmic (sky noise variations along with the help of a calibrated noise source. VHF radars are only rarely calibrated, but determination of efficiency is even less common. Here we emphasize the importance of efficiency for determination of cross-section measurements. The significant advantage of this method is that it can be directly applied to any MST radar system anywhere in the world as long as the sky noise variations are known. The radar efficiencies for two on-site radars at Resolute Bay are determined. PMSE backscatter cross-section is estimated, and decade-long PMSE strength variations at this location are investigated. It was noticed that the median of the backscatter cross-section distribution remains relatively unchanged, but over the years a great level of variability occurs in the high power tail of the distribution.

  12. Meteoroid Fragmentation as Revealed in Head- and Trail-Echoes Observed with the Arecibo UHF and VHF Radars

    Science.gov (United States)

    Mathews, J. D.; Malhorta, A.

    2011-01-01

    We report recent 46.8/430 MHz (VHF/UHF) radar meteor observations at Arecibo Observatory (AO) that reveal many previously unreported features in the radar meteor return - including flare-trails at both UHF and VHF - that are consistent with meteoroid fragmentation. Signature features of fragmentation include strong intra-pulse and pulse-to-pulse fading as the result of interference between or among multiple meteor head-echo returns and between head-echo and impulsive flare or "point" trail-echoes. That strong interference fading occurs implies that these scatterers exhibit well defined phase centers and are thus small compared with the wavelength. These results are consistent with and offer advances beyond a long history of optical and radar meteoroid fragmentation studies. Further, at AO, fragmenting and flare events are found to be a large fraction of the total events even though these meteoroids are likely the smallest observed by the major radars. Fragmentation is found to be a major though not dominate component of the meteors observed at other HPLA radars that are sensitive to larger meteoroids.

  13. High-Rate Fabrication of a-Si-Based Thin-Film Solar Cells Using Large-Area VHF PECVD Processes

    Energy Technology Data Exchange (ETDEWEB)

    Deng, Xunming [University of Toledo; Fan, Qi Hua

    2011-12-31

    The University of Toledo (UT), working in concert with it’s a-Si-based PV industry partner Xunlight Corporation (Xunlight), has conducted a comprehensive study to develop a large-area (3ft x 3ft) VHF PECVD system for high rate uniform fabrication of silicon absorber layers, and the large-area VHF PECVD processes to achieve high performance a-Si/a-SiGe or a-Si/nc-Si tandem junction solar cells during the period of July 1, 2008 to Dec. 31, 2011, under DOE Award No. DE-FG36-08GO18073. The project had two primary goals: (i) to develop and improve a large area (3 ft × 3 ft) VHF PECVD system for high rate fabrication of > = 8 Å/s a-Si and >= 20 Å/s nc-Si or 4 Å/s a-SiGe absorber layers with high uniformity in film thicknesses and in material structures. (ii) to develop and optimize the large-area VHF PECVD processes to achieve high-performance a-Si/nc-Si or a-Si/a-SiGe tandem-junction solar cells with >= 10% stable efficiency. Our work has met the goals and is summarized in “Accomplishments versus goals and objectives”.

  14. A Low Power RC-Coupled VHF Amplifier Designed for Fabrication by Hybrid Microcircuit Techniques.

    Science.gov (United States)

    RADIOFREQUENCY AMPLIFIERS, HYBRID CIRCUITS, MICROMINIATURIZATION , VERY HIGH FREQUENCY, MODULES(ELECTRONICS), TRANSISTOR AMPLIFIERS, RADIO RECEIVERS, COMMUNICATION EQUIPMENT, SATELLITE COMMUNICATIONS.

  15. Cryocooled wideband digital channelizing radio-frequency receiver based on low-pass ADC

    Energy Technology Data Exchange (ETDEWEB)

    Vernik, Igor V; Kirichenko, Dmitri E; Dotsenko, Vladimir V; Miller, Robert; Webber, Robert J; Shevchenko, Pavel; Talalaevskii, Andrei; Gupta, Deepnarayan; Mukhanov, Oleg A [HYPRES, Inc., 175 Clearbrook Road, Elmsford, NY 10523 (United States)

    2007-11-15

    We have demonstrated a digital receiver performing direct digitization of radio-frequency signals over a wide frequency range from kilohertz to gigahertz. The complete system, consisting of a cryopackaged superconductor all-digital receiver (ADR) chip followed by room-temperature interface electronics and a field programmable gate array (FPGA) based post-processing module, has been developed. The ADR chip comprises a low-pass analog-to-digital converter (ADC) delta modulator with phase modulation-demodulation architecture together with digital in-phase and quadrature mixer and a pair of digital decimation filters. The chip is fabricated using a 4.5 kA cm{sup -2} process and is cryopackaged using a commercial-off-the-shelf cryocooler. Experimental results in HF, VHF, UHF and L bands and their analysis, proving consistent operation of the cryopackaged ADR chip up to 24.32 GHz clock frequency, are presented and discussed.

  16. Solar heat receiver

    Science.gov (United States)

    Hunt, Arlon J.; Hansen, Leif J.; Evans, David B.

    1985-01-01

    A receiver for converting solar energy to heat a gas to temperatures from 700.degree.-900.degree. C. The receiver is formed to minimize impingement of radiation on the walls and to provide maximum heating at and near the entry of the gas exit. Also, the receiver is formed to provide controlled movement of the gas to be heated to minimize wall temperatures. The receiver is designed for use with gas containing fine heat absorbing particles, such as carbon particles.

  17. A flexible WLAN receiver

    NARCIS (Netherlands)

    Schiphorst, Roelof; Hoeksema, F.W.; Slump, Cornelis H.

    2003-01-01

    Flexible radio receivers are also called Software Defined Radios (SDRs) [1], [2]. The focus of our SDR project [3] is on designing the front end, from antenna to demodulation in bits, of a °exible, multi-standard WLAN receiver. We try to combine an instance of a (G)FSK receiver (Bluetooth) with an

  18. The Epi Info Viral Hemorrhagic Fever (VHF) Application: A Resource for Outbreak Data Management and Contact Tracing in the 2014-2016 West Africa Ebola Epidemic.

    Science.gov (United States)

    Schafer, Ilana J; Knudsen, Erik; McNamara, Lucy A; Agnihotri, Sachin; Rollin, Pierre E; Islam, Asad

    2016-10-15

    The Epi Info Viral Hemorrhagic Fever application (Epi Info VHF) was developed in response to challenges managing outbreak data during four 2012 filovirus outbreaks. Development goals included combining case and contact data in a relational database, facilitating data-driven contact tracing, and improving outbreak data consistency and use. The application was first deployed in Guinea, when the West Africa Ebola epidemic was detected, in March 2014, and has been used in 7 African countries and 2 US states. Epi Info VHF enabled reporting of compatible data from multiple countries, contributing to international Ebola knowledge. However, challenges were encountered in accommodating the epidemic's unexpectedly large magnitude, addressing country-specific needs within 1 software product, and using the application in settings with limited Internet access and information technology support. Use of Epi Info VHF in the West Africa Ebola epidemic highlighted the fundamental importance of good data management for effective outbreak response, regardless of the software used. Published by Oxford University Press for the Infectious Diseases Society of America 2016. This work is written by (a) US Government employee(s) and is in the public domain in the US.

  19. Statistical characteristics of low-latitude ionospheric field-aligned irregularities obtained with the Piura VHF radar

    Directory of Open Access Journals (Sweden)

    J. L. Chau

    2002-08-01

    Full Text Available We present a summary of the statistical characteristics of echoes from ionospheric (E- and F-region field-aligned irregularities obtained with the Piura VHF radar. This radar is located at ~ 7.0° dip latitude, just outside the equatorial electrojet (EEJ region. Our results are based on (1 intermittent observations made between 1991 and 1999 just few days a year, and (2 continuous observations made between January 2000 and June 2001. During most of the intermittent observations, simultaneous measurements of EEJ and equatorial spread F (ESF irregularities were performed with the Jicamarca VHF radar. From the continuous measurements, we have obtained the diurnal and seasonal characteristics of a variety of parameters (percentage of occurrence, signal-to-noise ratio and/or Doppler velocities from the lower and upper E-region irregularities and also from F-region irregularities over Piura. For example, we have found that (1 the E-region echoes are stronger and occur more frequently during local summer (i.e. between December and March; (2 between May and June, the E-region echoes are weaker and occur less frequently; moreover, during these months, a semidiurnal wave with large amplitudes is observed in the meridional wind (> 100 ms- 1; (3 there is vertical wavelength of about 20 km in the Doppler velocity, particularly after midnight; (4 the lower (upper E-region Doppler velocities are influenced mainly by meridional winds (equatorial F-region vertical drifts. In addition, we have observed that the seasonal and daily occurrences of Piura F-region irregularities are similar to the occurrence of topside ESF irregularities over Jicamarca. The likelihood of occurrence of F-region irregularities over Piura and, therefore, topside ESF over Jicamarca is greater when there are no E-region irregularities over Piura. On the other hand, there is more probability of observing bottomtype/bottomside ESF irregularities over Jicamarca when E-region irregularities

  20. PMSE observations with the EISCAT VHF- and UHF-radars: Ice particles and their effect on ambient electron densities

    Science.gov (United States)

    Li, Qiang; Rapp, Markus

    2013-11-01

    It is now well understood that the occurrence of PMSE is closely connected to the presence of ice particles. These ice particles modify the ambient electron density by electron attachment which occasionally leads to large electron density depletions which have also been called ‘biteouts’. There has been some debate in the literature regarding the relative depth of such depletions which is usually expressed by the parameter Λ=|ZA|NA/ne. Here, |ZA|NA is the charge number density of ice particles and ne is the electron density. In this paper, we present, for the first time, the statistical distribution of Λ using measurements with the EISCAT VHF- and UHF-radars. Based on 25 h of simultaneous observations, we derived a total of 757 Λ values based on 15 min of data each. In each of these cases, PMSE were observed with the EISCAT VHF-radar but not with the UHF-radar and the UHF-measurement were hence used to determine the electron density profile. From these 757 cases, there are 699 cases with Λ⪡1, and only 33 cases with Λ>0.5 (21 cases with Λ>1). A correlation analysis of Λ versus PMSE volume reflectivities further reveals that there is no strong dependence between the two parameters. This is in accordance with current PMSE-theory based on turbulence in combination with a large Schmidt-number. The maxima of Λ from each profile show a negative relationship with the undisturbed electron densities deduced at the same altitudes. This reveals that the variability of Λ mainly depends on the variability of the electron densities. In addition, variations of aerosol number densities may also play a role. Although part of the observations were conducted during the HF heating experiments, the so-called overshoot effects did not significantly bias our statistical results. In order to avoid missing biteouts because of a superposition of coherent and incoherent scatter in the UHF-data, we finally calculated spectral parameters n by applying a simple fit to auto

  1. Low complexity MIMO receivers

    CERN Document Server

    Bai, Lin; Yu, Quan

    2014-01-01

    Multiple-input multiple-output (MIMO) systems can increase the spectral efficiency in wireless communications. However, the interference becomes the major drawback that leads to high computational complexity at both transmitter and receiver. In particular, the complexity of MIMO receivers can be prohibitively high. As an efficient mathematical tool to devise low complexity approaches that mitigate the interference in MIMO systems, lattice reduction (LR) has been widely studied and employed over the last decade. The co-authors of this book are world's leading experts on MIMO receivers, and here they share the key findings of their research over years. They detail a range of key techniques for receiver design as multiple transmitted and received signals are available. The authors first introduce the principle of signal detection and the LR in mathematical aspects. They then move on to discuss the use of LR in low complexity MIMO receiver design with respect to different aspects, including uncoded MIMO detection...

  2. Auxiliary VHF transmitter to aid recovery of solar Argos/GPS PTTs

    Science.gov (United States)

    Christopher P. Hansen; Mark A. Rumble; R. Scott Gamo; Joshua J. Millspaugh

    2014-01-01

    While conducting greater sage-grouse (Centrocercus urophasianus) research, we found that solar-powered global positioning systems platform transmitter terminals (GPS PTTs) can be lost if the solar panel does not receive adequate sunlight. Thus, we developed 5-g (mortality sensor included; Prototype A) and 9.8-g (no mortality sensor; Prototype B) auxiliary very high...

  3. Delphi Accounts Receivable Module -

    Data.gov (United States)

    Department of Transportation — Delphi accounts receivable module contains the following data elements, but are not limited to customer information, cash receipts, line of accounting details, bill...

  4. Comparison of wind measurements in the troposphere and mesosphere by VHF/MF radars and in-situ techniques

    Directory of Open Access Journals (Sweden)

    N. Engler

    2008-11-01

    Full Text Available Radar wind observations at frequencies between 1.98 and 53.5 MHz obtained at polar latitudes were compared to in-situ wind measurements by radiosondes at tropospheric altitudes and to winds from falling spheres at mesospheric altitudes. Comparisons are shown for several campaigns of radiosonde and falling sphere observations. The radar wind directions agree well to the radiosonde and falling sphere observations and are highly correlated. The winds estimated from radar measurements are less than the radiosonde data by about 15% for spaced antenna observations and by about 10% for the Doppler beam swinging experiment. At mesospheric altitudes the spaced antenna winds obtained from the wide-beam Andenes MF radar are underestimated in the order of 35% and winds from the narrow-beam Saura MF radar are underestimated by about 20% compared to falling sphere winds at altitudes between 70 and 80 km. Furthermore, the relation between wind measurements using narrow-beam and wide-beam antenna arrangements for the MF radars is discussed and VHF radar observations are compared to the wide-beam MF radar.

  5. Comparison of wind measurements in the troposphere and mesosphere by VHF/MF radars and in-situ techniques

    Science.gov (United States)

    Engler, N.; Singer, W.; Latteck, R.; Strelnikov, B.

    2008-11-01

    Radar wind observations at frequencies between 1.98 and 53.5 MHz obtained at polar latitudes were compared to in-situ wind measurements by radiosondes at tropospheric altitudes and to winds from falling spheres at mesospheric altitudes. Comparisons are shown for several campaigns of radiosonde and falling sphere observations. The radar wind directions agree well to the radiosonde and falling sphere observations and are highly correlated. The winds estimated from radar measurements are less than the radiosonde data by about 15% for spaced antenna observations and by about 10% for the Doppler beam swinging experiment. At mesospheric altitudes the spaced antenna winds obtained from the wide-beam Andenes MF radar are underestimated in the order of 35% and winds from the narrow-beam Saura MF radar are underestimated by about 20% compared to falling sphere winds at altitudes between 70 and 80 km. Furthermore, the relation between wind measurements using narrow-beam and wide-beam antenna arrangements for the MF radars is discussed and VHF radar observations are compared to the wide-beam MF radar.

  6. Observation of polar mesosphere summer echoes with calibrated VHF radars at 69° in the Northern and Southern hemispheres

    Science.gov (United States)

    Latteck, R.; Singer, W.; Morris, R. J.; Holdsworth, D. A.; Murphy, D. J.

    2007-07-01

    Polar Mesosphere Summer Echoes (PMSE) observed in the northern and southern hemisphere were studied using continuous measurements obtained by calibrated VHF radars located at Andenes (69.3°N) and Davis (68.6°S) during the boreal summer 2004 and the austral summer 2004/2005. The PMSE observed at Davis have a lower peak volume reflectivity of approximately 4 . 10-11 m-1 compared with their counterparts (7 . 10-10 m-1) observed at Andenes. The duration of the PMSE season is correlated with the dynamical and thermal state of the mesopause region supported by recent studies using meridional winds and temperatures. PMSE occurred less frequently but with greater variability above Davis. The diurnal variation of PMSE occurrence has a maximum around 11-16 LT in both hemispheres, and a minimum occurs during late evening with a longer duration in the southern hemisphere. The mean PMSE season at both sites started around 34 days before solstice, but the duration of the Davis PMSE season is about 9 days shorter than at Andenes. The maximum occurrence height of PMSE at Davis is 86 km which is about 1 km higher than at Andenes.

  7. Comparison of wind measurements in the troposphere and mesosphere by VHF/MF radars and in-situ techniques

    Energy Technology Data Exchange (ETDEWEB)

    Engler, N.; Singer, W.; Latteck, R.; Strelnikov, B. [Rostock Univ., Kuehlungsborn (Germany). Leibniz Inst. of Atmospheric Physics

    2008-07-01

    Radar wind observations at frequencies between 1.98 and 53.5 MHz obtained at polar latitudes were compared to in-situ wind measurements by radiosondes at tropospheric altitudes and to winds from falling spheres at mesospheric altitudes. Comparisons are shown for several campaigns of radiosonde and falling sphere observations. The radar wind directions agree well to the radiosonde and falling sphere observations and are highly correlated. The winds estimated from radar measurements are less than the radiosonde data by about 15% for spaced antenna observations and by about 10% for the Doppler beam swinging experiment. At mesospheric altitudes the spaced antenna winds obtained from the wide-beam Andenes MF radar are underestimated in the order of 35% and winds from the narrow-beam Saura MF radar are underestimated by about 20% compared to falling sphere winds at altitudes between 70 and 80 km. Furthermore, the relation between wind measurements using narrow-beam and wide-beam antenna arrangements for the MF radars is discussed and VHF radar observations are compared to the wide-beam MF radar. (orig.)

  8. Calculating the azimuth of mountain waves, using the effect of tilted fine-scale stable layers on VHF radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    1999-02-01

    Full Text Available A simple method is described, based on standard VHF wind-profiler data, where imbalances of echo power between four off-vertical radar beams, caused by mountain waves, can be used to calculate the orientation of the wave pattern. It is shown that the mountain wave azimuth (direction of the horizontal component of the wavevector, is given by the vector [ W (PE - P W ,W (PN - P S ]; PN, PS, PE, PW are radar echo powers, measured in dB, in beams pointed away from vertical by the same angle towards north, south, east and west respectively, and W is the vertical wind velocity. The method is applied to Aberystwyth MST radar data, and the calculated wave vector usually, but not always, points into the low-level wind direction. The mean vertical wind at Aberystwyth, which may also be affected by tilted aspect-sensitive layers, is investigated briefly using the entire radar output 1990-1997. The mean vertical-wind profile is inconsistent with existing theories, but a new mountain-wave interpretation is proposed.Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; waves and tides; instruments and techniques.

  9. Effect of power on growth of nanocrystalline silicon films deposited by VHF PECVD technique for solar cell applications

    Science.gov (United States)

    Juneja, Sucheta; Verma, Payal; Savelyev, Dmitry A.; Khonina, Svetlana N.; Sudhakar, S.; Kumar, Sushil

    2016-04-01

    An investigation of the effect of power on the deposition of nanocrystalline silicon thin films were carried out using a gaseous mixture of silane and hydrogen in the 60MHz assisted VHF plasma enhanced chemical vapor deposition (PECVD) technique. The power was varied from 10 to 50 watt maintaining all other parameters constant. Corresponding layer properties w.r.t. material microstructure, optical, hydrogen content and electrical transport are studied in detail. The structural properties have been studied by Raman spectroscopy and x-ray diffraction (XRD). The presence of nano-sized crystals and their morphology have been investigated using atomic force microscopy (AFM). The role of bonded hydrogen content in the films have been studied from the results of Fourier transform infrared spectroscopy. It was observed from the results that with increase in power, crystalline volume fraction increases and crystallite size changes from 4 to 9 nm. The optical band gap varies from 1.7 to 2.1eV due to quantum confinement effect and which further can be explained with reduced hydrogen content. These striking features of nc-Si films can be used to fabricate stable thin film solar cells.

  10. Case study of stratospheric gravity waves of convective origin over Arctic Scandinavia. VHF radar observations and numerical modelling

    Energy Technology Data Exchange (ETDEWEB)

    Rechou, A. [La Reunion Univ., St. Denis Messag, Ile de La Reunion (France). Lab. de l' Atmosphere et des Cyclones; Arnault, J.; Dalin, P.; Kirkwood, S. [Swedish Institute of Space Physics, Kiruna (Sweden)

    2013-03-01

    Orography is a well-known source of gravity and inertia-gravity waves in the atmosphere. Other sources, such as convection, are also known to be potentially important but the large amplitude of orographic waves over Scandinavia has generally precluded the possibility to study such other sources experimentally in this region. In order to better understand the origin of stratospheric gravity waves observed by the VHF radar ESRAD (Esrange MST radar) over Kiruna, in Arctic Sweden (67.88 N, 21.10 E), observations have been compared to simulations made using the Weather Research and Forecasting model (WRF) with and without the effects of orography and clouds. This case study concerns gravity waves observed from 00:00 UTC on 18 February to 12:00 UTC on 20 February 2007. We focus on the wave signatures in the static stability field and vertical wind deduced from the simulations and from the observations as these are the parameters which are provided by the observations with the best height coverage. As is common at this site, orographic gravity waves were produced over the Scandinavian mountains and observed by the radar. However, at the same time, southward propagation of fronts in the Barents Sea created short-period waves which propagated into the stratosphere and were transported, embedded in the cyclonic winds, over the radar site. (orig.)

  11. Digital controller for the Wave Propagation Laboratory's VHF and UHF wind-profiling radars

    Science.gov (United States)

    Moran, K.

    1984-09-01

    Principles are described for operation of a digital system that is used to control the operations of a multiple beam stratospheric-tropospheric (ST) radar system. The digital system, referred to as the radar controller, contains the digital logic for generating the necessary pulse sequences for modulation of the radar transmitter, gating the radar's receiver channels, and sequencing the antenna beams. The radar controller also performs digital-to-analog conversion and coherent averaging of the receiver necessary for signal detection in ST radars. The radar controller is controlled internally by a Z80 microprocessor, and the entire system functions as a peripheral device to a host minicomputer. Block diagrams and detailed circuit schematics for all the custom designed electronics are included.

  12. Low VHF Channel Measurements and Simulations in Indoor and Outdoor Scenarios

    Science.gov (United States)

    2015-05-01

    S11 and radiation pattern of the λ/6 antenna ......................8 Fig. 5 The USRP integrated on a PackBot mobile platform...comparison, whereas in Fig. 3a the signal is only received via an antenna. 3.1 System Hardware 3.1.1 Radio and Daughtercards We use the USRP model N210 SDR for...our tests.46 The USRP N210 provides an Ethernet interface that allows us to use software control for transmission and reception. The USRP is

  13. Solar energy receiver

    Science.gov (United States)

    Schwartz, Jacob

    1978-01-01

    An improved long-life design for solar energy receivers provides for greatly reduced thermally induced stress and permits the utilization of less expensive heat exchanger materials while maintaining receiver efficiencies in excess of 85% without undue expenditure of energy to circulate the working fluid. In one embodiment, the flow index for the receiver is first set as close as practical to a value such that the Graetz number yields the optimal heat transfer coefficient per unit of pumping energy, in this case, 6. The convective index for the receiver is then set as closely as practical to two times the flow index so as to obtain optimal efficiency per unit mass of material.

  14. Receiver Gain Modulation Circuit

    Science.gov (United States)

    Jones, Hollis; Racette, Paul; Walker, David; Gu, Dazhen

    2011-01-01

    A receiver gain modulation circuit (RGMC) was developed that modulates the power gain of the output of a radiometer receiver with a test signal. As the radiometer receiver switches between calibration noise references, the test signal is mixed with the calibrated noise and thus produces an ensemble set of measurements from which ensemble statistical analysis can be used to extract statistical information about the test signal. The RGMC is an enabling technology of the ensemble detector. As a key component for achieving ensemble detection and analysis, the RGMC has broad aeronautical and space applications. The RGMC can be used to test and develop new calibration algorithms, for example, to detect gain anomalies, and/or correct for slow drifts that affect climate-quality measurements over an accelerated time scale. A generalized approach to analyzing radiometer system designs yields a mathematical treatment of noise reference measurements in calibration algorithms. By treating the measurements from the different noise references as ensemble samples of the receiver state, i.e. receiver gain, a quantitative description of the non-stationary properties of the underlying receiver fluctuations can be derived. Excellent agreement has been obtained between model calculations and radiometric measurements. The mathematical formulation is equivalent to modulating the gain of a stable receiver with an externally generated signal and is the basis for ensemble detection and analysis (EDA). The concept of generating ensemble data sets using an ensemble detector is similar to the ensemble data sets generated as part of ensemble empirical mode decomposition (EEMD) with exception of a key distinguishing factor. EEMD adds noise to the signal under study whereas EDA mixes the signal with calibrated noise. It is mixing with calibrated noise that permits the measurement of temporal-functional variability of uncertainty in the underlying process. The RGMC permits the evaluation of EDA by

  15. VHF SoOp (Signal of Opportunity) Technology Demonstration for Soil Moisture Measurement Using Microwave Hydraulic Boom Truck Platform

    Science.gov (United States)

    Joseph, A. T.; Deshpande, M.; O'Neill, P. E.; Miles, L.

    2017-01-01

    A goal of this research is to test deployable VHF antennas for 6U Cubesat platforms to enable validation of root zone soil moisture (RZSM) estimation algorithms for signal of opportunity (SoOp) remote sensing over the 240-270 MHz frequency band. The proposed work provides a strong foundation for establishing a technology development path for maturing a global direct surface soil moisture (SM) and RZSM measurement system over a variety of land covers. Knowledge of RZSM up to a depth of 1 meter and surface SM up to a depth of 0.05 meter on a global scale, at a spatial resolution of 1-10 km through moderate-to-heavy vegetation, is critical to understanding global water resources and the vertical moisture gradient in the Earths surface layer which controls moisture interactions between the soil, vegetation, and atmosphere. Current observations of surface SM from space by L-band radiometers (1.4 GHz) and radars (1.26 GHz) are limited to measurements of surface SM up to a depth of 0.05 meter through moderate amounts of vegetation. This limitation is mainly due to the inability of L-band signals to penetrate through dense vegetation and deep into the soil column. Satellite observations of the surface moisture conditions are coupled to sophisticated models which extrapolate the surface SM into the root zone, thus providing an indirect estimate rather than a direct measurement of RZSM. To overcome this limitation, low-frequency airborne radars operating at 435 MHz and 118 MHz have been investigated, since these lower frequencies should penetrate denser vegetation and respond to conditions deeper in the soil.

  16. Spatial variability of the aspect sensitivity of VHF radar echoes in the troposphere and lower stratosphere during jet stream passages

    Directory of Open Access Journals (Sweden)

    J. G. Yoe

    Full Text Available The aspect sensitivity of SOUSY-VHF-radar oblique-beam echoes from the troposphere and lower stratosphere has been examined for a number of jet stream passages during the years 1990 - 1992. When the core of the jet is overhead or nearly so, vertical profiles of the aspect sensitivity display two notable features. First, the distinction between mainly isotropic and strongly aspect-sensitive echoes in the troposphere and the lower stratosphere, respectively, often reported for measurements made during calm conditions, does not necessarily prevail in the vicinity of the jet stream. Second, echoes obtained at altitudes near the height of the horizontal wind maximum are found to be more aspect sensitive for beams directed parallel to the horizontal flow or nearly so, than for other beam directions. It is demonstrated that time-averaged horizontal wind speeds estimated from the radar data, taking into account the reduced effective oblique-beam zenith angle resulting from aspect sensitivity, may exceed uncorrected wind speeds by as much as 10 m s-1 in these circumstances. Implications for wind profiling and for describing the backscattering process are discussed. Doppler spectral widths examined for one jet stream passage are found to be narrower in a beam aligned with the horizontal wind at heights near the wind speed maximum than corresponding widths measured in a beam projected at right angles to the jet. The narrowest spectra thus coincide with the most aspect-sensitive echoes, consistent with the hypothesis that such returns result from specular backscattering processes.

  17. Calculating the azimuth of mountain waves, using the effect of tilted fine-scale stable layers on VHF radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    Full Text Available A simple method is described, based on standard VHF wind-profiler data, where imbalances of echo power between four off-vertical radar beams, caused by mountain waves, can be used to calculate the orientation of the wave pattern. It is shown that the mountain wave azimuth (direction of the horizontal component of the wavevector, is given by the vector [ W (PE - P W ,W (PN - P S ]; PN, PS, PE, PW are radar echo powers, measured in dB, in beams pointed away from vertical by the same angle towards north, south, east and west respectively, and W is the vertical wind velocity. The method is applied to Aberystwyth MST radar data, and the calculated wave vector usually, but not always, points into the low-level wind direction. The mean vertical wind at Aberystwyth, which may also be affected by tilted aspect-sensitive layers, is investigated briefly using the entire radar output 1990-1997. The mean vertical-wind profile is inconsistent with existing theories, but a new mountain-wave interpretation is proposed.

    Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; waves and tides; instruments and techniques.

  18. Wideband CMOS receivers

    CERN Document Server

    Oliveira, Luis

    2015-01-01

    This book demonstrates how to design a wideband receiver operating in current mode, in which the noise and non-linearity are reduced, implemented in a low cost single chip, using standard CMOS technology.  The authors present a solution to remove the transimpedance amplifier (TIA) block and connect directly the mixer’s output to a passive second-order continuous-time Σ∆ analog to digital converter (ADC), which operates in current-mode. These techniques enable the reduction of area, power consumption, and cost in modern CMOS receivers.

  19. Biconical receiving antenna

    Science.gov (United States)

    Grimes, Dale M.

    1982-05-01

    The modal solution to a biconical receiving antenna with arbitrary arm angles and lengths is presented in the form of sums over special functions; sums which are exact in the sense that no electromagnetic approximations are made. The antenna load is confined within a sphere of small radius centered at the apices of the cones. The analytical formulation is presented, along with solutions for ψ very small and very large, and certain selected numerical data. The general solution permits calculation of all detailed fields near and far, both receiving and transmitting current modes on the antenna arms and caps and the power and the momentum absorbed by the antenna from an incoming plane wave. It is shown that the receiving current modes are necessary for electromagnetic momentum to be conserved during power reception. Detailed calculation of comparative receiving and transmitting admittances confirms that they are identical, as predicted by the reciprocity theorem. The radiation patterns, however, for retransmission during reception and for transmission differ.

  20. Help Seeking and Receiving.

    Science.gov (United States)

    Nadler, Arie

    Although social psychology has always had an interest in helping behavior, only recently has the full complexity of helping relations begun to be researched. Help seeking and receiving in the educational setting raise many issues regarding the use and effectiveness of the help itself. Central to all helping relations is the seeking/receiving…

  1. A meteor head echo analysis algorithm for the lower VHF band

    Directory of Open Access Journals (Sweden)

    J. Kero

    2012-04-01

    Full Text Available We have developed an automated analysis scheme for meteor head echo observations by the 46.5 MHz Middle and Upper atmosphere (MU radar near Shigaraki, Japan (34.85° N, 136.10° E. The analysis procedure computes meteoroid range, velocity and deceleration as functions of time with unprecedented accuracy and precision. This is crucial for estimations of meteoroid mass and orbital parameters as well as investigations of the meteoroid-atmosphere interaction processes. In this paper we present this analysis procedure in detail. The algorithms use a combination of single-pulse-Doppler, time-of-flight and pulse-to-pulse phase correlation measurements to determine the radial velocity to within a few tens of metres per second with 3.12 ms time resolution. Equivalently, the precision improvement is at least a factor of 20 compared to previous single-pulse measurements. Such a precision reveals that the deceleration increases significantly during the intense part of a meteoroid's ablation process in the atmosphere. From each received pulse, the target range is determined to within a few tens of meters, or the order of a few hundredths of the 900 m long range gates. This is achieved by transmitting a 13-bit Barker code oversampled by a factor of two at reception and using a novel range interpolation technique. The meteoroid velocity vector is determined from the estimated radial velocity by carefully taking the location of the meteor target and the angle from its trajectory to the radar beam into account. The latter is determined from target range and bore axis offset. We have identified and solved the signal processing issue giving rise to the peculiar signature in signal to noise ratio plots reported by Galindo et al. (2011, and show how to use the range interpolation technique to differentiate the effect of signal processing from physical processes.

  2. SISTEMA WEB DE GEOLOCALIZACIÓN Y MONITOREO DE LA TORTUGA PODOCNEMIS LEWYANA EN EL RÍO SINÚ, MEDIANTE EL USO DE ANTENAS VHF Y DISPOSITIVOS GPS

    Directory of Open Access Journals (Sweden)

    Mario Macea Anaya

    2016-03-01

    Full Text Available Este trabajo tiene como finalidad el diseño e implementación de una aplicación para el monitoreo de las Tortugas de Río Podocnemis Lewyana, utilizando las tecnologías GPS (Global Positioning System y VHF (Very High Frequency. La aplicación permite apoyar los procesos de conservación y recuperación de la especie en el Departamento de Córdoba, en las poblaciones de Caño Viejo y Cotocá Arriba del municipio Santa Cruz de Lorica, Colombia. El uso de esa herramienta está dirigido a biólogos y personas de las comunidades rurales dedicadas a conservar dicha especie. En el desarrollo del proyecto se utilizaron 18 Tortugas de Río para su monitoreo. El resultado del trabajo es la aplicación Web Podocnemis-Soft. Su funcionamiento se basa en un dispositivo GPS y VHF, ubicado en una o varias de las tortugas Podocnemis Lewyana; los dispositivos envían los datos de la ubicación de la tortuga hasta un servidor para su procesamiento y posterior visualización de la información.

  3. Relationship between propagation direction of gravity waves in OH and OI airglow images and VHF radar echo occurrence during the SEEK-2 campaign

    Directory of Open Access Journals (Sweden)

    F. Onoma

    2005-10-01

    Full Text Available We report simultaneous observations of atmospheric gravity waves (AGW in OI (557.7nm and OH airglow images and VHF radar backscatter from field-aligned irregularities (FAI in the E-region during the SEEK-2 (Sporadic-E Experiment over Kyushu 2 campaign period from 29 July to 9 August 2002. An all-sky imager was operated at Nishino-Omote (30.5 N, 130.1 E, Japan. On 14 nights, 17 AGW events were detected in OI and OH airglow images. AGW propagated mostly toward the northeast or southeast. From comparison with the E-region FAI occurrence, which is detected by a nearby VHF radar (31.57MHz, we found that AGW tended to propagate southeastward during FAI events. This result suggests that the interaction between AGW and E-region plasma plays an important role in generating FAI. Furthermore, polarization electric fields generated directly by AGW may contribute to the FAI generation.

    Keywords. Atmospheric composition and structure (Airglow and aurora, Ionosphere (Ionospheric irregularities, Mid-latitude ionosphere

  4. Pressure difference receiving ears

    DEFF Research Database (Denmark)

    Michelsen, Axel; Larsen, Ole Næsbye

    2007-01-01

    waves behave in the air spaces leading to the interior surfaces of eardrums. A linear mathematical model with well-defined inputs is used for exploring how the directionality varies with the binaural directional cues and the amplitude and phase gain of the sound pathway to the inner surface...... of such pressure difference receiving ears have been hampered by lack of suitable experimental methods. In this review, we review the methods for collecting reliable data on the binaural directional cues at the eardrums, on how the eardrum vibrations depend on the direction of sound incidence, and on how sound...

  5. Angelopoulos receives Scarf Award

    Science.gov (United States)

    Lee, Martin

    AGU's third annual F.L. Scarf Award has been awarded to Vassilis Angelopoulos for his Ph.D. thesis, “Transport Phenomena in the Earth's Plasma Sheet,” which he completed at the University of California, Los Angeles, under the supervision of Charles Kennel. As part of the award, Angelopoulos will give an invited talk on a related topic at the upcoming AGU Fall Meeting in San Francisco.The award was established to honor Fred L. Scarf, a pioneer and leader in solar-planetary research. The award is given by the Space Physics and Aeronomy (SPA) section for outstanding dissertation research that contributes directly to solar-planetary science. The major criterion for the award is the impact or potential impact of the research on the field of solar-planetary studies. The awardee receives $1000 and is invited to deliver a paper at one of the following year's AGU meetings.

  6. Anchorage Receives Record Snowfall

    Science.gov (United States)

    2002-01-01

    The forecast called for flurries, but the snow accumulated on the ground in Anchorage, Alaska, at the rate of 2 inches per hour (5 cm per hour) for much of Saturday, March 16, 2002. By the time the winter storm passed on Sunday afternoon, Anchorage had received 28.6 inches (72.6 cm) of snow, surpassing by far the previous record of 15.6 inches (39.6 cm) set on December 29, 1955. Flights were canceled and schools were closed as a result of the storm. This true-color image of Alaska was acquired by the Sea-viewing Wide Field-of-view Sensor (SeaWiFS), flying aboard the OrbView-2 satellite, on March 18. It appears another large, low-pressure system is heading toward the Anchorage region, which could bring substantially more snowfall. The low-pressure system can be identified by the characteristic spiral pattern of clouds located off Alaska's southwestern coast in this scene.

  7. CERN apprentice receives award

    CERN Multimedia

    2008-01-01

    Another CERN apprentice has received an award for the quality of his work. Stéphane Küng (centre), at the UIG ceremony last November, presided over by Geneva State Councillor Pierre-François Unger, Head of the Department of Economics and Health. Electronics technician Stéphane Küng was honoured in November by the Social Foundation of the Union Industrielle Genevoise (UIG) as one of Geneva’s eight best apprentices in the field of mechatronics. The 20-year-old Genevan obtained his Federal apprentice’s certificate (Certificat fédéral de capacité - CFC) in June 2007, achieving excellent marks in his written tests at the Centre d’Enseignement Professionnel Technique et Artisanal (CEPTA). Like more than 200 youngsters before him, Stéphane Küng spent part of his four-year sandwich course working at CERN, where he followed many practical training courses and gained valuable hands-on experience in various technical groups and labs. "It’ always very gr...

  8. An ambiguity-function-based method for analysis of Doppler decompressed radar signals applied to EISCAT measurements of oblique UHF-VHF meteor echoes

    Science.gov (United States)

    Wannberg, G.; Pellinen-Wannberg, A.; Westman, A.

    1996-05-01

    Binary phase modulation using Barker codes as the modulating sequences is often used as a pulse compression technique in incoherent scatter radar measurements of the ionospheric E region. Demodulation of the compressed signal is usually accomplished by matched filtering techniques. If the target has appreciable velocity, the resulting Doppler shift detunes the scattered signal relative to the filter, and the target response spreads over a large range interval. The paper describes the development of a new data analysis method, based on an ambiguity function description of radar total-power measurements, which uses the characteristic Doppler decompression signatures to identify, extract, and analyze high-velocity events from conventional Barker-coded power profile type incoherent scatter (IS) measurements. Data sets recorded with the European Incoherent Scatter UHF (931 MHz) and VHF (224 MHz) radars during the 1990-1991 Geminid and 1993 Perseid showers are shown to contain many events which are associated with individual meteors crossing the radar beams over a wide range of aspect angles, including a few near-radial cases. Line-of-sight velocities and effective cross sections are derived for some of the best dual radar events. The cross sections are very small and increase with decreasing wavelength, something not observed before. It is suggested that this is indicative of a scattering mechanism different from the one operating at near-normal incidence at VHF, and Rayleigh scatter from compact "balls" of plasma contained within the meteor coma is proposed as a possible candidate, in qualitative agreement with the observations. Finally, some signal-processing related aspects of the method are discussed. It is shown that most IS radars should be able to apply it to their existing programs with very little effort and without having to compromise the performance in normal E region applications. The method could therefore become a powerful tool for studies of meteor

  9. VHF and L-band scintillation characteristics over an Indian low latitude station, Waltair (17.7° N, 83.3° E

    Directory of Open Access Journals (Sweden)

    P. V. S. Rama Rao

    2005-10-01

    Full Text Available Characteristics of simultaneous VHF (244 MHz and L-band (1.5 GHz scintillations recorded at a low-latitude station, Waltair (17.7° N, 83.3° E, during the low sunspot activity year of March 2004 to March 2005, suggest that the occurrence of scintillations is mainly due to two types, namely the Plasma Bubble Induced (PBI, which maximizes during the post sunset hours of winter and equinoctial months, and the Bottom Side Sinusoidal (BSS type, which maximizes during the post-midnight hours of the summer solstice months. A detailed study on the spectral characteristics of the scintillations at both the frequencies show that the post-sunset scintillations are strong with fast fading (≈40 fad/min and are multiple in nature in scattering, giving rise to steep spectral slopes, whereas the post-midnight scintillations, which occur mostly on the VHF signal with low fading rate (≈4 fad/min, are of the BSS type, often showing typical Fresnel oscillations with reduced roll off spectral slopes, indicating that the type of irregularity resembles a thin screen structure giving rise to weak scattering. Using the onset times of several similar scintillation patches across the two satellite (FLEETSAT 73° E, INMARSAT 65° E ray paths (sub-ionospheric points are separated by 82 km, the East ward movement of the irregularity patches is found to vary from 150 to 250 m/s during the post sunset hours and decrease slowly during the post midnight hours. Further, the east-west extent of the PBI type of irregularities is found to vary from 100 to 500 km, while that of the BSS type extend up to a few thousand kilometers. Keywords. Ionosphere (Ionospheric irregularities; Auroral ionosphere; Electric fields and currents

  10. GNSS Software Receiver for UAVs

    DEFF Research Database (Denmark)

    Olesen, Daniel Madelung; Jakobsen, Jakob; von Benzon, Hans-Henrik

    2016-01-01

    This paper describes the current activities of GPS/GNSS Software receiver development at DTU Space. GNSS Software receivers have received a great deal of attention in the last two decades and numerous implementations have already been presented. DTU Space has just recently started development of ...... of our own GNSS software-receiver targeted for mini UAV applications, and we will in in this paper present our current progress and briefly discuss the benefits of Software Receivers in relation to our research interests....

  11. Low-altitude spaceborne GPS receiver for monitoring the ionosphere-magnetosphere interface region

    Science.gov (United States)

    Chiu, Y. T.; Schulz, M.; Schropp, D. R.; Rinaldi, M. A.

    The ionosphere-magnetosphere interface region (IMIR) is difficult to monitor in situ because processes occurring there have short dynamic time scales and long spatial scales. However, a system of spaceborne Global Positioning System (GPS) receivers with upward-looking antennas onboard LEO (low Earth orbit, altitude LEO and GPS orbit (altitude ~ 3 R_E). Phase and group delays between the two GPS signals transmitted through the IMIR are directly proportional to the total line-of-sight electron content, which is the remotely sensed parameter usually required for modeling. LEO spacecraft motion causes the line-of-sight to sweep through the IMIR so as to reveal information about the plasma-density structure. GPS receivers on TOPEX, the NASA/CNES ocean-monitoring satellite at altitude ~ 1430 km, have precisely this capability to monitor the IMIR. Moreover, the two-frequency VHF cross-ranging signals from GPS satellites can be used in the same manner as L-band signals to ``image'' the IMIR. We demonstrate this capability by applying our special deconvolution algorithm to some appropriate TOPEX/GPS data and thereby produce a dynamic display of density structure in the ionosphere-magnetosphere interface region.

  12. Communications receivers principles and design

    CERN Document Server

    Rohde, Ulrich L; Zahnd, Hans

    2017-01-01

    This thoroughly updated guide offers comprehensive explanations of the science behind today’s radio receivers along with practical guidance on designing, constructing, and maintaining real-world communications systems. You will explore system planning, antennas and antenna coupling, amplifiers and gain control, filters, mixers, demodulation, digital communication, and the latest software defined radio (SDR) technology. Written by a team of telecommunication experts, Communications Receivers: Principles and Design, Fourth Edition, features technical illustrations, schematic diagrams, and detailed examples. Coverage includes: • Basic radio considerations • Radio receiver characteristics • Receiver system planning • Receiver implementation considerations • RF and baseband techniques for Software-Defined Radios • Transceiver SDR considerations • Antennas and antenna coupling • Mixers • Frequency sources and control • Ancillary receiver circuits • Performance measurement

  13. Securities backed by healthcare receivables.

    Science.gov (United States)

    Pallarito, K

    1992-09-14

    Prudential Securities has placed $40 million in medium-term, taxable notes believed to be the first AAA-rated securities backed by healthcare receivables. Standard & Poor's Corp. rated the three-year notes, which were issued by NPF III, an Ohio company created to buy receivables from cash-strapped providers, and are backed by the Medicare, Medicaid and insurance receivables of 21 hospitals and healthcare providers nationwide.

  14. The variability of the occurrence of the Field Aligned Irregularities in the middle-latitude F region using the VHF radar observation at Daejon, South Korea.

    Science.gov (United States)

    Oh, S. J.; Kil, H.; Tae-yong, Y.; Kwak, Y. S.; Lee, W. K.

    2016-12-01

    The VHF radar observations at Daejeon in South Korea reveal the highly variable nature of the field-aligned irregularities (FAIs) in the middle-latitude F-region. Medium-scale travelling ionospheric disturbances (MSTIDs) are suggested as the source of FAIs, however, the occurrence climatology of the FAIs cannot be fully explained by the existence of the MSTIDs. Moreover, the occurrence climatology of the FAIs with respect to local time (pre-midnight and post-midnight) likely to have separate onset mechanisms. We investigate the role of the ionospheric disturbances(MSTIDs, Equatorial Plasma Bubbles(EPBs)) in the creation of the FAIs using the radar data at Daejon , the total electron content maps over Japan acquired during 2010-2015. and the measurements of the ion density by Swarm (2014,2015). We assess the causal linkage of the occurrence of the FAIs by examining the correlative occurrence of MSTIDs in middle latitude F-region and EPB in low latitude F-region.

  15. Giving receivables an 'outside' chance.

    Science.gov (United States)

    Slater, R M; Corti, R; Privitera, J

    1991-10-01

    Because of a greater number of patient visits and transactions, outpatient care typically involves more clerical and administrative work for less revenue than inpatient accounts. One hospital turned to outsourcing its outpatient receivables-contracting with an outside company to handle outpatient receivables. An outside company first can help an organization tackle an outpatient billing backlog and increase cash flow from outpatient accounts. Eventually, outsourcing can help an organization replace an outdated computer system and stem the tide of billing office employee attrition.

  16. Economic Galileo E5 Receiver

    Directory of Open Access Journals (Sweden)

    P. Kovar

    2012-04-01

    Full Text Available The Galileo system introduces an extremely wideband civil E5 signal for high precision navigation. The structure of the receiver for the E5 signal is complicated due to the signal complexity and the large bandwidth. It is possible to process the whole E5 signal or process separately E5a and E5b parts combining obtained results afterwards (we call here such method as piece-wise processing. The second procedure has three times worse standard deviation of the pseudorange then first one. The main goal of the paper is to present a design of an E5 receiver which we will call the economic E5 receiver (ecoE5. It is built from jointly controlled correlators for the processing of the E5a and E5b signals which are parts of the E5 signal. Control of these partial E5a and E5b correlators is realized by only one delay and one phase lock loops. The performance, i.e. the pseudorange noise and multipath errors, of the receiver equipped with the ecoE5, is only slightly worse (the standard deviation of the pseudorange noise is 10 - 20% larger than the performance of the optimal E5 receiver and it is much better than the performance of the receiver combining the piecewise (E5a and E5b measurements. The ecoE5 receiver hardware demands are about one quarter of the hardware demands of the classical E5 receiver.

  17. HIGH-EFFICIENCY INFRARED RECEIVER

    Directory of Open Access Journals (Sweden)

    A. K. Esman

    2016-01-01

    Full Text Available Recent research and development show promising use of high-performance solid-state receivers of the electromagnetic radiation. These receivers are based on the low-barrier Schottky diodes. The approach to the design of the receivers on the basis of delta-doped low-barrier Schottky diodes with beam leads without bias is especially actively developing because for uncooled receivers of the microwave radiation these diodes have virtually no competition. The purpose of this work is to improve the main parameters and characteristics that determine the practical relevance of the receivers of mid-infrared electromagnetic radiation at the operating room temperature by modifying the electrodes configuration of the diode and optimizing the distance between them. Proposed original design solution of the integrated receiver of mid-infrared radiation on the basis of the low-barrier Schottky diodes with beam leads allows to effectively adjust its main parameters and characteristics. Simulation of the electromagnetic characteristics of the proposed receiver by using the software package HFSS with the basic algorithm of a finite element method which implemented to calculate the behavior of electromagnetic fields on an arbitrary geometry with a predetermined material properties have shown that when the inner parts of the electrodes of the low-barrier Schottky diode is performed in the concentric elliptical convex-concave shape, it can be reduce the reflection losses to -57.75 dB and the standing wave ratio to 1.003 while increasing the directivity up to 23 at a wavelength of 6.09 μm. At this time, the rounded radii of the inner parts of the anode and cathode electrodes are equal 212 nm and 318 nm respectively and the gap setting between them is 106 nm. These parameters will improve the efficiency of the developed infrared optical-promising and electronic equipment for various purposes intended for work in the mid-infrared wavelength range. 

  18. UWB communication receiver feedback loop

    Science.gov (United States)

    Spiridon, Alex; Benzel, Dave; Dowla, Farid U.; Nekoogar, Faranak; Rosenbury, Erwin T.

    2007-12-04

    A novel technique and structure that maximizes the extraction of information from reference pulses for UWB-TR receivers is introduced. The scheme efficiently processes an incoming signal to suppress different types of UWB as well as non-UWB interference prior to signal detection. Such a method and system adds a feedback loop mechanism to enhance the signal-to-noise ratio of reference pulses in a conventional TR receiver. Moreover, sampling the second order statistical function such as, for example, the autocorrelation function (ACF) of the received signal and matching it to the ACF samples of the original pulses for each transmitted bit provides a more robust UWB communications method and system in the presence of channel distortions.

  19. GIVING AND RECEIVING CONSTRUCTIVE FEEDBACK

    Directory of Open Access Journals (Sweden)

    Ірина Олійник

    2015-05-01

    Full Text Available The article scrutinizes the notion of feedback applicable in classrooms where team teaching is provided. The experience of giving and receiving feedback has been a good practice in cooperation between a U.S. Peace Corps volunteer and a Ukrainian counterpart. Giving and receiving feedback is an effective means of classroom observation that provides better insight into the process of teaching a foreign language. The article discusses the stages of feedback and explicates the notion of sharing experience between two teachers working simultaneously in the same classroom. The guidelines for giving and receiving feedback have been provided as well as the most commonly used vocabulary items have been listed. It has been proved that mutual feedback leads to improving teaching methods and using various teaching styles and techniques.

  20. vhfRNAi: a web-platform for analysis of host genes involved in viral infections discovered by genome wide RNAi screens.

    Science.gov (United States)

    Thakur, Anamika; Qureshi, Abid; Kumar, Manoj

    2017-06-27

    Knockdown of host genes using high-throughput genome-wide RNA interference screens has identified numerous host factors that affect viral infections, which would be helpful in understanding host-virus interactions. We have developed a vhfRNAi web resource based on genome-wide RNAi experiments for viruses. It contains experimental details of 12 249 entries (host factors + restriction factors) for 18 viruses. Simultaneously, this resource encompasses analysis of overlapping genes, genome wide association studies, gene ontology (GO), pathogen interacting proteins, interaction networks and pathway enrichment. Using overlap analysis, it was found that Influenza A virus shared overlapping host genes with the majority of viruses including Hepatitis C virus and Dengue virus 2. In the genome wide association studies analysis, 429 diseases/traits were mapped, of which obesity-related traits were the most common. GO analysis revealed that the major categories belonged to metabolic processes, molecule transport, signal transduction, proteolysis, etc. In the pathogen interacting protein analysis, protein interaction data from different resources can be explored for further understanding of host-virus biology. By pathway enrichment analysis, a total of 8955 genes were mapped on 303 pathways with most of the hits coming from metabolic pathways. We have found 491 genes that are not essential for the host but essential for the virus and can be targeted to inhibit the virus. These may be explored as potential candidates for drug targets. The resource is freely accessible at and will be useful in understanding host-virus biology as well as identification of targets for the development of antiviral therapeutics.

  1. WHU VHF radar observations of the diurnal tide and its variability in the lower atmosphere over Chongyang (114.14° E, 29.53° N, China

    Directory of Open Access Journals (Sweden)

    C. Huang

    2015-07-01

    Full Text Available The diurnal tide (DT and its variability in the lower atmosphere over Chongyang (114.14° E, 29.53° N were studied based on the newly established Wuhan University (WHU VHF radar observations with the height intervals of 0.145 km (below 9 km and 0.58 km (above 9 km in the whole year of 2012. We find that the DT was the dominant tidal component and showed remarkable height and season variations. A prominent seasonally dependent height variability characteristic is that maximum DT amplitude usually occurs around 6 km in the winter and spring months, which might be due to the tidal wave energy concentration arising from the reflections from the strong eastward tropospheric jet around 13 km and the ground surface. Our results suggest that the background wind is a crucial cause for height variability and seasonal variability of DT. In April 2012, a notable strengthening of DT is observed. Meanwhile, the significant higher harmonics of tides, i.e., the semidiurnal, terdiurnal, and even quarterdiurnal tides, can also be observed, which has seldom been reported. Interestingly, these four tidal components displayed consistent short-term variability, implying that they were excited by the same dramatically varying tidal source. In addition, we identified two symptoms of the coupling of DT and planetary waves (PWs, which can also lead to the short-term DT variability. One is the sum and difference interactions between DT and PWs, causing the tidal amplitude short-term variability as a consequence of the energy exchange among the interacting waves. The other one is the modulation of DT by PWs, leading to that the amplitude of DT varies with the periods of the PWs.

  2. Heat flux and thermal conduction in O+ and H+ ion flows deduced from EISCAT-VHF radar observations in the high-latitude topside ionosphere

    Science.gov (United States)

    Wu, Jian; Taieb, Charley

    1994-06-01

    With two periods of EISCAT-VHF radar observations, magnetically quiet and moderately disturbed, we have calculated the H+ and O+ heat fluxes in using formulae of Wu and Taieb (1993), accounting not only for temperature gradients but also for pressure gradients, velocity gradients, and diffusion-thermal effects. They correspond to different physical processes that are calculated and compared between them. Then, the general features of the H+ and O+ ion thermal conductions are studied during the two periods of observation in the high-latitude topside ionosphere. The analysis of the two periods of measurements revealed the following trends, to be confirmed by further observations: (1) During the two periods the H+ heat flux Q2 is always upward in the altitude range from 600 km up to about 1000 km. It is larger during the quiet period than during the disturbed period. (2) The most important dominant mechanism for H+ heat flux is the diffusion-thermal effect due to the H+-O+ collision, with a correcting term due to the H+ temperature gradient. (3) The O+ heat flux is always downward in the same altitude range during the two periods of observations. The absolute value during the disturbed period is slightly larger than that during the quiet period. (4) The dominant mechanism for O+ heat flux is its temperature gradient, corrected by the coupling with the H+ ion. (5) The O+ thermal conduction is less important during the quiet period than during the disturbed period, while for the H+ thermal conduction it is the contrary. (6) The H+ thermal conduction increases with altitude below about 1000 km.

  3. Partitioning of a DRM receiver

    NARCIS (Netherlands)

    Wolkotte, P.T.; Smit, Gerardus Johannes Maria; Smit, L.T.

    In this article we present the results of partitioning the OFDM baseband processing of a DRM receiver into smaller independent processes. Furthermore, we give a short introduction into the relevant parts of the DRM standard. Based on the number of multiplications and additions we can map individual

  4. Madhu Sudan Receives Nevanlinna Prize

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 7; Issue 12. Madhu Sudan Receives Nevanlinna Prize. Meena Mahajan Priti Shankar. Research News Volume 7 Issue 12 December 2002 pp 84-90. Fulltext. Click here to view fulltext PDF. Permanent link:

  5. Books Received Information and Announcements ...

    Indian Academy of Sciences (India)

    committee receives about 120-150 problems from which it prepares a short-list of about. 30 problems taking care to see that all the areas-algebra, combinatorics, geometry and number theory - are represented. The most important single criterion for a problem to be short-listed is that it should be new and not have been ...

  6. Receiver Operating Characteristic (ROC) Analysis

    Science.gov (United States)

    Krupinski, Elizabeth A.

    2017-01-01

    Visual expertise covers a broad range of types of studies and methodologies. Many studies incorporate some measure(s) of observer performance or how well participants perform on a given task. Receiver Operating Characteristic (ROC) analysis is a method commonly used in signal detection tasks (i.e., those in which the observer must decide whether…

  7. Books Received Information and Announcements ...

    Indian Academy of Sciences (India)

    Books Received. Tradition, Science and Society. 5 Balachandra Roo. Navakarnataka. 1990, Rs.1S. A Textbook of Biology - Volume 2. P KG Nair, K P Achor, M J Hegde and 5 G Prabhu. Himalaya Publishing House. 1996, Rs.1S0. Indus Script - Its Nature and Structure. B V SUbbarayappa. New Era Publications. 1996 ...

  8. Development of a passive VHF radar system using software-defined radio for equatorial plasma instability studies

    Science.gov (United States)

    Tuysuz, B.; Urbina, J.; Lind, F. D.

    2013-07-01

    In this paper, a bistatic passive radar receiver system named "Coherent-scatter Atmospheric Passive Radar Imager (CAPRI)" is described. It is primarily designed to study the dynamics of the upper atmosphere by utilizing "transmitters of opportunity" as the RF target illuminators. CAPRI is constructed using the open source software-defined radio toolkit, GNU Radio, to meet the signal processing requirements in combination with the open source hardware, Universal Software Radio Peripheral 2, for data acquisition. The resultant system is highly flexible, and we present the details of the design as well as a performance analysis. CAPRI will be deployed in Peru, near the magnetic equator, for long-term operations in the area. FM stations near Lima, Peru, will be utilized with the targets of interest being the equatorial electrojet and the spread F. The results will then be compared to the Jicamarca Unattended Long-term investigations of the Ionosphere and Atmosphere (JULIA) radar data, and CAPRI will be used to improve the simultaneous time and spatial coverage in the region in a more cost-effective manner.

  9. Scintillation-Hardened GPS Receiver

    Science.gov (United States)

    Stephens, Donald R.

    2015-01-01

    CommLargo, Inc., has developed a scintillation-hardened Global Positioning System (GPS) receiver that improves reliability for low-orbit missions and complies with NASA's Space Telecommunications Radio System (STRS) architecture standards. A software-defined radio (SDR) implementation allows a single hardware element to function as either a conventional radio or as a GPS receiver, providing backup and redundancy for platforms such as the International Space Station (ISS) and high-value remote sensing platforms. The innovation's flexible SDR implementation reduces cost, weight, and power requirements. Scintillation hardening improves mission reliability and variability. In Phase I, CommLargo refactored an open-source GPS software package with Kalman filter-based tracking loops to improve performance during scintillation and also demonstrated improved navigation during a geomagnetic storm. In Phase II, the company generated a new field-programmable gate array (FPGA)-based GPS waveform to demonstrate on NASA's Space Communication and Navigation (SCaN) test bed.

  10. Femtosecond Photon-Counting Receiver

    Science.gov (United States)

    Krainak, Michael A.; Rambo, Timothy M.; Yang, Guangning; Lu, Wei; Numata, Kenji

    2016-01-01

    An optical correlation receiver is described that provides ultra-precise distance and/or time/pulse-width measurements even for weak (single photons) and short (femtosecond) optical signals. A new type of optical correlation receiver uses a fourth-order (intensity) interferometer to provide micron distance measurements even for weak (single photons) and short (femtosecond) optical signals. The optical correlator uses a low-noise-integrating detector that can resolve photon number. The correlation (range as a function of path delay) is calculated from the variance of the photon number of the difference of the optical signals on the two detectors. Our preliminary proof-of principle data (using a short-pulse diode laser transmitter) demonstrates tens of microns precision.

  11. Digital-data receiver synchronization

    Science.gov (United States)

    Smith, Stephen F.; Turner, Gary W.

    2005-08-02

    Digital-data receiver synchronization is provided with composite phase-frequency detectors, mutually cross-connected comparison feedback or both to provide robust reception of digital data signals. A single master clock can be used to provide frequency signals. Advantages can include fast lock-up time in moderately to severely noisy conditions, greater tolerance to noise and jitter when locked, and improved tolerance to clock asymmetries.

  12. Diversity of MMSE MIMO Receivers

    CERN Document Server

    Mehana, Ahmed Hesham

    2011-01-01

    In most MIMO systems, the family of waterfall error curves, calculated at different spectral efficiencies, are asymptotically parallel at high SNR. In other words, most MIMO systems exhibit a single diversity value for all {\\em fixed} rates. The MIMO MMSE receiver does not follow this pattern and exhibits a varying diversity in its family of error curves. This effect cannot be captured by DMT analysis, due to the fact that all fixed rates correspond to the same multiplexing gain, thus they cannot be differentiated within DMT analysis. This work analyzes this interesting behavior of the MMSE MIMO receiver and produces the MMSE MIMO diversity at each rate. The diversity of the quasi-static flat-fading MIMO channel consisting of any arbitrary number of transmit and receive antennas is fully characterized, showing that full spatial diversity is possible for all antenna configurations if and only if the rate is within a certain bound which is a function of the number of antennas. For other rate brackets, the avail...

  13. Absorption Efficiency of Receiving Antennas

    DEFF Research Database (Denmark)

    Andersen, Jørgen Bach; Frandsen, Aksel

    2005-01-01

    A receiving antenna with a matched load will always scatter some power. This paper sets an upper and a lower bound on the absorption efficiency (absorbed power over sum of absorbed and scattered powers), which lies between 0 and 100% depending on the directivities of the antenna and scatter...... patterns. It can approach 100% as closely as desired, although in practice this may not be an attractive solution. An example with a small endfire array of dipoles shows an efficiency of 93%. Several examples of small conical horn antennas are also given, and they all have absorption efficiencies less than...

  14. Broadband direct RF digitization receivers

    CERN Document Server

    Jamin, Olivier

    2014-01-01

    This book discusses the trade-offs involved in designing direct RF digitization receivers for the radio frequency and digital signal processing domains.  A system-level framework is developed, quantifying the relevant impairments of the signal processing chain, through a comprehensive system-level analysis.  Special focus is given to noise analysis (thermal noise, quantization noise, saturation noise, signal-dependent noise), broadband non-linear distortion analysis, including the impact of the sampling strategy (low-pass, band-pass), analysis of time-interleaved ADC channel mismatches, sampling clock purity and digital channel selection. The system-level framework described is applied to the design of a cable multi-channel RF direct digitization receiver. An optimum RF signal conditioning, and some algorithms (automatic gain control loop, RF front-end amplitude equalization control loop) are used to relax the requirements of a 2.7GHz 11-bit ADC. A two-chip implementation is presented, using BiCMOS and 65nm...

  15. CERN physicist receives Einstein Medal

    CERN Multimedia

    2006-01-01

    On 29 June the CERN theorist Gabriele Veneziano was awarded the prestigious Albert Einstein Medal for significant contributions to the understanding of string theory. This award is given by the Albert Einstein Society in Bern to individuals whose scientific contributions relate to the work of Einstein. Former recipients include exceptional physicists such as Murray Gell-Mann last year, but also Stephen Hawking and Victor Weisskopf. Gabriele Veneziano, a member of the integrated CERN Theory Team since 1977, led the Theory Division from 1994 to 1997 and has already received many prestigious prizes for his outstanding work, including the Enrico Fermi Prize (see CERN Courier, November 2005), the Dannie Heineman Prize for mathematical physics of the American Physical Society in 2004 (see Bulletin No. 47/2003), and the I. Ya. Pomeranchuk Prize of the Institute of Theoretical and Experimental Physics (Moscow) in 1999.

  16. Development of wide band digital receiver for atmospheric radars using COTS board based SDR

    Science.gov (United States)

    Yasodha, Polisetti; Jayaraman, Achuthan; Thriveni, A.

    2016-07-01

    Digital receiver extracts the received echo signal information, and is a potential subsystem for atmospheric radar, also referred to as wind profiling radar (WPR), which provides the vertical profiles of 3-dimensional wind vector in the atmosphere. This paper presents the development of digital receiver using COTS board based Software Defined Radio technique, which can be used for atmospheric radars. The developmental work is being carried out at National Atmospheric Research Laboratory (NARL), Gadanki. The digital receiver consists of a commercially available software defined radio (SDR) board called as universal software radio peripheral B210 (USRP B210) and a personal computer. USRP B210 operates over a wider frequency range from 70 MHz to 6 GHz and hence can be used for variety of radars like Doppler weather radars operating in S/C bands, in addition to wind profiling radars operating in VHF, UHF and L bands. Due to the flexibility and re-configurability of SDR, where the component functionalities are implemented in software, it is easy to modify the software to receive the echoes and process them as per the requirement suitable for the type of the radar intended. Hence, USRP B210 board along with the computer forms a versatile digital receiver from 70 MHz to 6 GHz. It has an inbuilt direct conversion transceiver with two transmit and two receive channels, which can be operated in fully coherent 2x2 MIMO fashion and thus it can be used as a two channel receiver. Multiple USRP B210 boards can be synchronized using the pulse per second (PPS) input provided on the board, to configure multi-channel digital receiver system. RF gain of the transceiver can be varied from 0 to 70 dB. The board can be controlled from the computer via USB 3.0 interface through USRP hardware driver (UHD), which is an open source cross platform driver. The USRP B210 board is connected to the personal computer through USB 3.0. Reference (10 MHz) clock signal from the radar master oscillator

  17. High bit rate BPSK receiver

    Science.gov (United States)

    Osorio-Marti, J. A.; Sieiro, J. J.; Lopez-Villegas, J. M.

    2005-06-01

    This work presents a simple differentially BPSK receiver front-end using a novel schema without the need of an explicit carrier recovery system. The main principle of operation is the conversion of the incoming BPSK signal into an ASK signal having the same modulation pattern. Two versions of the system have been designed. One is intended to work at the 433.92 MHz ISM band and the other at 2 GHz frequency band. Accordingly, two prototypes of the system core, the BPSK to ASK converter circuit, have been implemented and tested. First a hybrid version for the low frequency operation and, second a multi chip module (MCM) for the 2 GHz frequency band. The system performance has been evaluated using Agilent Technologies Advanced Design System (ADS) platform. The ability to jointly perform system, circuit and EM simulations and co-simulations is the main advantage of this design tool. Obtained results indicate that modulation rates up to 20 Mbits/s for the hybrid version and up to 80 Mbits/s for the MCM version can be reached.

  18. Sistema de adquisición de datos para la medición de parámetros radioeléctricos en antenas lineales en la banda de TV de VHF y UHF System of acquisition of information for measurement of radioelectric parameters in linear antennas in the band of VHF and UHF’s television

    Directory of Open Access Journals (Sweden)

    María del Pilar Celemín

    2007-06-01

    Full Text Available Este proyecto desarrolla un sistema de adquisición y procesamiento de datos para la medición y ajuste de parámetros radioeléctricos de antenas lineales en las bandas de VHF y UHF. Como señal de prueba se utilizan algunas de las señales de televisión que se encuentran en el espectro radioeléctrico, provenientes de los transmisores que radian señales de canales nacionales. El receptor implementado incluye un sintonizador comercial de televisión que toma como muestra la señal portadora de video. Esta señal es amplificada, filtrada, almacenada y acondicionada, para ser leída por el puerto serial de un computador personal y procesada empleando un programa en Visual Basic, con una interfaz gráfica que permite una interacción amigable con el usuario. Desde acá se interactúa con un microcontrolador que controla el mecanismo de posicionamiento de la antena receptora por medio de una estructura electromecánica, que le permite ejecutar movimientos en dos grados de libertad: en azimut y en elevación. Con esto se logra un sistema capaz de determinar automáticamente el apuntamiento óptimo de la antena de acuerdo al máximo nivel de recepción de señal. Así mismo, se determinan parámetros propios de la antena tales como: el patrón de radiación (tanto en el plano horizontal como vertical, la ganancia directiva de la antena, la ganancia en cada uno de los puntos que conforman el plano principal, y otros parámetros de interés para el análisis de las características reales de antenas lineales.This project develops a data acquisition and processing system for measuring and adjusting lineal-antenna radioelectric parameters in VHF and UHF. Television signals are used as test signal. They can be found in radio electric spectrum, as they come from commercial transmitters that broadcast signals of national channels. The achieved receptor includes a television commercial tuner for obtaining video signal. Later, this signal is conditioning to

  19. Ionospheric plasma by VHF waves

    Indian Academy of Sciences (India)

    ... chart recorder at Varanasi during 1991 to 1999. The amplitude fluctuations having peak to peak variations>1 dB have been con- sidered for the present analysis. At Varanasi scintillations are frequently observed during nighttime, hence only nocturnal variation of irregularities in different months and sea- sons are studied.

  20. Microwave receivers with electronic warfare applications

    CERN Document Server

    Tsui, James

    2005-01-01

    This book by the author of Digital Techniques for Wideband Receivers willbe like no other one on your book shelf as the definitive word on electronicwarfare (EW) receiver design and performance. Whether you are an EWscientist involved in the test and evaluation of EW receivers or a designerof RWR's and other EW-related receivers, Microwave Receivers withElectronic Warfare Applications is a handy reference through which you canperfect your technical art. Lucidly written, this book is a treatise on EWreceivers that is relevant to you if you are just looking for a top-levelinsight into EW receive

  1. Trough Receiver Heat Loss Testing (Presentation)

    Energy Technology Data Exchange (ETDEWEB)

    Lewandowski, A.; Feik, C.; Hansen, R.; Phillips, S.; Bingham, C.; Netter, J.; Forristal, R.; Burkholder, F.; Meglan, B.; Wolfrum, E.

    2006-02-01

    This presentation describes the design, fabrication, and qualification of an experimental capability for thermal loss testing of full-size trough receiver elements; and the testing on a variety of receivers.

  2. 21 CFR 1020.10 - Television receivers.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Television receivers. 1020.10 Section 1020.10 Food...) RADIOLOGICAL HEALTH PERFORMANCE STANDARDS FOR IONIZING RADIATION EMITTING PRODUCTS § 1020.10 Television receivers. (a) Applicability. The provisions of this section are applicable to television receivers...

  3. 49 CFR 393.88 - Television receivers.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Television receivers. 393.88 Section 393.88... NECESSARY FOR SAFE OPERATION Miscellaneous Parts and Accessories § 393.88 Television receivers. Any motor vehicle equipped with a television viewer, screen or other means of visually receiving a television...

  4. 47 CFR 32.1170 - Receivables.

    Science.gov (United States)

    2010-10-01

    ... Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES UNIFORM SYSTEM OF ACCOUNTS.... (f) Dividends received and receivable from affiliated companies accounted for on the equity method..., matured rents, and interest receivable under monthly settlements on short-term loans, advances, and open...

  5. A zero-power radio receiver.

    Energy Technology Data Exchange (ETDEWEB)

    Brocato, Robert Wesley

    2004-09-01

    This report describes both a general methodology and some specific examples of passive radio receivers. A passive radio receiver uses no direct electrical power but makes sole use of the power available in the radio spectrum. These radio receivers are suitable as low data-rate receivers or passive alerting devices for standard, high power radio receivers. Some zero-power radio architectures exhibit significant improvements in range with the addition of very low power amplifiers or signal processing electronics. These ultra-low power radios are also discussed and compared to the purely zero-power approaches.

  6. Concentrated solar power generation using solar receivers

    Science.gov (United States)

    Anderson, Bruce N.; Treece, William Dean; Brown, Dan; Bennhold, Florian; Hilgert, Christoph

    2017-08-08

    Inventive concentrated solar power systems using solar receivers, and related devices and methods, are generally described. Low pressure solar receivers are provided that function to convert solar radiation energy to thermal energy of a working fluid, e.g., a working fluid of a power generation or thermal storage system. In some embodiments, low pressure solar receivers are provided herein that are useful in conjunction with gas turbine based power generation systems.

  7. Compressive Sensing for Spread Spectrum Receivers

    DEFF Research Database (Denmark)

    Fyhn, Karsten; Jensen, Tobias Lindstrøm; Larsen, Torben

    2013-01-01

    to a decrease in the two design parameters. This paper investigates the use of Compressive Sensing (CS) in a general Code Division Multiple Access (CDMA) receiver. We show that when using spread spectrum codes in the signal domain, the CS measurement matrix may be simplified. This measurement scheme, named...... Compressive Spread Spectrum (CSS), allows for a simple, effective receiver design. Furthermore, we numerically evaluate the proposed receiver in terms of bit error rate under different signal to noise ratio conditions and compare it with other receiver structures. These numerical experiments show that though...

  8. Shipping/Receiving and Quality Control

    Data.gov (United States)

    Federal Laboratory Consortium — Shipping receiving, quality control, large and precise inspection and CMM machines. Coordinate Measuring Machines, including "scanning" probes, optical comparators,...

  9. Hybrid Microoptical WDM Receiver for PON Communication

    Directory of Open Access Journals (Sweden)

    Vitezslav Jerabek

    2012-01-01

    Full Text Available The paper presents the design, simulation and construction results of the wavelength division multiplex (WDM optical hybrid receiver module for the passive optical network (PON. The optical WDM receiver was constructed using system of three micromodules in the new circle topology. The optical micromodule contains multimode fiber pigtail 50/125 µm, VHGT filter with collimation lens and two microwave optoelectronics receiver micromodules (OE receiver micromodules. OE receiver micromodules were designed by use small signal equivalent electrical circuit model and noise model, from which the mathematically solved the transmittance function, which was used for calculation and simulation of the optimal frequency characteristics and signal to noise ratio. For determine the limit frequency of OE receiver micromodule, the transcendent equation with transmittance function was numerically solved. OE receiver micromodule was composed of decollimation lenses and microwave optoelectronics receivers with bandwidth 2,5 GHz and alternatively in SMD technology with bandwidth 1,25 GHz, using the thin layer hybrid technology. WDM receiver use radiation 1490 nm for internet and 1550 nm for digital TV signals download information.

  10. Variable velocity in solar external receivers

    Science.gov (United States)

    Rodríguez-Sánchez, M. R.; Sánchez-González, A.; Acosta-Iborra, A.; Santana, D.

    2017-06-01

    One of the major problems in solar external receivers is tube overheating, which accelerates the risk of receiver failure. It can be solved implementing receivers with high number of panels. However, it exponentially increases the pressure drop in the receiver and the parasitic power consumption of the Solar Power Tower (SPT), reducing the global efficiency of the SPT. A new concept of solar external receiver, named variable velocity receiver, is able to adapt their configuration to the different flux density distributions. A set of valves allows splitting in several independent panels those panels in which the wall temperature is over the limit. It increases the velocity of the heat transfer fluid (HTF) and its cooling capacity. This receiver does not only reduce the wall temperature of the tubes, but also simplifies the control of the heliostat field and allows to employ more efficient aiming strategies. In this study, it has been shown that variable velocity receiver presents high advantages with respect to traditional receiver. Nevertheless, more than two divisions per panels are not recommendable, due to the increment of the pressure drop over 70 bars. In the design point (12 h of the Spring Equinox), the use of a variable number of panels between 18 and 36 (two divisions per panel), in a SPT similar to Gemasolar, improves the power capacity of the SPT in 5.7%, with a pressure drop increment of 10 bars. Off-design, when the flux distribution is high and not symmetric (e.g. 10-11 h), the power generated by the variable velocity receiver is 18% higher than the generated by the traditional receiver, at these hours the pressure drop increases almost 20 bars.

  11. Directional Receiver for Biomimetic Sonar System

    Science.gov (United States)

    Guarato, Francesco; Andrews, Heather; Windmill, James F.; Jackson, Joseph; Gachagan, Anthony

    An ultrasonic localization method for a sonar system equipped with an emitter and two directional receivers and inspired by bat echolocation uses knowledge of the beam pattern of the receivers to estimate target orientation. Rousettus leschenaultii's left ear constitutes the model for the design of the optimal receiver for this sonar system and 3D printing was used to fabricate receiver structures comprising of two truncated cones with an elliptical external perimeter and a parabolic flare rate in the upper part. Measurements show one receiver has a predominant lobe in the same region and with similar attenuation values as the bat ear model. The final sonar system is to be mounted on vehicular and aerial robots which require remote control for motion and sensors for estimation of each robot's location.

  12. High dynamic, low volume GPS receiver

    Science.gov (United States)

    Hurd, W. J.

    1983-01-01

    A new GPS receiver concept and design are presented to meet the high dynamic and low volume requirements for range applications in missiles and drones. The receiver has the potential to satisfy all range requirements with one basic receiver, which has significant potential economic benefit over the alternate approach of using a family of receivers, each tailored for specific applications. The main new concept is to use approximate maximum likelihood estimates of pseudo range and range-rate, rather than tracking with carrier phase locked loops and code delay locked loops. Preliminary analysis indicates that receivers accelerating at 50 g or more can track with position errors due to acceleration of approximately 0.2 m/g, or 10 m at 50 g. Implementation is almost entirely digital to meet the low volume requirements.

  13. An SDR based AIS receiver for satellites

    DEFF Research Database (Denmark)

    Larsen, Jesper Abildgaard; Mortensen, Hans Peter; Nielsen, Jens Frederik Dalsgaard

    2011-01-01

    For a few years now, there has been a high interest in monitoring the global ship traffic from space. A few satellite, capable of listening for ship borne AIS transponders have already been launched, and soon the AAUSAT3, carrying two different types of AIS receivers will also be launched. One...... of the AIS receivers onboard AAUSAT3 is an SDR based AIS receiver. This paper serves to describe the background of the AIS system, and how the SDR based receiver has been integrated into the AAUSAT3 satellite. Amongst some of the benefits of using an SDR based receiver is, that due to its versatility, new...... detection algorithms are easily deployed, and it is easily adapted the new proposed AIS transmission channels....

  14. Fundamentals of GPS Receivers A Hardware Approach

    CERN Document Server

    Doberstein, Dan

    2012-01-01

    While much of the current literature on GPS receivers is aimed at those intimately familiar with their workings, this volume summarizes the basic principles using as little mathematics as possible, and details the necessary specifications and circuits for constructing a GPS receiver that is accurate to within 300 meters. Dedicated sections deal with the features of the GPS signal and its data stream, the details of the receiver (using a hybrid design as exemplar), and more advanced receivers and topics including time and frequency measurements. Later segments discuss the Zarlink GPS receiver chip set, as well as providing a thorough examination of the TurboRogue receiver, one of the most accurate yet made. Guiding the reader through the concepts and circuitry, from the antenna to the solution of user position, the book’s deployment of a hybrid receiver as a basis for discussion allows for extrapolation of the core ideas to more complex, and more accurate designs. Digital methods are used, but any analogue c...

  15. The Mitigation of Radio Noise from External Sources at Receiving Sites

    Science.gov (United States)

    2007-05-01

    to 30-MHz was used between the antenna and the voltmeter to prevent signals lower and higher in frequency from contaminating the results. This... conversion device caused harmful interference at the microwave frequencies used by the satellite terminal, but they did cause harmful levels of...and voltage . These short pulses (with steep rise and fall times) have spectral components that extend up into the HF and VHF frequencies and

  16. Decoding algorithm for vortex communications receiver

    Science.gov (United States)

    Kupferman, Judy; Arnon, Shlomi

    2018-01-01

    Vortex light beams can provide a tremendous alphabet for encoding information. We derive a symbol decoding algorithm for a direct detection matrix detector vortex beam receiver using Laguerre Gauss (LG) modes, and develop a mathematical model of symbol error rate (SER) for this receiver. We compare SER as a function of signal to noise ratio (SNR) for our algorithm and for the Pearson correlation algorithm. To our knowledge, this is the first comprehensive treatment of a decoding algorithm of a matrix detector for an LG receiver.

  17. Exploiting Redundancy in an OFDM SDR Receiver

    Directory of Open Access Journals (Sweden)

    Tomas Palenik

    2009-01-01

    Full Text Available Common OFDM system contains redundancy necessary to mitigate interblock interference and allows computationally effective single-tap frequency domain equalization in receiver. Assuming the system implements an outer error correcting code and channel state information is available in the receiver, we show that it is possible to understand the cyclic prefix insertion as a weak inner ECC encoding and exploit the introduced redundancy to slightly improve error performance of such a system. In this paper, an easy way to implement modification to an existing SDR OFDM receiver is presented. This modification enables the utilization of prefix redundancy, while preserving full compatibility with existing OFDM-based communication standards.

  18. GPU Acceleration of DSP for Communication Receivers.

    Science.gov (United States)

    Gunther, Jake; Gunther, Hyrum; Moon, Todd

    2017-09-01

    Graphics processing unit (GPU) implementations of signal processing algorithms can outperform CPU-based implementations. This paper describes the GPU implementation of several algorithms encountered in a wide range of high-data rate communication receivers including filters, multirate filters, numerically controlled oscillators, and multi-stage digital down converters. These structures are tested by processing the 20 MHz wide FM radio band (88-108 MHz). Two receiver structures are explored: a single channel receiver and a filter bank channelizer. Both run in real time on NVIDIA GeForce GTX 1080 graphics card.

  19. Global Positioning System receiver evaluation results

    Energy Technology Data Exchange (ETDEWEB)

    Byrne, R.H.

    1993-09-01

    A Sandia project currently uses an outdated Magnavox 6400 Global Positioning System (GPS) receiver as the core of its navigation system. The goal of this study was to analyze the performance of the current GPS receiver compared to newer, less expensive models and to make recommendations on how to improve the performance of the overall navigation system. This paper discusses the test methodology used to experimentally analyze the performance of different GPS receivers, the test results, and recommendations on how an upgrade should proceed. Appendices contain detailed information regarding the raw data, test hardware, and test software.

  20. Enlaces de datos En VHF (VDL dentro del contexto CNS/ATM para la prestación de los servicios de tránsito aéreo en Colombia

    Directory of Open Access Journals (Sweden)

    Édgar Leonardo Gómez Gómez

    2012-09-01

    Full Text Available En este artículo se analiza el protocolo de comunicaciones por enlaces de datos en VHF (VDL, el cual, junto con técnicas de posicionamiento satelital, es uno de los pilares fundamentales dentro del concepto CNS/ATM planteado por la Organización de Aviación Civil Internacional (OACI, el cual busca la implantación de nuevas tecnologías para la prestación de los servicios de tránsito aéreo en las áreas de comunicaciones, navegación y vigilancia de aeronaves a nivel mundial. Se presenta el tipo de sistemas usados actualmente por la Unidad Administrativa Especial de Aeronáutica Civil (UAEAC para la prestación de estos servicios en Colombia, y se hace un comparativo para establecer las ventajas que tiene la implantación de las nuevas tecnologías planteadas en el concepto CNS/ATM, teniendo en cuenta las condiciones particulares de terreno y de flujo de tránsito aéreo que presenta Colombia. Además, se presentan los proyectos de implementación de subredes basadas en enlaces de datos VDL más relevantes a nivel mundial, los cuales permiten obtener resultados de pruebas de funcionamiento, como un paso fundamental hacia la consolidación a nivel mundial de este tipo de tecnología.

  1. List of Nuclear Materials Licensing Actions Received

    Data.gov (United States)

    Nuclear Regulatory Commission — A catalog of all Materials Licensing Actions received for review. The catalog lists the name of the entity submitting the license application, their city and state,...

  2. Solar central receiver systems comparative economics

    Science.gov (United States)

    Eicker, P. J.

    1980-04-01

    Several major conceptual design studies of solar central receiver systems and components were completed in the last year. The results of these studies were used to compare the projected cost of electric power generation using central receiver systems with that of more conventional power generation. The cost estimate for a molten salt central receiver system is given. Levelized busbar energy cost is shown as a function of annual capacity factor indicating the fraction of the cost due to each of the subsystems. The estimated levelized busbar energy cost for a central receiver (70 to 90 mills per kilowatt hour) is compared with the levelized busbar energy cost for a new coal fired Rankine cycle plant. Sensitivities to the initial cost of coal and the delta fuel escalation are shown.

  3. Metal Mesh Filters for Terahertz Receivers Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The technical objective of this SBIR program is to develop and demonstrate metal mesh filters for use in NASA's low noise receivers for terahertz astronomy and...

  4. Collector/Receiver Characterization (Fact Sheet)

    Energy Technology Data Exchange (ETDEWEB)

    2010-08-01

    Fact sheet describing NREL CSP Program capabilities for collector/receiver characterization: determining optical efficiency, measuring heat loss, developing and testing concentrators, concentrating the sun's power, and optically characterizing CSP plants.

  5. Changes in Received Pronunciation: Diachronic Case Studies

    National Research Council Canada - National Science Library

    Martin Hinton

    2015-01-01

    This paper sets out to investigate changes and individual irregularities in the Received Pronunciation of a number of individuals over time and to compare them with the changes noted in contemporary RP in the literature...

  6. High-Rate Receiver Design Project

    Data.gov (United States)

    National Aeronautics and Space Administration — We propose an initial architectural and preliminary hardware design study for a high-rate receiver capable of decoding modulation suites specified by CCSDS 413.0-G-1...

  7. Digital Signal Processing Based Biotelemetry Receivers

    Science.gov (United States)

    Singh, Avtar; Hines, John; Somps, Chris

    1997-01-01

    This is an attempt to develop a biotelemetry receiver using digital signal processing technology and techniques. The receiver developed in this work is based on recovering signals that have been encoded using either Pulse Position Modulation (PPM) or Pulse Code Modulation (PCM) technique. A prototype has been developed using state-of-the-art digital signal processing technology. A Printed Circuit Board (PCB) is being developed based on the technique and technology described here. This board is intended to be used in the UCSF Fetal Monitoring system developed at NASA. The board is capable of handling a variety of PPM and PCM signals encoding signals such as ECG, temperature, and pressure. A signal processing program has also been developed to analyze the received ECG signal to determine heart rate. This system provides a base for using digital signal processing in biotelemetry receivers and other similar applications.

  8. Optical Coherent Receiver Enables THz Wireless Bridge

    DEFF Research Database (Denmark)

    Yu, Xianbin; Liu, Kexin; Zhang, Hangkai

    2016-01-01

    We experimentally demonstrated a 45 Gbit/s 400 GHz photonic wireless communication system enabled by an optical coherent receiver, which has a high potential in fast recovery of high data rate connections, for example, in disaster....

  9. Metal Mesh Filters for Terahertz Receivers Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The best low-noise receiver solutions for frequencies above about 800 GHz rely on either a low-noise bolometric direct detector or a hot electron bolometric mixer....

  10. High dynamic GPS receiver validation demonstration

    Science.gov (United States)

    Hurd, W. J.; Statman, J. I.; Vilnrotter, V. A.

    1985-01-01

    The Validation Demonstration establishes that the high dynamic Global Positioning System (GPS) receiver concept developed at JPL meets the dynamic tracking requirements for range instrumentation of missiles and drones. It was demonstrated that the receiver can track the pseudorange and pseudorange rate of vehicles with acceleration in excess of 100 g and jerk in excess of 100 g/s, dynamics ten times more severe than specified for conventional High Dynamic GPS receivers. These results and analytic extensions to a complete system configuration establish that all range instrumentation requirements can be met. The receiver can be implemented in the 100 cu in volume required by all missiles and drones, and is ideally suited for transdigitizer or translator applications.

  11. Rabies: What Care Will I Receive?

    Science.gov (United States)

    ... Exposure at a Softball Tournament September 9, 2006: Horse Stabled in Tennessee Tested Positive for Rabies May ... the likelihood of rabies. You should receive a tetanus shot if you have not been immunized in ...

  12. Flexible receiver adapter formal design review

    Energy Technology Data Exchange (ETDEWEB)

    Krieg, S.A.

    1995-06-13

    This memo summarizes the results of the Formal (90%) Design Review process and meetings held to evaluate the design of the Flexible Receiver Adapters, support platforms, and associated equipment. The equipment is part of the Flexible Receiver System used to remove, transport, and store long length contaminated equipment and components from both the double and single-shell underground storage tanks at the 200 area tank farms.

  13. A handbook for solar central receiver design

    Energy Technology Data Exchange (ETDEWEB)

    Falcone, P.K.

    1986-12-01

    This Handbook describes central receiver technology for solar thermal power plants. It contains a description and assessment of the major components in a central receiver system configured for utility scale production of electricity using Rankine-cycle steam turbines. It also describes procedures to size and optimize a plant and discussed examples from recent system analyses. Information concerning site selection criteria, cost estimation, construction, and operation and maintenance is also included, which should enable readers to perform design analyses for specific applications.

  14. Accounts Receivables Management: Insight and Challenges

    Directory of Open Access Journals (Sweden)

    Charles Adusei

    2017-02-01

    Full Text Available This paper studied how Zoomlion Company Limited manages its accounts receivables. Based on multiple linear regression analysis, Kendall coefficient of concordance and One sample t-test, the result shows effective credit control systems by the company. However, poor monitoring and lack of effective follow up measures were the key challenges to debt management. The paper recommend stricter adherence to the credit policy and vigorously pursued effective recovery strategies and further prescribed best practices in accounts receivables management.

  15. Digital coherent receiver technique for onboard receiver of future optical data relay system

    Science.gov (United States)

    Araki, Tomohiro

    2016-03-01

    A digital coherent receiver technique for an onboard receiver for use in a future space optical communication system is investigated. Digital coherent technologies comprising coherent detection and digital signal processing are confirmed to possibly increase the signal speed, improve the receiver sensitivity, and extend tolerance for the Doppler frequency shift. As a facet of expandability, the concept of a multichannel-rate receiver using a digital coherent technique is introduced. Experimental results using 2.5 Gbps DBPSK signal light demodulation are presented together with future issues involved in implementation. This study confirms that the digital coherent receiver has higher expandability than other detection techniques.

  16. Binomial congestion control at receivers for multicast

    Science.gov (United States)

    Zhang, Bing; Liu, Zengji; Xu, Yayan; Li, Zhen; Zhang, Shi

    2004-09-01

    A single rate multicast congestion control for streaming media applications called Binomial congestion control At Receivers for Multicast (BARM) is proposed. Combining aspects of window-based and rate-based congestion control, the protocol shifts most of the congestion control mechanisms to multicast receivers. The main features of BARM are as follows. (1) The protocol adopts binomial algorithm (k=l=0.5, α=0.28, β=0.2 for our implementation) to adjust congestion window, which not only provides TCP-friendliness but decreases abrupt rate fluctuations, making it suitable for real time streaming media multicast applications. (2) The binomial algorithm is executed at the receivers instead of at the sender; to do this, a congestion window is maintained and updated separately by each receiver. Hence the protocol not only has a better scalability but reduces the burden of the sender significantly and is suitable to Client/Server model. (3) The congestion window is converted to the expected receiving rate which is then fed back to the sender if permitted. Compared to window feedback scheme, rate feedback scheme is simpler and increases the scalability. (4) The representative approach is used to suppress the feedback implosion. Simulations results indicate that BARM shows good fairness, TCP-friendliness, smoothness, scalability, and acceptable responsiveness.

  17. Chiral Receiving Antenna With Low Backscattering Levels

    CERN Document Server

    Karilainen, Antti O

    2011-01-01

    Receiving antennas absorb power from incident waves, but they also re-radiate some power into surrounding space. If a receiving antenna is to be used as a sensor which should not disturb the object under study, it should scatter as little power as possible in the receiving direction. We propose to use a chiral element composed of two orthogonal chiral particles as a low-scattering sensor.The element can transmit and receive circular polarization in all directions with the Huygens' pattern. We derive the vector effective length for the antenna using the small dipole approximation for the chiral particles. We observe that the element does not backscatter, regardless of the polarization, when the incidence direction is normal to the plane of the particles. Scattered fields, scattered axial ratio, and the scattering cross section are presented. We show that the zero-backscattering property holds also for the antenna element when it is capable to receive all the available power with conjugate loading. The approxim...

  18. Characteristics of patients who receive electroconvulsive therapy.

    Science.gov (United States)

    Malla, A K

    1988-11-01

    Case records of all non-forensic psychiatric admissions (n = 5,729), over a three year period, to all the inpatient psychiatric facilities, within one geographic area were studied on a number of demographic, clinical, and treatment characteristics. Patients who had received E.C.T. were compared with those who did not receive tis treatment. The results showed that a high proportion (21%) had received E.C.T. In comparison with patients not receiving E.C.T., E.C.T. recipients were significantly older, more often female, had greater number of previous admissions, greater incidence of violent behaviour, and longer stays in hospital. E.C.T. patients did not differ from others on social class, education, and marital status, nor was E.C.T. prescribed more often to patients who had demonstrated suicidal behaviour, even if they had a diagnosis of depression. E.C.T. and non E.C.T. patients received an equal number of psychotropic drugs.

  19. The Communication Between Designer and Design Receiver

    DEFF Research Database (Denmark)

    Dai, Zheng; Dai, Yan

    2009-01-01

    When people think about a product,the first impression always mainly influences the result.Product is the medium of communication between designer and designer receiver.Because both of them have varied different experience and background,the information would be biased during the transferring...... process.The common symbols which can be recognized by both of designer and receiver are the key tools for communication.In some case,the same symbol in one product would be leads to different receiver impression.Generally,impression includes 3 aspects:aesthetics,function, and emotion.Designer needs...... to create an attractive and accurate impression in product from these 3 aspects.For facing the dilemma of communication,some experimental approaches can help designer deal with unique and diversity situations.Solving the detail problem in each step could keep the original meaning of designer....

  20. Windowed versus windowless solar energy cavity receivers

    Energy Technology Data Exchange (ETDEWEB)

    Jarvinen, P. O.

    1976-09-01

    A model for a windowed, high-temperature cavity receiver of the heated-air type is developed and used to evaluate the greenhouse effect as a method for obtaining high receiver operating efficiencies. The effects on receiver efficiency of varying the window cutoff wavelength, the amount of absorption in the window pass-band, the cavity operating temperature, and the number of windows are determined. Single windowed cavities are found to offer theoretical efficiencies comparable to windowless ones, while multiple windowed units are found to suffer from low operating efficiencies due to losses resulting from reflections at each window/air interface. A ''first order'' examination is made of the feasibility of air cooling the window to assure its survival. This appears possible if a proper combination of cooling technique and window material characteristics is selected.

  1. Patients' preferences for receiving laboratory test results.

    Science.gov (United States)

    Sabahi, Azam; Ahmadian, Leila; Mirzaee, Moghadameh; Khajouei, Reza

    2017-04-01

    The laboratory, as a diagnostic department in the hospital, plays an important role in the treatment and prevention of diseases. Paying attention to patients' preferences for communication of test results may provide a better and more responsive system for delivering these results. This study aimed to identify patient preferences regarding receiving their laboratory test results electronically and to identify the reasons behind their choice. Descriptive-analytical study. This study was carried out in 2015 with 200 patients who had access to the internet and had been referred at least once previously to the hospital laboratory department to receive their test results. Data were collected through an expert-validated questionnaire, and its reliability was confirmed by test-retest (P = .8). Data were analyzed using χ2 and marginal independence SPSS and R software. Ninety-eight percent of participants preferred to be notified by short message service when their test results were ready. All participants preferred to receive their test results online, and 82.5% (n = 165) preferred to receive both normal and abnormal test results this way. The main reason for receiving results online was time savings, which was reported by 77% of participants, followed by lowering the chance of missing the results (31%). About 40% of participants thought e-mail notification was more secure than accessing the results through a hospital website. Findings showed that although patients wanted to benefit from online services for receiving their test results, they were concerned about confidentiality and security. Before using online technologies, security measures necessary to protect patient privacy and to gain the trust of patients should be defined.

  2. Building and Testing a Portable VLF Receiver

    Science.gov (United States)

    McLaughlin, Robert; Krause, L.

    2014-01-01

    Unwanted emissions or signal noise is a major problem for VLF radio receivers. These can occur from man made sources such as power line hum, which can be prevalent for many harmonics after the fundamental 50 or 60 Hz AC source or from VLF radio transmissions such as LORAN, used for navigation and communications. Natural emissions can also be detrimental to the quality of recordings as some of the more interesting natural emissions such as whistlers or auroral chorus may be drowned out by the more common sferic emissions. VLF receivers must selectively filter out unwanted emissions and amplify the filtered signal to a record-able level without degrading the quality.

  3. Near-infrared receiver for advanced ophthalmology

    Science.gov (United States)

    Myers, Richard A.; Farrell, Richard; Zhang, Yuhua; Roorda, Austin

    2010-02-01

    We will present research on the development of an optical receiver module with a wide frequency bandwidth and excellent response to near-infrared radiation. This module is being produced to promote new imaging modalities, allowing retinal specialist to utilize established diagnostic instruments, such as scanning laser ophthalmoscopes (SLO) in a unique or more effective manner. In particular, it can be applied towards more accurate visual threshold studies in both the healthy and diseased eye. With this goal in mind, measurements of the targeted receiver's performance with and without additional amplification are presented, as is a survey of available APD detectors.

  4. Avalanche Photodiode Arrays for Optical Communications Receivers

    Science.gov (United States)

    Srinivasan, M.; Vilnrotter, V.

    2001-01-01

    An avalanche photodiode (APD) array for ground-based optical communications receivers is investigated for the reception of optical signals through the turbulent atmosphere. Kolmogorov phase screen simulations are used to generate realistic spatial distributions of the received optical field. It is shown that use of an APD array for pulse-position modulation detection can improve performance by up to 4 dB over single APD detection in the presence of turbulence, but that photon-counting detector arrays yield even greater gains.

  5. Signal Processing for Improved Wireless Receiver Performance

    DEFF Research Database (Denmark)

    Christensen, Lars P.B.

    2007-01-01

    This thesis is concerned with signal processing for improving the performance of wireless communication receivers for well-established cellular networks such as the GSM/EDGE and WCDMA/HSPA systems. The goal of doing so, is to improve the end-user experience and/or provide a higher system capacity...

  6. Management of Febrile Neutropenia in Patients receiving ...

    African Journals Online (AJOL)

    antifungal therapy for oral candidiassis. Eight (40%) patients received growth factors. The mean fever duration was 4.5 days (range 1–10 days). Two (10%) of the patients died. CONCLUSION: Febrile neutropenia in resource limited countries can be managed with good history and physical examination skills.

  7. A 24GHz Radar Receiver in CMOS

    NARCIS (Netherlands)

    Kwok, K.C.

    2015-01-01

    This thesis investigates the system design and circuit implementation of a 24GHz-band short-range radar receiver in CMOS technology. The propagation and penetration properties of EM wave offer the possibility of non-contact based remote sensing and through-the-wall imaging of distance stationary or

  8. immunisation fever amongst infants receiving Diphtheria

    African Journals Online (AJOL)

    PROF. EZECHUKWU

    2013-08-06

    Aug 6, 2013 ... Methods: A prospective study was conducted on a cohort of 710 in- fants who received ... immunisation, especially in infants and young children. Although generally benign and self-limiting, fever is ..... Although this method might minimise recall bias because of the short duration of memory re- call required ...

  9. Fresnel zone imaging of receiver functions

    Science.gov (United States)

    Mullick, Nirjhar; Buske, Stefan

    2014-05-01

    The receiver function method is a widely applied and powerful technique to obtain structural information of the crust and mantle. In its standard implementation, the depths to interfaces are interpreted from the arrival time delay of waves converted at these interfaces relative to the direct P waves. In recent times, common methods from exploration seismics (e.g. Kirchhoff prestack depth migration) have been used to image the converters instead. However, these methods are in principle not designed for receiver function imaging because of the usually non-uniform and less dense source-receiver coverage, which may lead to results dominated by significant migration noise. In this study, we present a new imaging technique that works by restricting the migration operator to the Fresnel zone in the vicinity of the conversion point at the converter. Both a synthetic test and an application to a real data set show great improvements of image quality over standard Kirchhoff migration results particularly in the case of less favorable source receiver geometry.

  10. Receiving Assistance and Local Food System Participation

    Directory of Open Access Journals (Sweden)

    Rebecca L. Som Castellano

    2017-02-01

    Full Text Available A body of literature has noted that local food systems (LFSs may not involve active participation by individuals with lower incomes. This is, in part, a function of racial and class hegemony, as well as physical and financial accessibility of LFSs. LFS institutions, such as farmers’ markets, have been working to facilitate receipt of food assistance programs, such as the Supplemental Nutrition Assistance Program (SNAP. Charitable assistance programs, such as food banks, have also been actively working to engage in LFSs, for example, by making local foods available. However, little research has explored the role that receiving public or charitable assistance can play in influencing LFS participation. In this article, I utilize quantitative and qualitative data collected from across the state of Ohio to examine the relationship between receiving assistance and LFS participation for women, who remain predominately responsible for food provisioning in the U.S., including among those who participate in LFSs. Quantitative results suggest that receiving assistance can increase participation in LFSs. Qualitative data provides more nuanced information about the importance of food assistance for women who want to participate in LFSs, and suggest that it is essential that food cooperatives and farmers’ markets are equipped to receive food assistance programs, such as SNAP, in order for women with lower incomes to participate in LFSs.

  11. Nicolas Receives 2004 Harry H. Hess Medal

    Science.gov (United States)

    Allègre, Claude J.

    2005-02-01

    Adolphe Nicolas received the Hess Medal at the 2004 Fall Meeting Honors Ceremony on 15 December, in San Francisco, California. The medal is given for outstanding achievements in research in the constitution and evolution of Earth and other planets. Citation. Adolphe Nicolas is a pioneer in Earth sciences. He has almost created a new field that we can name: the textural geodynamics.

  12. Forestry professors and students receive national recognition

    OpenAIRE

    Davis, Lynn

    2005-01-01

    Two Virginia Tech professors in the College of Natural Resources and the university's Society of American Foresters student chapter received awards for their accomplishments at the Society of American Foresters 2005 national convention held in Fort Worth, Texas, earlier this month.

  13. Two business professors receive Fulbright Scholar awards

    OpenAIRE

    Ho, Sookhan

    2005-01-01

    Virginia Tech Pamplin College of Business professors Larry French and Mahmood A. Khan have received Fulbright Scholar Awards to teach and conduct research abroad next year. Both faculty members teach in the MBA program at the university's Northern Virginia Center in metro Washington, D.C.

  14. Compressed Sensing-Based Direct Conversion Receiver

    DEFF Research Database (Denmark)

    Pierzchlewski, Jacek; Arildsen, Thomas; Larsen, Torben

    2012-01-01

    Due to the continuously increasing computational power of modern data receivers it is possible to move more and more processing from the analog to the digital domain. This paper presents a compressed sensing approach to relaxing the analog filtering requirements prior to the ADCs in a direct...

  15. 7 CFR 29.42 - Receiving station.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing... INSPECTION Regulations Definitions § 29.42 Receiving station. Points at which producer tobacco is offered for marketing (other than sale at auction on a designated market), including tobacco auction warehouses, packing...

  16. Anatomy of a digital coherent receiver

    DEFF Research Database (Denmark)

    Borkowski, Robert; Zibar, Darko; Tafur Monroy, Idelfonso

    2014-01-01

    Digital coherent receivers have gained significant attention in the last decade. The reason for this is that coherent detection, along with digital signal processing (DSP) allows for substantial increase of the channel capacity by employing advanced detection techniques. In this paper, we first r...

  17. Howard Feiertag receives hospitality industry award

    OpenAIRE

    Ho, Sookhan

    2004-01-01

    Howard Feiertag, of Blacksburg, an instructor in hospitality and tourism management at Virginia Tech's Pamplin College of Business, received the inaugural Excellence in Sales and Marketing Strategy Award at the Hospitality Sales and Marketing Association/New York University Strategy Conference in New York recently.

  18. Social effects of migration in receiving countries.

    Science.gov (United States)

    Ohndorf, W

    1989-06-01

    This paper examines the impact of post-1945 migration into Western, Middle, and Northern Europe from Southern Europe, Turkey, and Northern Africa, and migration to the traditional immigration countries by Asian and Latin American immigrants, on the social structures of receiving countries. Between 1955 and 1974, 1) traditional migration to the US and Australia became less important for European countries while traditional receiving countries accepted many immigrants from developing countries; and 2) rapid economic revival in Western and Northern Europe caused a considerable labor shortage which was filled by migrant workers especially from Southern Europe, Turkey, and Northern Africa, who stayed only until they reached their economic goals. Since 1974, job vacancies have declined and unemployment has soared. This employment crisis caused some migrants 1) to return to their countries of origin, 2) to bring the rest of their families to the receiving country, or 3) to lengthen their stay considerably. The number of refugees has also significantly increased since the mid-970s, as has the number of illegal migrants. After the mid-1970s, Europe began to experience integration problems. The different aspects of the impact of migration on social structures include 1) improvement of the housing situation for foreigners, 2) teaching migrants the language of the receiving country, 3) solving the unemployment problem of unskilled migrants, 4) improvement of educational and vocational qualifications of 2nd generation migrants, 5) development of programs to help unemployed wives of migrants to learn the language and meet indigenous women, 6) encouraging migrants to maintain their cultural identity and assisting them with reintegration if they return to their original country, 7) coping with the problems of refugees, and 8) solving the problems of illegal migration. Almost all receiving countries now severely restrict further immigration. [Those policies should result in

  19. CERN Press Office receives award from Euroscience

    CERN Multimedia

    2009-01-01

    The CERN Communication group has received an award for its efforts in communicating the LHC first beam to the media and the public. James Gillies, head of the Communication group was presented the AlphaGalileo Research Public Relations Award on Wednesday, 14 October during the Euroscience Media Award Ceremony in Hannover. "It’s great to receive this recognition," said Gillies. "Of course, we had great material to work with: the LHC is a fantastic story and one that is going to get even better. Angels, Demons and black holes also had their roles to play, but behind the media interest there’s been a lot of hard work by my team. This is for them." The CERN Communication group also works with communication professionals in all the CERN Member States and major physics labs around the world through the European Particle Physics Communication Network, and the InterAction collaboration. "Without them," says Gillies, &am...

  20. Jian Receives 2009 F. L. Scarf Award

    Science.gov (United States)

    2010-03-01

    Lan Jian has been awarded the AGU F. L. Scarf Award, given annually to recent Ph.D recipients for outstanding dissertation research that contributes directly to solar planetary sciences. Jian's thesis is entitled “Radial evolution of large-scale solar wind structures.” She was formally presented with the award at the Space Physics and Aeronomy section dinner during the 2009 AGU Fall Meeting, held 14-18 December in San Francisco, Calif. Lan Jian received her B.S. in geophysics from University of Science and Technology of China in 2003. She received her M.S. and Ph.D. degrees in geophysics and space physics, under the supervision of Christopher T. Russell, at University of California, Los Angeles in 2006 and 2008, respectively. Her research interests include various structures in the solar wind, their origin and evolution, and their effect on the space environment of planets.

  1. Grooms receives 2011 Donald L. Turcotte Award

    Science.gov (United States)

    2012-02-01

    Ian Grooms has been awarded the AGU Donald L. Turcotte Award, given annually to recent Ph.D. recipients for outstanding dissertation research that contributes directly to the field of nonlinear geophysics. Grooms's thesis is entitled “Asymptotic and numerical methods for rapidly rotating buoyant flow.” He presented an invited talk and was formally presented with the award at the 2011 AGU Fall Meeting, held 5-9 December in San Francisco, Calif. Grooms received his B.S. in mathematics from the College of William and Mary, Williamsburg, Va., in 2005. He received a Ph.D. in applied mathematics in 2011 under the supervision of Keith Julien at the University of Colorado at Boulder. His research interests include asymptotic and numerical methods for multiscale problems in geophysical fluid dynamics.

  2. Perception of older adults receiving palliative care

    Directory of Open Access Journals (Sweden)

    Fernanda Laporti Seredynskyj

    2014-06-01

    Full Text Available The present study aimed at understanding the perception of older adults who are receiving palliative oncological care on self care in relation to different stages of the disease and how such perception affected their lives. This is a qualitative study using oral history conducted with 15 older adults receiving palliative chemotherapy treatment in a health institution. The following categories emerged: social network, perspectives for confronting life, changes and spirituality. It is necessary for nursing staff to understand this process so that the measures implemented take into account all of the implications of the disease and aim at improving quality of life.   doi: 10.5216/ree.v16i2.22795.

  3. Fused silica windows for solar receiver applications

    Science.gov (United States)

    Hertel, Johannes; Uhlig, Ralf; Söhn, Matthias; Schenk, Christian; Helsch, Gundula; Bornhöft, Hansjörg

    2016-05-01

    A comprehensive study of optical and mechanical properties of quartz glass (fused silica) with regard to application in high temperature solar receivers is presented. The dependence of rupture strength on different surface conditions as well as high temperature is analyzed, focussing particularly on damage by devitrification and sandblasting. The influence of typical types of contamination in combination with thermal cycling on the optical properties of fused silica is determined. Cleaning methods are compared regarding effectiveness on contamination-induced degradation for samples with and without antireflective coating. The FEM-aided design of different types of receiver windows and their support structure is presented. A large-scale production process has been developed for producing fused silica dome shaped windows (pressurized window) up to a diameter of 816 mm. Prototypes were successfully pressure-tested in a test bench and certified according to the European Pressure Vessel Directive.

  4. 47 CFR 22.709 - Rural radiotelephone service application requirements.

    Science.gov (United States)

    2010-10-01

    ... call signs, if any, of any fixed points of communication. (c) No landline facilities. Each application... authority to operate a new interoffice station or to add transmitters or points of communications to an... center frequency of each channel requested, the maximum effective radiated power, the effective radiated...

  5. 47 CFR 80.268 - Technical requirements for radiotelephone installation.

    Science.gov (United States)

    2010-10-01

    ... SPECIAL RADIO SERVICES STATIONS IN THE MARITIME SERVICES Equipment Authorization for Compulsory Ships § 80... radio ground waves over seawater. The installation and construction of the required antenna must ensure... between masts or other supports subject to whipping, a safety link must be installed which under heavy...

  6. Hypersensitivity reactions in patients receiving hemodialysis.

    Science.gov (United States)

    Butani, Lavjay; Calogiuri, Gianfranco

    2017-06-01

    To describe hypersensitivity reactions in patients receiving maintenance hemodialysis. PubMed search of articles published during the past 30 years with an emphasis on publications in the past decade. Case reports and review articles describing hypersensitivity reactions in the context of hemodialysis. Pharmacologic agents are the most common identifiable cause of hypersensitivity reactions in patients receiving hemodialysis. These include iron, erythropoietin, and heparin, which can cause anaphylactic or pseudoallergic reactions, and topical antibiotics and anesthetics, which lead to delayed-type hypersensitivity reactions. Many hypersensitivity reactions are triggered by complement activation and increased bradykinin resulting from contact system activation, especially in the context of angiotensin-converting enzyme inhibitor use. Several alternative pharmacologic preparations and dialyzer membranes are available, such that once an etiology for the reaction is established, recurrences can be prevented without affecting the quality of care provided to patients. Although hypersensitivity reactions are uncommon in patients receiving hemodialysis, they can be life-threatening. Moreover, considering the large prevalence of the end-stage renal disease population, the implications of such reactions are enormous. Most reactions are pseudoallergic and not mediated by immunoglobulin E. The multiplicity of potential exposures and the complexity of the environment to which patients on dialysis are exposed make it challenging to identify the precise cause of these reactions. Great diligence is needed to investigate hypersensitivity reactions to avoid recurrence in this high-risk population. Copyright © 2017 American College of Allergy, Asthma & Immunology. Published by Elsevier Inc. All rights reserved.

  7. Transient simulation of molten salt central receiver

    Science.gov (United States)

    Doupis, Dimitri; Wang, Chuan; Carcorze-Soto, Jorge; Chen, Yen-Ming; Maggi, Andrea; Losito, Matteo; Clark, Michael

    2016-05-01

    Alstom is developing concentrated solar power (CSP) utilizing 60/40wt% NaNO3-KNO3 molten salt as the working fluid in a tower receiver for the global renewable energy market. In the CSP power generation cycle, receivers undergo a daily cyclic operation due to the transient nature of solar energy. Development of robust and efficient start-up and shut-down procedures is critical to avoiding component failures due to mechanical fatigue resulting from thermal transients, thus maintaining the performance and availability of the CSP plant. The Molten Salt Central Receiver (MSCR) is subject to thermal transients during normal daily operation, a cycle that includes warmup, filling, operation, draining, and shutdown. This paper describes a study to leverage dynamic simulation and finite element analysis (FEA) in development of start-up, shutdown, and transient operation concepts for the MSCR. The results of the FEA also verify the robustness of the MSCR design to the thermal transients anticipated during the operation of the plant.

  8. Radio Astronomy Software Defined Receiver Project

    Energy Technology Data Exchange (ETDEWEB)

    Vacaliuc, Bogdan [ORNL; Leech, Marcus [Shirleys Bay Radio Astronomy Consortium; Oxley, Paul [Retired; Flagg, Richard [Retired; Fields, David [ORNL

    2011-01-01

    The paper describes a Radio Astronomy Software Defined Receiver (RASDR) that is currently under development. RASDR is targeted for use by amateurs and small institutions where cost is a primary consideration. The receiver will operate from HF thru 2.8 GHz. Front-end components such as preamps, block down-converters and pre-select bandpass filters are outside the scope of this development and will be provided by the user. The receiver includes RF amplifiers and attenuators, synthesized LOs, quadrature down converters, dual 8 bit ADCs and a Signal Processor that provides firmware processing of the digital bit stream. RASDR will interface to a user s PC via a USB or higher speed Ethernet LAN connection. The PC will run software that provides processing of the bit stream, a graphical user interface, as well as data analysis and storage. Software should support MAC OS, Windows and Linux platforms and will focus on such radio astronomy applications as total power measurements, pulsar detection, and spectral line studies.

  9. Hepatic Dysfunction in Patients Receiving Intravenous Amiodarone.

    Science.gov (United States)

    Hashmi, Ali; Keswani, Nicole R; Kim, Sharon; Graham, David Y

    2016-02-01

    Amiodarone is a commonly used antiarrhythmic drug. Hepatotoxicity following chronic oral administration occurs in 1% to 3% of patients. Hepatotoxicity following intravenous (IV) administration is infrequent but may be associated with dramatic increases in serum transaminases. We describe the incidence of liver toxicity among patients receiving IV amiodarone during a 5-year period. This was a single-center retrospective review of patients receiving IV amiodarone for any cause. The outcome measures were development of elevated serum transaminases and the relation of transaminitis to all-cause 30-day mortality. A total of 1510 patients received amiodarone intravenously between 2005 and 2011; 77 (5%) developed elevated liver enzymes. Enzyme elevation was divided into mild (100-300 IU/L), moderate (300-1000 IU/L), and severe (>1000 IU/L). The median alanine aminotransferase was 189 (37-10,006) IU/L and aspartate aminotransferase was 253 (84-12,005) IU/L. The 30-day mortality among those with transaminitis was 22%; however, no patient died of amiodarone-related liver disease. Amiodarone can cause severe elevation in liver enzymes. The incidence of severe transaminitis is low; deaths following IV amiodarone are rarely caused by drug-induced liver failure.

  10. Russian institute receives CMS Gold Award

    CERN Multimedia

    Patrice Loïez

    2003-01-01

    The Snezhinsk All-Russian Institute of Scientific Research for Technical Physics (VNIITF) of the Russian Federal Nuclear Centre (RFNC) is one of twelve CMS suppliers to receive awards for outstanding performance this year. The CMS Collaboration took the opportunity of the visit to CERN of the Director of VNIITF and his deputy to present the CMS Gold Award, which the institute has received for its exceptional performance in the assembly of steel plates for the CMS forward hadronic calorimeter. This calorimeter consists of two sets of 18 wedge-shaped modules arranged concentrically around the beam-pipe at each end of the CMS detector. Each module consists of steel absorber plates with quartz fibres inserted into them. The institute developed a special welding technique to assemble the absorber plates, enabling a high-quality detector to be produced at relatively low cost.RFNC-VNIITF Director Professor Georgy Rykovanov (right), is seen here receiving the Gold Award from Felicitas Pauss, Vice-Chairman of the CMS ...

  11. [Are domiciliary care patients receiving adequate thromboprophylaxis?].

    Science.gov (United States)

    Cátedra, B; Muñoz, F; Cabello, L

    2014-01-01

    The study aims to determine the percentage of patients treated at home with an indication of prophylaxis of thromboembolic disease (TED) according to the PRETEMED guidelines and whether they receive such prophylaxis. A cross-sectional descriptive study was conducted in Segovia Palace Health Centre (Madrid). to be included in the domiciliary care protocol. terminal patient, hospitalised or surgery in the last 3 months. The variables used include, age, sex, duration of domiciliary care, mobility, anticoagulant or antiplatelet treatment and reason, and associated and precipitating factors to calculate the risk of TED according to the PRETEMED guidelines, and if they receive such prophylaxis, by reviewing computerised medical records and meeting with the staff responsible. The study included a total of 187 patients, of whom 81% were women There was a significant differences in mean age by sex (men, 76.91 years, 95% CI; 72.59-81.24, and women, 86.72 years, 95% CI; 72.59-81.24, Pdomiciliary care have a low baseline risk of developing a TED episode in our study. There should be more emphasis placed on the prophylaxis of TED in acute medical episodes in which patients with slightly elevated risk may increase the likelihood of TED. Observational studies should be conducted to study the baseline risk and the subsequent development of TED in the population receiving home care. Copyright © 2012 Sociedad Española de Médicos de Atención Primaria (SEMERGEN). Publicado por Elsevier España. All rights reserved.

  12. Performance Driven Six-Port Receiver and Its Advantages over Low-IF Receiver Architecture

    Directory of Open Access Journals (Sweden)

    Abul Hasan

    2014-01-01

    Full Text Available This paper provides an extensive analysis of the performance of a six-port based direct conversion receiver (SPR in terms of signal quality, dynamic range, noise figure, ports matching, isolation, bandwidth, and cost. Calibration technique using multimemory polynomials has been adopted in order to improve the signal quality of the six-port receiver. The performances of the calibrated receiver are then compared with the performances of a commercially available I-Q demodulator used as a low-IF receiver. The main advantages and disadvantages of the SPR compared to the low-IF receiver are highlighted. The major advantages of the SPR come in terms of its available input frequency bandwidth and the low power requirement. The SPR system requires no external bias supply but suffers in terms of the available conversion gain. A better port matching of the SPR can be guaranteed over a wide frequency bandwidth, which mixer based receiver systems lack. The main component limiting the performance of a SPR is the diode detector. A faster and a better diode detector will alleviate some of the problems highlighted in this paper. The SPR system is calibratable and its error-vector-magnitude performance can be made better than the I-Q demodulator used as a low-IF receiver.

  13. Receivers Gather Data for Climate, Weather Prediction

    Science.gov (United States)

    2012-01-01

    Signals from global positioning system (GPS) satellites are now being used for more than just location and navigation information. By looking at the radio waves from GPS satellites, a technology developed at NASA s Jet Propulsion Laboratory (JPL) not only precisely calculates its position, but can also use a technique known as radio occultation to help scientists study the Earth s atmosphere and gravity field to improve weather forecasts, monitor climate change, and enhance space weather research. The University Corporation for Atmospheric Research (UCAR), a nonprofit group of universities in Boulder, Colorado, compares radio occultation to the appearance of a pencil when viewed though a glass of water. The water molecules change the path of visible light waves so that the pencil appears bent, just like molecules in the air bend GPS radio signals as they pass through (or are occulted by) the atmosphere. Through measurements of the amount of bending in the signals, scientists can construct detailed images of the ionosphere (the energetic upper part of the atmosphere) and also gather information about atmospheric density, pressure, temperature, and moisture. Once collected, this data can be input into weather forecasting and climate models for weather prediction and climate studies. Traditionally, such information is obtained through the use of weather balloons. In 1998, JPL started developing a new class of GPS space science receivers, called Black Jack, that could take precise measurements of how GPS signals are distorted or delayed along their way to the receiver. By 2006, the first demonstration of a GPS radio occultation constellation was launched through a collaboration among Taiwan s National Science Council and National Space Organization, the U.S. National Science Foundation, NASA, the National Oceanic and Atmospheric Administration (NOAA), and other Federal entities. Called the Constellation Observing System for Meteorology, Ionosphere, and Climate (COSMIC

  14. Solomon Receives 2005 Harry H. Hess Medal

    Science.gov (United States)

    Purdy, G. Michael; Solomon, Sean C.

    2006-02-01

    Sean C. Solomon received the Harry H. Hess Medal at the 2005 Fall Meeting Honors Ceremony, which was held on 7 December in San Francisco, Calif. The medal is given for outstanding achievements in research on the constitution and evolution of the Earth and other planets. It is a privilege to present Sean C. Solomon as the American Geophysical Union's Harry H. Hess Medal recipient. During more than 30 years of accomplished research he has established himself as one of the remarkable leadersin geophysical research today.

  15. Designing a heterostructure for the quantum receiver

    Science.gov (United States)

    Kiselev, A. A.; Kim, K. W.; Yablonovitch, E.

    2002-04-01

    In this letter, we develop optimal parameters for a structure which is suitable for the realization of a coherent quantum receiver. Conditions including predefined photon wavelength, strain, small Zeeman splitting of the electron levels, and large Zeeman effect for quantum-confined light holes are satisfied simultaneously for the structure based on the InGaAsP solid solutions. We are able to achieve designs with wavelengths of 1.3 and 1.55 μm that are desirable for optoelectronic applications.

  16. Efficiency of the Receivable Rotation Ratio as a Measure of the Accounts Receivable Settlement Period

    Directory of Open Access Journals (Sweden)

    Aleksandra Szpulak

    2010-01-01

    Full Text Available Accounts receivable forecasting, due to a wide range of applications in a number of financial decisions, is an important area of a company’s financial forecasts. Estimation of accounts receivable involves finding solutions for two fundamental problems: forecasting the level of daily sales revenues and estimating the accounts receivable settlement period. This paper addresses the issue of constructing reliable models to be used in forecasting accounts receivable due on deliveries and services – the trend model and the simple regression model. The postulated models, together with a range of alternative methods suggested in the literature on the field, are tested to examine the quality of the resulting estimates of the A/R settlement period. The methods postulated in the paper prove to be functional – on the one hand, the results are reliable, on the other hand, the postulated models can be constructed using readily available data. (original abstract

  17. Cardiac Arrest in Pediatric Patients Receiving Azithromycin.

    Science.gov (United States)

    Valdés, Santiago O; Kim, Jeffrey J; Niu, Mary C; de la Uz, Caridad M; Miyake, Christina Y; Moffett, Brady S

    2017-03-01

    To compare outcomes of pediatric patients treated with azithromycin compared with penicillin or cephalosporin. We hypothesized that azithromycin use would not be associated with increased cardiac mortality in the pediatric population. Retrospective cohort study from the Pediatric Health Information System database between 2008 and 2012. Patients Azithromycin was used in 5039 (6.1%); penicillin or cephalosporin was used in 77 943 (93.9%). Overall prevalence of antibiotic-associated CPR was 0.14%. Patients receiving a macrolide antibiotic had a lower prevalence of CPR compared with patients receiving a penicillin or cephalosporin (0.04% vs 0.14%, P = .04), and there was no difference in mortality. Multivariable analysis did not find an association between macrolide use and CPR. In contrast to recent adult studies, among children hospitalized for community-acquired pneumonia, azithromycin use was not associated with a greater prevalence of cardiac arrest compared with penicillin or cephalosporin use. Copyright © 2016 Elsevier Inc. All rights reserved.

  18. Parabolic Trough Receiver Heat Loss Testing (Poster)

    Energy Technology Data Exchange (ETDEWEB)

    Price, H.; Netter, J.; Bingham, C.; Kutscher, C.; Burkholder, F.; Brandemuehl, M.

    2007-03-01

    Parabolic trough receivers, or heat collection elements (HCEs), absorb sunlight focused by the mirrors and transfer that thermal energy to a fluid flowing within them. Thje absorbing tube of these receivers typically operates around 400 C (752 F). HCE manufacturers prevent thermal loss from the absorbing tube to the environment by using sputtered selective Cermet coatings on the absorber and by surrounding the absorber with a glass-enclosed evacuated annulus. This work quantifies the heat loss of the Solel UVAC2 and Schott PTR70 HCEs. At 400 C, the HCEs perform similarly, losing about 400 W/m of HCE length. To put this in perspective, the incident beam radiation on a 5 m mirror aperture is about 4500 W/m, with about 75% of that energy ({approx} 3400 W/m) reaching the absorber surface. Of the 3400 W/m on the absorber, about 3000 W/m is absorbed into the working fluid while 400 W/m is lost to the environment.

  19. Omnidirectional free-space optical receiver architecture

    Science.gov (United States)

    Murshid, Syed H.; Lovell, Gregory L.; Finch, Michael F.

    2013-05-01

    Free Space Optical (FSO) communication is the fusion of wireless technology and optical fiber communications systems. It has the potential of providing fiber optic data rates without the physical restraints of optical fiber cables. This endeavor presents a novel receiver structure with potential for omnidirectional free space optical communications. Interesting approaches for accomplishing omnidirectional free space lasercomm such as direct detection and solar blind non-line of sight UV scattering have been reported over the last few years. However, these technologies have resulted in limited distances of the order of 10 to 100 meters and data rates often limited to less than 1 Mb/s. This endeavor reports the architecture of an omnidirectional receiver setup by integrating an off the shelf detector and a fiber bundle, where the fiber bundle couples omnidirectional photons within its field of view and delivers these photons to the detector. The coupling of light from all directions into a detector is regulated by the cone of the acceptance angle of the fiber. Multiple fibers with overlapping acceptance angles provide the necessary coverage that may be needed to extract the optical signal from the free space optical channel. Simulated results showing the normalized power pattern of the system is presented to demonstrate omnidirectional potential of the structure. Theoretical power level versus distance plot for an FSO System employing On-O Keying (OOK) is also presented.

  20. Observation of strong VHF-radar echoes from the E-region at 69°N and 54°N: Echo properties, relation to sporadic layers, and physical mechanisms

    Science.gov (United States)

    Rapp, Markus; Leitert, Lasse; Latteck, Ralph; Zecha, Marius; Hoffmann, Peter; Höffner, Josef; Hoppe, Ulf-Peter; La Hoz, Cesar

    For more than ten years the Leibniz-Institute of Atmospheric Physics at Rostock University in Kühlungsborn has been operating two VHF-radars (53.5 MHz) at the Arctic location Andenes (69N, 16E) as well as the mid-latitude site Kühlungsborn (54.1N 11.8E). Both radars have primarily been used for the study of strong radar echoes from the summer mesopause region known as (polar) mesosphere summer echoes or (P)MSE. PMSE occur from mid May until mid August in an altitude range from 80 -90 km, i.e., at the time of year and in the altitude range where the atmosphere is supersaturated with respect to ice such that ice particles may form, modify the D-region plasma, and lead to spectacular radar echoes. The existence of echoes from above this altitude range has generally been deemed impossible since refractive index fluctuations arising from neutral dynamics such as turbulence are effectively destroyed at these altitudes owing to the exponential increase of viscosity with height. Also, plasma instabilities which occur between 90 -110 km height produce field aligned irregularities and should not lead to detectable echoes for vertically sounding radars at polar latitudes where the magnetic field lines are essentially perpendicular to the surface. It hence comes as a surprise that our recent observations in the altitude range from 90 -115 km reveals the presence of strong radar echoes both at 69N as well as 54N. These echoes have a typical duration of less than 1 hour and extend over less than 1 km in height. They occur in the entire altitude range from 90 to 115 km with a pronounced maximum at 100 km. The seasonal variation is marked by a pronounced maximum during the summer months. This paper describes the morphology and statistics of these echoes, discusses its relation to sporadic E-layers and sporadic metal layers, and closes with an initial attempt to identify a physical mechanism responsible for these structures.

  1. Eosinophils increase in animals that received biotherapic

    Directory of Open Access Journals (Sweden)

    Pedro Gilberto Silva Morais

    2012-12-01

    Full Text Available Dairy industry is an important Brazilian economic activity participating of income generation. European breeds cattle aren’t adapted to parasites found in the tropics, like the Rhipicephalus microplus tick. Parasites can acquire resistance to allopathic products, but not to homeopathic products. We evaluate the efficacy of an antiparasiticide biotherapic against the R. microplus tick. The biotherapic was prepared according to the homeopathic pharmacopoeia recommendations from vegetable (Abrotanum and animal products (Rhipicephalus microplus, Amblyomma cajenennense, Haematobia irritans, Musca domestica, Dermatobia hominis, all diluted and vigorous shaken (dynamized in water or alcohol at a ratio of 1:99, in the 12th Centesimal Hahnemann (CH12, with limestone as the carrier. This homeophatic product found in veterinary pharmacies of Ituiutaba’s region, Minas Gerais State, is registered at Ministério da Agricultura, Pecuária e Abastecimento (MAPA. Natural tick infestation was accessed in thirty Girolando (Gir x Holstein cows with 7 to 13 year-old, by monthly counting of tick female bigger than 6 mm, from October/2009 to July/2011. Cows were divided in three groups of 10 similar animals. The treated group (T1 received roughage, concentrate and biotherapic. The placebo group (T2 received roughage, concentrate and limestone and the control group (T3 received only roughage and concentrate. T1 and T2 groups were managed together and remained in the same paddock. T3 group was separed from T1 and T2 by a wire fence. From October 2009 to September 2010 blood cell counts and serum biochemical tests were performed monthly only in T1 and T2, but visual clinical observations were made in all animals. Any group was treated with acaricide when the count’s average reached 50 or more ticks. It was necessary 7 baths with acaricide in T1 and T2, while in T3 group (control group it was necessary 19 acaricide baths to control the cattle tick. We verified

  2. Receiver based PAPR reduction in OFDMA

    KAUST Repository

    Ali, Anum Z.

    2014-05-01

    High peak-to-average power ratio is one of the major drawbacks of orthogonal frequency division multiplexing (OFDM). Clipping is the simplest peak reduction scheme, however, it requires clipping mitigation at the receiver. Recently compressed sensing has been used for clipping mitigation (by exploiting the sparse nature of clipping signal). However, clipping estimation in multi-user scenario (i.e., OFDMA) is not straightforward as clipping distortions overlap in frequency domain and one cannot distinguish between distortions from different users. In this work, a collaborative clipping removal strategy is proposed based on joint estimation of the clipping distortions from all users. Further, an effective data aided channel estimation strategy for clipped OFDM is also outlined. Simulation results are presented to justify the effectiveness of the proposed schemes. © 2014 IEEE.

  3. Morel Receives 2005 Maurice Ewing Medal

    Science.gov (United States)

    Schrag, Daniel P.; Morel, François M. M.

    2006-02-01

    François M. M. Morel received the Ewing Medal at the AGU Fall Meeting Honors Ceremony, which was held on 7 December 2005, in San Francisco, Calif. The medal is given for significant original contributions to the scientific understanding of the processes in the ocean; for the advancement of oceanographic engineering, technology, and instrumentation; and for outstanding service to marine sciences. François Morel has led the search to understand the role of metals in the ocean, starting with a focus on inorganic processes and aquatic chemistry, and leading to a blend of geochemistry, microbiology, biochemistry, and genetics. His influence comes from his research and from the way he has educated an entire community of scientists with his textbooks, with his teaching, and through his former students and postdocs who hold faculty positions at universities throughout the world.

  4. MRI in children receiving total parenteral nutrition

    Energy Technology Data Exchange (ETDEWEB)

    Quaghebeur, G. [Department of Neuroradiology, National Hospital for Neurology and Neurosurgery, Queen Square, London WC1N 3BG (United Kingdom)]|[Department of Paediatric Neuroradiology, Great Ormond Street Hospital for Children NHS Trust, Great Ormond Street, London WC1N 3JH (United Kingdom); Taylor, W.J. [Department of Paediatric Neuroradiology, Great Ormond Street Hospital for Children NHS Trust, Great Ormond Street, London WC1N 3JH (United Kingdom); Kingsley, D.P.E. [Department of Paediatric Neuroradiology, Great Ormond Street Hospital for Children NHS Trust, Great Ormond Street, London WC1N 3JH (United Kingdom); Fell, J.M.E. [Department of Gastroenterology, Great Ormond Street Hospital for Children NHS Trust, Great Ormond Street, London WC1N 3JH (United Kingdom); Reynolds, A.P. [Department of Chemical Pathology, Great Ormond Street Hospital for Children NHS Trust, Great Ormond Street, London WC1N 3JH (United Kingdom); Milla, P.J. [Department of Gastroenterology, Great Ormond Street Hospital for Children NHS Trust, Great Ormond Street, London WC1N 3JH (United Kingdom)

    1996-10-01

    Cranial MRI was obtained in 13 of a group of 57 children receiving long-term parenteral nutrition, who were being investigated for hypermanganasaemia. Increased signal intensity on T1-weighted images has been reported in adult patients on long-term parenteral nutrition and with encephalopathy following chronic manganese exposure in arc welding. It has been postulated that these changes are due to deposition of the paramagnetic trace element manganese. In excess manganese is hepato- and neurotoxic and we present the correlation of whole blood manganese levels with imaging findings. The age range of our patients was 6 months to 10 years, and the duration of therapy 3 months to 10 years. In 7 children we found characteristic increased signal intensity on T1-weighted images, with no abnormality on T2-weighted images. All patients had elevated whole blood manganese levels, suggesting that the basis for this abnormality is indeed deposition of manganese within the tissues. (orig.). With 3 figs.

  5. Humboldt SK pilot biodigester receives funding

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    2005-09-30

    The Canada-Saskatchewan Western Economic Partnership Agreement (WEPA) will provide funding for Canada's first pilot-scale biodigester to be built in Humboldt, Saskatchewan. The $208,138 pilot facility will use household garbage as well as agricultural waste such as manure and livestock operations, abattoirs and food processing to create heat or power and fertilizer. Support for this bio-energy facility, which could also reduce greenhouse gases, will come from the Prairie Agricultural Machinery Institute which has received $186,138 from Canada and Saskatchewan in the form of cost-shared federal-provincial funding. The pilot plant will test different combinations of waste material feedstocks and the characteristics of the resulting gas end products. The pilot facility will also provide design information for full-scale biodigester manufacturers in Canada. It is expected that 25 full-scale biodigesters will be constructed in Canada in the near future.

  6. Teleseismic receiver functions imaging of Siberia

    DEFF Research Database (Denmark)

    Soliman, Mohammad Youssof Ahmad; Thybo, Hans; Artemieva, Irina

    2014-01-01

    We map the lithosphere in Siberia by using the available broadband seismic data for calculation of Ps- and Sp-wave receiver functions (RF). RFs show converted waves from discontinuities in the vicinity of the seismic stations. The main objective is to image the Moho and upper mantle discontinuities......, including the lithosphere-asthenosphere boundary (LAB) beneath the study area. We construct the RF using the LQT method (Vinnik, 1977; Kind et al. 1995) in the version by Yuan et al. (1997). Rotation of ray coordinates uses the incidence angles predicted by the AK135 velocity model. This decomposes the wave...... by high-frequency S-RFs. Teleseismic converted Ps waves have higher frequency content (0.5–2 Hz) than Sp, which have an upper frequency of 0.1–0.2 Hz, and therefore Ps have about an order of magnitude better resolving power than Sp. The converted Sp-wave rarely resolve intracrustal structure, but can...

  7. The BINP receives its Golden Hadron award

    CERN Document Server

    2002-01-01

    On Thursday, 14 September, the LHC Project Leader, Lyn Evans, handed over a Golden Hadron award to Alexander Skrinsky of Russia's Budker Institute of Nuclear Physics (BINP). The prize is awarded in recognition of exceptional performances by suppliers and this year prizes were awarded to two firms, Cockerill-Sambre (Belgium) and Wah-Chang (United States), and to the Budker Institute, which was unable to receive the award at the same time as the two other recipients (see Bulletin No 34/2002, of 19 August 2002). The Russian institute has been rewarded for the particularly high-quality production of 360 dipole magnets and 185 quadrupole magnets for the LHC proton beam transfer lines.

  8. Ototoxicity in children receiving cisplatin chemotherapy

    Directory of Open Access Journals (Sweden)

    Hee Jin Jang

    2010-02-01

    Full Text Available Purpose : Cisplatin is highly effective for the treatment of solid tumors in children. However, the clinical use of cisplatin is limited by its ototoxicity. The aim of this study was to evaluate the ototoxicity in children treated with cisplatin. Methods : We performed a single institution retrospective analysis of pediatric oncology patients who received cisplatin therapy between January 2001 and January 2008. Thirty-seven patients with sufficient medical and audiologic data were included in this study. Results : The median age at the time of diagnosis was 10.7 (range 3.8&#8211;16.7 years. There were 16 males and 21 females. The underlying diseases were osteosarcoma (15 cases, medulloblastoma (14 cases, germ cell tumors (7 cases, and hepatoblastoma (1 case. The median individual dose was 100 mg/m2/cycle (56-200. The median cumulative dose was 480 mg/m2 (200-1,490. Sixteen patients (43% received cranial radiotherapy. Of the 37 patients, 17 developed hearing loss, leading to an overall incidence of 46%. Logistic regression showed that age at treatment (P=0.04 and cumulative dose of cisplatin (P=0.005 were the significant risk factors in predicting hearing loss in children treated with cisplatin. In all the patients who had hearing loss, there was neither improvement nor aggravation during the follow-up (3&#8211;68 months. Conclusion : The cumulative dose of cisplatin (&gt;500 mg/m2 and younger age at treatment (&lt;12 years were 2 most important risk factors for ototoxicity in patients treated with cisplatin. Serial audiometric evaluations are needed in the patients with risk factors during and after cisplatin treatment.

  9. URBAN POND AS A RAINWATER RECEIVER

    Directory of Open Access Journals (Sweden)

    Piotr Stachowski

    2017-02-01

    Full Text Available This paper presents the functioning of a closed pond as a small storage reservoir in the urban catchment area located in the Wilda district of Poznań. It presents the natural, hydro-geological and urban conditions and the factors conditioning the water level in the pond. Particular attention was focused upon on the pond as a rainwater receiver. The total catchment area and partial catchment area were determined. The inflow of water into the pond, with varying degrees of probability of occurrence, was calculated based on metrological data. The example of a pond in the John Paul II Park shows that this reservoir may be effectively used as rainwater receiver, without underestimating their other functions. They contribute to the increase of the underground water resources, increase the attractiveness of the recreational area and provide a natural value. However, the continuous urbanization, sealing the soil surface and the occurrence of extreme weather conditions necessitate a comprehensive look at the management of rainwater in urban areas. Calculations showed that the largest inflow of rain water occurs after a day’s rain with the probability p = 100%, and would amount to 3365 m3, and the water level in the pond would rise by only 0.25 m to a capacity of about 7000 m3. This represents 57% of the total capacity of the pond. If such an increase in the water level had occurred during the period of high water levels in the pond, it could not have damaging consequences of flooding. Only the occurrence of a day’s rain with the probability p = 10%, and capacity around 4700 m3, would completely fill the pond. Such a situation can be avoided by recultivation and desilting the bottom of the pond, where the slime collects with a capacity of 1300 m3.

  10. Full-wave receiver architecture for the homodyne motion sensor

    Science.gov (United States)

    Haugen, Peter C; Dallum, Gregory E; Welsh, Patrick A; Romero, Carlos E

    2013-11-19

    A homodyne motion sensor or detector based on ultra-wideband radar utilizes the entire received waveform through implementation of a voltage boosting receiver. The receiver includes a receiver input and a receiver output. A first diode is connected to the receiver output. A first charge storage capacitor is connected from between the first diode and the receiver output to ground. A second charge storage capacitor is connected between the receiver input and the first diode. A second diode is connected from between the second charge storage capacitor and the first diode to ground. The dual diode receiver performs voltage boosting of a RF signal received at the receiver input, thereby enhancing receiver sensitivity.

  11. Phase Noise Tolerant QPSK Receiver Using Phase Sensitive Wavelength Conversion

    DEFF Research Database (Denmark)

    Da Ros, Francesco; Xu, Jing; Lei, Lei

    2013-01-01

    A novel QPSK receiver based on a phase noise reduction pre-stage exploiting PSA in a HNLF and balanced detection is presented. Receiver sensitivity improvement over a conventional balanced receiver is demonstrated.......A novel QPSK receiver based on a phase noise reduction pre-stage exploiting PSA in a HNLF and balanced detection is presented. Receiver sensitivity improvement over a conventional balanced receiver is demonstrated....

  12. Social Interactions Receive Priority to Conscious Perception.

    Science.gov (United States)

    Su, Junzhu; van Boxtel, Jeroen J A; Lu, Hongjing

    2016-01-01

    Humans are social animals, constantly engaged with other people. The importance of social thought and action is hard to overstate. However, is social information so important that it actually determines which stimuli are promoted to conscious experience and which stimuli are suppressed as invisible? To address this question, we used a binocular rivalry paradigm, in which the two eyes receive different action stimuli. In two experiments we measured the conscious percept of rival actions and found that actions engaged in social interactions are granted preferential access to visual awareness over non-interactive actions. Lastly, an attentional task that presumably engaged the mentalizing system enhanced the priority assigned to social interactions in reaching conscious perception. We also found a positive correlation between human identification of interactive activity and the promotion of socially-relevant information to visual awareness. The present findings suggest that the visual system amplifies socially-relevant sensory information and actively promotes it to consciousness, thereby facilitating inferences about social interactions.

  13. Neufeld Receives 2009 Donald L. Turcotte Award

    Science.gov (United States)

    2010-03-01

    Jerome Neufeld has been awarded the Donald L. Turcotte Award, given annually to recent Ph.D. recipients for outstanding dissertation research that contributes directly to the field of nonlinear geophysics. Neufeld's thesis is entitled “Solidification in the fast lane: Flow-induced morphological instability in geological systems.” He was formally presented with the award at the Nonlinear Geophysics Focus Group reception during the 2009 AGU Fall Meeting, held 14-18 December in San Francisco, Calif. Jerome received his B.A.S. in engineering science from the University of Toronto in 2001, and a Ph.D. in geophysics from Yale University in 2008, under the supervision of J. S. Wettlaufer, on the impact of oceanic currents on the formation of sea ice. He is currently a fellow at the Institute of Theoretical Geophysics, University of Cambridge, working on the fluid dynamics of geophysical systems including carbon dioxide sequestration, the influence of flow on the crystal structure of mushy layers, and the evolution of icicles.

  14. CERN safety expert receives international award

    CERN Multimedia

    2005-01-01

    On 18 December 2004, the President of the Swiss Electro-technical Committee, Martin Reichle (left), presented the award to Helmut Schönbacher. Helmut Schönbacher, of the Safety Commission at CERN, has received, the "1906 Award" of the International Electrotechnical Commission (IEC) for his standardisation work on the influence of ionizing radiation on insulating materials. From 1986 until 2004, Schönbacher was leader of a working group on radiation composed of internationally recognised experts. It edited standards of the IEC 60544 series on the determination of the effects of ionizing radiation on electrical insulating materials. The working group also edited three IEC Technical Reports on the determination of long-term radiation ageing in polymers. This standardisation work and long-term experience from CERN on the radiation ageing of materials also contributed to research coordination programmes of the International Atomic Energy Agency (IAEA). From 1968 until 1988, Schönbacher was a member of the Rad...

  15. Crustal Structure beneath Mexico from Receiver Functions

    Science.gov (United States)

    Espindola, V.; Quintanar, L.; Espindola, J.

    2011-12-01

    The Servicio Sismológico Nacional (SSN) is Mexico's official organism in charge of the observation of seismicity in the country. Operated by the Universidad Nacional Autonoma de Mexico, it counts with 32 broadband stations deployed throughout the country. The coverage includes most of the geologic provinces of the territory, which vary widely in their geologic characteristics. The availability of records from teleseisms at those stations makes feasible to obtain sound and homogeneous estimates of the structure of the crust in the Mexican territory through the analysis of receiver functions (RF). In this work we present the results of the analysis of RF obtained from events registered from 1998 to 2009 in the 32 stations of the SSN. The RF technique, which uses converted phases at major velocity discontinuities, is a well established technique to infer the velocity contrasts and thickness of the underlying crust. Using this method we were able to infer the depth of the Moho, a major intracrustal discontinuity and in some cases the depth to the base of the subducting plate. We present maps of crustal thickness in Mexico, which varies between about 29 km in the Yucatan peninsula to more than 40 km in central Mexico. Poisson's coefficient varies between 0.19 and 0.30. The position of the descending slab shows a large variation in the subduction angle (from about 6° in the SE margin of the Pacific coast to about 60° in the NW ) as has been found from other techniques.

  16. Infant position in neonates receiving mechanical ventilation.

    Science.gov (United States)

    Rivas-Fernandez, May; Roqué I Figuls, Marta; Diez-Izquierdo, Ana; Escribano, Joaquin; Balaguer, Albert

    2016-11-07

    In patients of various ages undergoing mechanical ventilation (MV), it has been observed that positions other than the standard supine position, such as the prone position, may improve respiratory parameters. The benefits of these positions have not been clearly defined for critically ill newborns receiving MV.This is an update of a review first published in 2005 and last updated in 2013. Primary objectiveTo assess the effects of different positioning of newborn infants receiving MV (supine vs prone, lateral decubitus or quarter turn from prone) in improving short-term respiratory outcomes. Secondary objectiveTo assess the effects of different positioning of newborn infants receiving MV on mortality and neuromotor and developmental outcomes over the long term, and on other complications of prematurity. We used the standard search strategy of the Cochrane Neonatal Review Group to search the Cochrane Central Register of Controlled Trials (CENTRAL; 2016, Issue 8), MEDLINE via PubMed (1966 to 22 August 2016), Embase (1980 to 22 August 2016) and the Cumulative Index to Nursing and Allied Health Literature (CINAHL; 1982 to 22 August 2016). We also searched clinical trials databases, conference proceedings and reference lists of retrieved articles for randomised controlled trials and quasi-randomised trials. Randomised and quasi-randomised clinical trials comparing different positions in newborns receiving mechanical ventilation. Three unblinded review authors independently assessed trials for inclusion in the review and extracted study data. We used standard methodological procedures as expected by The Cochrane Collaboration and assessed the quality of the evidence using the GRADE approach. If the meta-analysis was not appropriate owing to substantial clinical heterogeneity between trials, we presented review findings in narrative format. We included in this review 19 trials involving 516 participants. Seven of the included studies (N = 222) had not been evaluated in the

  17. [Travel Preparations for Patients Receiving Peritoneal Dialysis].

    Science.gov (United States)

    Lu, Shu-Chi; Lin, Wen-Chuan

    2018-02-01

    People who receive peritoneal dialysis (PD) have more freedom than those who are on hemodialysis. However, some PD patients have difficulty adapting to their new environment and thus remain largely homebound. When they work or travel abord, who cannot rely wholly on others, these patients must handle certain life problems alone. It is essential for nursing staff to help PD patients to prepare for overcoming typical inconveniences, improving quality of life, and handling unfamiliar environments. The present study assists patients to arrange domestic and foreign tourism and to participate in various activities. The intervention teaches the pre-assessment of tourism, the assessment and selection of the sterile environment for exchange, the arrangements for dialysate, planning for handling complications, the travel matters attention, and other tourist information using group or individual instruction. It is expected that patients with peritoneal dialysis will be more willing to leave their houses and be better prepared to travel, which should lead to their having more fun and to their greater enjoyment of life.

  18. Patrick Janot receives the CNRS silver medal

    CERN Multimedia

    2005-01-01

    Patrick Janot during the award ceremony. (Photo Schwemling, Paris) On 25 November, Patrick Janot of the CERN Physics Department received the CNRS silver medal for IN2P3 (Institut national de physique nucléaire et de physique des particules). This prize, one of the most prestigious awarded by the French research centre, is given to scientists for the 'originality, quality and importance of their work, as recognised both nationally and internationally'. Patrick Janot joined the ALEPH collaboration, one of the four experiments at LEP, then under construction, in 1987. First a CERN Fellow, he went on to work for the CNRS at LAL in 1989. Together with his team, he developed innovative algorithms for the reconstruction of events. This work and others earned him the bronze CNRS medal in 1993, which is awarded to scientists for their first achievements. In 1997, he became a permanent physicist at CERN, where he continued to work for ALEPH. He was appointed LEP scientific co-ordinator for the last two years of the ac...

  19. CERN Web Pages Receive a Makeover

    CERN Multimedia

    2001-01-01

    Asudden allergic reaction to the colour turquoise? Never fear, from Monday 2 April you'll be able to click in the pink box at the top of the CERN users' welcome page to go to the all-new welcome page, which is simpler and better organized. CERN's new-look intranet is the first step in a complete Web-makeover being applied by the Web Public Education (WPE) group of ETT Division. The transition will be progressive, to allow users to familiarize themselves with the new pages. Until 17 April, CERN users will still get the familiar turquoise welcome page by default, with the new pages operating in parallel. From then on, the default will switch to the new pages, with the old ones being finally switched off on 25 May. Some 400 pages have received the makeover treatment. For more information about the changes to your Web, take a look at: http://www.cern.ch/CERN/NewUserPages/ Happy surfing!

  20. Diffuse exanthema in a patient receiving varenicline.

    Science.gov (United States)

    Song, Wei; Miller, William A

    2008-07-01

    A diffuse exanthema in a patient receiving varenicline is reported. A 71-year-old white woman, who was initially admitted to the hospital for elective vascular bypass surgery, had a three-day history of a diffuse rash, severe itching, and moderate headache. Her symptoms started two days before her admission. She denied having a fever, chills, nausea, vomiting, diarrhea, and flulike symptoms. She also denied having had contact with anyone who was ill, tick or insect bites, exposure to cats, or any changes in her diet, habits, or personal hygiene. Her medical problems included peripheral vascular disease, chronic obstructive pulmonary disease (COPD), dyslipidemia, hypertension, and hypothyroidism. In addition to several medications she had been taking for over 2 years, she had been taking varenicline as an aid for smoking cessation for eight days. The patient had been smoking for 40 years. The bright-red rash covered 70% of her torso and four extremities. She had mild swelling in her cheeks, but not on the eyelids or lips. Both of her lungs were clear on auscultation, with distant breath sounds caused by her COPD. Varenicline was discontinued, and her symptoms had completely resolved by the eighth day following discontinuation of the medication. While it is possible that other medications caused her symptoms, she had been taking most of them for over 2 years and all of them for over 1 year. Also, continuation of these drugs did not prevent her symptoms from resolving, nor did it cause a recurrence of the skin reaction. A patient developed diffuse exanthema after being treated with varenicline.

  1. 47 CFR 15.117 - TV broadcast receivers.

    Science.gov (United States)

    2010-10-01

    ... portion of a TV broadcast receiver, tuning aids of the same type and comparable capability and quality... 47 Telecommunication 1 2010-10-01 2010-10-01 false TV broadcast receivers. 15.117 Section 15.117... TV broadcast receivers. (a) All TV broadcast receivers shipped in interstate commerce or imported...

  2. Assessment of L5 receiver performance in presence of interference using a realistic receiver simulator

    OpenAIRE

    Bastide, Frédéric; Macabiau, Christophe; Akos, Dennis; Roturier, Benoit

    2003-01-01

    International audience; In the frame of the GPS modernization program, a third civil GPS signal, called L5, will be broadcasted by the first Block IIF satellites launched in 2005. The signal band is located in an ARNS band so that it is of particular interest for users such as civil aviation. It is expected to increase accuracy, availability, integrity and continuity of service. A receiver dedicated to this signal requires special design. Signal modulation is different from that used on the L...

  3. Superior Coherent Receivers for AF Relaying with Distributed Alamouti Code

    KAUST Repository

    Khan, Fahd Ahmed

    2012-01-01

    Coherent receivers are derived for a pilot-symbol aided distributed Alamouti-coded system with imperfect channel state information. The derived coherent receivers do not perform channel estimation but rather use the received pilot signals for decoding. The derived receiver metrics use the statistics of the channel to give improved performance. The performance is further improved by using the decision history. Simulation results show that a performance gain of up to 1.8 dB can be achieved for the new receivers with decision history as compared with the conventional mismatched coherent receiver. © 2011 IEEE.

  4. Solar Central Receiver Hybrid Power Systems sodium-cooled receiver concept. Final report. Volume III. Appendices

    Energy Technology Data Exchange (ETDEWEB)

    None

    1980-01-01

    The overall, long term objective of the Solar Central Receiver Hybrid Power System is to identify, characterize, and ultimately demonstrate the viability and cost effectiveness of solar/fossil, steam Rankine cycle, hybrid power systems that: (1) consist of a combined solar central receiver energy source and a nonsolar energy source at a single, common site, (2) may operate in the base, intermediate, and peaking capacity modes, (3) produce the rated output independent of variations in solar insolation, (4) provide a significant savings (50% or more) in fuel consumpton, and (5) produce power at the minimum possible cost in mills/kWh. It is essential that these hybrid concepts be technically feasible and economically competitive with other systems in the near to mid-term time period (1985-1990) on a commercial scale. The program objective for Phase I is to identify and conceptually characterize solar/fossil steam Rankine cycle, commercial-scale, power plant systems that are economically viable and technically feasible. This volume contains appendices to the conceptual design and systems analysis studies gien in Volume II, Books 1 and 2. (WHK)

  5. A Bluetooth-enabled HiperLAN/2 receiver

    NARCIS (Netherlands)

    Schiphorst, Roelof; Hoeksema, F.W.; Slump, Cornelis H.

    2003-01-01

    n our SDR project we aim to combine a GFSK receiver (Bluetooth) with an OFDM receiver (HiperLAN/2). Other WLAN standards use the same frequency bands and modulation techniques. So our Bluetooth-enabled HiperLAN/2 receiver can easily be adapted to other WLAN standards. This paper focuses on the

  6. A Bluetooth-enabled HiperLan/2 Receiver

    NARCIS (Netherlands)

    Schiphorst, Roelof; Hoeksema, F.W.; Slump, Cornelis H.

    2003-01-01

    In our SDR project we aim to combine a GFSK receiver (Bluetooth) with an OFDM receiver (HiperLAN/2). Other WLAN standards use the same frequency bands and modulation techniques. So our Bluetooth-enabled HiperLAN/2 receiver can easily be adapted to other WLAN standards. This paper focuses on the

  7. 42 CFR 436.110 - Individuals receiving cash assistance.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Individuals receiving cash assistance. 436.110... Mandatory Coverage of the Categorically Needy § 436.110 Individuals receiving cash assistance. (a) A Medicaid agency must provide Medicaid to individuals receiving cash assistance under OAA, AFDC, AB, APTD...

  8. 42 CFR 435.120 - Individuals receiving SSI.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Individuals receiving SSI. 435.120 Section 435.120..., Blind, and Disabled § 435.120 Individuals receiving SSI. Except as allowed under § 435.121, the agency must provide Medicaid to aged, blind, and disabled individuals or couples who are receiving or are...

  9. Noise and intercept point calculation for modern radio receiver planning

    DEFF Research Database (Denmark)

    Iversen, Christian Rye; Kolding, T. E.

    2001-01-01

    The paper presents analytical expressions for determining noise and intercept points for cascaded radio receiver stages. The theory allows for active receiver stages with frequency selectivity and flexible impedance levels. This makes the method highly usable for planning of modem receivers where...

  10. RECEIVE SIGNAL STRENGTH PREDICTION IN THE GSM BAND ...

    African Journals Online (AJOL)

    In this work, GSM receive signal strength was monitored in an indoor environment. Samples of GSM receive signal strength was measured on a Mobile Equipment (ME). One-dimensional multilevel wavelet decomposition technique was used to predict the fading phenomenon of the GSM receive signal strength measured.

  11. 10 CFR 733.5 - Allegations received by DOE.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Allegations received by DOE. 733.5 Section 733.5 Energy DEPARTMENT OF ENERGY ALLEGATIONS OF RESEARCH MISCONDUCT § 733.5 Allegations received by DOE. If DOE receives directly a written allegation of research misconduct with regard to research under a DOE contract or...

  12. 49 CFR 220.33 - Receiving a radio transmission.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Receiving a radio transmission. 220.33 Section 220... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD COMMUNICATIONS Radio and Wireless Communication Procedures § 220.33 Receiving a radio transmission. (a) Upon receiving a radio call, an employee shall promptly...

  13. IMPROVEMENT WAYS OF ACCOUNTING AND INTERNAL AUDIT OF ENTERPRISE RECEIVABLES

    Directory of Open Access Journals (Sweden)

    V. D. Zelikman

    2014-06-01

    Full Text Available Purpose. Determination and substantiation of ways to improve accounting and internal audit of receivables at the enterprises. Methodology.The basic principles and ways for improvement of accounting and internal audit systems that should help Ukrainian enterprises to optimize receivables are considered. Findings. It is proved that the receivables optimization is possible on the basis of improving its accounting and internal audit. The basic ways for improvement of accounting and internal audit of receivable are determined. They are: improvement of normative coverage of receivables at the enterprises; providing further harmonization of financial and tax accounting in the part of formation of the doubtful debt receivables, accounting of bad and doubtful receivables and etc. The formation of department for internal audit to control the doubtful and bad debts; providing the timely control of the receivables and payables ratio; determination and support of the optimal value of the receivables at the enterprises. Originality. Improvement of accounting and internal audit of receivables at the enterprises by the way of development of internal audit system and optimization of the receivables size. Practical value. The proposed recommendations will improve the accounting and internal audit system of receivables at the enterprises of Ukraine.

  14. Seismic Imaging of Receiver Functions at Virtual Receivers in Ryukyu Arc, Japan

    Science.gov (United States)

    Murakoshi, T.; Takenaka, H.; Komatsu, M.; Yamada, N.

    2016-12-01

    This study describes the seismic images of the crust and uppermost mantle beneath the Ryukyu Arc, Japan by using S-wavevector receiver functions (SWV-RFs) analysis at virtual subsurface receivers. The SWV-RFs are the time series deconvolving the upgoing SV-wave component by the upgoing P-wave one. This method for ground surface records was originally introduced by Reading et al. (2003, GRL). Takenaka and Murakoshi (2010, AGU) proposed the SWV-RFs at the surface or subsurface station, which virtually move the seismic sensor at the surface or in the borehole down to the top of the basement layer and calculate the SWV-RFs at that location for suppressing the sedimentary layer effect. The SWV-RFs have a great advantage that the problem of unclearly seismic images beneath very thick sedimentary basin due to the records include strong effect of reverberation within the sedimentary layer can be overcome. Takenaka et al. (2014, AGU) applied the SWV-RFs to the teleseismic waveform records observed at borehole and ground surface stations and obtained clearly seismic images of Moho and subducted Philippine Sea plate beneath in Kyushu island, Japan. In this study, we applied the SWV-RFs from broadband seismic records of the F-net (NIED) and ETOS (JMA) to obtain the seismic structures in Ryukyu Arc, Japan. In this presentation, we will show the estimated seismic structure under each stations in the Ryukyu Arc, Japan. Acknowledgement: We have used Fnet data (NIED), ETOS data (JMA) and deep subsurface structure model by J-SHIS (NIED).

  15. Receiver function HV ratio: a new measurement for reducing non-uniqueness of receiver function waveform inversion

    Science.gov (United States)

    Chong, Jiajun; Chu, Risheng; Ni, Sidao; Meng, Qingjun; Guo, Aizhi

    2018-02-01

    It is known that a receiver function has relatively weak constraint on absolute seismic wave velocity, and that joint inversion of the receiver function with surface wave dispersion has been widely applied to reduce the trade-off of velocity with interface depth. However, some studies indicate that the receiver function itself is capable for determining the absolute shear-wave velocity. In this study, we propose to measure the receiver function HV ratio which takes advantage of the amplitude information of the receiver function to constrain the shear-wave velocity. Numerical analysis indicates that the receiver function HV ratio is sensitive to the average shear-wave velocity in the depth range it samples, and can help to reduce the non-uniqueness of receiver function waveform inversion. A joint inversion scheme has been developed, and both synthetic tests and real data application proved the feasibility of the joint inversion.

  16. GNSS Receiver Identification Using Clock-Derived Metrics †

    Science.gov (United States)

    Gioia, Ciro; Cano Pons, Eduardo

    2017-01-01

    Falsifying Global Navigation Satellite System (GNSS) data with a simulator or with a fake receiver can have a significant economic or safety impact in many transportation applications where Position, Velocity and Time (PVT) are used to enforce a regulation. In this context, the authentication of the source of the PVT data (i.e., the GNSS receiver) is a requirement since data faking can become a serious threat. Receiver fingerprinting techniques represent possible countermeasures to verify the authenticity of a GNSS receiver and of its data. Herein, the potential of clock-derived metrics for GNSS receiver fingerprinting is investigated, and a filter approach is implemented for feature selection. Novel experimental results show that three intrinsic features are sufficient to identify a receiver. Moreover, the adopted technique is time effective as data blocks of about 40 min are sufficient to produce stable features for fingerprinting. PMID:28914760

  17. GNSS Receiver Identification Using Clock-Derived Metrics.

    Science.gov (United States)

    Borio, Daniele; Gioia, Ciro; Cano Pons, Eduardo; Baldini, Gianmarco

    2017-09-15

    Falsifying Global Navigation Satellite System (GNSS) data with a simulator or with a fake receiver can have a significant economic or safety impact in many transportation applications where Position, Velocity and Time (PVT) are used to enforce a regulation. In this context, the authentication of the source of the PVT data (i.e., the GNSS receiver) is a requirement since data faking can become a serious threat. Receiver fingerprinting techniques represent possible countermeasures to verify the authenticity of a GNSS receiver and of its data. Herein, the potential of clock-derived metrics for GNSS receiver fingerprinting is investigated, and a filter approach is implemented for feature selection. Novel experimental results show that three intrinsic features are sufficient to identify a receiver. Moreover, the adopted technique is time effective as data blocks of about 40 min are sufficient to produce stable features for fingerprinting.

  18. Solar advanced internal film receiver; Receptor avanzado de pelicular interna

    Energy Technology Data Exchange (ETDEWEB)

    Torre Cabezas, M. de la

    1990-07-01

    In a Solar Central Internal Film Receiver, the heat absorbing fluid (a molten nitrate salt) flows in a thin film down over the non illuminated side of an absorber panel. Since the molten salt working fluid is not contained in complicated tube manifolds, the receiver design is simples than a conventional tube type-receiver resulting in a lower cost and a more reliable receiver. The Internal Film Receiver can be considered as an alternative to the Direct Absorption Receiver, in the event that the current problems of the last one can not be solved. It also describes here the test facility which will be used for its solar test, and the test plans foreseen. (Author) 17 refs.

  19. BPSK Receiver Based on Recursive Adaptive Filter with Remodulation

    Directory of Open Access Journals (Sweden)

    N. Milosevic

    2011-12-01

    Full Text Available This paper proposes a new binary phase shift keying (BPSK signal receiver intended for reception under conditions of significant carrier frequency offsets. The recursive adaptive filter with least mean squares (LMS adaptation is used. The proposed receiver has a constant, defining the balance between the recursive and the nonrecursive part of the filter, whose proper choice allows a simple construction of the receiver. The correct choice of this parameter could result in unitary length of the filter. The proposed receiver has performance very close to the performance of the BPSK receiver with perfect frequency synchronization, in a wide range of frequency offsets (plus/minus quarter of the signal bandwidth. The results obtained by the software simulation are confirmed by the experimental results measured on the receiver realized with the universal software radio peripheral (USRP, with the baseband signal processing at personal computer (PC.

  20. Ways to rational management of accounts receivable at enterprises

    Directory of Open Access Journals (Sweden)

    Yevtushenko N. O.

    2015-05-01

    Full Text Available This article investigated the principal reasons of management problems an account receivable of enterprises. Credit politics of management is worked out by an account receivable of enterprises. Essence of the stages of construction of rational management an account receivable of enterprises is exposed. In the article are exposed the basic elements of control system for an account receivable such as mission, aims, strategy as politics of management. The basic stages of management politics are described for an account receivable of enterprises: analysis; organization of forming of principles of credit politics, terms of delivery of credit and procedure of collection of accounts receivable; planning of the use of modern forms of refunding, and similarly control.

  1. Improved Design and Implementation of Variational Bayesian Iterative Receivers

    Directory of Open Access Journals (Sweden)

    M. Modarresi

    2012-09-01

    Full Text Available It was recently shown that detection performance can be significantly improved if the statistics of channel estimation errors are available and properly used at the receiver. Although deriving the statistics of channel estimation errors is rather straightforward for pilot-only channel estimation methods, it is not the case for semi-blind receivers such as variational Bayesian (VB receivers. We have shown in a recent contribution that by a modified formulation of the VB formalism, one can reduce the impact of channel uncertainty on the decoder performance. In this paper, we propose different practical VB receiver implementation techniques that lead to further performance improvement. The adequacy of the proposed receiver design compared to classically-used VB receivers is demonstrated by simulations for orthogonal frequency-division multiplexing (OFDM systems.

  2. Performance Improvement of QPSK Signal Predetection EGC Diversity Receiver

    Directory of Open Access Journals (Sweden)

    B. Nikolic

    2012-09-01

    Full Text Available This paper proposes a modification of quadrature phase-shift-keying (QPSK signal diversity reception with predetection equal gain combiner (EGC. The EGC combining is realized by using the constant modulus algorithm (CMA. Carrier synchronization is performed by the phase locked loop (PLL. Comparative analysis of the modified and ordinary diversity receiver in the presence of carrier frequency offset in the additive white Gaussian noise (AWGN channel, as well as in Rician fading channel is shown. The proposed diversity receiver allows significant frequency offset compared to the diversity receiver that uses only PLL, and the error probability of the proposed receiver is very close to the error probability of the receiver with only PLL and zero frequency offset. The functionality of the proposed diversity receiver, as well as its properties is experimentally verified on a system based on universal software radio peripheral (USRP hardware. The performed comparison confirms the expected behavior of the system.

  3. Polarization mode dispersion effects on phase and polarization diversity receivers

    Science.gov (United States)

    Pratt, Thomas G.; Ingram, Mary Ann

    1992-12-01

    The objective of this paper is to examine the combined effects of weak phase noise and polarization mode dispersion (PMD) on a coherent receiver employing phase and polarization diversity reception. The receiver is assumed to be subjected to the following: transmitter and receiver polarization misalignment relative to the principal states of the optical fiber, phase noise, polarization mode dispersion, and shot noise. The receiver outputs are investigated for ASK demodulation using square-law and envelope detection. The results show that for the assumed receiver configuration, square law detection provides an output which is independent of PMD, phase noise, and polarization misalignment. Envelope detection results in a receiver output which is dependent on all of these parameters. Furthermore, when phase noise and PMD are simultaneously present, the resulting probability of bit error is no greater than the probability of bit error under worst-case operating conditions when polarization mode dispersion and phase noise are absent.

  4. Switched-RC Beamforming Receivers in Advanced CMOS

    OpenAIRE

    Soer, M.C.M.

    2012-01-01

    In consumer electronic devices, analog radio transmitters and receivers provide the wireless links between devices. These radios are mostly omni-directional, i.e. transmitters send their energy in all directions and receivers listen to signals from all directions. As a result, interference between devices and services is becoming an increasing problem as more wireless connectivity is added. In order to steer radio signals toward their destination and to receive from a specic direction, it is ...

  5. Guide to Repent and Receive Jesus Christ (in several languages)

    OpenAIRE

    Christianto, Victor

    2010-01-01

    This Guide to Repent and Receive Jesus Christ is dedicated to new believers in Christianity, in order that they can follow some steps in ordered manner, and by doing so feel completely guided in their pursuit of happiness. The seven steps to receive Jesus Christ: R - Recognize that you are sinners E - writE your sins and mistake in a paper P - Pray in order you will be forgiven, and receive Jesus Christ E - be Ensured that Jesus come to your heart ...

  6. Molecular Spectroscopy With a Compact 557-GHz Heterodyne Receiver

    OpenAIRE

    Neumaier, Philipp F.-X.; Richter, Heiko; Stake, Jan; Zhao, Huan; Tang, Aik-Yean; Drakinskiy, Vladimir; Sobis, Peter; Emrich, Anders; Hülsmann, Axel; Johansen, Tom K.; Bryllert, Tomas; Hanning, Johanna; Krozer, Viktor; Hübers, Heinz-Wilhelm

    2014-01-01

    We report on a heterodyne terahertz spectrometer based on a fully integrated 557-GHz receiver and a digital fast Fourier transform spectrometer. The receiver consists of a chain of multipliers and power amplifiers, followed by a heterostructure barrier varactor tripler that subharmonically pumps a membrane GaAs Schottky diode mixer. All sub-components are newly developed and optimized with regard to the overall receiver performance such as noise temperature, power consumption, weight and phys...

  7. GPS Receiver and Satellite DCB Estimation using Ionospheric TEC

    OpenAIRE

    Byung-Kyu Choi; Sung-Ki Cho; Sang-Jeong Lee

    2009-01-01

    We estimated the receiver and satellite differential code bias (DCB) based on the ionospheric total electron content (TEC) estimation method. The GPS network which has been operated by the Korea Astronomy and Space Science Institute (KASI) was designed to calculate TEC. The receiver and satellite DCB values were obtained from the weighted least square method with time interval for one hour. The results represented that the receiver DCB values are mostly varying within ±2 meter and are derived...

  8. Signal-processing theory for the TurboRogue receiver

    Science.gov (United States)

    Thomas, J. B.

    1995-01-01

    Signal-processing theory for the TurboRogue receiver is presented. The signal form is traced from its formation at the GPS satellite, to the receiver antenna, and then through the various stages of the receiver, including extraction of phase and delay. The analysis treats the effects of ionosphere, troposphere, signal quantization, receiver components, and system noise, covering processing in both the 'code mode' when the P code is not encrypted and in the 'P-codeless mode' when the P code is encrypted. As a possible future improvement to the current analog front end, an example of a highly digital front end is analyzed.

  9. Sepsis outcomes in patients receiving statins prior to hospitalization for sepsis: comparison of in-hospital mortality rates between patients who received atorvastatin and those who received simvastatin.

    Science.gov (United States)

    Ouellette, Daniel R; Moscoso, Erics Espinoza; Corrales, Julio Pinto; Peters, Michael

    2015-01-01

    The purpose of this study is to compare the in-hospital mortality rates between septic patients receiving statins and those that did not prior to developing sepsis. We compared subgroups receiving atorvastatin and simvastatin because these two drugs differ in their pharmacologic properties. This study was a retrospective analysis of patients selected from an institutional data base of patients hospitalized with sepsis. The study patients were drawn from a data base of 1,961 hospitalized patients with sepsis and included patients who met selection criteria and who were studied for HMG-CoA reductase inhibitor (statin) use both prior to and during hospitalization. The in-hospital mortality rates of patients receiving statins and those that did not prior to developing sepsis were compared. In-hospital mortality rates of patient subgroups receiving atorvastatin and simvastatin were also compared. A multivariable analysis was conducted with in-hospital mortality as the outcome variable and with multiple risk factors to include atorvastatin and simvastatin use. The mortality rate for 359 patients receiving statins prior to hospitalization for sepsis was not significantly different than that for 1,302 patients who did not receive pre-hospital statins (26.5% versus 30.4%, p > 0.05). The mortality rate for 92 patients who had received atorvastatin prior to hospitalization was significantly less than that of 253 patients who received simvastatin (18.5% versus 30.0%, p = 0.032). The use of atorvastatin prior to sepsis was independently associated with lower in-hospital mortality in a multivariable analysis of sepsis risk factors (p = 0.021, OR = 0.455). Patients who received atorvastatin prior to hospitalization for sepsis and had statins continued in hospital had a very low mortality rate that was significantly less than that of those patients who never received statins (15.7% versus 30.8%, p = 0.007). Pre-hospital atorvastatin use was associated with

  10. Compact wideband CMOS receiver frontends for wireless communication

    NARCIS (Netherlands)

    Blaakmeer, S.C.

    2010-01-01

    Abstract Wireless communication is an integral part of our daily life, the mobile phone is an example of a very popular wireless communication device. A communication link consists of a transmitter, a receiver and the transmission medium, which air or vacuum for a wireless link. Part of the receiver

  11. Enzymuria in neonates receiving continuous intravenous infusion of gentamicin

    DEFF Research Database (Denmark)

    Colding, H; Brygge, K; Brendstrup, L

    1992-01-01

    with non-treatment periods in the same newborn infant (33 infants). The same tendency applied to AAP. Newborn infants receiving continuous intravenous infusion of gentamicin were not found to be at greater risk of nephrotoxicity than those receiving intermittent gentamicin treatment, using NAG and AAP...

  12. Current perspectives on dental patients receiving coumarin anticoagulant therapy.

    Science.gov (United States)

    Herman, W W; Konzelman, J L; Sutley, S H

    1997-03-01

    Despite approximately 40 years of experience with oral anticoagulant drugs, controversy still exists about the safety of dental treatment in a patient receiving this therapy. The authors review the topic in depth and offer detailed recommendations for the dental management of patients receiving coumarin anticoagulant therapy.

  13. Three scientists to receive presidential Enrico Fermi award

    CERN Multimedia

    2003-01-01

    "Secretary of Energy Spencer Abraham today named John Bahcall, Raymond Davis, Jr. and Seymour Sack as winners of the Enrico Fermi Award. ... Drs. Bahcall and Davis will receive the award for their research in neutrino physics. Dr. Sack will receive the award for his contributions to national security" (1 page).

  14. Switched-RC Beamforming Receivers in Advanced CMOS

    NARCIS (Netherlands)

    Soer, M.C.M.

    2012-01-01

    In consumer electronic devices, analog radio transmitters and receivers provide the wireless links between devices. These radios are mostly omni-directional, i.e. transmitters send their energy in all directions and receivers listen to signals from all directions. As a result, interference between

  15. Receiving versus being denied an abortion and subsequent tobacco use.

    Science.gov (United States)

    Roberts, Sarah C M; Foster, Diana Greene

    2015-03-01

    The negative health consequences of tobacco use are well documented. Some research finds women receiving abortions are at increased risk of subsequent tobacco use. This literature has methodological problems, most importantly, inappropriate comparison groups. This study uses data from the Turnaway Study, a longitudinal study of women who all sought, but did not all receive, abortions at 30 facilities across the United States. Participants included women presenting just before an abortion facility's gestational age limit who received abortions (Near Limit Abortion Group, n = 452), just after the gestational limit who were denied abortions (Turnaways, n = 231), and who received first trimester abortions (First Trimester Abortion Group, n = 273). This study examined the association between receiving versus being denied an abortion and subsequent tobacco use over 2-years. Trajectories of tobacco use over 2 years were compared using multivariate mixed effects regression. Women receiving abortion maintained their level of tobacco use over 2 years. Women denied abortion initially had lower levels of tobacco use than women receiving abortion, but increased their tobacco use from 1 week through 12-18 months post-abortion seeking and then decreased their use by 2 years post-abortion seeking. Baseline parity modified these associations. Receiving an abortion was not associated with an increase in tobacco use over time. Overall, women who carry unwanted pregnancies to term appear to demonstrate similar cessation and resumption patterns to other pregnant women.

  16. 5 CFR 582.201 - Agent to receive process.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Agent to receive process. 582.201 Section 582.201 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS COMMERCIAL GARNISHMENT OF FEDERAL EMPLOYEES' PAY Service of Legal Process § 582.201 Agent to receive process. (a) Except...

  17. 5 CFR 581.201 - Agent to receive process.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Agent to receive process. 581.201 Section 581.201 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PROCESSING GARNISHMENT ORDERS FOR CHILD SUPPORT AND/OR ALIMONY Service of Process § 581.201 Agent to receive process. (a...

  18. 34 CFR 691.15 - Eligibility to receive a grant.

    Science.gov (United States)

    2010-07-01

    ... ACCESS TO RETAIN TALENT GRANT (NATIONAL SMART GRANT) PROGRAMS Application Procedures § 691.15 Eligibility..., is eligible to receive an ACG or a National SMART Grant if the student is receiving a Federal Pell... school; or (D) A testing organization such as the College Board or State agency; or (ii) A home-schooled...

  19. 27 CFR 20.212 - Deposit in receiving tanks.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Deposit in receiving tanks. 20.212 Section 20.212 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Alcohol, Specially Denatured Rum, or Articles § 20.212 Deposit in receiving tanks. All recovered denatured...

  20. 20 CFR 639.6 - Who must receive notice?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Who must receive notice? 639.6 Section 639.6... RETRAINING NOTIFICATION § 639.6 Who must receive notice? Section 3(a) of WARN provides for notice to each... representative at that time, to each affected employee. Notice also must be served on the State dislocated worker...

  1. Reimbursement of VAT on written-off Receivables

    DEFF Research Database (Denmark)

    Florentsen, Bjarne; Møller, Michael; Nielsen, Niels Chr.

    2003-01-01

    In many OECD countries, a seller has a right to reimbursement of VAT (RVAT) she has paid on goods sold, but for which she has not yet received payment. Such reimbursement of VAT on receivables is economically inefficient. It leads to:@* Distortion of credit markets, by subsidizing direct credit a...

  2. Distributed Iterative Processing for Interference Channels with Receiver Cooperation

    DEFF Research Database (Denmark)

    Badiu, Mihai Alin; Manchón, Carles Navarro; Bota, Vasile

    2012-01-01

    . The exchange of information between receivers arises in the form of passing messages along some specific edges of the factor graph; the rate of updating and passing these messages determines the amount of communication overhead associated with cooperation. Simulation results illustrate the high performance...... of the proposed algorithm even with a low number of message exchanges between receivers....

  3. Gluconeogenesis continues in premature infants receiving total parenteral nutrition

    Science.gov (United States)

    To determine the contribution of total gluconeogenesis, to glucose production in preterm infants receiving total parenteral nutrition (TPN) providing glucose exceeding normal infant glucose turnover rate, eight infants (0.955 +/- 0.066 kg, 26.5 - 0.5 wks, 4-1 d) were studied while receiving routine ...

  4. A Three-Dimensional Receiver Operator Characteristic Surface Diagnostic Metric

    Science.gov (United States)

    2010-10-01

    Annual Conference of the Prognostics and Health Management Society, 2010 1 A Three-Dimensional Receiver Operator Characteristic Surface... Characteristic (ROC) curves are commonly applied as metrics for quantifying the performance of binary fault detection systems. An ROC curve provides a...receiver operator characteristic (3D ROC) surface metric has been developed. This is done by generating and applying two separate curves: the

  5. STREAMLINING THE POWERS AND DUTIES OF A RECEIVER ...

    African Journals Online (AJOL)

    Mofasony

    In practice, it is customary to have the agreement reduced into writing which would contain the essential terms of the contract. The bank usually inserts a clause conferring on it powers to appoint a receiver simpliciter, a manager or a receiver and manager over the assets of the company. In the light of the 21st century, it is.

  6. Calibration of Hurricane Imaging Radiometer C-Band Receivers

    Science.gov (United States)

    Biswas, Sayak K.; Cecil, Daniel J.; James, Mark W.

    2017-01-01

    The laboratory calibration of airborne Hurricane Imaging Radiometer's C-Band multi-frequency receivers is described here. The method used to obtain the values of receiver frontend loss, internal cold load brightness temperature and injected noise diode temperature is presented along with the expected RMS uncertainty in the final calibration.

  7. 47 CFR 32.1191 - Accounts receivable allowance-other.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Accounts receivable allowance-other. 32.1191....1191 Accounts receivable allowance—other. (a) This account shall be credited with amounts charged to... collection. (b) If no such allowance is maintained, uncollectible amounts shall be charged directly to...

  8. Transmit and Receive Diversity in Body-Centric Wireless Communications

    DEFF Research Database (Denmark)

    Medina, Pablo F.; Kvist, Søren Helstrup; Jakobsen, Kaj Bjarne

    2012-01-01

    Two antenna diversity schemes are evaluated for use with the 2:45 GHz wireless o-body communication between a receiver worn at the ear and a stationary transmitter. A receive diversity scheme is compared to a transmit diversity scheme in an indoor environment. It is found that the two diversity...

  9. Multi-DSP and FPGA based Multi-channel Direct IF/RF Digital receiver for atmospheric radar

    Science.gov (United States)

    Yasodha, Polisetti; Jayaraman, Achuthan; Kamaraj, Pandian; Durga rao, Meka; Thriveni, A.

    2016-07-01

    Modern phased array radars depend highly on digital signal processing (DSP) to extract the echo signal information and to accomplish reliability along with programmability and flexibility. The advent of ASIC technology has made various digital signal processing steps to be realized in one DSP chip, which can be programmed as per the application and can handle high data rates, to be used in the radar receiver to process the received signal. Further, recent days field programmable gate array (FPGA) chips, which can be re-programmed, also present an opportunity to utilize them to process the radar signal. A multi-channel direct IF/RF digital receiver (MCDRx) is developed at NARL, taking the advantage of high speed ADCs and high performance DSP chips/FPGAs, to be used for atmospheric radars working in HF/VHF bands. Multiple channels facilitate the radar t be operated in multi-receiver modes and also to obtain the wind vector with improved time resolution, without switching the antenna beam. MCDRx has six channels, implemented on a custom built digital board, which is realized using six numbers of ADCs for simultaneous processing of the six input signals, Xilinx vertex5 FPGA and Spartan6 FPGA, and two ADSPTS201 DSP chips, each of which performs one phase of processing. MCDRx unit interfaces with the data storage/display computer via two gigabit ethernet (GbE) links. One of the six channels is used for Doppler beam swinging (DBS) mode and the other five channels are used for multi-receiver mode operations, dedicatedly. Each channel has (i) ADC block, to digitize RF/IF signal, (ii) DDC block for digital down conversion of the digitized signal, (iii) decoding block to decode the phase coded signal, and (iv) coherent integration block for integrating the data preserving phase intact. ADC block consists of Analog devices make AD9467 16-bit ADCs, to digitize the input signal at 80 MSPS. The output of ADC is centered around (80 MHz - input frequency). The digitized data is fed

  10. Evaluation and Error Analysis for a Solar thermal Receiver

    Energy Technology Data Exchange (ETDEWEB)

    Pfander, M.

    2001-07-01

    In the following study a complete balance over the REFOS receiver module, mounted on the tower power plant CESA-1 at the Plataforma Solar de Almeria (PSA), is carried out. Additionally an error inspection of the various measurement techniques used in the REFOS project is made. Especially the flux measurement system Prohermes that is used to determine the total entry power of the receiver module and known as a major error source is analysed in detail. Simulations and experiments on the particular instruments are used to determine and quantify possible error sources. After discovering the origin of the errors they are reduced and included in the error calculation. the ultimate result is presented as an overall efficiency of the receiver module in dependence on the flux density at the receiver module's entry plane and the receiver operating temperature. (Author) 26 refs.

  11. The e-POP Radio Receiver Instrument on CASSIOPE

    Science.gov (United States)

    James, H. G.; King, E. P.; White, A.; Hum, R. H.; Lunscher, W. H. H. L.; Siefring, C. L.

    2015-06-01

    The Radio Receiver Instrument (RRI) is a four-channel digital receiver fed by four 3-metre monopoles, arranged in a crossed configuration, each connected to a high input impedance preamplifier. The RRI bandwidth extends from 10 Hz to 18 MHz. The receiver measures the electric fields of either spontaneous radio emissions or waves created by ground transmitters, such as ionosondes, high-frequency radars and ionospheric heaters. In order to measure accurately the intensity, frequency, direction of propagation and signal delay of such fields over the broad frequency range, modern digital receiver technology is employed. The amplified signals from the monopoles are digitized at a rate of 40 megasamples per second, and from there on, the signal is down-converted, filtered, time-stamped and communicated in digital form. The characterization results of the RRI flight model are reported. Formats for data commands for configuring the digital receiver and for data output are described.

  12. Joint Transmitter-Receiver Optimization in the Downlink CDMA Systems

    Directory of Open Access Journals (Sweden)

    Mohammad Saquib

    2002-08-01

    Full Text Available To maximize the downlink code-division multiple access (CDMA system capacity, we propose to minimize the total transmitted power of the system subject to users′ signal-to-interference ratio (SIR requirements via designing optimum transmitter sequences and utilizing linear optimum receivers (minimum mean square error (MMSE receiver. In our work on joint transmitter-receiver design for the downlink CDMA systems with multiple antennas and multipath channels, we develop several optimization algorithms by considering various system constraints and prove their convergence. We empirically observed that under the optimization algorithm with no constraint on the system, the optimum receiver structure matches the received transmitter sequences. A simulation study is performed to see how the different practical system constraints penalize the system with respect to the optimum algorithm with no constraint on the system.

  13. Sensitivity analysis of heliostat aiming strategies and receiver size on annual thermal production of a molten salt external receiver

    Science.gov (United States)

    Servert, Jorge; González, Ana; Gil, Javier; López, Diego; Funes, Jose Felix; Jurado, Alfonso

    2017-06-01

    Even though receiver size and aiming strategy are to be jointly analyzed to optimize the thermal energy that can be extracted from a solar tower receiver, customarily, they have been studied as separated problems. The main reason is the high-level of detail required to define aiming strategies, which are often simplified in annual simulation models. Aiming strategies are usually focused on obtaining a homogeneous heat flux on the central receiver, with the goal to minimize the maximum heat flux value that may lead to damaging it. Some recent studies have addressed the effect of different aiming strategies on different receiver types, but they have only focused on the optical efficiency. The receiver size is also an additional parameter that has to be considered: larger receiver sizes provide a larger aiming surface and a reduction on spillage losses, but require higher investment while penalizing the thermal performance of the receiver due to the greater external convection losses. The present paper presents a sensitivity analysis of both factors for a predefined solar field at a fixed location, using a central receiver and molten salts as HTF. The analysis includes the design point values and annual energy outputs comparing the effect on the optical performance (measured using a spillage factor) and thermal energy production.

  14. Analysis of signal acquisition in GPS receiver software

    Directory of Open Access Journals (Sweden)

    Vlada S. Sokolović

    2011-01-01

    Full Text Available This paper presents a critical analysis of the flow signal processing carried out in GPS receiver software, which served as a basis for a critical comparison of different signal processing architectures within the GPS receiver. It is possible to achieve Increased flexibility and reduction of GPS device commercial costs, including those of mobile devices, by using radio technology software (SDR, Software Defined Radio. The SDR application can be realized when certain hardware components in a GPS receiver are replaced. Signal processing in the SDR is implemented using a programmable DSP (Digital Signal Processing or FPGA (Field Programmable Gate Array circuit, which allows a simple change of digital signal processing algorithms and a simple change of the receiver parameters. The starting point of the research is the signal generated on the satellite the structure of which is shown in the paper. Based on the GPS signal structure, a receiver is realized with a task to extract an appropriate signal from the spectrum and detect it. Based on collected navigation data, the receiver calculates the position of the end user. The signal coming from the satellite may be at the carrier frequencies of L1 and L2. Since the SPS is used in the civil service, all the tests shown in the work were performed on the L1 signal. The signal coming to the receiver is generated in the spread spectrum technology and is situated below the level of noise. Such signals often interfere with signals from the environment which presents a difficulty for a receiver to perform proper detection and signal processing. Therefore, signal processing technology is continually being improved, aiming at more accurate and faster signal processing. All tests were carried out on a signal acquired from the satellite using the SE4110 input circuit used for filtering, amplification and signal selection. The samples of the received signal were forwarded to a computer for data post processing, i. e

  15. United States Department of Energy solar receiver technology development

    Science.gov (United States)

    Klimas, P. C.; Diver, R. B.; Chavez, J. M.

    The United States Department of Energy (DOE), through Sandia National Laboratories, has been conducting a Solar Thermal Receiver Technology Development Program, which maintains a balance between analytical modeling, bench and small scale testing, and experimentation conducted at scales representative of commercially-sized equipment. Central receiver activities emphasize molten salt-based systems on large scales and volumetric devices in the modeling and small scale testing. These receivers are expected to be utilized in solar power plants rated between 100 and 200 MW. Distributed receiver research focuses on liquid metal refluxing devices. These are intended to mate parabolic dish concentrators with Stirling cycle engines in the 5 to 25 kW(sub e) power range. The effort in the area of volumetric receivers is less intensive and highly cooperative in nature. A ceramic foam absorber of Sandia design was successfully tested on the 200 kW(sub t) test bed at Plataforma Solar during 1989. Material integrity during the approximately 90-test series was excellent. Significant progress has been made with parabolic dish concentrator-mounted receivers using liquid metals (sodium or a potassium/sodium mixture) as heat transport media. Sandia has successfully solar-tested a pool boiling reflux receiver sized to power a 25 kW Stirling engine. Boiling stability and transient operation were both excellent. This document describes these activities in detail and will outline plans for future development.

  16. Introduction to heat transfer test setup for the SCRAP receiver

    Science.gov (United States)

    Lubkoll, Matti; Harms, Thomas M.; von Backström, Theodor W.

    2017-06-01

    The Spiky Central Receiver Air Pre-heater (SCRAP) receiver is a novel external tubular metallic central receiver concept. The SCRAP receiver is designed to increase an air-receivers solar-thermal performance. This is aimed to be achieved by enhancing heat transfer to the pressurized air-stream within the absorber assemblies (spikes) by utilizing an internally finned tube geometry. The fin shape is defined to create rectangular ducts as passages for the air flow, therewith a high heat transfer coefficient. The spikes are arranged in such a way that they trap incoming concentrated radiation (reduce reflection losses) and minimize thermal radiation losses from the receiver to ambient. In previous work, the modeling of a SCRAP receiver was discussed on. This included the modeling of the internal air flow and heat transfer within a spike, analysis of the optical characteristics of a SCRAP receiver and the impingement heat transfer capabilities in the spike tip (exposed to the highest flux). Further, analysis of the thermal interaction of spikes with one another and with ambient (convective and radiative heat loss) permitted drawing of first conclusions of the receiver performance potential. To validate the models predicting the pressurized air flow and heat transfer within a spike, an experimental test setup was designed, constructed and built at the heat transfer laboratories at Stellenbosch University. This work introduces the design of the test setup and will discuss preliminary results obtained during its commissioning. From first analysis the predictions made for the pressure drop within the internally finned section appear adequate. The heat transfer behavior will require further detailed analysis to develop sufficient confidence to allow for conclusions. Initial results, however, show good general agreement between measured and simulated data.

  17. Reasons for receiving or not receiving HPV vaccination in primary schoolgirls in Tanzania: a case control study.

    Directory of Open Access Journals (Sweden)

    Deborah Watson-Jones

    Full Text Available There are few data on factors influencing human papillomavirus (HPV vaccination uptake in sub-Saharan Africa. We examined the characteristics of receivers and non-receivers of HPV vaccination in Tanzania and identified reasons for not receiving the vaccine.We conducted a case control study of HPV vaccine receivers and non-receivers within a phase IV cluster-randomised trial of HPV vaccination in 134 primary schools in Tanzania. Girls who failed to receive vaccine (pupil cases and their parents/guardians (adult cases and girls who received dose 1 (pupil controls of the quadrivalent vaccine (Gardasil™ and their parents/guardians (adult controls were enrolled from 39 schools in a 1∶1 ratio and interviewed about cervical cancer, HPV vaccine knowledge and reasons why they might have received or not received the vaccine. Conditional logistic regression was used to determine factors independently associated with not receiving HPV vaccine.We interviewed 159 pupil/adult cases and 245 pupil/adult controls. Adult-factors independently associated with a daughter being a case were older age, owning fewer household items, not attending a school meeting about HPV vaccine, and not knowing anyone with cancer. Pupil-factors for being a case included having a non-positive opinion about the school de-worming programme, poor knowledge about the location of the cervix, and not knowing that a vaccine could prevent cervical cancer. Reasons for actively refusing vaccination included concerns about side effects and infertility. Most adult and pupil cases reported that they would accept the HPV vaccine if it were offered again (97% and 93% respectively.Sensitisation messages, especially targeted at older and poorer parents, knowledge retention and parent meetings are critical for vaccine acceptance in Tanzania. Vaccine side effects and fertility concerns should be addressed prior to a national vaccination program. Parents and pupils who initially decline vaccination

  18. Financial reserve. Hospitals leery of credit lines, factoring receivables.

    Science.gov (United States)

    Edwards, D E; Hamilton, W C; Hauser, R

    1991-10-01

    Opening lines of credit and factoring (selling) accounts receivable are two ways to generate operating cash that non-healthcare industries have long used successfully. A recent survey of hospital officials across the nation, however, showed these techniques are used infrequently in health care. Among the 281 hospitals responding: Only 45 percent use lines of credit; Less than 5 percent pursue accounts receivable factoring; and Only 12 percent plan to begin factoring receivables in the future. As hospitals look for ways to offset depleted cash reserves, these percentages may increase.

  19. A Collective Detection Based GPS Receiver for Small Satellites Project

    Data.gov (United States)

    National Aeronautics and Space Administration — To solve the problem of autonomous navigation on small satellite platforms less than 20 kg, we propose to develop an onboard orbit determination receiver for small...

  20. MULTI-GNSS RECEIVER FOR AEROSPACE NAVIGATION AND POSITIONING APPLICATIONS

    Directory of Open Access Journals (Sweden)

    T. R. Peres

    2014-03-01

    Full Text Available The upcoming Galileo system opens a wide range of new opportunities in the Global Navigation Satellite System (GNSS market. However, the characteristics of the future GNSS signals require the development of new GNSS receivers. In the frame of the REAGE project, DEIMOS and ISEL have developed a GNSS receiver targeted for aerospace applications, supporting current and future GPS L1 and Galileo E1 signals, based on commercial (or, in the furthest extent, industrial grade components. Although the REAGE project aimed at space applications, the REAGE receiver is also applicable to many terrestrial applications (ground or airborne, such as Georeferencing and Unmanned Aerial Vehicle (UAV navigation. This paper presents the architecture and features of the REAGE receiver, as well as some results of the validation campaign with GPS L1 and Galileo E1 signals.

  1. Wavelength Drift Corrector for Wind Lidar Receivers Project

    Data.gov (United States)

    National Aeronautics and Space Administration — We propose to develop and demonstrate an receiver system utilizing our novel technique for tracking and compensating for laser wavelength shifts in lidar systems....

  2. Lithospheric structure across the California Continental Borderland from receiver functions

    National Research Council Canada - National Science Library

    Reeves, Zachary; Lekić, Vedran; Schmerr, Nicholas; Kohler, Monica; Weeraratne, Dayanthie

    2015-01-01

    .... We map variations in present‐day lithospheric structure across the region using Ps and Sp receiver functions at permanent stations of the Southern California Seismic Network as well as ocean bottom seismometer (OBS...

  3. Detailed noise statistics for an optically preamplified direct detection receiver

    DEFF Research Database (Denmark)

    Danielsen, Søren Lykke; Mikkelsen, Benny; Durhuus, Terji

    1995-01-01

    We describe the exact statistics of an optically preamplified direct detection receiver by means of the moment generating function. The theory allows an arbitrary shaped electrical filter in the receiver circuit. The moment generating function (MGF) allows for a precise calculation of the error...... rate by using the inverse Fast Fourier transform (FFT). The exact results are compared with the usual Gaussian approximation (GA), the saddlepoint approximation (SAP) and the modified Chernoff bound (MCB). This comparison shows that the noise is not Gaussian distributed for all values of the optical...... amplifier gain. In the region from 20-30 dB gain, calculations show that the GA underestimates the receiver sensitivity while the SAP is very close to the results of our exact model. Using the MGF derived in the article we then find the optimal bandwidth of the electrical filter in the receiver circuit...

  4. Initial results for compressive sensing in electronic support receiver systems

    CSIR Research Space (South Africa)

    Du Plessis, WP

    2011-04-01

    Full Text Available The agile bandwidths of modern radars mean that Electronic Support (ES) receivers require wide instantaneous bandwidths leading to high data rates. Compressive sensing is shown to be a promising technique for reducing data rates for a number...

  5. Higher performance and lower cost optical DPSK receiver Project

    Data.gov (United States)

    National Aeronautics and Space Administration — To demonstrate (benchtop experiment) a DPSK receiver with a free-space interferometer, showing that fiber-optic coupling, associated adaptive optics, and optical...

  6. Asymmetric Hardware Distortions in Receive Diversity Systems: Outage Performance Analysis

    KAUST Repository

    Javed, Sidrah

    2017-02-22

    This paper studies the impact of asymmetric hardware distortion (HWD) on the performance of receive diversity systems using linear and switched combining receivers. The asymmetric attribute of the proposed model motivates the employment of improper Gaussian signaling (IGS) scheme rather than the traditional proper Gaussian signaling (PGS) scheme. The achievable rate performance is analyzed for the ideal and non-ideal hardware scenarios using PGS and IGS transmission schemes for different combining receivers. In addition, the IGS statistical characteristics are optimized to maximize the achievable rate performance. Moreover, the outage probability performance of the receive diversity systems is analyzed yielding closed form expressions for both PGS and IGS based transmission schemes. HWD systems that employ IGS is proven to efficiently combat the self interference caused by the HWD. Furthermore, the obtained analytic expressions are validated through Monte-Carlo simulations. Eventually, non-ideal hardware transceivers degradation and IGS scheme acquired compensation are quantified through suitable numerical results.

  7. An Evaluation of Hepatotoxicity in Breast Cancer Patients Receiving ...

    African Journals Online (AJOL)

    hanumantp

    liver injury may be affected by pre-existing medical problems, ... investigation was a prospective study that was conducted in cancer patients receiving ... study using the patient information format and the written ... Adult (36-50) ..... Last updated.

  8. Using a referee to resolve shipper-receiver differences

    Energy Technology Data Exchange (ETDEWEB)

    Tietjen, G.L.

    1981-01-01

    Within the nuclear community, shipper-receiver differences generate considerable concern. Current methods of resolving these differences are discussed, prticularly the use of an umpire or referee. Numerous statistical problems connected with the present procedures are also considered.

  9. Monolithic optoelectronic integrated broadband optical receiver with graphene photodetectors

    Directory of Open Access Journals (Sweden)

    Cheng Chuantong

    2017-07-01

    Full Text Available Optical receivers with potentially high operation bandwidth and low cost have received considerable interest due to rapidly growing data traffic and potential Tb/s optical interconnect requirements. Experimental realization of 65 GHz optical signal detection and 262 GHz intrinsic operation speed reveals the significance role of graphene photodetectors (PDs in optical interconnect domains. In this work, a novel complementary metal oxide semiconductor post-backend process has been developed for integrating graphene PDs onto silicon integrated circuit chips. A prototype monolithic optoelectronic integrated optical receiver has been successfully demonstrated for the first time. Moreover, this is a firstly reported broadband optical receiver benefiting from natural broadband light absorption features of graphene material. This work is a perfect exhibition of the concept of monolithic optoelectronic integration and will pave way to monolithically integrated graphene optoelectronic devices with silicon ICs for three-dimensional optoelectronic integrated circuit chips.

  10. Receiving vectors of muon telescope of cosmic ray station "Novosibirsk"

    Science.gov (United States)

    Yanchukovskiy, Valeriy; Grigoryev, Vladislav; Krimsky, Germogen; Kuzmenko, Vasiliy; Molchanov, Anton

    2016-03-01

    The method of receiving vectors allows us to determine cosmic ray anisotropy at each moment. Also, the method makes it possible to study fast anisotropy fluctuations related to the interplanetary medium dynamics. Receiving vectors have been calculated earlier for neutron monitors and muon telescopes. However, the most of muon telescopes of the network of cosmic ray stations for which calculations were made does not operate now. In recent years, new improved detectors appeared. Unfortunately, the use of them is limited because of absence of receiving coefficients. These detectors include the matrix telescope in Novosibirsk. Therefore, components of receiving vector for muon telescopes of observation cosmic ray station "Novosibirsk" have been defined. Besides, design features of the facility, its orientation, and directional diagram depending on zenith and azimuth angles were taken into account. Also, for the system of telescopes, we allowed for coupling coefficients found experimentally using the test detector.

  11. Monolithic optoelectronic integrated broadband optical receiver with graphene photodetectors

    Science.gov (United States)

    Cheng, Chuantong; Huang, Beiju; Mao, Xurui; Zhang, Zanyun; Zhang, Zan; Geng, Zhaoxin; Xue, Ping; Chen, Hongda

    2017-07-01

    Optical receivers with potentially high operation bandwidth and low cost have received considerable interest due to rapidly growing data traffic and potential Tb/s optical interconnect requirements. Experimental realization of 65 GHz optical signal detection and 262 GHz intrinsic operation speed reveals the significance role of graphene photodetectors (PDs) in optical interconnect domains. In this work, a novel complementary metal oxide semiconductor post-backend process has been developed for integrating graphene PDs onto silicon integrated circuit chips. A prototype monolithic optoelectronic integrated optical receiver has been successfully demonstrated for the first time. Moreover, this is a firstly reported broadband optical receiver benefiting from natural broadband light absorption features of graphene material. This work is a perfect exhibition of the concept of monolithic optoelectronic integration and will pave way to monolithically integrated graphene optoelectronic devices with silicon ICs for three-dimensional optoelectronic integrated circuit chips.

  12. David Nolfi Receives NAHRS Award for Professional Excellence

    Directory of Open Access Journals (Sweden)

    Maureen Diana Sasso

    2013-09-01

    Full Text Available News AnnouncementDavid A. Nolfi, MLS, AHIP, Health Sciences Librarian & Library Assessment Coordinator at Duquesne University’s Gumberg Library, received the 2013 NAHRS Award for Professional Excellence at the One Health Conference in Boston, MA.

  13. Wavelength Drift Corrector for Wind Lidar Receivers Project

    Data.gov (United States)

    National Aeronautics and Space Administration — We propose a key innovation to improve wavelength-sensitive lidar measurements (such as wind velocity) using photon-counting receivers. A novel binning technique to...

  14. The Effect of Two Receivers on Broadcast Molecular Communication Systems.

    Science.gov (United States)

    Lu, Yi; Higgins, Matthew D; Noel, Adam; Leeson, Mark S; Chen, Yunfei

    2016-12-01

    Molecular communication is a paradigm that utilizes molecules to exchange information between nano-machines. When considering such systems where multiple receivers are present, prior work has assumed for simplicity that they do not interfere with each other. This paper aims to address this issue and shows to what extent an interfering receiver, [Formula: see text], will have an impact on the target receiver, [Formula: see text], with respect to Bit Error Rate (BER) and capacity. Furthermore, approximations of the Binomial distribution are applied to reduce the complexity of calculations. Results show the sensitivity in communication performance due to the relative location of the interfering receiver. Critically, placing [Formula: see text] between the transmitter [Formula: see text] and [Formula: see text] causes a significant increase in BER or decrease in capacity.

  15. Next generation GNSS single receiver cycle slip reliability

    NARCIS (Netherlands)

    Teunissen, P.J.G.; De Bakker, P.F.

    2009-01-01

    In this contribution we study the multi-frequency, carrier-phase slip detection capabilities of a single receiver. Our analysis is based on an analytical expression that we present for themulti-frequencyminimal detectable carrier phase cycle slip.

  16. Optical Communication over Plastic Optical Fibers Integrated Optical Receiver Technology

    CERN Document Server

    Atef, Mohamed

    2013-01-01

    This book presents high-performance data transmission over plastic optical fibers (POF) using integrated optical receivers having good properties with multilevel modulation, i.e. a higher sensitivity and higher data rate transmission over a longer plastic optical fiber length. Integrated optical receivers and transmitters with high linearity are introduced for multilevel communication. For binary high-data rate transmission over plastic optical fibers, an innovative receiver containing an equalizer is described leading also to a high performance of a plastic optical fiber link. The cheap standard PMMA SI-POF (step-index plastic optical fiber) has the lowest bandwidth and the highest attenuation among multimode fibers. This small bandwidth limits the maximum data rate which can be transmitted through plastic optical fibers. To overcome the problem of the plastic optical fibers high transmission loss, very sensitive receivers must be used to increase the transmitted length over POF. The plastic optical fiber li...

  17. Water Fluoridation Statistics - Percent of PWS population receiving fluoridated water

    Data.gov (United States)

    U.S. Department of Health & Human Services — 2000-2014. Water Fluoridation Statistics is a biennial report of the percentage and number of people receiving fluoridated water from 2000 through 2014, originally...

  18. Water Fluoridation Statistics - Percent of PWS population receiving fluoridated water

    Data.gov (United States)

    U.S. Department of Health & Human Services — 2000-2014 Water Fluoridation Statistics is a biennial report of the percentage and number of people receiving fluoridated water from 2000 through 2014, originally...

  19. Low Complexity Receiver Design for MIMO-Radar

    KAUST Repository

    Ahmed, Sajid

    2012-09-08

    In this work, an algorithm for the multiple-input multiple-output (MIMO) radar is proposed. It has low computational complexity compared to the available schemes, and relatively low side-lobe-levels in the receive beampattern compared to the phased-array and MIMO-radar. In the proposed algorithm, the received signal vector of MIMO-radar is divided into sub-vectors, and each sub-vector is multiplied with the corresponding weight vector. The number of sub-vectors and weight vectors are optimally found to maximise the received signal power from the target of interest direction. The proposed scheme can be effectively applied in passive radars to minimise the side-lobe levels and place deep nulls for interferers in the receive beampattern. Simulation results show that the proposed scheme has relatively lower side lobe levels and better detection capabilities compared to MIMO-radar and phased-array.

  20. RF-Frontend Design for Process-Variation-Tolerant Receivers

    CERN Document Server

    Sakian, Pooyan; van Roermund, Arthur

    2012-01-01

    This book discusses a number of challenges faced by designers of wireless receivers, given complications caused by the shrinking of electronic and mobile devices circuitry into ever-smaller sizes and the resulting complications on the manufacturability, production yield, and the end price of the products.  The authors describe the impact of process technology on the performance of the end product and equip RF designers with countermeasures to cope with such problems.  The mechanisms by which these problems arise are analyzed in detail and novel solutions are provided, including design guidelines for receivers with robustness to process variations and details of circuit blocks that obtain the required performance level. Describes RF receiver frontends and their building blocks from a system- and circuit-level perspective; Provides system-level analysis of a generic RF receiver frontend with robustness to process variations; Includes details of CMOS circuit design at 60GHz and reconfigurable circuits at 60GHz...

  1. A Low-Complexity High-Performance Bluetooth Receiver

    OpenAIRE

    Tibenderana, C.; Weiss, S.

    2003-01-01

    This paper presents an implementation of a GFSK receiver based on matched filtering of a sequence of K successive bits. This enables improved detection and superior BER perfroamcne but requires 2^K matched filters of considerable ciomplexity. Exploiting redundancy and performing phase propagation of successive single-bit stages, we propose a new receiver structure of low complexity. Simultion results presented highlight the benefits of the proposed method in terms of computational cost and pe...

  2. Long-term heating to improve receiver performance

    Science.gov (United States)

    Glatzmaier, Greg C.; Cable, Robert; Newmarker, Marc

    2017-06-01

    The buildup of hydrogen in the heat transfer fluid (HTF) that circulates through components of parabolic trough power plants decreases receiver thermal efficiency, and ultimately, it decreases plant performance and electricity output. The generation and occurrence of hydrogen in the HTF provides the driving force for hydrogen to permeate from the HTF through the absorber tube wall and into the receiver annulus. Getters adsorb hydrogen from the annulus volume until they saturate and are no longer able to maintain low hydrogen pressure. The increase in hydrogen pressure within the annulus significantly degrades thermal performance of the receiver and decreases overall power-plant efficiency. NREL and Acciona Energy North America (Acciona) are developing a method to control the levels of dissolved hydrogen in the circulating HTF. The basic approach is to remove hydrogen from the expansion tanks of the HTF subsystem at a rate that maintains hydrogen in the circulating HTF to a target level. Full-plant steady-state models developed by the National Renewable Energy Laboratory (NREL) predict that if hydrogen is removed from the HTF within the expansion tanks, the HTF that circulates through the collector field remains essentially free of hydrogen until the HTF returns to the power block in the hot headers. One of the key findings of our modeling is the prediction that hydrogen will reverse-permeate out of the receiver annulus if dissolved hydrogen in the HTF is kept sufficiently low. To test this prediction, we performed extended heating of an in-service receiver that initially had high levels of hydrogen in its annulus. The heating was performed using NREL's receiver test stand. Results of our testing showed that receiver heat loss steadily decreased with daily heating, resulting in a corresponding improvement in receiver thermal efficiency.

  3. GNSS/INS Integration using Software Defined Radio Receiver

    OpenAIRE

    Aravindan, Avinash Manu

    2012-01-01

    [ANGLÈS] The aim of the thesis is to provide a simplified basic framework for the implementation of GNSS/INS integration using SDR receiver. This thesis investigates the different architectures of integration between the inertial navigation system and the GNSS receiver and the advantages and disadvantages of each. The integration is implemented in MATLAB using simulated GPS and inertial sensor data. [CASTELLÀ] El objetivo de la tesis es proporcionar un marco simplificado para la implementa...

  4. The lithosphere-asthenosphere boundary observed with USArray receiver functions

    OpenAIRE

    Kumar, P.; Yuan, X.; Kind, R.; Mechie, J.

    2012-01-01

    The dense deployment of seismic stations so far in the western half of the United States within the USArray project provides the opportunity to study in greater detail the structure of the lithosphere-asthenosphere system. We use the S receiver function technique for this purpose, which has higher resolution than surface wave tomography, is sensitive to seismic discontinuities, and is free from multiples, unlike P receiver functions. Only two major discontinuities are observed in the entire a...

  5. Practical Receiver for Optimal Discrimination of Binary Coherent Signals

    Science.gov (United States)

    Sych, Denis; Leuchs, Gerd

    2016-11-01

    We address the long-standing problem of discriminating coherent states with the minimum error rate. We show an optimum receiver for coherent states which admits a relatively simple implementation with current technologies. The receiver is based on multichannel splitting of the signal, followed by feed-forward signal displacement and photon-counting detection. We develop an optimal control strategy for a finite signal split and show convergence of the error rate to the Helstrom bound.

  6. Influence of Frequency Offset on Modified EGC Diversity Receiver

    Directory of Open Access Journals (Sweden)

    B. Z. Nikolić

    2013-11-01

    Full Text Available In this paper a performance analysis of a modified M-ary phase-shift-keying (MPSK signal diversity receiver with a predetection equal gain combiner (EGC will be presented. The modification is in introducing a structure that performs the estimation with remodulation (ER. The EGC combining is realized by using a constant modulus algorithm (CMA. The influence of carrier frequency offset, length of ER structure and other parameters of the receiver will be examined.

  7. Receiving Right/Wrong Feedback: Consequences for Learning

    OpenAIRE

    Fazio, Lisa K.; Huelser, Barbie J.; Johnson, Aaron; Marsh, Elizabeth J.

    2010-01-01

    Prior work suggests that receiving feedback that one's response was correct or incorrect (right/wrong feedback) does not help learners, as compared to not receiving any feedback at all (Pashler, Cepeda, Wixted, & Rohrer, 2005). In three experiments, we examined the generality of this conclusion. Right/wrong feedback did not aid error correction, regardless of whether subjects learned facts embedded in prose (Exp. 1) or translations of foreign vocabulary (Exp. 2). While right/wrong feedback di...

  8. Long-Term Heating to Improve Receiver Performance

    Energy Technology Data Exchange (ETDEWEB)

    Glatzmaier, Greg C.; Cable, Robert; Newmarker, Marc

    2017-06-27

    The buildup of hydrogen in the heat transfer fluid (HTF) that circulates through components of parabolic trough power plants decreases receiver thermal efficiency, and ultimately, it decreases plant performance and electricity output. The generation and occurrence of hydrogen in the HTF provides the driving force for hydrogen to permeate from the HTF through the absorber tube wall and into the receiver annulus. Getters adsorb hydrogen from the annulus volume until they saturate and are no longer able to maintain low hydrogen pressure. The increase in hydrogen pressure within the annulus significantly degrades thermal performance of the receiver and decreases overall power-plant efficiency. NREL and Acciona Energy North America (Acciona) are developing a method to control the levels of dissolved hydrogen in the circulating HTF. The basic approach is to remove hydrogen from the expansion tanks of the HTF subsystem at a rate that maintains hydrogen in the circulating HTF to a target level. Full-plant steady-state models developed by the National Renewable Energy Laboratory (NREL) predict that if hydrogen is removed from the HTF within the expansion tanks, the HTF that circulates through the collector field remains essentially free of hydrogen until the HTF returns to the power block in the hot headers. One of the key findings of our modeling is the prediction that hydrogen will reverse-permeate out of the receiver annulus if dissolved hydrogen in the HTF is kept sufficiently low. To test this prediction, we performed extended heating of an in-service receiver that initially had high levels of hydrogen in its annulus. The heating was performed using NREL's receiver test stand. Results of our testing showed that receiver heat loss steadily decreased with daily heating, resulting in a corresponding improvement in receiver thermal efficiency.

  9. Information privacy, the right to receive information and (mobile ICTs

    Directory of Open Access Journals (Sweden)

    Litska Strikwerda

    2010-07-01

    Full Text Available The first part of this paper is about the notion of (information privacy and its grounding in law. It discusses the tension between the right to privacy and the right to receive information. The second part of this paper explores how (mobile ICTs challenge and complicate privacy claims and satisfy the right to receive information.http://dx.doi.org/10.5324/eip.v4i2.1761

  10. Molecular Spectroscopy With a Compact 557-GHz Heterodyne Receiver

    DEFF Research Database (Denmark)

    Neumaier, Philipp F.-X.; Richter, Heiko; Stake, Jan

    2014-01-01

    a membrane GaAs Schottky diode mixer. All sub-components are newly developed and optimized with regard to the overall receiver performance such as noise temperature, power consumption, weight and physical size. The receiver works at room temperature, has a double sideband noise temperature as low as 2000 K...... of methanol absorption lines were determined, that agree with other published data. Using the experimentally determined molecular parameters the CH3OH absorption spectrum could be modeled with very high precision....

  11. Design optimization improves IFM/DFD receiver accuracy

    Science.gov (United States)

    Sullivan, William B.

    1992-09-01

    A number of tradeoffs are described which are necessary to be made in the design of instantaneous-frequency-measurement (IFM) receivers and digital frequency discriminators (DFDs) to ensure minimal frequency error. IFM/DFD receivers are used in electronic-warfare systems which are designed to provide signal sorting and identification capability. A wideband IFM/DFD systems employ a parallel array of microwave correlators, the RF amplifier, the power divider, and the frequency processor.

  12. Blood Products Provided to Patients Receiving Futile Critical Care.

    Science.gov (United States)

    Neville, Thanh H; Ziman, Alyssa; Wenger, Neil S

    2017-09-01

    The number of hospitalized patients receiving treatment perceived to be futile is not insignificant. Blood products are valuable resources that are donated to help others in need. We aimed to quantify the amount of blood transfused into patients who were receiving treatment that the critical care physician treating them perceived to be futile. During a 3-month period, critical care physicians in 5 adult intensive care units completed a daily questionnaire to identify patients perceived as receiving futile treatment. Of 1136 critically ill patients, physicians assessed 123 patients (11%) as receiving futile treatment. Fifty-nine (48%) of the 123 patients received blood products after they were assessed to be receiving futile treatment: 242 units of packed red blood cells (PRBCs) (7.6% of all PRBC units transfused into critical care patients during the 3-month study period); 161 (9.9%) units of plasma, 137 (12.1%) units of platelets, and 21 (10.5%) units of cryoprecipitate. Explicit guidelines on the use of blood products should be developed to ensure that the use of this precious resource achieves meaningful goals. © 2017 Society of Hospital Medicine.

  13. Receiver buffer requirement for video streaming over TCP

    Science.gov (United States)

    Kim, Taehyun; Ammar, Mostafa H.

    2006-01-01

    TCP is one of the most widely used transport protocols for video streaming. However, the rate variability of TCP makes it difficult to provide good video quality. To accommodate the variability, video streaming applications require receiver-side buffering. In current practice, however, there are no systematic guidelines for the provisioning of the receiver buffer, and smooth playout is insured through over-provisioning. In this work, we are interested in memory-constrained applications where it is important to determine the right size of receiver buffer in order to insure a prescribed video quality. To that end, we characterize video streaming over TCP in a systematic and quantitative manner. We first model a video streaming system analytically and derive an expression of receiver buffer requirement based on the model. Our analysis shows that the receiver buffer requirement is determined by the network characteristics and desired video quality. Experimental results validate our model and demonstrate that the receiver buffer requirement achieves desired video quality.

  14. Wake-up receiver based ultra-low-power WBAN

    CERN Document Server

    Lont, Maarten; Roermund, Arthur van

    2014-01-01

    This book presents the cross-layer design and optimization of wake-up receivers for wireless body area networks (WBAN), with an emphasis on low-power circuit design. This includes the analysis of medium access control (MAC) protocols, mixer-first receiver design, and implications of receiver impairments on wideband frequency-shift-keying (FSK) receivers. Readers will learn how the overall power consumption is reduced by exploiting the characteristics of body area networks. Theoretical models presented are validated with two different receiver implementations, in 90nm and 40nm CMOS technology.   • Provides an overview of wireless body area network design from the network layer to the circuit implementation, and an overview of the cross-layer design trade-offs; • Discusses design at both the network or MAC-layer and circuit-level, with an emphasis on circuit design; • Covers the design of low-power frequency shift keying (FSK) wake-up-receivers; • Validates theory presented with two different recei...

  15. Holographic Optical Receiver Front End for Wireless Infrared Indoor Communications

    Science.gov (United States)

    Jivkova, S.; Kavehrad, M.

    2001-06-01

    Multispot diffuse configuration (MSDC) for indoor wireless optical communications, utilizing multibeam transmitter and angle diversity detection, is one of the most promising ways of achieving high capacities for use in high-bandwidth islands such as classrooms, hotel lobbies, shopping malls, and train stations. Typically, the optical front end of the receiver consists of an optical concentrator to increase the received optical signal power and an optical bandpass filter to reject the ambient light. Using the unique properties of holographic optical elements (HOE), we propose a novel design for the receiver optical subsystem used in MSDC. With a holographic curved mirror as an optical front end, the receiver would achieve more than an 10-dB improvement in the electrical signal-to-noise ratio compared with a bare photodetector. Features such as multifunctionality of the HOE and the receiver s small size, light weight, and low cost make the receiver front end a promising candidate for a user s portable equipment in broadband indoor wireless multimedia access.

  16. High Sensitivity Very Low Frequency Receiver for Earthquake Data Acquisition.

    Science.gov (United States)

    Munir, A.; Najmurrokhman, A.

    2017-03-01

    high sensitivity very low frequency (VLF) receiver is developed based on AD744 monolithic operational amplifier (Op-Amp) for earthquake data acquisition. In research related natural phenomena such as atmospheric noise, lightning and earthquake, a VLF receiver particularly with high sensitivity is utterly required due to the low power of VLF wave signals received by the antenna. The developed receiver is intended to have high sensitivity reception for the signals in frequency range of 10-30kHz allocated for earthquake observation. The VLF receiver which is portably designed is also equipped with an output port connectable to the soundcard of personal computer for further data acquisition. After obtaining the optimum design, the hardware realization is implemented on a printed circuit board (PCB) for experimental characterization. It shows that the sensitivity of realized VLF receiver is almost linear in the predefined frequency range for the input signals lower than -12dBm and to be quadratic for the higher level input signals.

  17. Conceptual design of advanced central receiver power systems sodium-cooled receiver concept. Volume 2, Book 2. Appendices. Final report

    Energy Technology Data Exchange (ETDEWEB)

    1979-03-01

    The appendices include: (A) design data sheets and P and I drawing for 100-MWe commercial plant design, for all-sodium storage concept; (B) design data sheets and P and I drawing for 100-MWe commercial plant design, for air-rock bed storage concept; (C) electric power generating water-steam system P and I drawing and equipment list, 100-MWe commercial plant design; (D) design data sheets and P and I drawing for 281-MWe commercial plant design; (E) steam generator system conceptual design; (F) heat losses from solar receiver surface; (G) heat transfer and pressure drop for rock bed thermal storage; (H) a comparison of alternative ways of recovering the hydraulic head from the advanced solar receiver tower; (I) central receiver tower study; (J) a comparison of mechanical and electromagnetic sodium pumps; (K) pipe routing study of sodium downcomer; and (L) sodium-cooled advanced central receiver system simulation model. (WHK)

  18. The UNCITRAL Convention on the Assignment of Receivables in International Trade, assignment of future receivables and Turkish law.

    OpenAIRE

    Akseli, N. Orkun

    2006-01-01

    The Assignment of receivables is an important financing technique the regulation of which varies from legal system to legal system. In December 2001, the Convention on the Assignment of Receivables in International Trade made by the United Nations Commission on International Trade (“the UNCITRAL Convention”)1 was adopted by the General Assembly2. The UNCITRAL Convention was prepared for the purposes of establishing a model for the modernisation of domestic assignment law and as a first substa...

  19. Performance and durability testing of parabolic trough receivers

    Science.gov (United States)

    Lei, Dongqiang; Fu, Xuqiang; Zhao, Dongming; Yuan, Guofeng; Wang, Zhifeng; Guo, Minghuan

    2017-06-01

    The paper describes the key performance and durability testing facilities of the parabolic trough receiver developed by Institute of Electrical Engineering, Chinese Academy of Sciences. The indoor heat loss test can be applied at 4-7 different temperature levels within 200-550 on receivers. The optical efficiency test bench consists of 12 metal halide lamps as the solar simulator and a 5 m length half-elliptical cylinder reflector with flat end reflectors. 3 ultra-precision temperature sensors are used in receiver each end to get the temperature difference. The residual gas analysis test bench is applied to analyze and predict the vacuum lifetime of the receiver. It can test the variations of composition and partial pressure of residual gases with temperature and time in the receiver annulus space by a high sensitivity quadrupole mass spectrometer gas analyzer. A coating accelerated ageing test bench, which is also used to test the thermal cycle, has been developed. This test bench uses the absorber tube of the recevier as the resistance heater to heat up the whole receiver. The coating lifetime can be predicted by the Arrhenius parameters. For the cycling test, the compressed air is used to directly cool the inner surface of the absorber tube. The thermal cycling test is performed with temperature cycles from 150 °C to 450 °C for 160 cycles. The maximum thermal cycling frequency is 8 cycles per day. The mechanical fatigue test bench is used to test the bellows and the glass-to-metal seals durability at the same time. Both bellows are expanded and compressed to 6.5 mm in turn with 10,000 cycles. A new rotating test bench was also developed to test the thermal efficiency of the receiver.

  20. Review and Future Perspective of Central Receiver Design and Performance

    Energy Technology Data Exchange (ETDEWEB)

    Zhu, Guangdong; Libby, Cara

    2017-06-27

    Concentrating solar power (CSP) technology provides a commercial solar option to the utility-scale electricity market. CSP is unique in its ability to include low-cost thermal storage; thus, it can generate electricity when the sun is not available and dispatch electricity to meet varying load requirements. Within the suite of CSP technologies, the central receiver design represents the state-of-the-art technology, promising low cost, high performance, and dispatchable energy production. Current total capacity of central receiver plants worldwide is about 1.0 gigawatt (electric) with operating plants in Spain and the United States, as well as projects under construction in Asia, the Middle East, and North Africa. Central receiver technology has been under development since the 1950s, and a variety of central receiver designs have been explored. A distinguishing feature is the heat transfer medium. Central receiver designs exist that use dense fluids, gases, and solid particles in this role. Water/steam and molten salt receivers have been adopted in current commercial plants and are often coupled with a steam-Rankine power cycle with an operating temperature of less than 600 degrees C. Many new central receiver concepts, such as the volumetric air, supercritical carbon dioxide (sCO2), solid particle, and liquid-metal receiver designs, are under active research and development (R&D). New designs target operating temperatures generally higher than 700 degrees C-800 degrees C -- and even above 1000 degrees C -- so that higher-performance power cycles such as the sCO2-Brayton cycle or air-Brayton/steam-Rankine combined cycle can be used to promote greater overall system efficiency. Central receiver thermal storage provides dispatchability unavailable from variable-output renewables such as solar photovoltaic and wind power. Case study analysis of the California grid shows that there is a limit on the amount of non-dispatchable renewable generation that the grid can

  1. Review and future perspective of central receiver design and performance

    Science.gov (United States)

    Zhu, Guangdong; Libby, Cara

    2017-06-01

    Concentrating solar power (CSP) technology provides a commercial solar option to the utility-scale electricity market. CSP is unique in its ability to include low-cost thermal storage; thus, it can generate electricity when the sun is not available and dispatch electricity to meet varying load requirements. Within the suite of CSP technologies, the central receiver design represents the state-of-the-art technology, promising low cost, high performance, and dispatchable energy production. Current total capacity of central receiver plants worldwide is about 1.0 gigawatt (electric) with operating plants in Spain and the United States, as well as projects under construction in Asia, the Middle East, and North Africa. Central receiver technology has been under development since the 1950s, and a variety of central receiver designs have been explored. A distinguishing feature is the heat transfer medium. Central receiver designs exist that use dense fluids, gases, and solid particles in this role. Water/steam and molten salt receivers have been adopted in current commercial plants and are often coupled with a steam-Rankine power cycle with an operating temperature of less than 600°C. Many new central receiver concepts, such as the volumetric air, supercritical carbon dioxide (sCO2), solid particle, and liquid-metal receiver designs, are under active research and development (R&D). New designs target operating temperatures generally higher than 700°C-800°C—and even above 1000°C—so that higher-performance power cycles such as the sCO2-Brayton cycle or air-Brayton/steam-Rankine combined cycle can be used to promote greater overall system efficiency. Central receiver thermal storage provides dispatchability unavailable from variable-output renewables such as solar photovoltaic and wind power. Case study analysis of the California grid shows that there is a limit on the amount of non-dispatchable renewable generation that the grid can accommodate, beyond which

  2. Clinical importance of Demodex folliculorum in patients receiving phototherapy.

    Science.gov (United States)

    Kulac, Mustafa; Ciftci, Ihsan Hakki; Karaca, Semsettin; Cetinkaya, Zafer

    2008-01-01

    Patients with immunodeficiency are prone to infestation with Demodex folliculorum mites. Ultraviolet (UV) radiation can lead to immunosuppression and sebaceous gland hyperplasia. Although some cases of demodicidosis related to UV radiation exposure have been reported, no studies have been performed on the incidence of D. folliculorum and its clinical characteristics in patients receiving phototherapy. Objective To investigate the effects of phototherapy on the density of D. folliculorum infestation and its clinical characteristics. This was a cross-sectional study. Forty-five patients receiving phototherapy and 43 age- and sex-matched healthy controls were enrolled to the study. The sociodemographic characteristics, occupational information, and skin types (2, 3, 4, or 5) of both patients and controls were carefully recorded. The dermatologic diseases requiring phototherapy, type and number of phototherapy treatments, and cumulative UV doses of all patients were noted. The clinical findings that may relate to demodicidosis were recorded. Standardized skin surface biopsies were taken from three anatomic regions (forehead, cheek, and nasal dorsum) and suspected lesions; five or more D. folliculorum mites per square centimeter of skin was defined as demodicidosis. Twelve (26.7%) patients received psoralen plus UV-A (PUVA) and 33 (73.3%) received narrow-band UV-B. Demodicidosis was detected in 13 (28.9%) patients and three (7%) controls. The difference in the demodicidosis rate between patients and controls was statistically significant (P = 0.01). In eight of the 13 patients (61.5%) with demodicidosis, clinical demodicidosis was present. Demodicidosis was present in seven of the 12 patients (58.3%) receiving PUVA and in six of the 33 patients (18.2%) receiving narrow-band UV-B. The difference in demodicidosis rates between patients receiving PUVA and those receiving narrow-band UV-B was statistically significant (P = 0.02). A statistically significant difference was

  3. Receiving versus being denied an abortion and subsequent drug use.

    Science.gov (United States)

    Roberts, Sarah C M; Rocca, Corinne H; Foster, Diana Greene

    2014-01-01

    Some research finds that women receiving abortions are at increased risk of subsequent drug use and drug use disorders. This literature is rife with methodological problems, particularly inappropriate comparison groups. This study used data from the Turnaway Study, a prospective, longitudinal study of women who sought abortions at 30 sites across the U.S. Participants included women presenting just prior to an abortion facility's gestational age limit who received abortions (Near Limit Abortion Group, n=452), just beyond the gestational limit who were denied abortions (Turnaways, n=231), and who received first trimester abortions (First Trimester Abortion Group, n=273). This study examined the relationship between receiving versus being denied an abortion and subsequent drug use over two years. Trajectories of drug use were compared using multivariate mixed effects regression. Any drug use, frequency of drug use, and marijuana use did not change over time among women in any group. There were no differential changes over time in any drug use, frequency of drug use, or marijuana use between groups. However, Turnaways who ultimately gave birth increased use of drugs other than marijuana compared to women in the Near Limit Abortion Group (p=.041), who did not increase use. Women receiving abortions did not increase drug use over two years or have higher levels of drug use than women denied abortions. Assertions that abortion leads women to use drugs to cope with the stress of abortion are not supported. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

  4. Design of DGPS Receiver Based on the Net of VRS

    Directory of Open Access Journals (Sweden)

    Yun XU

    2014-02-01

    Full Text Available To improve the positioning accuracy of the GPS system, the differential technology based on real time kinematic is utilized. Comparing with the conventional differential technology, the differential technology based on the virtual reference station can minimize the size of the rover station which is of great significance for the small system such as the mini-type unmanned vehicle, smart ammunitions and so on. Due to the high cost of the GPS receivers in the market which can’t be redeveloped and the limitation of their interface, it is not suitable for the application of the embedded system. In this paper, the receiver based on the aforementioned method is proposed to realize the real time differential positioning. Firstly, the concept of differential positioning based on real time kinematic is explained. Next, the composition of the virtual reference system and its working principle are introduced. And then, the design of differential GPS receiver based on the virtual reference system for rover station is illustrated. Finally, from the repeatability test, the result shows that by means of getting the differential corrections from the virtual reference station, the designed differential GPS receiver can correct the errors caused by ionosphere, troposphere and atmospheric refraction. Moreover, it can improve the positioning accuracy to centimeter-level. With low cost, small size and convertibility of the interface of the designed differential GPS receiver according to the embedded system, it will be popular in the future market.

  5. Testing of the Prototype Receiver for ITER ECE Diagnostic

    Directory of Open Access Journals (Sweden)

    Danani S.

    2017-01-01

    Full Text Available The Electron Cyclotron Emission (ECE diagnostic system in ITER provides essential information for plasma control and for evaluating the plasma performance. It measures the electron temperature profile (edge/core, electron temperature fluctuations and radiated power in the electron cyclotron frequency range from the plasma. Virginia Diodes Inc. (VDI has designed and developed a state-of-the-art prototype receiver to detect emission in the 200-300 GHz frequency range. The prototype receiver developed by VDI has been tested at DIII-D tokamak to check its performance by measuring higher frequency ECE harmonics in high temperature plasmas. Bench testing verifies the receiver’s band coverage and noise temperatures. Good sensitivity has been obtained meeting the ITER requirement. Also, the receiver performance is assessed for ITER by comparing the data from the receiver and the existing Michelson interferometer for the same DIII-D plasma shot. The measurement results show that the receiver provides accurate temperature information for the plasma emission throughout the frequency band.

  6. Smooth time-dependent receiver operating characteristic curve estimators.

    Science.gov (United States)

    Martínez-Camblor, Pablo; Pardo-Fernández, Juan Carlos

    2017-01-01

    The receiver operating characteristic curve is a popular graphical method often used to study the diagnostic capacity of continuous (bio)markers. When the considered outcome is a time-dependent variable, two main extensions have been proposed: the cumulative/dynamic receiver operating characteristic curve and the incident/dynamic receiver operating characteristic curve. In both cases, the main problem for developing appropriate estimators is the estimation of the joint distribution of the variables time-to-event and marker. As usual, different approximations lead to different estimators. In this article, the authors explore the use of a bivariate kernel density estimator which accounts for censored observations in the sample and produces smooth estimators of the time-dependent receiver operating characteristic curves. The performance of the resulting cumulative/dynamic and incident/dynamic receiver operating characteristic curves is studied by means of Monte Carlo simulations. Additionally, the influence of the choice of the required smoothing parameters is explored. Finally, two real-applications are considered. An R package is also provided as a complement to this article.

  7. Airborne demonstration of a quantum key distribution receiver payload

    Science.gov (United States)

    Pugh, Christopher J.; Kaiser, Sarah; Bourgoin, Jean-Philippe; Jin, Jeongwan; Sultana, Nigar; Agne, Sascha; Anisimova, Elena; Makarov, Vadim; Choi, Eric; Higgins, Brendon L.; Jennewein, Thomas

    2017-06-01

    Satellite-based quantum terminals are a feasible way to extend the reach of quantum communication protocols such as quantum key distribution (QKD) to the global scale. To that end, prior demonstrations have shown QKD transmissions from airborne platforms to receivers on ground, but none have shown QKD transmissions from ground to a moving aircraft, the latter scenario having simplicity and flexibility advantages for a hypothetical satellite. Here, we demonstrate QKD from a ground transmitter to a receiver prototype mounted on an airplane in flight. We have specifically designed our receiver prototype to consist of many components that are compatible with the environment and resource constraints of a satellite. Coupled with our relocatable ground station system, optical links with distances of 3-10 km were maintained and quantum signals transmitted while traversing angular rates similar to those observed of low-Earth-orbit satellites. For some passes of the aircraft over the ground station, links were established within 10 s of position data transmission, and with link times of a few minutes and received quantum bit error rates typically ≈3%-5% , we generated secure keys up to 868 kb in length. By successfully generating secure keys over several different pass configurations, we demonstrate the viability of technology that constitutes a quantum receiver satellite payload and provide a blueprint for future satellite missions to build upon.

  8. Single Cell Analysis of a Bacterial Sender-Receiver System.

    Science.gov (United States)

    Ramalho, Tiago; Meyer, Andrea; Mückl, Andrea; Kapsner, Korbinian; Gerland, Ulrich; Simmel, Friedrich C

    2016-01-01

    Monitoring gene expression dynamics on the single cell level provides important information on cellular heterogeneity and stochasticity, and potentially allows for more accurate quantitation of gene expression processes. We here study bacterial senders and receivers genetically engineered with components of the quorum sensing system derived from Aliivibrio fischeri on the single cell level using microfluidics-based bacterial chemostats and fluorescence video microscopy. We track large numbers of bacteria over extended periods of time, which allows us to determine bacterial lineages and filter out subpopulations within a heterogeneous population. We quantitatively determine the dynamic gene expression response of receiver bacteria to varying amounts of the quorum sensing inducer N-3-oxo-C6-homoserine lactone (AHL). From this we construct AHL response curves and characterize gene expression dynamics of whole bacterial populations by investigating the statistical distribution of gene expression activity over time. The bacteria are found to display heterogeneous induction behavior within the population. We therefore also characterize gene expression in a homogeneous bacterial subpopulation by focusing on single cell trajectories derived only from bacteria with similar induction behavior. The response at the single cell level is found to be more cooperative than that obtained for the heterogeneous total population. For the analysis of systems containing both AHL senders and receiver cells, we utilize the receiver cells as 'bacterial sensors' for AHL. Based on a simple gene expression model and the response curves obtained in receiver-only experiments, the effective AHL concentration established by the senders and their 'sending power' is determined.

  9. Performance Evaluation of Irbene RT-16 Radio Telescope Receiving System

    Directory of Open Access Journals (Sweden)

    Bleiders M.

    2017-12-01

    Full Text Available In the present paper, recent measurement results of refurbished Irbene RT-16 radio telescope receiving system performance are presented. The aim of the research is to evaluate characteristics of RT-16, which will allow carrying out necessary amplitude calibration in both single dish and VLBI observations, to improve the performance of existing system as well as to monitor, control and compare performance if possible changes in the receiving system will occur in future. The evaluated receiving system is 16 m Cassegrain antenna equipped with a cryogenic receiver with frequency range from 4.5 to 8.8 GHz, which is divided into four sub-bands. Multiple calibration sessions have been carried out by observing stable astronomical sources with known flux density by using in-house made total power registration backend. First, pointing offset calibration has been carried out and pointing model coefficients calculated and applied. Then, amplitude calibration, namely antenna sensitivity, calibration diode equivalent flux density and gain curve measurements have been carried out by observing calibration sources at different antenna elevations at each of the receiver sub-bands. Beam patterns have also been evaluated at different frequency bands. As a whole, acquired data will serve as a reference point for comparison in future performance evaluation of RT-16.

  10. Quad channel software defined receiver for passive radar application

    Directory of Open Access Journals (Sweden)

    Pető Tamás

    2017-03-01

    Full Text Available In recent times the growing utilization of the electromagnetic environment brings the passive radar researches more and more to the fore. For the utilization of the wide range of illuminators of opportunity the application of wideband radio receivers is required. At the same time the multichannel receiver structure has also critical importance in target direction finding and interference suppression. This paper presents the development of a multichannel software defined receiver specifically for passive radar applications. One of the relevant feature of the developed receiver platform is its up-to-date SoC (System on hip based structure, which greatly enhance the integration and signal processing capacity of the system, all while keeping the costs low. The software defined operation of the discussed receiver system is demonstrated with using DVB-T (Digital Video Broadcast – Terrestrial signal as illuminator of opportunity. During this demonstration the multichannel capabilities of the realized system are also tested with real data using direction finding and beamforming algorithms.

  11. Performance evaluation of GPS receiver under equatorial scintillation

    Directory of Open Access Journals (Sweden)

    Alison de Oliveira Moraes

    2009-06-01

    Full Text Available Equatorial scintillation is a phenomenon that occurs daily in the equatorial region after the sunset and affects radio signals that propagate through the ionosphere. Depending on the temporal and spatial situation, equatorial scintillation can represent a problem in the availability and precision of the Global Positioning System (GPS. This work is concerned with evaluating the impact of equatorial scintillation on the performance of GPS receivers. First, the morphology and statistical model of equatorial scintillation is briefly presented. A numerical model that generates synthetic scintillation data to simulate the effects of equatorial scintillation is presented. An overview of the main theoretical principles on GPS receivers is presented. The analytical models that describe the effects of scintillation at receiver level are presented and compared with numerical simulations using a radio software receiver and synthetic data. The results achieved by simulation agreed quite well with those predicted by the analytical models. The only exception is for links with extreme levels of scintillation and when weak signals are received.

  12. Low Noise Amplifiers and Receivers for Remote Sensing

    Science.gov (United States)

    Kangaslahti, Pekka; Lim, Boon; Gaier, Todd; Tanner, Alan; Varonen, Mikko; Samoska, Lorene; Brown, Shannon; Lambrigtsen, Bjorn; Reising, Steven; Tanabe, Jordan; hide

    2011-01-01

    The study of atmospheric dynamics and climatology depend on accurate and frequent measurements of temperature and humidity profiles of the atmosphere. These measurements furthermore enable highly accurate measurements of ocean topography by providing total column water vapour data for radar path delay correction. The atmospheric temperature profile is characterised at the oxygen molecule absorption frequencies (60 and 118 GHz) and the humidity profile at the water molecule absorption frequencies (23 and 183 GHz). Total column measurements can be achieved by comparing measured radiometric temperatures at atmospheric window channels, such as 90, 130 and 166 GHz. The standard receiver technology for these frequencies was diode mixers with MMIC LNAs being applied at the lower frequencies. The sensitivity of millimetre wave receivers improved significantly with the introduction of the low noise 35 nm gate length InP MMIC amplifiers. We currently achieve 3 dB noise figure at 180 GHz and 2 dB noise figure at 90 GHz with our MMIC low noise amplifiers (LNAs) in room temperature. These amplifiers and the receivers we have built using them made it possible to conduct highly accurate airborne measurement campaigns from the Global Hawk unmanned aerial vehicle, develop millimeter wave internally calibrated radiometers for altimeter radar path delay correction, and build prototypes of large arrays of millimeter receivers for a geostationary interferometric sounder. We use the developed millimeter wave receivers to measure temperature and humidity profiles in the atmosphere and in hurricanes as well as to characterize the path delay error in ocean topography altimetry.

  13. Is phenytoin contraindicated in patients receiving cranial irradiation?

    Energy Technology Data Exchange (ETDEWEB)

    Borg, M.F. [Royal Adelaide Hospital, SA (Australia); Probert, J.C. [Auckland Hospital, Auckland (New Zealand). Dept. of Radiation Oncology; Zwi, L.J. [Auckland Univ. (New Zealand). Dept. of Medicine and Surgery

    1995-02-01

    Three recent publications have reported the development of erythema multiforme and Stevens-Johnson syndrome in patients receiving cranial irradiation and sodium phenytoin. Some authors have recommended that patients receiving whole brain radiation therapy and who have had seizures should not be prescribed phenytoin but an alternative anticonvulsant. This article reviews the current literature pertaining to the development of this potentially lethal complication in patients receiving whole brain radiation and phenytoin, with reference to the single recorded case of Stevens-Johnson syndrome in a patient receiving cranial irradiation and phenytoin in Auckland, New Zealand. While the clinical picture in the 16 patients reported in the literature and the current case report differed from the classical form of erythema multiforme, a similar pattern of presentation and outcome appeared in all patients reviewed, suggesting that the combination of phenytoin, cranial irradiation and the gradual reduction of concomitant steroids seem to lead to the development of erythema multiforme and/or Stevens-Johnson syndrome. The data presented, although sparse, suggest that phenytoin should not be prescribed in patients receiving cranial irradiation. 21 refs., 2 tabs., 3 figs.

  14. SDR implementation of the receiver of adaptive communication system

    Science.gov (United States)

    Skarzynski, Jacek; Darmetko, Marcin; Kozlowski, Sebastian; Kurek, Krzysztof

    2016-04-01

    The paper presents software implementation of a receiver forming a part of an adaptive communication system. The system is intended for communication with a satellite placed in a low Earth orbit (LEO). The ability of adaptation is believed to increase the total amount of data transmitted from the satellite to the ground station. Depending on the signal-to-noise ratio (SNR) of the received signal, adaptive transmission is realized using different transmission modes, i.e., different modulation schemes (BPSK, QPSK, 8-PSK, and 16-APSK) and different convolutional code rates (1/2, 2/3, 3/4, 5/6, and 7/8). The receiver consists of a software-defined radio (SDR) module (National Instruments USRP-2920) and a multithread reception software running on Windows operating system. In order to increase the speed of signal processing, the software takes advantage of single instruction multiple data instructions supported by x86 processor architecture.

  15. Group delay variations of GPS transmitting and receiving antennas

    Science.gov (United States)

    Wanninger, Lambert; Sumaya, Hael; Beer, Susanne

    2017-09-01

    GPS code pseudorange measurements exhibit group delay variations at the transmitting and the receiving antenna. We calibrated C1 and P2 delay variations with respect to dual-frequency carrier phase observations and obtained nadir-dependent corrections for 32 satellites of the GPS constellation in early 2015 as well as elevation-dependent corrections for 13 receiving antenna models. The combined delay variations reach up to 1.0 m (3.3 ns) in the ionosphere-free linear combination for specific pairs of satellite and receiving antennas. Applying these corrections to the code measurements improves code/carrier single-frequency precise point positioning, ambiguity fixing based on the Melbourne-Wübbena linear combination, and determination of ionospheric total electron content. It also affects fractional cycle biases and differential code biases.

  16. Central receiver power plant: an environmental, ecological, and socioeconomic analysis

    Energy Technology Data Exchange (ETDEWEB)

    Davison, M.; Grether, D.

    1977-06-01

    The technical details of the central receiver design are reviewed. Socio-economic questions are considered including: market penetration, air industrial sector model, demands on industry, employment, effluents associated with manufacture of components, strains due to intensive construction, water requirements, and land requirements. The ecological effects in the vicinity of the central receiver plant site are dealt with, with emphasis on effects on land surface, mammals, and reptiles and amphibians. Climatological considerations are reviewed including: desert types, effects of surface albedo modification, effects of aerosols, effects on evaporation rates, the heliostat canopy, effects on turbulent transfer rates, effects on the wind profile, a model of convection about a central receiver plant, and a global scenario. Drawings of heliostat and plant design are included in appendices. (MHR)

  17. System for transmitting and receiving multi-polarized signals

    DEFF Research Database (Denmark)

    2016-01-01

    The present disclosure relates to: an optical receiver, configured to receive at least three multiplexed, differently polarized, optically transmitted signals, each signal associated with a predefined state of polarization, said receiver comprising a multi- polarization analyzer for obtaining...... an analyzed signal for each of said polarized signals, wherein at least one of said analyzed signals comprises data in the full Stokes space; an optical transmitter, configured to transmit at least three multiplexed, differently polarized, optically transmitted signals, wherein at least one of said polarized...... signals comprises data in the full Stokes space; a system configured to communicate optically over a communication link, comprising: an optical transmitter, configured to generate and multiplex at least three independent data signals having different states of polarization into a multiplexed signal...

  18. An Analog Correlator for Ultra-Wideband Receivers

    Directory of Open Access Journals (Sweden)

    Tu Chunjiang

    2005-01-01

    Full Text Available We present a new analog circuit exhibiting high bandwidth and low distortion, specially designed for signal correlation in an ultra-wideband receiver front end. The ultra-wideband short impulse signals are correlated with a local pulse template by the correlator. A comparator then samples the output for signal detection. A typical Gilbert mixer core is adopted for multiplication of broadband signals up to . As a result of synchronization of the received signal and the local template, the output voltage level after integration and sampling can reach up to , which is sufficient for detection by the comparator. The circuit dissipates about from double voltage supplies of and using SiGe BiCMOS technology. Simulation results are presented to show the feasibility of this circuit design for use in ultra-wideband receivers.

  19. UWB-Based Tracking of Autonomous Vehicles with Multiple Receivers

    Science.gov (United States)

    Busanelli, Stefano; Ferrari, Gianluigi

    In this paper, we consider real-time tracking of an Autonomous Guided Vehicle (AGV) in an indoor industrial scenario. An on-board odometer provides information about the dynamic state of the AGV, allowing to predict its pose (position and orientation). At the same time, an external Ultra Wide Band (UWB) wireless network provides the information necessary to compensate the error drift accumulated by the odometer. Two novel alternative solutions for real-time tracking are proposed: (i) a classical Time Differences of Arrivals (TDOA) approach with a single receiver; (ii) a "Twin-receiver" TDOA (TTDOA) approach, that requires the presence of two independent receivers on the AGV. The performance of the two proposed algorithms is evaluated in realistic conditions. The obtained results clearly show the tradeoff existing between the frequency of UWB measurements and their quality.

  20. An automated test system for terahertz receiver characterization

    Science.gov (United States)

    Kuenzi, Linda C.; Groppi, Christopher E.; Wheeler, Caleb H.; Mani, Hamdi

    2014-07-01

    An automated test system was developed to characterize detectors for the Kilopixel Array Pathfinder Project (KAPPa), a 16-pixel 2D integrated heterodyne focal plane array. Although primarily designed for KAPPa, the system can be used with other instruments to automate tests that might be tedious and time-consuming by hand. Mechanical components include an adjustable structure of aluminum t-slot framing that supports a rotating chopper. Driven by a stepper motor, the wheel alternates between blackbodies at room temperature and 77 K. The cold load consists of absorbing material submerged in liquid nitrogen in an open Styrofoam cooler. Python scripts control the mechanical system, interface with receiver components, and process data. Test system operation was verified by sweeping the local oscillator frequency with a Virginia Diodes room temperature receiver. The system was then integrated with the KAPPa receiver to allow complete and automated testing of all array pixels with minimal user intervention.

  1. The majority of sick children receive paracetamol during the winter

    DEFF Research Database (Denmark)

    Ertmann, Ruth Kirk; Møller, Janne Julie; Waldorff, Frans Boch

    2012-01-01

    -administered paracetamol in toddlers during a winter-period in relation to symptoms, doctor contacts and severity-rated illness. MATERIAL AND METHODS: The study was conducted as a prospective diary study covering a three-month winter-period. It comprised a cohort of 183 infants born in February 2001 in a district...... of the capital area in Denmark. RESULTS: According to the parents, a total of 119 toddlers (65%) received paracetamol at least once during the study period; 9.3% of the toddlers received paracetamol for more than ten days. The administration of paracetamol rose as the number of symptoms increased. Paracetamol....... CONCLUSION: The majority of ill toddlers received paracetamol if they had several symptoms. However, paracetamol was administrated in 37% of days with fever. This use of paracetamol seems reasonable as the parents differentiate between degrees of illness and withhold paracetamol until the second day...

  2. A novel mirror diversity receiver for indoor MIMO visible light

    KAUST Repository

    Park, Ki-Hong

    2016-03-01

    In this paper, we propose and study a non-imaging receiver design reducing the correlation of channel matrix for indoor multiple-input multiple-output (MIMO) visible light communication (VLC) systems. Contrary to previous works, our proposed mirror diversity receiver (MDR) not only blocks the reception of light on one specific direction but also improves the channel gain on the other direction by receiving the light reflected by a mirror deployed between the photodetectors. We analyze the channel capacity and optimal height of mirror in terms of maximum channel capacity for a 2 -by-2 MIMO-VLC system in a 2-dimensional geometric model.We prove that this constructive and destructive effects in channel matrix resulting from our proposed MDR are more beneficial to obtain well-conditioned channel matrix which is suitable for implementing spatial-multiplexing MIMO-VLC systems in order to support high data rate.

  3. Development of the Multi-Level Seismic Receiver (MLSR)

    Energy Technology Data Exchange (ETDEWEB)

    Sleefe, G.E.; Engler, B.P.; Drozda, P.M.; Franco, R.J.; Morgan, J.

    1995-02-01

    The Advanced Geophysical Technology Department (6114) and the Telemetry Technology Development Department (2664) have, in conjunction with the Oil Recovery Technology Partnership, developed a Multi-Level Seismic Receiver (MLSR) for use in crosswell seismic surveys. The MLSR was designed and evaluated with the significant support of many industry partners in the oil exploration industry. The unit was designed to record and process superior quality seismic data operating in severe borehole environments, including high temperature (up to 200{degrees}C) and static pressure (10,000 psi). This development has utilized state-of-the-art technology in transducers, data acquisition, and real-time data communication and data processing. The mechanical design of the receiver has been carefully modeled and evaluated to insure excellent signal coupling into the receiver.

  4. GPS Receiver and Satellite DCB Estimation using Ionospheric TEC

    Science.gov (United States)

    Choi, Byung-Kyu; Cho, Sung-Ki; Lee, Sang-Jeong

    2009-06-01

    We estimated the receiver and satellite differential code bias (DCB) based on the ionospheric total electron content (TEC) estimation method. The GPS network which has been operated by the Korea Astronomy and Space Science Institute (KASI) was designed to calculate TEC. The receiver and satellite DCB values were obtained from the weighted least square method with time interval for one hour. The results represented that the receiver DCB values are mostly varying within ±2 meter and are derived comparatively stable within three days. The estimated mean values of the satellite DCB show the maximum and minimum values of 4.09 nano-second (ns), --6.28ns respectively. We could detect great variations of TEC over 9 TECU difference at any time when the DCB sets were applied to TEC estimation.

  5. GPS Receiver and Satellite DCB Estimation using Ionospheric TEC

    Directory of Open Access Journals (Sweden)

    Byung-Kyu Choi

    2009-06-01

    Full Text Available We estimated the receiver and satellite differential code bias (DCB based on the ionospheric total electron content (TEC estimation method. The GPS network which has been operated by the Korea Astronomy and Space Science Institute (KASI was designed to calculate TEC. The receiver and satellite DCB values were obtained from the weighted least square method with time interval for one hour. The results represented that the receiver DCB values are mostly varying within ±2 meter and are derived comparatively stable within three days. The estimated mean values of the satellite DCB show the maximum and minimum values of 4.09 nano-second (ns, --6.28ns respectively. We could detect great variations of TEC over 9 TECU difference at any time when the DCB sets were applied to TEC estimation.

  6. Cylindrical PVDF film transmitters and receivers for air ultrasound.

    Science.gov (United States)

    Toda, Minoru

    2002-05-01

    Cylindrical polyvinylidene fluoride (PVDF) film transducers for transmission and reception of 40-kHz ultrasonic waves in air have been investigated. A key feature of such transducers is their omni-directional polar response. An optimized structure comprises a cylindrical PVDF film element resting on a spool without a mechanical bond to it. Various key design equations to obtain the required ultrasonic performance both as transmitter and receiver are shown, which include resonance frequency, acoustic pressure, angle performance, back air cavity effect, and receiver sensitivity. Measurements of actual frequency response of transmitter output and receiver sensitivity, angular performance, back air space effect, and temperature effect are presented. The results agree well with the theoretical predictions. It has been shown that this device is well-suited for practical application as an ultrasonic ranging device.

  7. Low Noise Amplifier Receivers from Millimeter Wave Atmospheric Remote Sensing

    Science.gov (United States)

    Kangaslahti, Pekka; Lim, Boon; Gaier, Todd; Tanner, Alan; Varonen, Mikko; Samoska, Lorene; Brown, Shannon; Lambrigsten, Bjorn; Reising, Steven; Tanabe, Jordan; hide

    2012-01-01

    We currently achieve 3.4 dB noise figure at 183GHz and 2.1 dB noise figure at 90 GHz with our MMIC low noise amplifiers (LNAs) in room temperature. These amplifiers and the receivers we have built using them made it possible to conduct highly accurate airborne measurement campaigns from the Global Hawk unmanned aerial vehicle, develop millimeter wave internally calibrated radiometers for altimeter radar path delay correction, and build prototypes of large arrays of millimeter receivers for a geostationary interferometric sounder. We use the developed millimeter wave receivers to measure temperature and humidity profiles in the atmosphere and in hurricanes as well as to characterize the path delay error in ocean topography altimetry.

  8. Respiratory source control versus receiver protection: impact of facemask fit.

    Science.gov (United States)

    Mansour, Mohamed Mohsen; Smaldone, Gerald C

    2013-06-01

    Placing a surgical mask on an infected patient (respiratory source control) may offer a health-care worker (HCW) more protection than donning an N95 respirator (receiver protection). This observation was made in an in vitro study that used hard, nondeformable faces, and the lack of proper N95 fit may have accounted for the observed results. In the present study, we test the effects of fit on respiratory source control protection, using a soft, deformable mannequin head. Resusci Anne CPR mannequin heads were placed in a chamber allowing 6 air exchanges/hr (14 cubic feet per minute), to simulate an infected patient (source) and an HCW (receiver). The heads were ventilated with a tidal breathing pattern. The source exhaled radioactive aerosols, and a filter was attached to the receiver to quantify inhaled exposure. N95 respirators and surgical masks were tested on both heads. The degree of protection was expressed by calculating the reduction in exposure expressed as a simulated workplace protection factor (sWPF; the ratio of exposure with mask to exposure without mask) compared statistically using confidence intervals. Use of the Resusci Anne heads resulted in improved fit, with higher sWPF than previously reported, for example, for source N95 mask combinations (7,174 vs. 317) as well as receiver (7.53 vs. 1.37). Masks placed on the receiver provided minimal exposure protection (sWPF range 0.99-7.53), except when sealed with Vaseline (sWPF 63.1). Any mask applied to the source mannequin resulted in significant reductions in exposure (sWPF range 214-17,038). Improved fit significantly enhanced the effects of source control protection. A Vaseline-sealed N95 respirator on the receiver offered less protection when compared with any mask on the source. Respiratory source control can offer more protection to HCW and potentially decrease the spread of aerosolized infections.

  9. Baseline Receiver Concept for a Next Generation Very Large Array

    Science.gov (United States)

    Srikanth, Sivasankaran; Wes Grammer, Silver Sturgis, Rob Selina

    2018-01-01

    The Next Generation Very Large Array (ngVLA) is envisioned to be an interferometric array with 10 times the effective collecting area and spatial resolution as the current VLA, operating over a frequency range of 1.2-116 GHz. Achieving these goals will require 214 antennas of nominal 18m diameter, on baselines of 300km. Maximizing sensitivity for each receiver band, while also minimizing the overall operating cost are the primary design goals. Therefore, receivers and feeds will be cryogenically cooled, with multiple bands integrated into a common cryostat to the greatest extent possible. Using feed designs that yield broad bandwidths and high aperture efficiencies are key to meeting these goals.The proposed receiver configuration will be implemented as six independent bands, each with its own feed. The upper five bands will be integrated into a single compact cryostat, while the lowest-frequency band occupies a second cryostat of similar volume and mass. The lowest-band feed is cooled to 80K, while all other feeds are cooled to 20K.For optimum performance at the higher frequencies, waveguide-bandwidth (~1.66:1) receivers are proposed to cover 12.6 – 50.5 GHz and 70 – 116 GHz in four separate bands, integrated into a single cryostat. Excellent LNA noise performance is readily achievable, and using waveguide throughout the signal chain reduces losses and their associated noise contributions, without adding undue size or weight. An axially-corrugated conical feed horn with wide flare angle (~50degree half-angle), based on a design by G. Cortes and L. Baker, is being considered for these receivers.For continuous coverage between 1.2 – 12.6 GHz, waveguide or even octave-bandwidth receivers are not cost-effective, given the > 10:1 frequency range. For these bands, wideband (3.25:1) receivers mated to a Caltech-designed quad-ridge feed horn (QRFH) are proposed. These feeds are highly compact, and cryogenically cooled to reduce losses ahead of the LNAs. Aperture

  10. Early Death from Rabies Despite of Receiving Immunoglobulin and Vaccine

    Directory of Open Access Journals (Sweden)

    Mahmood Sadeghi

    2015-05-01

    Full Text Available Rabies is a viral disease with the high rate of mortality, which is non-curable after presenting clinical signs weather in humans or animals. Persons who are bitten by suspicious animals can be protected from rabies, in case of early referring to the health care preventive centers. However, the rate of durability and safety are questionable among those received immunoglobulin and vaccine. Here, it was reported a 57 year-old woman who was bitten by a jackal and died, despite of receiving immunoglobulin and rabies vaccine.  

  11. A Fast Adaptive Receive Antenna Selection Method in MIMO System

    Directory of Open Access Journals (Sweden)

    Chaowei Wang

    2013-01-01

    Full Text Available Antenna selection has been regarded as an effective method to acquire the diversity benefits of multiple antennas while potentially reduce hardware costs. This paper focuses on receive antenna selection. According to the proportion between the numbers of total receive antennas and selected antennas and the influence of each antenna on system capacity, we propose a fast adaptive antenna selection algorithm for wireless multiple-input multiple-output (MIMO systems. Mathematical analysis and numerical results show that our algorithm significantly reduces the computational complexity and memory requirement and achieves considerable system capacity gain compared with the optimal selection technique in the same time.

  12. Features of the compost received by use of dairy whey

    Directory of Open Access Journals (Sweden)

    V. V. Smolnikova

    2010-01-01

    Full Text Available In the article features cjmposting of organic materials are considered at use of a traditional way and fermenting additives. Indicators of quality of the composts received with the use of dairy whey and a bacterial preparation as the fermenting additive are investigated. Comparison of the received samples of composts on such indicators of quality as is spent: humidity, acidity, the maintenance of organic substance in recalculation on dry weight, quantity of the general and fmmonium nitrogen.

  13. Baseband receiver design for wireless MIMO-OFDM communications

    CERN Document Server

    Chiueh, Tzi-Dar; Lai I-Wei; Chiueh, Tzi-Dar

    2012-01-01

    The Second Edition of OFDM Baseband Receiver Design for Wirless Communications, this book expands on the earlier edition with enhanced coverage of MIMO techniques, additional baseband algorithms, and more IC design examples. The authors cover the full range of OFDM technology, from theories and algorithms to architectures and circuits. The book gives a concise yet comprehensive look at digital communication fundamentals before explaining signal processing algorithms in receivers. The authors give detailed treatment of hardware issues - from architecture to IC implementation. Links OFDM and M.

  14. Adaptive Receive and Transmit Apodization for Synthetic Aperture Ultrasound Imaging

    DEFF Research Database (Denmark)

    Holfort, Iben Kraglund; Austeng, Andreas; Synnevåg, Johan-Fredrik

    2009-01-01

    This paper suggests a framework for utilizing adaptive, data-dependent apodization weights on both the receiving and transmitting aperture for Synthetic Aperture (SA) ultrasound imaging. The suggested approach is based on the Minimum Variance (MV) beamformer and consists of two steps. A set...... of uniquely designed receive apodization weights are applied to pre-summed element data forming a set of adaptively weighted images; these are in SA literature conventionally referred to as low-resolution images. The adaptive transmit apodization is obtained by applying MV across the full set of single...

  15. Baseload Nitrate Salt Central Receiver Power Plant Design Final Report

    Energy Technology Data Exchange (ETDEWEB)

    Tilley, Drake [Abengoa Solar LLC, Lakewood, CO (United States); Kelly, Bruce [Abengoa Solar LLC, Lakewood, CO (United States); Burkholder, Frank [Abengoa Solar LLC, Lakewood, CO (United States)

    2014-12-12

    The objectives of the work were to demonstrate that a 100 MWe central receiver plant, using nitrate salt as the receiver coolant, thermal storage medium, and heat transport fluid in the steam generator, can 1) operate, at full load, for 6,400 hours each year using only solar energy, and 2) satisfy the DOE levelized energy cost goal of $0.09/kWhe (real 2009 $). To achieve these objectives the work incorporated a large range of tasks relating to many different aspects of a molten salt tower plant. The first Phase of the project focused on developing a baseline design for a Molten Salt Tower and validating areas for improvement. Tasks included a market study, receiver design, heat exchanger design, preliminary heliostat design, solar field optimization, baseline system design including PFDs and P&IDs and detailed cost estimate. The baseline plant met the initial goal of less than $0.14/kWhe, and reinforced the need to reduce costs in several key areas to reach the overall $0.09/kWhe goal. The major improvements identified from Phase I were: 1) higher temperature salt to improve cycle efficiency and reduce storage requirements, 2) an improved receiver coating to increase the efficiency of the receiver, 3) a large receiver design to maximize storage and meet the baseload hours objective, and 4) lower cost heliostat field. The second Phase of the project looked at advancing the baseline tower with the identified improvements and included key prototypes. To validate increasing the standard solar salt temperature to 600 °C a dynamic test was conducted at Sandia. The results ultimately proved the hypothesis incorrect and showed high oxide production and corrosion rates. The results lead to further testing of systems to mitigate the oxide production to be able to increase the salt temperature for a commercial plant. Foster Wheeler worked on the receiver design in both Phase I and Phase II looking at both design and lowering costs utilizing commercial fossil boiler

  16. Delay in Seeking and Receiving Emergency Obstetric Care in Eritrea.

    African Journals Online (AJOL)

    MBY

    Objective: To determine the extent of and main reasons for failure or delay in seeking and receiving emergency obstetric care. Methods: The study was ... The study involved quantitative and in-depth qualitative, investigation of the causes factors ... care services were viewed as resulting from a multiple causes. The following ...

  17. Should a hospitalized child receive empiric treatment with acyclovir?

    Directory of Open Access Journals (Sweden)

    Kulik Dina M

    2012-12-01

    Full Text Available Abstract Background Herpes simplex encephalitis is associated with substantial morbidity and mortality and may be related to timely diagnosis and treatment. While awaiting the results of testing, hospitalization and empiric treatment with acyclovir is recommended, though the direct and indirect costs associated with this management are substantial. We sought to examine children hospitalized for possible herpes simplex encephalitis, following clinical and laboratory assessment in the emergency department, and empiric treatment with acyclovir, in order to describe the proportion receiving a complete course of treatment; and to identify the clinical variables which are associated with receiving a complete course, as compared with an incomplete course of acyclovir. Methods Hospitalized children prescribed acyclovir were included in this case control study. Clinical, laboratory and diagnostic variables were abstracted for children prescribed a complete (≥ 14 days or an incomplete course ( Results 289 children met eligibility criteria, 30 (10% received a complete course and 259 (90% received an incomplete course. A history of mucocutaneous herpes simplex virus infection (p  Conclusions Many children did not complete a full course of therapy. Unnecessary testing and treatment is burdensome to families and the health care system. Possible predictive variables include abnormal Glascow Coma Scale, focal neurologic findings and cerebrospinal fluid pleocytosis.

  18. Sportmen's experiences at a somatology clinic receiving a sport ...

    African Journals Online (AJOL)

    2013-06-03

    Jun 3, 2013 ... The men experienced the sports massage as relaxing and giving perceived holistic beneficial effects. They described their ... anxiety or tension headaches. Receiving a massage can help alleviate stress in the ... to help prepare for exercise, expedite recovery from muscle soreness, and enhance athletic ...

  19. Evaluation of drug therapy problems among renal patients receiving ...

    African Journals Online (AJOL)

    Purpose: To determine the prevalence of drug therapy problems (DTPs), identify the types of DTPs and assess outcomes of DTP interventions among renal patients receiving care in three Nigerian tertiary hospitals. Methods: This prospective descriptive study was conducted in nephrology units of three tertiary hospitals in ...

  20. The Economic Impact of Medical Migration: A Receiving Country's Perspective

    NARCIS (Netherlands)

    Rutten, M.M.

    2009-01-01

    This paper seeks to determine the macroeconomic impacts of migration of skilled medical personnel from a receiving country's perspective. The resource allocation issues are explored in theory, by developing an extension of the Rybczynski theorem in a low-dimension Heckscher–Ohlin framework, and

  1. Improved timing recovery in wireless mobile receivers | Olwal ...

    African Journals Online (AJOL)

    In the proposed method, the receiver exploits the soft decisions computed at each turbo decoding iteration to provide reliable estimates of a soft timing signal, which in turn, improves the decoding time. The derived method, based on sequential minimization techniques, approaches the theoretical Cramer-Rao bound with ...

  2. Intention of College Students to Receive the Human Papillomavirus Vaccine

    Science.gov (United States)

    Richards, Keith

    2016-01-01

    Purpose: The purpose of this paper is to better understand what influences the intentions of college students to receive the human papillomavirus (HPV) vaccine. HPV is the most common sexually transmitted infection in the USA and cancers related to HPV are on the rise. Design/Methodology/Approach: A 2×2 experimental design was used to predict the…

  3. 34 CFR 303.113 - Reviewing public comments received.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 2 2010-07-01 2010-07-01 false Reviewing public comments received. 303.113 Section 303.113 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION AND REHABILITATIVE SERVICES, DEPARTMENT OF EDUCATION EARLY INTERVENTION PROGRAM FOR INFANTS AND...

  4. Acoustic transmitter and receiver performance in freshwater and estuarine environments

    Science.gov (United States)

    We report on the performance of passive acoustic receivers intended to detect the passage of 281 acoustically tagged migratory salmonids in two Oregon coastal watersheds. We found that ambient acoustic noise can vary considerably with location, and that “sync” pulses thought to ...

  5. Fully Integrated SAW-Less Discrete-Time Superheterodyne Receiver

    NARCIS (Netherlands)

    Madadi, I.

    2015-01-01

    There are nowadays strong business and technical demands to integrate radio- frequency (RF) receivers (RX) into a complete system-on-chip (SoC) realized in scaled digital processes technology. As a consequence, the RF circuitry has to function well in face of reduced power supply ( V DD ) while the

  6. Software defined radio receivers exploiting noise cancelling: A tutorial review

    NARCIS (Netherlands)

    Klumperink, Eric A.M.; Nauta, Bram

    2014-01-01

    Traditional radio receivers were narrowband and dedicated to a single frequency band exploiting LC tanks, whereas software defined radios target a flexibly programmable frequency. The broadband noise cancelling circuit technique has proven useful to achieve this target, as it breaks the traditional

  7. Compact implementation of dynamic receive apodization in ultrasound scanners

    DEFF Research Database (Denmark)

    Tomov, Borislav Gueorguiev; Jensen, Jørgen Arendt

    2004-01-01

    The image quality in medical ultrasound scanners is determined by several factors, one of which is the ability of the receive beamformer to change the aperture weighting function with depth and beam angle. In digital beamformers, precise dynamic apodization can be achieved by representing the fun...

  8. Production response of lambs receiving creep feed while grazing ...

    African Journals Online (AJOL)

    The aim of the study was to determine the production responses of lambs receiving either creep feed or not while grazing two different pastures. The production of ewes within each treatment was also recorded. The study was conducted at both the Kromme Rhee and Langgewens Research Farms. At Kromme Rhee, sheep ...

  9. Actors with Multi-Headed Message Receive Patterns

    DEFF Research Database (Denmark)

    Sulzmann, Martin; Lam, Edmund Soon Lee; Van Weert, Peter

    2008-01-01

    The actor model provides high-level concurrency abstractions to coordinate simultaneous computations by message passing. Languages implementing the actor model such as Erlang commonly only support single-headed pattern matching over received messages. We propose and design an extension of Erlang ...

  10. Average weighted receiving time in recursive weighted Koch networks

    Indian Academy of Sciences (India)

    Motivated by the empirical observation in airport networks and metabolic networks, we introduce the model of the recursive weighted Koch networks created by the recursive division method. As a fundamental dynamical process, random walks have received considerable interest in the scientific community. Then, we study ...

  11. A Fully Integrated Discrete-Time Superheterodyne Receiver

    NARCIS (Netherlands)

    Tohidian, M.; Madadi, I.; Staszewski, R.B.

    2016-01-01

    The zero/low intermediate frequency (IF) receiver (RX) architecture has enabled full CMOS integration. As the technology scales and wireless standards become ever more challenging, the issues related to time-varying dc offsets, the second-order nonlinearity, and flicker noise become more critical.

  12. Moroccan argan oil first African product to receive special status ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2010-10-07

    Oct 7, 2010 ... Long valued for its nutritive, cosmetic, and medicinal properties, argan oil from Morocco has received Protected Geographical Indication (PGI) from Morocco's Commission nationale des signes distinctifs d'origine et de qualité (CNSDOQ). The official document was presented by the King of Morocco, ...

  13. Modular assembly of a photovoltaic solar energy receiver

    Science.gov (United States)

    Graven, Robert M.; Gorski, Anthony J.; Schertz, William W.; Graae, Johan E. A.

    1978-01-01

    There is provided a modular assembly of a solar energy concentrator having a photovoltaic energy receiver with passive cooling. Solar cell means are fixedly coupled to a radiant energy concentrator. Tension means bias a large area heat sink against the cell thereby allowing the cell to expand or contract with respect to the heat sink due to differential heat expansion.

  14. Children's Experiences of Support Received from Men in Rural ...

    African Journals Online (AJOL)

    The nomination of a father-figure by all children, even if the man was not their biological father, ascertained that all children receive some support from men. Our data highlight the influence of biological ties, co-residence, family social network, and marriage or father-mother relationship on fathers' involvement with their ...

  15. Comparing Relaxation Programs for Breast Cancer Patients Receiving Radiotherapy

    Science.gov (United States)

    In this study, women with breast cancer who have had surgery and are scheduled to undergo radiation therapy will be randomly assigned to one of two different stretching and relaxation programs or to a control group that will receive usual care.

  16. the influence of molybdenum and sulphur on sheep receiving high ...

    African Journals Online (AJOL)

    THE INFLUENCE OF MOLYBDENUM AND SULPHUR ON SHEEP RECEIVING HIGH LEVELS. OF COPPER AND BROILER LITTER IN THEIR RATIONS. Receipr of MS 06-09-1978. J.B.J. van RYSSEN. Department of Animol Science, University of Natal, Pietermoritzburg, 3200. (Key words: Molybdenum, sulphur, copper ...

  17. Diagnostic methods 2: receiver operating characteristic (ROC) curves

    NARCIS (Netherlands)

    Tripepi, Giovanni; Jager, Kitty J.; Dekker, Friedo W.; Zoccali, Carmine

    2009-01-01

    Clinical practice commonly demands 'yes or no' decisions; and for this reason a clinician frequently needs to convert a continuous diagnostic test into a dichotomous test. Receiver operating characteristic (ROC) curve analysis is an important test for assessing the diagnostic accuracy (or

  18. The effect of receiving supplementary UI benefits on unemployment duration

    DEFF Research Database (Denmark)

    Tomi, Kyyrä,; Pierpaolo, Parrotta,; Rosholm, Michael

    2013-01-01

    We consider the consequences of working part-time and receiving supplementary benefits for part-time unemployment in the Danish labor market. Following the timing-of-events approach we estimate causal effects of part-time work with supplementary benefits on the hazard rate out of unemployment...

  19. Quantifying non-compliance in patients receiving digoxin - a ...

    African Journals Online (AJOL)

    Non-compliance has a major influence on the successful outcome of a therapeutic regimen. It also unnecessarily increases the costs of health care. In a study involving 137 outpatients receiving digoxin 55 patients (40%) were found to be non-compliant. Patients who experienced communication probiems and who lacked a ...

  20. Satisfaction with Quality of Care Received by Patients without ...

    African Journals Online (AJOL)

    Satisfaction with Quality of Care Received by Patients without National Health Insurance Attending a Primary Care Clinic in a Resource.Poor Environment of a Tertiary Hospital in Eastern Nigeria in the Era of Scaling up the Nigerian Formal Sector Health In.

  1. Low-noise superheterodyne receiver array for ECEI and MIR

    Science.gov (United States)

    Wang, Yan; Yu, Jo-Han; Pham, Anh-Vu; Domier, Calvin; Tobias, Benjamin; Luhmann, Neville

    2016-10-01

    Superheterodyne receiver array has been widely used in ECEI and MIR to extract the temperature and plasma density fluctuation, respectively. The system downconverts RF signals to a much lower IF for easy filtering and processing. The current system employs Schottky diode as the mixing element, which is mounted directly on the antenna. The LO and RF signals illuminate the antenna simultaneously to produce desired IF signals. One big drawback is that the system generates large amount of noise due to the lack of low-noise amplifier (LNA) before the mixer. It also requires complicated lens system in order to facilitate simultaneous RF and LO illumination. Additionally, it's difficult to shield the circuits from stray heating power and interfering signals. New receivers are developed for improving the signal quality as well as the ease of measurement. The new circuit consists of compact GaAs MMICs integrated on low-loss liquid crystal polymer substrate. Low noise and high gain GaAs LNAs, mixers and even complete receivers are available as off-the-shelf chips for V and W band applications. Employing MMICs in plasma diagnostics not only dramatically improves signal integrity, the on-board LO signal supply also eliminates the lenses for simultaneous RF and LO illumination. Additionally, the new receiver employs horn antennas, which produces directive radiation and strong interference attenuation.

  2. A (simplified) Bluetooth Maximum A posteriori Probability (MAP) receiver

    NARCIS (Netherlands)

    Schiphorst, Roelof; Hoeksema, F.W.; Slump, Cornelis H.

    2003-01-01

    In our software-defined radio project we aim at combining two standards: Bluetooth and HiperLAN/2. The Hiper- LAN/2 receiver requires the most computation power in comparison with Bluetooth. We choose to use this computational power also for Bluetooth and look for more advanced demodulation

  3. A (Simplified) Bluetooth Maximum a Posteriori Probability (Map) Receiver

    NARCIS (Netherlands)

    Schiphorst, Roelof; Hoeksema, F.W.; Slump, Cornelis H.; Barbarossa, Sergio; Scutari, Gesualdo

    2003-01-01

    In our software-defined radio project, we aim at combining two standards luetooth and HIPERLAN/2. The HIPERLAN/2 receiver requires more computational power than Bluetooth. We choose to use this computational power also for Bluetooth and look for more advanced demodulation algorithms such as a

  4. Hospitality and tourism management graduate receives best paper award

    OpenAIRE

    Ho, Sookhan

    2010-01-01

    A paper co-authored by Jeongdoo Park, who received a master's degree in hospitality and tourism management last year, and hospitality and tourism management professor Ken McCleary, was selected as one of three best papers at the 15th Annual Graduate Student Research Conference In Hospitality and Tourism.

  5. Optimization of Sensing Receiver for Cognitive Radio Applications

    Directory of Open Access Journals (Sweden)

    Hassan Zamat

    2009-01-01

    Full Text Available We propose an optimized dedicated broadband sensing receiver architecture for use in cognitive radios supporting delay sensitive applications. Specifically, we first reason the need for a dedicated sensing receiver that employs a combination of coarse and fine scanning to reduce sensing time over a large bandwidth. We derive an expression for mean acquisition/detection time as a function of a number of parameters including the number of coarse and fine frequency bins employed. We then determine the optimal number of coarse and fine bins that minimize the overall detection time required to identify idle channels under various system conditions. Using analytical and simulation results, we quantify the dependence of optimal coarse and fine bin selection on system parameters such as (1 size of FFT used in scanning; (2 probability of detection and false alarm of the underlying sensing algorithm; (3 signal-to-noise ratio of the received signal, and (4 expected number of available channels. The primary contribution of this work lies in a practical realization of an optimal broadband sensing receiver.

  6. Delay in Seeking and receiving Emergency Obstetric Care in Eritrea.

    African Journals Online (AJOL)

    MBY

    cases or controls who reached a health facility. Women face multiple delays in seeking and. Record Review of cards for the cases or controls who receiving life saving care when they need it. Failure reached a health facility. or delay 2-4, to use appropriate and timely maternal care services were viewed as resulting from a ...

  7. Comparing interpolation schemes in dynamic receive ultrasound beamforming

    DEFF Research Database (Denmark)

    Kortbek, Jacob; Andresen, Henrik; Nikolov, Svetoslav

    2005-01-01

    In medical ultrasound interpolation schemes are of- ten applied in receive focusing for reconstruction of image points. This paper investigates the performance of various interpolation scheme by means of ultrasound simulations of point scatterers in Field II. The investigation includes conventional...

  8. A Simple Radio Receiver Aids Understanding of Wireless Communication

    Science.gov (United States)

    Straulino, S.; Orlando, A.

    2012-01-01

    The basic theory of radio broadcasting is discussed from an experimental point of view. First, concepts like wave modulation and tuning are explained with the use of instruments in the physics laboratory. Then, a very basic radio receiver is described and assembled, whose most important feature, like in the old "crystal radios", is the absence of…

  9. Calibration method for direct conversion receiver front-ends

    Directory of Open Access Journals (Sweden)

    R. Müller

    2008-05-01

    Full Text Available Technology induced process tolerances in analog circuits cause device characteristics different from specification. For direct conversion receiver front-ends a system level calibration method is presented. The malfunctions of the devices are compensated by tuning dominant circuit parameters. Thereto optimization techniques are applied which use measurement values and special evaluation functions.

  10. 19 CFR 181.48 - Person entitled to receive drawback.

    Science.gov (United States)

    2010-04-01

    ...-Deferral Programs § 181.48 Person entitled to receive drawback. (a) Manufacturing drawback. The person... considered the exporter and entitled to manufacturing drawback, unless the manufacturer or producer shall... made with the knowledge and consent of the exporter. Drawback also may be granted to the agent of the...

  11. The ‘vivid sociolinguistic profiling’ of Received Pronunciation

    DEFF Research Database (Denmark)

    Fabricius, Anne

    2006-01-01

    The present paper contributes to an ongoing debate on the sociolinguistic situation of modern Received Pronunciation (hereafter RP) , the social elite accent of England (Milroy 2001; Mugglestone 2003). It reports on an attitudinal study which elicited openended as well as scaled responses...

  12. Optocoupled line receiver input discriminates against narrow noise pulses

    CERN Document Server

    Napier, T M

    1977-01-01

    Describes a simple optocoupled interface which connects a data line to the receiving end of a data link that features pulse length discrimination to enhance noise pulse rejection. A rugged red LED, D /sub 1/, can bypass any reasonable fault currents to protect the relatively fragile optocoupler input diode. (0 refs).

  13. Balloon-Borne Superconducting Integrated Receiver for Atmospheric Research

    NARCIS (Netherlands)

    Kiselev, Oleg; Birk, Manfred; Ermakov, Andrey; Filippenko, Lyudmila; Golstein, Hans; Hoogeveen, Ruud; Kinev, Nickolay; van Kuik, Bart; de Lange, Arno; de Lange, Gert; Yagoubov, Pavel; Koshelets, Valery

    A Superconducting Integrated Receiver (SIR) was proposed more than 10 years ago and has since then been developed up to the point of practical applications. We have demonstrated for the first time the capabilities of the SIR technology for heterodyne spectroscopy both in the laboratory and at remote

  14. Robust AlGaN/GaN MMIC Receiver Components

    NARCIS (Netherlands)

    Heijningen, M. van; Janssen, J.P.B.; Vliet, F.E. van

    2009-01-01

    Apart from delivering very high output powers, GaN can also be used to realize robust receiver components, such as Low Noise Amplifiersand Switches. This paper presents the designand measurement results of two GaN X-band switch and LNA MMICs, designed for integration in a radar front end. The switch

  15. The impact of inadequate wastewater treatment on the receiving ...

    African Journals Online (AJOL)

    1 Tshwane University of Technology, Water Care Department, Arcadia Campus, P/Bag x 680 Pretoria 0002, South Africa ... pollution point sources into their respective receiving water bodies (Tembisa Dam, the Nahoon and Eastern Beach which are ... municipalities' sewage treatment works, i.e. design weaknesses,.

  16. 12 CFR 614.4700 - Financing foreign trade receivables.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Financing foreign trade receivables. 614.4700 Section 614.4700 Banks and Banking FARM CREDIT ADMINISTRATION FARM CREDIT SYSTEM LOAN POLICIES AND... extent to which foreign currency exposure may be hedged by forward or future contracts. (5) The...

  17. The production performance of lactating Jersey cows receiving ...

    African Journals Online (AJOL)

    Unknown

    Introduction. Nutrition is one of many factors that affects milk yield in dairy cows. Increasing the protein concentration in the supplement increases milk yield of cows receiving grass silage based diets (Huhtanen et al., 1995). Gross margins for purchased feed per litre milk produced can be reduced by decreased feeding of ...

  18. Radiation tolerance of an SLVS receiver based on commercial components

    CERN Document Server

    Belloni, A; Nogima, H; Vaz, M

    2014-01-01

    The capability of ProASIC3L FPGAs to receive SLVS signals has been studied in laboratory conditions and after irradiation. The irradiation has been performed using a Cs-137 source. The SLVS communication has remained functional after 201 Gy. The slowest rise time after irradiation is 324 ps, negligibly degraded with respect to the pre-irradiation rise time.

  19. The impact of inadequate wastewater treatment on the receiving ...

    African Journals Online (AJOL)

    687. The impact of inadequate wastewater treatment on the receiving water bodies – Case study: Buffalo City and. Nkokonbe Municipalities of the Eastern Cape Province. MNB Momba1*, AN Osode2 and M Sibewu1. 1 Tshwane University of Technology, Water Care Department, Arcadia Campus, P/Bag x 680 Pretoria 0002, ...

  20. Patient satisfaction after receiving dental treatment among patients ...

    African Journals Online (AJOL)

    Background: Patient satisfaction is one of the indicators of the quality of care. Therefore it is one of the tools for evaluating the quality of care. Aim: To determine patient satisfaction after receiving dental treatment among patients attending public dental clinics in Dar-Es-Salaam. Material and methods: Five public dental clinics ...