WorldWideScience

Sample records for vhf radiotelephone receiver

  1. Simultaneous radar and spaced receiver VHF scintillation observations of ESF irregularities

    Directory of Open Access Journals (Sweden)

    D. Tiwari

    2006-07-01

    Full Text Available Simultaneous observations of equatorial spread F (ESF irregularities made on 10 nights during March-April 1998 and 1999, using an 18-MHz radar at Trivandrum (77° E, 8.5° N, dip 0.5° N and two spaced receivers recording scintillations on a 251-MHz signal at Tirunelveli (77.8° E, 8.7° N, dip 0.4° N, have been used to study the evolution of Equatorial Spread F (ESF irregularities. Case studies have been carried out on the day-to-day variability in ESF structure and dynamics, as observed by 18-MHz radar, and with spaced receiver measurements of average zonal drift Vo of the 251-MHz radio wave diffraction pattern on the ground, random velocity Vc, which is a measure of random changes in the characteristics of scintillation-producing irregularities, and maximum cross-correlation CI of the spaced receivers signals. Results show that in the initial phase of plasma bubble development, the greater the maximum height of ESF irregularities responsible for the radar backscatter, the greater the decorrelation is of the spaced receiver scintillation signals, indicating greater turbulence. The relationship of the maximum spectral width derived from the radar observations and CI also supports this result.

  2. Simultaneous radar and spaced receiver VHF scintillation observations of ESF irregularities

    Directory of Open Access Journals (Sweden)

    D. Tiwari

    2006-07-01

    Full Text Available Simultaneous observations of equatorial spread F (ESF irregularities made on 10 nights during March-April 1998 and 1999, using an 18-MHz radar at Trivandrum (77° E, 8.5° N, dip 0.5° N and two spaced receivers recording scintillations on a 251-MHz signal at Tirunelveli (77.8° E, 8.7° N, dip 0.4° N, have been used to study the evolution of Equatorial Spread F (ESF irregularities. Case studies have been carried out on the day-to-day variability in ESF structure and dynamics, as observed by 18-MHz radar, and with spaced receiver measurements of average zonal drift Vo of the 251-MHz radio wave diffraction pattern on the ground, random velocity Vc, which is a measure of random changes in the characteristics of scintillation-producing irregularities, and maximum cross-correlation CI of the spaced receivers signals. Results show that in the initial phase of plasma bubble development, the greater the maximum height of ESF irregularities responsible for the radar backscatter, the greater the decorrelation is of the spaced receiver scintillation signals, indicating greater turbulence. The relationship of the maximum spectral width derived from the radar observations and CI also supports this result.

  3. 47 CFR 80.873 - VHF radiotelephone transmitter.

    Science.gov (United States)

    2010-10-01

    ...) The transmitter must deliver a carrier power between 8 and 25 watts into a 50 ohm effective resistance... 50 ohms effective resistance over the frequency band specified in § 80.871(d). An individual...

  4. 33 CFR 26.03 - Radiotelephone required.

    Science.gov (United States)

    2010-07-01

    ... BRIDGE-TO-BRIDGE RADIOTELEPHONE REGULATIONS § 26.03 Radiotelephone required. (a) Unless an exemption is... 26 feet or over in length while navigating; and (4) Every dredge and floating plant engaged in or... for an unmanned or intermittently manned floating plant under the control of a dredge. (b) Every...

  5. Forming and detection of digital watermarks in the System for Automatic Identification of VHF Transmissions

    Directory of Open Access Journals (Sweden)

    О. В. Шишкін

    2013-07-01

    Full Text Available Forming and detection algorithms for digital watermarks are designed for automatic identification of VHF radiotelephone transmissions in the maritime and aeronautical mobile services. An audible insensitivity and interference resistance of embedded digital data are provided by means of OFDM technology jointly with normalized distortions distribution and data packet detection by the hash-function. Experiments were carried out on the base of ship’s radio station RT-2048 Sailor and USB ADC-DAC module of type Е14-140M L-CARD in the off-line processing regime in Matlab medium

  6. 47 CFR 80.903 - Inspection of radiotelephone installation.

    Science.gov (United States)

    2010-10-01

    ... ship passes the inspection, the technician will issue a Communications Act Safety Radiotelephony... 47 Telecommunication 5 2010-10-01 2010-10-01 false Inspection of radiotelephone installation. 80... Passenger Boats § 80.903 Inspection of radiotelephone installation. Every vessel subject to Part III of...

  7. Dihydroazulene/Vinylheptafulvene (DHA/VHF)

    DEFF Research Database (Denmark)

    Vlasceanu, Alexandru

    A theoretical and experimental investigation of conformational modifications on the thermodynamic, optical, and switching properties of dihydroazulene/vinylheptafulvene (DHA/VHF) photoswitches, in the context of molecular solar thermal (MOST) systems, is described herein. The optical properties...... of monomeric DHA/VHF systems are found to be strongly dependent on structural changes which can be tuned via steric modifications. This correlation is then used to infer structural features of more complex, macrocyclic DHA/VHF systems based on their optical properties. The introduction of macrocyclic ring...... strain is furthermore found to significantly influence the switching behavior of DHA/VHF moieties compared to non-cyclized systems. The thermal ring closure of macrocyclic VHF-VHF systems is found to occur in a stepwise manner, enabling the release of the energy on both a fast and slow timescale...

  8. 33 CFR 117.24 - Radiotelephone installation identification.

    Science.gov (United States)

    2010-07-01

    ... using Reflective Blue and Reflective White colors. Color and design information is available from the... the lower right quadrant. Note: It is recommended that the radiotelephone sign be similar in design to...

  9. 47 CFR 80.271 - Technical requirements for portable survival craft radiotelephone transceivers.

    Science.gov (United States)

    2010-10-01

    ... craft radiotelephone transceivers. 80.271 Section 80.271 Telecommunication FEDERAL COMMUNICATIONS... Authorization for Compulsory Ships § 80.271 Technical requirements for portable survival craft radiotelephone transceivers. (a) Portable survival craft radiotelephone transceivers must comply with the following: (1) The...

  10. CMOS VHF transconductance-C lowpass filter

    NARCIS (Netherlands)

    Nauta, Bram

    1990-01-01

    Experimental results of a VHF CMOS transconductance-C lowpass filter are described. The filter is built with transconductors as published earlier. The cutoff frequency can be tuned from 22 to 98 MHz and the measured filter response is very close to the ideal response

  11. 47 CFR 22.970 - Unacceptable interference to part 90 non-cellular 800 MHz licensees from cellular radiotelephone...

    Science.gov (United States)

    2010-10-01

    ...-cellular 800 MHz licensees from cellular radiotelephone or part 90-800 MHz cellular systems. 22.970 Section... MOBILE SERVICES Cellular Radiotelephone Service § 22.970 Unacceptable interference to part 90 non-cellular 800 MHz licensees from cellular radiotelephone or part 90-800 MHz cellular systems. (a) Definition...

  12. 47 CFR 80.1007 - Bridge-to-bridge radiotelephone installation.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Bridge-to-bridge radiotelephone installation. 80.1007 Section 80.1007 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND... Bridge-to-Bridge Act § 80.1007 Bridge-to-bridge radiotelephone installation. Use of the bridge-to-bridge...

  13. 47 CFR 22.960 - Cellular unserved area radiotelephone licenses subject to competitive bidding.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Cellular unserved area radiotelephone licenses... (CONTINUED) COMMON CARRIER SERVICES PUBLIC MOBILE SERVICES Cellular Radiotelephone Service § 22.960 Cellular... applications for cellular unserved area Phase I and Phase II licenses filed after July 26, 1993 are subject to...

  14. 47 CFR 80.320 - Radiotelephone distress call and message transmission procedure.

    Science.gov (United States)

    2010-10-01

    ... by its call sign or name, to permit direction-finding stations to determine its position. This... 47 Telecommunication 5 2010-10-01 2010-10-01 false Radiotelephone distress call and message... Procedures Distress, Alarm, Urgency and Safety Procedures § 80.320 Radiotelephone distress call and message...

  15. 47 CFR 80.102 - Radiotelephone station identification.

    Science.gov (United States)

    2010-10-01

    ... use of the name of the bridge in lieu of the call sign. (c) Ship stations transmitting on any authorized VHF bridge-to-bridge channel may be identified by the name of the ship in lieu of the call sign... may be identified by the name of the ship in lieu of the call sign, or as directed by the agency or...

  16. VHF Scintillation in an Artificially Heated Ionosphere

    Science.gov (United States)

    Suszcynsky, D. M.; Layne, J.; Light, M. E.; Pigue, M. J.; Rivera, L.

    2017-12-01

    As part of an ongoing project to characterize very-high-frequency (VHF) radio wave propagation through structured ionospheres, Los Alamos National Laboratory has been conducting a set of experiments to measure the scintillation effects of VHF transmissions under a variety of ionospheric conditions. Previous work (see 2015 Fall AGU poster by D. Suszcynsky et al.) measured the S4 index and ionospheric coherence bandwidth in the 32 - 44 MHz frequency range under naturally scintillated conditions in the equatorial region at Kwajalein Atoll during three separate campaigns centered on the 2014 and 2015 equinoxes. In this paper, we will present preliminary results from the February and September, 2017 High Altitude Auroral Research Project (HAARP) Experimental Campaigns where we are attempting to make these measurements under more controlled conditions using the HAARP ionospheric heater in a twisted-beam mode. Two types of measurements are made by transmitting VHF signals through the heated ionospheric volume to the Radio Frequency Propagation (RFProp) satellite experiment. The S4 scintillation index is determined by measuring the power fluctuations of a 135-MHz continuous wave signal and the ionospheric coherence bandwidth is simultaneously determined by measuring the delay spread of a frequency-modulated continuous wave (FMCW) signal in the 130 - 140 MHz frequency range. Additionally, a spatial Fourier transform of the CW time series is used to calculate the irregularity spectral density function. Finally, the temporal evolution of the time series is used to characterize spread-Doppler clutter effects arising from preferential ray paths to the satellite due to refraction off of isolated density irregularities. All results are compared to theory and scaled for comparison to the 32 - 44 MHz Kwajalein measurements.

  17. Environmental/Noise Effects on VHF/UHF UWB SAR

    National Research Council Canada - National Science Library

    Ralston, James

    1998-01-01

    This paper presents a straightforward approach to estimating the impact of natural environmental noise on an overall system noise temperature for very high frequency/ultrahigh frequency synthetic aperture radar (VHF/UHF SAR...

  18. Dicty_cDB: VHF145 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF145 (Link to dictyBase) - - - Contig-U15430-1 VHF145E (Link...) Clone ID VHF145 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15430-1 Ori...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116984 |AC116984.2 Dictyos... theta DNA for complete sequence of nucleomorph chromosome 2. 48 2e-07 2 ES451909 | PREDICTED: similar to PI...al 16.0 %: nuclear 8.0 %: vacuolar 8.0 %: endoplasmic reticulum 4.0 %: cytoskeletal >> prediction for VHF145

  19. Broadband VHF observations for lightning impulses from a small satellite SOHLA-1 (Maido 1)

    Science.gov (United States)

    Morimoto, T.; Kikuchi, H.; Ushio, T.; Kawasaki, Z.; Hidekazu, H.; Aoki, T.

    2009-12-01

    Lightning Research Group of Osaka University (LRG-OU) has been developing VHF Broadband Digital Interferometer (DITF) to image precise lightning channels and monitor lightning activity widely. The feature of broadband DITF is its ultrawide bandwidth (from 25MHz to 100MHz) and implicit redundancy for estimating VHF source location. LRG-OU considers an application of the broadband DITF to the spaceborne measurement system and joins the SOHLA (Space Oriented Higashi-Osaka Leading Associate) satellite project. The SOHLA satellite project represents a technology transfer program to expand the range of the space development community in Japan. The objective is to get SMEs (Small and Medium sized manufacturing Enterprises) involved in small space projects and new space technologies. Under the cooperative agreement, JAXA (Japan Aerospace Exploration Agency) intends to contribute to socio-economic development by returning its R&D results to society, and SOHLA tries to revitalize the local economy through the commercialization of versatile small satellites. According to the agreement, JAXA provides SOHLA its technical information on small satellites and other technical assistance for the development of the small satellites, SOHLA-1. The prime objective of the SOHLA-1 program is to realize low-cost and short term development of a microsatellite which utilizes the components and bus technologies of JAXA’s MicroLabSat. SOHLA-1 is a spin-stabilized microsatellite of MicroLabSat heritage (about 50 kg). The spin axis is fixed to inertial reference frame. The spin axis (z-axis) lies in the plane containing the solar direction and the normal to the orbital plane. LRG-OU takes responsibility for a science mission of SOHLA-1. To examine the feasibility of the DITF receiving VHF lightning impulses in space, LRG-OU proposes the BMW (Broadband Measurement of Waveform for VHF Lightning Impulses). BMW consists of a single pair of an antenna, a band-pass filter, an amplifier, and an

  20. Discharge Characteristic of VHF-DC Superimposed Magnetron Sputtering System

    Science.gov (United States)

    Toyoda, Hirotaka; Fukuoka, Yushi; Fukui, Takashi; Takada, Noriharu; Sasai, Kensuke

    2014-10-01

    Magnetron plasmas are one of the most important tools for sputter deposition of thin films. However, energetic particles from the sputtered target such as backscattered rare gas atoms or oxygen negative ions from oxide targets sometimes induce physical and chemical damages as well as surface roughening to the deposited film surface during the sputtering processes. To suppress kinetic energy of such particles, superposition of RF or VHF power to the DC power has been investigated. In this study, influence of the VHF power superposition on the DC target voltage, which is important factor to determine kinetic energy of high energy particles, is investigated. In the study, 40 MHz VHF power was superimposed to an ITO target and decrease in the target DC voltage was measured as well as deposited film deposition properties such as deposition rate or electrical conductivity. From systematic measurement of the target voltage, it was revealed that the target voltage can be determined by a very simple parameter, i.e., a ratio of VHF power to the total input power (DC and VHF powers) in spite of the DC discharge current. Part of this work was supported by ASTEP, JST.

  1. VHF signal power suppression in stratiform and convective precipitation

    Directory of Open Access Journals (Sweden)

    A. J. McDonald

    2006-03-01

    Full Text Available Previous studies have indicated that VHF clear-air radar return strengths are reduced during periods of precipitation. This study aims to examine whether the type of precipitation, stratiform and convective precipitation types are identified, has any impact on the relationships previously observed and to examine the possible mechanisms which produce this phenomenon. This study uses a combination of UHF and VHF wind-profiler data to define periods associated with stratiform and convective precipitation. This identification is achieved using an algorithm which examines the range squared corrected signal to noise ratio of the UHF returns for a bright band signature for stratiform precipitation. Regions associated with convective rainfall have been defined by identifying regions of enhanced range corrected signal to noise ratio that do not display a bright band structure and that are relatively uniform until a region above the melting layer. This study uses a total of 68 days, which incorporated significant periods of surface rainfall, between 31 August 2000 and 28 February 2002 inclusive from Aberystwyth (52.4° N, 4.1° W. Examination suggests that both precipitation types produce similar magnitude reductions in VHF signal power on average. However, the frequency of occurrence of statistically significant reductions in VHF signal power are very different. In the altitude range 2-4 km stratiform precipitation is related to VHF signal suppression approximately 50% of the time while in convective precipitation suppression is observed only 27% of the time. This statistical result suggests that evaporation, which occurs more often in stratiform precipitation, is important in reducing the small-scale irregularities in humidity and thereby the radio refractive index. A detailed case study presented also suggests that evaporation reducing small-scale irregularities in humidity may contribute to the observed VHF signal suppression.

  2. VHF signal power suppression in stratiform and convective precipitation

    Directory of Open Access Journals (Sweden)

    A. J. McDonald

    2006-03-01

    Full Text Available Previous studies have indicated that VHF clear-air radar return strengths are reduced during periods of precipitation. This study aims to examine whether the type of precipitation, stratiform and convective precipitation types are identified, has any impact on the relationships previously observed and to examine the possible mechanisms which produce this phenomenon. This study uses a combination of UHF and VHF wind-profiler data to define periods associated with stratiform and convective precipitation. This identification is achieved using an algorithm which examines the range squared corrected signal to noise ratio of the UHF returns for a bright band signature for stratiform precipitation. Regions associated with convective rainfall have been defined by identifying regions of enhanced range corrected signal to noise ratio that do not display a bright band structure and that are relatively uniform until a region above the melting layer.

    This study uses a total of 68 days, which incorporated significant periods of surface rainfall, between 31 August 2000 and 28 February 2002 inclusive from Aberystwyth (52.4° N, 4.1° W. Examination suggests that both precipitation types produce similar magnitude reductions in VHF signal power on average. However, the frequency of occurrence of statistically significant reductions in VHF signal power are very different. In the altitude range 2-4 km stratiform precipitation is related to VHF signal suppression approximately 50% of the time while in convective precipitation suppression is observed only 27% of the time. This statistical result suggests that evaporation, which occurs more often in stratiform precipitation, is important in reducing the small-scale irregularities in humidity and thereby the radio refractive index. A detailed case study presented also suggests that evaporation reducing small-scale irregularities in humidity may contribute to the observed VHF signal

  3. Using the SLAC VHF and UHF radio systems

    International Nuclear Information System (INIS)

    Struven, W.

    1987-02-01

    The use of the SLAC VHF and UHF Radio Systems and the Tunnel Antenna Systems as they are presently configured is described. The original radio system was built in 1966 and has grown in scope over the years. The Tunnel Antenna Systems were developed for, and first installed in, the PEP ring, and later added to other tunnels and redesigned to cover the UHF range, as well as VHF. The UHF radio system was designed and built for SLC use, and was first used in the SLC Arcs. The three radio systems will be described and the capabilities of each system will be defined

  4. From VHF to UHF CMOS-MEMS Monolithically Integrated Resonators

    DEFF Research Database (Denmark)

    Teva, Jordi; Berini, Abadal Gabriel; Uranga, A.

    2008-01-01

    This paper presents the design, fabrication and characterization of microresonators exhibiting resonance frequencies in the VHF and UHF bands, fabricated using the available layers of the standard and commercial CMOS technology, AMS-0.35mum. The resonators are released in a post-CMOS process cons...

  5. Combined VLF and VHF lightning observations of Hurricane Rita landfall

    Science.gov (United States)

    Henderson, B. G.; Suszcynsky, D. M.; Wiens, K. C.; Hamlin, T.; Jeffery, C. A.; Orville, R. E.

    2009-12-01

    Hurricane Rita displayed abundant lightning in its northern eyewall as it made landfall at 0740 UTC 24 Sep 2005 near the Texas/Louisiana border. For this work, we combined VHF and VLF lightning data from Hurricane Rita, along with radar observations from Gulf Coast WSR-88D stations, for the purpose of demonstrating the combined utility of these two spectral regions for hurricane lightning monitoring. Lightning is a direct consequence of the electrification and breakdown processes that take place during the convective stages of thunderstorm development. As Rita approached the Gulf coast, the VHF lightning emissions were distinctly periodic with a period of 1.5 to 2 hours, which is consistent with the rotational period of hurricanes. VLF lightning emissions, measured by LASA and NLDN, were present in some of these VHF bursts but not all of them. At landfall, there was a significant increase in lightning emissions, accompanied by a significant convective surge observed in radar. Furthermore, VLF and VHF lightning source heights clearly increase as a function of time. The evolution of the IC/CG ratio is consistent with that seen in thunderstorms, showing a dominance of IC activity during storm development, followed by an increase in CG activity at the storm’s peak. The periodic VHF lightning events are correlated with increases in convective growth (quantified by the volume of radar echo >40 dB) above 7 km altitude. VLF can discriminate between lightning types, and in the LASA data, Rita landfall lightning activity was dominated by Narrow Bi-polar Events (NBEs)—high-energy, high-altitude, compact intra-cloud discharges. The opportunity to locate NBE lightning sources in altitude may be particularly useful in quantifying the vertical extent (strength) of the convective development and in possibly deducing vertical charge distributions.

  6. VHF lightning mapping observations of a triggered lightning flash

    Science.gov (United States)

    Edens, H. E.; Eack, K. B.; Eastvedt, E. M.; Trueblood, J. J.; Winn, W. P.; Krehbiel, P. R.; Aulich, G. D.; Hunyady, S. J.; Murray, W. C.; Rison, W.; Behnke, S. A.; Thomas, R. J.

    2012-10-01

    On 3 August 2010 an extensive lightning flash was triggered over Langmuir Laboratory in New Mexico. The upward positive leader propagated into the storm's midlevel negative charge region, extending over a horizontal area of 13 × 13 km and 7.5 km altitude. The storm had a normal-polarity tripolar charge structure with upper positive charge over midlevel negative charge. Lightning Mapping Array (LMA) observations were used to estimate positive leader velocities along various branches, which were in the range of 1-3 × 104 m s-1, slower than in other studies. The upward positive leader initiated at 3.4 km altitude, but was mapped only above 4.0 km altitude after the onset of retrograde negative breakdown, indicating a change in leader propagation and VHF emissions. The observations suggest that both positive and negative breakdown produce VHF emissions that can be located by time-of-arrival systems, and that not all VHF emissions occurring along positive leader channels are associated with retrograde negative breakdown.

  7. Repotenciación de un sistema de radiocomunicaciones VHF

    Directory of Open Access Journals (Sweden)

    Juan Ortega

    2016-11-01

    Full Text Available Las comunicaciones móviles avanzan a pasos acelerados, como fuente de ayuda para la interrelación entre personas, empresas y proyectos que se enmarcan dentro de los criterios zonales de planificación, el cambio en la matriz productiva del país y el Plan Nacional del Buen Vivir. En tal virtud, el estudio de una repotenciación mediante la aplicación de conocimientos y herramientas enmarcadas dentro de las comunicaciones VHF, es fundamental dentro del mejoramiento en términos de calidad de servicio dentro del área de concesión donde se fundamenta el estudio. El presente artículo realiza un análisis situacional de la red de radiocomunicaciones VHF actual de la Empresa Eléctrica Regional Centro Sur C. A., el área de concesión, localización y coberturas de los repetidores existentes, con el diagnóstico actual de la misma. Además, se desarrolla la propuesta de repotenciación detallando la infraestructura necesaria para su ejecución, la ampliación del área de cobertura, la configuración del software para la gestión e interconexión de los equipos de diferentes zonas.

  8. Use of vhf dielectric measurements for borehole formation analysis

    Energy Technology Data Exchange (ETDEWEB)

    Poley, J.P.; Nooteboom, J.J.; de Waal, P.J.

    1978-01-01

    A study of the dielectric properties of sedimentary rocks at a sufficiently high frequency may provide useful data for the evaluation of borehole wall formations in exploration and production wells. An experimental program carried out between 1960 and 1967 on sandstone and limestone samples lent further support to these expectations. At frequencies above 20 Mc/s both real and imaginary parts of the complex epsilon* = epsilon' - j epsilon'' were measurable. Moreover, at higher frequencies, epsilon' proved to be independent of the salinity of the water filling the pores, and insensitive to the way in which the oil and the water are actually distributed. The value of epsilon'', on the other hand, turned out to be indicative of the prevailing salinity. By combining other logging data (for instance from an electric or porosity log) with a series of such v.h.f. measurements of epsilon' and epsilon'', the oil or water saturation, the effective formation porosity, the pore-filling fluid salinity, and the rock matrix formation factor might be deduced, if the depth of investigation can be made large enough to overcome the invasion effects.

  9. Observations of lightning processes using VHF radio interferometry

    Science.gov (United States)

    Rhodes, C. T.; Shao, X. M.; Krehbiel, P. R.; Thomas, R.

    1991-01-01

    A single station, multiple baseline radio interferometer was used to locate the direction of VHF radiation from lightning discharges with microsec time resolution. Radiation source directions and electric field waveforms were analyzed for various types of breakdown events. These include initial breakdown and K type events of in-cloud activity, and the leaders of initial and subsequent strokes to ground and activity during and following return strokes. Radiation during the initial breakdown of a flash and in the early stages of initial leaders to ground is found to be similar. In both instances, the activity consists of localized bursts of radiation that are intense and slow moving. Motion within a given burst is unresolved by the interferometer. Radiation from in-cloud K type events is essentially the same as that from dart leaders; in both cases it is produced at the leading edge of a fast moving streamer that propagates along a well defined, often extensive path. K type events are sometimes terminated by fast field changes that are similar to the return stroke initiated by dart leaders; such K type events are the in-cloud analog of the dart leader return stroke process.

  10. Letter to the Editor: Complete maps of the aspect sensitivity of VHF atmospheric radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    1999-08-01

    Full Text Available Using the MU radar at Shigaraki, Japan (34.85°N, 136.10°E, we measure the power distribution pattern of VHF radar echoes from the mid-troposphere. The large number of radar beam-pointing directions (320 allows the mapping of echo power from 0° to 40° from zenith, and also the dependence on azimuth, which has not been achieved before at VHF wavelengths. The results show how vertical shear of the horizontal wind is associated with a definite skewing of the VHF echo power distribution, for beam angles as far as 30° or more from zenith, so that aspect sensitivity cannot be assumed negligible at any beam-pointing angle that most existing VHF radars are able to use. Consequently, the use of VHF echo power to calculate intensity of atmospheric turbulence, which assumes only isotropic backscatter at large beam zenith angles, will sometimes not be valid.Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; turbulence; instruments and techniques

  11. Why does the lumen maintenance of sodium-scandium metal halide lamps improve by VHF operation?

    International Nuclear Information System (INIS)

    Van Erk, W; Luijks, G M J F; Hitchcock, W

    2011-01-01

    Lifetime experiments show that sodium-scandium metal halide lamps perform better on very high frequency (VHF) drivers than on low frequency (LF) constant wattage autotransformer (CWA) ballasts. The question why, will be addressed with focus on arc tube aspects. It is argued that at high frequency operation sodium loss is less, and that the absence of thermal fluctuations in the electrode tip causes less damage and cracking to this part of the electrode. Sudden lm W -1 drops, observed with CWA-operated lamps, most probably occur when the arc attaches on such a corroded and cracked surface. Thorium is effective as an emitter both in the CWA and the VHF operation mode, despite the absence of cataphoretic transport to the cathode in the VHF case.

  12. Why does the lumen maintenance of sodium-scandium metal halide lamps improve by VHF operation?

    Energy Technology Data Exchange (ETDEWEB)

    Van Erk, W [Philips Lighting, Sondervick 47, 5505 NB Veldhoven (Netherlands); Luijks, G M J F [Advanced Development Lighting, Philips Lighting, PO Box 80020, 5600 JM Eindhoven (Netherlands); Hitchcock, W, E-mail: Gerard.luijks@philips.com [Philips Lighting Company, 7265 Route 54, Bath, NY 14810 (United States)

    2011-06-08

    Lifetime experiments show that sodium-scandium metal halide lamps perform better on very high frequency (VHF) drivers than on low frequency (LF) constant wattage autotransformer (CWA) ballasts. The question why, will be addressed with focus on arc tube aspects. It is argued that at high frequency operation sodium loss is less, and that the absence of thermal fluctuations in the electrode tip causes less damage and cracking to this part of the electrode. Sudden lm W{sup -1} drops, observed with CWA-operated lamps, most probably occur when the arc attaches on such a corroded and cracked surface. Thorium is effective as an emitter both in the CWA and the VHF operation mode, despite the absence of cataphoretic transport to the cathode in the VHF case.

  13. Testing VHF/GPS collar design and safety in the study of free-roaming horses.

    Directory of Open Access Journals (Sweden)

    Gail H Collins

    Full Text Available Effective and safe monitoring techniques are needed by U.S. land managers to understand free-roaming horse behavior and habitat use and to aid in making informed management decisions. Global positioning system (GPS and very high frequency (VHF radio collars can be used to provide high spatial and temporal resolution information for detecting free-roaming horse movement. GPS and VHF collars are a common tool used in wildlife management, but have rarely been used for free-roaming horse research and monitoring in the United States. The purpose of this study was to evaluate the design, safety, and detachment device on GPS/VHF collars used to collect free-roaming horse location and movement data. Between 2009 and 2010, 28 domestic and feral horses were marked with commercial and custom designed VHF/GPS collars. Individual horses were evaluated for damage caused by the collar placement, and following initial observations, collar design was modified to reduce the potential for injury. After collar modifications, which included the addition of collar length adjustments to both sides of the collar allowing for better alignment of collar and neck shapes, adding foam padding to the custom collars to replicate the commercial collar foam padding, and repositioning the detachment device to reduce wear along the jowl, we observed little to no evidence of collar wear on horses. Neither custom-built nor commercial collars caused injury to study horses, however, most of the custom-built collars failed to collect data. During the evaluation of collar detachment devices, we had an 89% success rate of collar devices detaching correctly. This study showed that free-roaming horses can be safely marked with GPS and/or VHF collars with minimal risk of injury, and that these collars can be a useful tool for monitoring horses without creating a risk to horse health and wellness.

  14. Some radiation safety aspects of operating medical generators of VHF electromagnetic energy

    International Nuclear Information System (INIS)

    Bosevski, V.; Radev, S.; Donev, Ch.

    1977-01-01

    The state of radiation safety in physiotherapy practice using very-high-frequency diathermy was studied with regard to personnel and patient protection. A specially devised shielding set to protect patients and personnel is offered for adoption, and the necessity is insistently stressed of prohibiting any patient head or gonad exposure. It is pointed out that the protective set developed may also be used at facilities employing other types of VHF electromagnetic energy sources. (author)

  15. Adjuvant VHF therapy in locally recurrent and primary unresectable rectal cancer

    International Nuclear Information System (INIS)

    Trotter, J.M.; Lamb, M.H.; Bayliss, E.J.; Edis, A.J.; Blackwell, J.B.; Shepherd, J.M.; Cassidy, B.

    1996-01-01

    In a prospective randomized study, 434 MHz microwave therapy combined with external beam radiotherapy (VHF+RT) was compared with standard external beam radiotherapy (RT) in controlling locally recurrent or unresectable primary adenocarcinoma of the rectum. Independent assessors documented quality of life scores, performance status, toxicities local response to treatment, and systemic disease progression before treatment and after treatment and every 8 week thereafter. Of 75 patients randomized, 73 were eligible for inclusion in the study. Forty-three of these patients had local pelvic tumour recurrence only and 21 also had distant metastases. In addition, nine patients had primary inoperable carcinomas, two of whom also had metastases. Thirty-seven patients were randomized to RT and 36 to VHF+RT. Th median dose of radiation in the VHF+RT arm was 4275 cGy with a median fraction size of 150 cGy and median duration of therapy of 48.5 days versus 4500 cGy in the RT-only arm with a median fraction size of 180 cGy and median duration of therapy of 38 days. These doses are unlikely to be significantly different in biological effect. No significant difference between the two groups was observed in extent and duration of local control, measures of toxicity or quality of life scores. Additionally, survival and cumulative incidence of pelvic site of first progression did not differ significantly between the groups. It is concluded that VHF microwave therapy in conjunction with radiotherapy produces no therapeutic advantage over conventional radiation therapy alone in the treatment of locally recurrent rectal carcinoma. 35 refs., 8 tabs., 3 figs

  16. TH-AB-209-09: Quantitative Imaging of Electrical Conductivity by VHF-Induced Thermoacoustics

    Energy Technology Data Exchange (ETDEWEB)

    Patch, S; Hull, D [Avero Diagnostics, Irving, TX (United States); See, W [Medical College of Wisconsin, Milwaukee, WI (United States); Hanson, G [UW-Milwaukee, Milwaukee, WI (United States)

    2016-06-15

    Purpose: To demonstrate that very high frequency (VHF) induced thermoacoustics has the potential to provide quantitative images of electrical conductivity in Siemens/meter, much as shear wave elastography provides tissue stiffness in kPa. Quantitatively imaging a large organ requires exciting thermoacoustic pulses throughout the volume and broadband detection of those pulses because tomographic image reconstruction preserves frequency content. Applying the half-wavelength limit to a 200-micron inclusion inside a 7.5 cm diameter organ requires measurement sensitivity to frequencies ranging from 4 MHz down to 10 kHz, respectively. VHF irradiation provides superior depth penetration over near infrared used in photoacoustics. Additionally, VHF signal production is proportional to electrical conductivity, and prostate cancer is known to suppress electrical conductivity of prostatic fluid. Methods: A dual-transducer system utilizing a P4-1 array connected to a Verasonics V1 system augmented by a lower frequency focused single element transducer was developed. Simultaneous acquisition of VHF-induced thermoacoustic pulses by both transducers enabled comparison of transducer performance. Data from the clinical array generated a stack of 96-images with separation of 0.3 mm, whereas the single element transducer imaged only in a single plane. In-plane resolution and quantitative accuracy were measured at isocenter. Results: The array provided volumetric imaging capability with superior resolution whereas the single element transducer provided superior quantitative accuracy. Combining axial images from both transducers preserved resolution of the P4-1 array and improved image contrast. Neither transducer was sensitive to frequencies below 50 kHz, resulting in a DC offset and low-frequency shading over fields of view exceeding 15 mm. Fresh human prostates were imaged ex vivo and volumetric reconstructions reveal structures rarely seen in diagnostic images. Conclusion

  17. Characterization of VHF radar observations associated with equatorial Spread F by narrow-band optical measurements

    Directory of Open Access Journals (Sweden)

    R. Sekar

    2004-09-01

    Full Text Available The VHF radars have been extensively used to investigate the structures and dynamics of equatorial Spread F (ESF irregularities. However, unambiguous identification of the nature of the structures in terms of plasma depletion or enhancement requires another technique, as the return echo measured by VHF radar is proportional to the square of the electron density fluctuations. In order to address this issue, co-ordinated radar backscatter and thermospheric airglow intensity measurements were carried out during March 2003 from the MST radar site at Gadanki. Temporal variations of 630.0-nm and 777.4-nm emission intensities reveal small-scale ("micro" and large-scale ("macro" variations during the period of observation. The micro variations are absent on non-ESF nights while the macro variations are present on both ESF and non-ESF nights. In addition to the well-known anti-correlation between the base height of the F-region and the nocturnal variation of thermospheric airglow intensities, the variation of the base height of the F-layer, on occasion, is found to manifest as a bottomside wave-like structure, as seen by VHF radar on an ESF night. The micro variations in the airglow intensities are associated with large-scale irregular plasma structures and found to be in correspondence with the "plume" structures obtained by VHF radar. In addition to the commonly observed depletions with upward movement, the observation unequivocally reveals the presence of plasma enhancements which move downwards. The observation of enhancement in 777.4-nm airglow intensity, which is characterized as plasma enhancement, provides an experimental verification of the earlier prediction based on numerical modeling studies.

  18. Comparison Study of Lightning observations from VHF interferometer and Geostationary Lightning Mapper

    Science.gov (United States)

    Kudo, A.; Stock, M.; Ushio, T.

    2017-12-01

    We compared the optical observation from Geostationary Lightning Mapper (GLM) which is mounted on the geostationary meteorological satellite GOES-16 launched last year, and the radio observations from the ground-based VHF broad band interferometer. GLM detects 777.4 nm wavelength infrared optical signals from thunderstorm cells which are illuminated by the heated path during lightning discharge, and was developed mainly for the purpose of increasing the lead time for warning of severe weather and clarifying the discharge mechanism. Its detection has 2 ms frame rate, and 8 km square of space resolution at nadir. The VHF broad band interferometer is able to capture the electromagnetic waves from 20 MHz to 75 MHz and estimate the direction of arrival of the radiation sources using the interferometry technique. This system also has capability of observing the fast discharge process which cannot be captured by other systems, so it is expected to able to make detailed comparison. The recording duration of the system is 1 second. We installed the VHF broad band interferometer which consists of three VHF antenna and one fast antenna at Huntsville, Alabama from April 22nd to May 15th and in this total observation period, 720 triggers of data were observed by the interferometer. For comparison, we adopted the data from April 27th , April 30th. Most April 27th data has GLM "event" detection which is coincident time period. In time-elevation plot comparison, we found GLM detection timing was well coincide with interferometer during K-changes or return strokes and few detection during breakdown process. On the other hand, no GLM detection near the site for all data in April 30th and we are triyng to figure out the reason. We would like to thank University of Alabama Huntsville, New Mexico Institute of Mining and Technology, and RAIRAN Pte. Ltd for the help during the campaign.

  19. Low VHF Channel Measurements and Simulations in Indoor and Outdoor Scenarios

    Science.gov (United States)

    2015-05-01

    Transactions on. 2002;50(5):591-599. 22. Nerguizian C, Despins C, Affes S, Djadel M. Radio-channel characterization of an underground mine at 2.4 ghz...INTENTIONALLY LEFT BLANK. viii 1. Introduction Reliable wireless communication is of paramount importance for many important civilian and military...report, we study near-ground, wireless channel modeling in the lower VHF band for indoor and indoor/outdoor scenarios, drawing from extensive propagation

  20. Bias-Voltage Stabilizer for HVHF Amplifiers in VHF Pulse-Echo Measurement Systems.

    Science.gov (United States)

    Choi, Hojong; Park, Chulwoo; Kim, Jungsuk; Jung, Hayong

    2017-10-23

    The impact of high-voltage-high-frequency (HVHF) amplifiers on echo-signal quality is greater with very-high-frequency (VHF, ≥100 MHz) ultrasound transducers than with low-frequency (LF, ≤15 MHz) ultrasound transducers. Hence, the bias voltage of an HVHF amplifier must be stabilized to ensure stable echo-signal amplitudes. We propose a bias-voltage stabilizer circuit to maintain stable DC voltages over a wide input range, thus reducing the harmonic-distortion components of the echo signals in VHF pulse-echo measurement systems. To confirm the feasibility of the bias-voltage stabilizer, we measured and compared the deviations in the gain of the HVHF amplifier with and without a bias-voltage stabilizer. Between -13 and 26 dBm, the measured gain deviations of a HVHF amplifier with a bias-voltage stabilizer are less than that of an amplifier without a bias-voltage stabilizer. In order to confirm the feasibility of the bias-voltage stabilizer, we compared the pulse-echo responses of the amplifiers, which are typically used for the evaluation of transducers or electronic components used in pulse-echo measurement systems. From the responses, we observed that the amplitudes of the echo signals of a VHF transducer triggered by the HVHF amplifier with a bias-voltage stabilizer were higher than those of the transducer triggered by the HVHF amplifier alone. The second, third, and fourth harmonic-distortion components of the HVHF amplifier with the bias-voltage stabilizer were also lower than those of the HVHF amplifier alone. Hence, the proposed scheme is a promising method for stabilizing the bias voltage of an HVHF amplifier, and improving the echo-signal quality of VHF transducers.

  1. A beaded collar for dual micro GPS/VHF transmitter attachment to nutria

    Science.gov (United States)

    Haramis, G.M.; White, T.S.

    2011-01-01

    We report on the development of an approximately 85-g beaded collar for dual micro GPS/VHF transmitter attachment to semi-aquatic nutria (Myocastor coypus). Prototype collars were tested on captive nutria and refined during field trials. Central to the design was novel use of the VHF transmitter antenna as a collar. A circular collar was formed by passing the 44-cm antenna cable through a pre-made hole in the transmitter, leaving an approximately 16-cm upright antenna. GPS units were mounted separately via a hole in the base of each unit. For good satellite contact, GPS units (28 g) were maintained at the nape of the neck by counterbalance of the heavier VHF transmitters (50 g) positioned under the neck. To reduce friction, we lined the collar with alternate-sized plastic and, later, more durable nylon beads. The final collar configuration was worn for approximately 1 month deployments with only minor neck abrasion; one collar was worn successfully for 5 months. Foot entanglement remained the greatest risk of injury from the collar. By fitting collars tightly, we reduced the incidence of foot entanglement to 2 of 33 deployments (6%). Successful GPS tracks were acquired on 29 of 33 deployments (88%).

  2. A signature correlation study of ground target VHF/UHF ISAR imagery

    Science.gov (United States)

    Gatesman, Andrew J.; Beaudoin, Christopher J.; Giles, Robert H.; Kersey, William T.; Waldman, Jerry; Carter, Steve; Nixon, William E.

    2003-09-01

    VV and HH-polarized radar signatures of several ground targets were acquired in the VHF/UHF band (171-342 MHz) by using 1/35th scale models and an indoor radar range operating from 6 to 12 GHz. Data were processed into medianized radar cross sections as well as focused, ISAR imagery. Measurement validation was confirmed by comparing the radar cross section of a test object with a method of moments radar cross section prediction code. The signatures of several vehicles from three vehicle classes (tanks, trunks, and TELs) were measured and a signature cross-correlation study was performed. The VHF/UHF band is currently being exploited for its foliage penetration ability, however, the coarse image resolution which results from the relatively long radar wavelengths suggests a more challenging target recognition problem. One of the study's goals was to determine the amount of unique signature content in VHF/UHF ISAR imagery of military ground vehicles. Open-field signatures are compared with each other as well as with simplified shapes of similar size. Signatures were also acquired on one vehicle in a variety of configurations to determine the impact of monitor target variations on the signature content at these frequencies.

  3. Effect of geomagnetic storms on VHF scintillations observed at low latitude

    Science.gov (United States)

    Singh, S. B.; Patel, Kalpana; Singh, A. K.

    2018-06-01

    A geomagnetic storm affects the dynamics and composition of the ionosphere and also offers an excellent opportunity to study the plasma dynamics. In the present study, we have used the VHF scintillations data recorded at low latitude Indian station Varanasi (Geomag. latitude = 14^{°}55^' }N, long. = 154^{°}E) which is radiated at 250 MHz from geostationary satellite UFO-02 during the period 2011-2012 to investigate the effects of geomagnetic storms on VHF scintillation. Various geomagnetic and solar indices such as Dst index, Kp index, IMF Bz and solar wind velocity (Vx) are used to describe the geomagnetic field variation observed during geomagnetic storm periods. These indices are very helpful to find out the proper investigation and possible interrelation between geomagnetic storms and observed VHF scintillation. The pre-midnight scintillation is sometimes observed when the main phase of geomagnetic storm corresponds to the pre-midnight period. It is observed that for geomagnetic storms for which the recovery phase starts post-midnight, the probability of occurrence of irregularities is enhanced during this time and extends to early morning hours.

  4. The Mitigation of Radio Noise from External Sources at Receiving Sites

    Science.gov (United States)

    2007-05-01

    53 3.1.7 Underground Distribution Lines...available newer models were preferred for laboratory measurements of time- stable signals and noise. 9 An ELF Engineering Model 7200B 3-Axis... communications terminal was located about 1 km from an HF and VHF receiving site. The satellite terminal was equipped with an Uninterruptible Power Supply (UPS

  5. Time and latitudinal distribution of the ionospheric irregularities in Brazil, through the VHF-scintillation and ionogram data analysis

    International Nuclear Information System (INIS)

    Nelson, O.R.

    1984-01-01

    Equatorial ionospheric irregularity distribution morphology, and dynamics, and the dynamics of the ambient ionosphere were investigated. Spread F data from ionograms over Fortaleza (4 0 S; 38 0 O) and Cachoeira Paulista (22,7 0 S; 45 0 O), and simultaneous VHF scintillations of geoestationary satellite beacon received over Natal (5,6 0 S; 33,7 0 O) were used to determine the irregularity local time versus seasonal distribution, over the equatorial and low latitude location, during the solar activity maximum as well as minimum epochs. Concept of flux tube alignment properties of the transequatorial plasma bubbles were used to determine statistical features of the plasma bubble rise velocities. Calculations of plasma bubble rise velocities were then carried out for different solar activity epochs and compared with prereversal enhancement amplitude in the F-layer vertical rise velocities, for the same epochs. Using theoretical considerations on the development of plasma bubble based on flux tube integrated properties, the observed dependence of the plasma bubble rise velocities and the F-region dynamo electric field has been analysed to estimate the average ionizations depletions in the plasma bubble. Possible causes for the lack of correlation often observed between bubble rise velocities and F-Layer velocities also are discussed. (Author) [pt

  6. Structure, optical properties and thermal stability of HfErO films deposited by simultaneous RF and VHF magnetron sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, H.Y. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Nanjing University of Posts and Telecommunications, School of Tongda, Nanjing (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); He, H.J.; Zhang, Z.; Jin, C.G.; Yang, Y.; Wang, Y.Y.; Ye, C. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Zhuge, L.J. [Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Soochow University, Analysis and Testing Center, Suzhou (China); Wu, X.M. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Chinese Academy of Sciences, State Key Laboratory of Functional Materials for Informatics, Shanghai Institute of Microsystem and Information Technology, Shanghai (China)

    2015-01-23

    HfErO films are deposited on Si substrates by simultaneous radio frequency (RF) and very high frequency (VHF) magnetron sputtering technique. The content of the doped ingredient of Er and the body composition of HfO{sub x} are, respectively, controlled through the VHF and RF powers. Low content of Er doping in the HfErO films can be achieved, because the VHF source of 27.12 MHz has higher ion energy and lower ion flux than the RF source resulting in low sputtering rate in the magnetron sputtering system. The structure, optical properties and thermal stability of the HfErO films are investigated in this work. Results show that the doped content of Er is independently controlled by the VHF power. The oxygen vacancies are created by the Er incorporation. The hafnium in the HfErO films forms mixed valence of Hf{sup 2+} and Hf{sup 4+}. The HfErO films are composed with the structures of HfO{sub 2}, HfO and ErO{sub x}, which can be optimized through the VHF power. At high VHF power, the Hf-Er-O bonds are formed, which demonstrates that the Er atoms are doped into the lattice of HfO{sub 2} in the HfErO films. The HfErO films have bad thermal stability as the crystallization temperature decreases from 900 to 800 C. After thermal annealing, cubic phase of HfO{sub 2} are stabilized, which is ascribed to the oxygen vacancies creation by the Er incorporation. The optical properties such as the refractive index and the optical band gap of the HfErO films are optimized by the VHF power. (orig.)

  7. Structure, optical properties and thermal stability of HfErO films deposited by simultaneous RF and VHF magnetron sputtering

    International Nuclear Information System (INIS)

    Zhang, H.Y.; He, H.J.; Zhang, Z.; Jin, C.G.; Yang, Y.; Wang, Y.Y.; Ye, C.; Zhuge, L.J.; Wu, X.M.

    2015-01-01

    HfErO films are deposited on Si substrates by simultaneous radio frequency (RF) and very high frequency (VHF) magnetron sputtering technique. The content of the doped ingredient of Er and the body composition of HfO x are, respectively, controlled through the VHF and RF powers. Low content of Er doping in the HfErO films can be achieved, because the VHF source of 27.12 MHz has higher ion energy and lower ion flux than the RF source resulting in low sputtering rate in the magnetron sputtering system. The structure, optical properties and thermal stability of the HfErO films are investigated in this work. Results show that the doped content of Er is independently controlled by the VHF power. The oxygen vacancies are created by the Er incorporation. The hafnium in the HfErO films forms mixed valence of Hf 2+ and Hf 4+ . The HfErO films are composed with the structures of HfO 2 , HfO and ErO x , which can be optimized through the VHF power. At high VHF power, the Hf-Er-O bonds are formed, which demonstrates that the Er atoms are doped into the lattice of HfO 2 in the HfErO films. The HfErO films have bad thermal stability as the crystallization temperature decreases from 900 to 800 C. After thermal annealing, cubic phase of HfO 2 are stabilized, which is ascribed to the oxygen vacancies creation by the Er incorporation. The optical properties such as the refractive index and the optical band gap of the HfErO films are optimized by the VHF power. (orig.)

  8. Ionospheric Coherence Bandwidth Measurements in the Lower VHF Frequency Range

    Science.gov (United States)

    Suszcynsky, D. M.; Light, M. E.; Pigue, M. J.

    2015-12-01

    The United States Department of Energy's Radio Frequency Propagation (RFProp) experiment consists of a satellite-based radio receiver suite to study various aspects of trans-ionospheric signal propagation and detection in four frequency bands, 2 - 55 MHz, 125 - 175 MHz, 365 - 415 MHz and 820 - 1100 MHz. In this paper, we present simultaneous ionospheric coherence bandwidth and S4 scintillation index measurements in the 32 - 44 MHz frequency range collected during the ESCINT equatorial scintillation experiment. 40-MHz continuous wave (CW) and 32 - 44 MHz swept frequency signals were transmitted simultaneously to the RFProp receiver suite from the Reagan Test Site at Kwajalein Atoll in the Marshall Islands (8.7° N, 167.7° E) in three separate campaigns during the 2014 and 2015 equinoxes. Results show coherence bandwidths as small as ~ 1 kHz for strong scintillation (S4 > 0.7) and indicate a high degree of ionospheric variability and irregularity on 10-m spatial scales. Spread-Doppler clutter effects arising from preferential ray paths to the satellite due to refraction off of isolated density irregularities are also observed and are dominant at low elevation angles. The results are compared to previous measurements and available scaling laws.

  9. Books Received

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Books Received. Articles in Resonance – Journal of Science Education. Volume 1 Issue 1 January 1996 pp 118-118 Books Received. Books Received · More Details Fulltext PDF. Volume 1 Issue 2 February 1996 pp 120-120 Books Received. Books Received.

  10. Two-dimensional simulations of multi-hollow VHF SiH4/H2 plasma

    Directory of Open Access Journals (Sweden)

    Li-Wen Su

    2018-02-01

    Full Text Available A triode multi-hollow VHF SiH4/H2 plasma (60 MHz was examined at a pressure of 20 Pa by two-dimensional simulations using the fluid model. In this study, we considered the effect of the rate constant of reaction, SiH3 + SiH3→SiH2 + SiH4, on the plasma characteristics. A typical VHF plasma of a high-electron density with a low-electron temperature was obtained between two discharge electrodes. Spatial profiles of SiH3+, SiH2+, SiH3- and SiH3 densities were similar to that of the electron density while the electron temperature had a maximum value near the two discharge electrodes. It was found that the SiH3 radical density did not decrease rapidly near the substrate and the electron temperature was lower than 1 eV, suggesting that the triode multi-hollow plasma source can provide high quality amorphous silicon with a high deposition rate.

  11. VHF/UHF radar observations of tropical mesoscale convective systems over southern India

    Directory of Open Access Journals (Sweden)

    K. Kishore Kumar

    2005-07-01

    Full Text Available Several campaigns have been carried out to study the convective systems over Gadanki (13.5° N, 79.2° E, a tropical station in India, using VHF and UHF radars. The height-time sections of several convective systems are investigated in detail to study reflectivity, turbulence and vertical velocity structure. Structure and dynamics of the convective systems are the main objectives of these campaigns. The observed systems are classified into single- and multi-cell systems. It has been observed that most of the convective systems at this latitude are multi-cellular in nature. Simultaneous VHF and UHF radar observations are used to classify the observed precipitating systems as convective, intermediary and stratiform regions. Composite height profiles of vertical velocities in these regions were obtained and the same were compared with the profiles obtained at other geographical locations. These composite profiles of vertical velocity in the convective regions have shown their peaks in the mid troposphere, indicating that the maximum latent heat is being released at those heights. These profiles are very important for numerical simulations of the convective systems, which vary significantly from one geographical location to the other.

    Keywords. Meteorology and atmospheric dynamics (Mesoscale meteorology; Convective processes – Radio science (Remote sensing

  12. VHF/UHF radar observations of tropical mesoscale convective systems over southern India

    Directory of Open Access Journals (Sweden)

    K. Kishore Kumar

    2005-07-01

    Full Text Available Several campaigns have been carried out to study the convective systems over Gadanki (13.5° N, 79.2° E, a tropical station in India, using VHF and UHF radars. The height-time sections of several convective systems are investigated in detail to study reflectivity, turbulence and vertical velocity structure. Structure and dynamics of the convective systems are the main objectives of these campaigns. The observed systems are classified into single- and multi-cell systems. It has been observed that most of the convective systems at this latitude are multi-cellular in nature. Simultaneous VHF and UHF radar observations are used to classify the observed precipitating systems as convective, intermediary and stratiform regions. Composite height profiles of vertical velocities in these regions were obtained and the same were compared with the profiles obtained at other geographical locations. These composite profiles of vertical velocity in the convective regions have shown their peaks in the mid troposphere, indicating that the maximum latent heat is being released at those heights. These profiles are very important for numerical simulations of the convective systems, which vary significantly from one geographical location to the other. Keywords. Meteorology and atmospheric dynamics (Mesoscale meteorology; Convective processes – Radio science (Remote sensing

  13. VHF/UHF imagery and RCS measurements of ground targets in forested terrain

    Science.gov (United States)

    Gatesman, Andrew J.; Beaudoin, Christopher J.; Giles, Robert H.; Waldman, Jerry; Nixon, William E.

    2002-08-01

    The monostatic VV and HH-polarized radar signatures of several targets and trees have been measured at foliage penetration frequencies (VHF/UHF) by using 1/35th scale models and an indoor radar range operating at X-band. An array of high-fidelity scale model ground vehicles and test objects as well as scaled ground terrain and trees have been fabricated for the study. Radar measurement accuracy has been confirmed by comparing the signature of a test object with a method of moments radar cross section prediction code. In addition to acquiring signatures of targets located on a smooth, dielectric ground plane, data have also been acquired with targets located in simulated wooded terrain that included scaled tree trunks and tree branches. In order to assure the correct backscattering behavior, all dielectric properties of live tree wood and moist soil were scaled properly to match the complex dielectric constant of the full-scale materials. The impact of the surrounding tree clutter on the VHF/UHF radar signatures of ground vehicles was accessed. Data were processed into high-resolution, polar-formatted ISAR imagery and signature comparisons are made between targets in open-field and forested scenarios.

  14. In situ occupational and general public exposure to VHF/UHF transmission for air traffic communication.

    Science.gov (United States)

    Joseph, Wout; Goeminne, Francis; Verloock, Leen; Vermeeren, Günter; Martens, Luc

    2012-09-01

    Occupational and general public exposure due to very high frequency (VHF)/ultra high frequency (UHF) transmission centres for verbal communication for air traffic control is investigated in situ for the first time. These systems are used for communication with aircraft, resulting in different human exposure from that of classical broadcasting. Measurement methods are proposed for the exposure assessment, and a measurement campaign is executed in three transmission centres. By investigating the temporal behaviour of the VHF signals for 6 d, a realistic worst-case duty cycle of 29 % is determined. Periods of high exposures corresponding with high aircraft traffic are from 7 a.m. to 1 p.m. and in the evening. All measured electric-field values satisfy the International Commission on Non-ionizing Radiation Protection guidelines. Fields vary from 0.2 to 21.1 V m(-1) for occupational exposure and from 0.007 to 8.0 V m(-1) for general public exposure. The average fields equal 5.2 V m(-1) for workers, and 0.7 V m(-1) for general public.

  15. In situ occupational and general public exposure to VHF/UHF transmission for air traffic communication

    International Nuclear Information System (INIS)

    Joseph, W.; Goeminne, F.; Verloock, L.; Vermeeren, G.; Martens, L.

    2012-01-01

    Occupational and general public exposure due to very high frequency (VHF)/ultra high frequency (UHF) transmission centres for verbal communication for air traffic control is investigated in situ for the first time. These systems are used for communication with aircraft, resulting in different human exposure from that of classical broadcasting. Measurement methods are proposed for the exposure assessment, and a measurement campaign is executed in three transmission centres. By investigating the temporal behaviour of the VHF signals for 6 d, a realistic worst-case duty cycle of 29 % is determined. Periods of high exposures corresponding with high aircraft traffic are from 7 a.m. to 1 p.m. and in the evening. All measured electric field values satisfy the International Commission on Non-ionizing Radiation Protection guidelines. Fields vary from 0.2 to 21.1 V m -1 for occupational exposure and from 0.007 to 8.0 V m -1 for general public exposure. The average fields equal 5.2 V m -1 for workers, and 0.7 V m -1 for general public. (authors)

  16. VHF radar observation of atmospheric winds, associated shears and C2n at a tropical location: interdependence and seasonal pattern

    Directory of Open Access Journals (Sweden)

    A. R. Jain

    Full Text Available The turbulence refractivity structure constant (C2n is an important parameter of the atmosphere. VHF radars have been used extensively for the measurements of C2n. Presently, most of such observations are from mid and high latitudes and only very limited observations are available for equatorial and tropical latitudes. Indian MST radar is an excellent tool for making high-resolution measurements of atmospheric winds, associated shears and turbulence refractivity structure constant (C2n. This radar is located at Gadanki (13.45° N, 79.18° E, a tropical station in India. The objective of this paper is to bring out the height structure of C2n for different seasons using the long series of data (September 1995 – August 1999 from Indian MST radar. An attempt is also made to understand such changes in the height structure of C2n in relation to background atmospheric parameters such as horizontal winds and associated shears. The height structure of C2n, during the summer monsoon and post-monsoon season, shows specific height features that are found to be related to Tropical Easterly Jet (TEJ winds. It is important to examine the nature of the radar back-scatterers and also to understand the causative mechanism of such scatterers. Aspect sensitivity of the received radar echo is examined for this purpose. It is observed that radar back-scatterers at the upper tropospheric and lower stratospheric heights are more anisotropic, with horizontal correlation length of 10–20 m, as compared to those observed at lower and middle tropospheric heights.Key words. Meteorology and atmospheric dynamics (climatology; tropical meteorology; turbulence

  17. Final environmental assessment for vegetation control at VHF stations, microwave stations, electrical substations, and pole yards

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-10-13

    Southwestern Power Adm. operates very high frequency (VHF) and microwave radio stations, electrical substations, and pole yards for electric power transmission throughout AR, MO, and OK. Vegetation growth at the stations must be suppressed for safety of operation and personnel. Southwestern has been using a combination of mechanical/manual and herbicide control for this purpose; Federally- mandated reductions in staff and budgetary resources require Southwestern to evaluate all potentially efficient methods for vegetation control. Three alternatives were examined: no action, mechanical/manual control, and (proposed) a combination of mechanical/manual and herbicide control. Environmental impacts on air and water quality, wetlands, wildlife, endangered species, archaeological and other resources, farmland, human health, transportation, etc. were evaluated.

  18. Morphology and Structural Characterization of Carbon Nanowalls Grown via VHF-PECVD

    Science.gov (United States)

    Akmal Hasanudin, M.; Wahab, Y.; Ismail, A. K.; Zahid Jamal, Z. A.

    2018-03-01

    A 150 MHz very high frequency plasma enhanced chemical vapor deposition (150 MHz VHF-PECVD) system was utilized to fabricate two-dimensional carbon nanostructure from the mixture of methane and hydrogen. Morphology and structural properties of the grown nanostructure were investigated by FESEM imaging and Raman spectroscopy. Carbon nanowalls (CNW) with dense and wavy-like structure were successfully synthesized. The wavy-like morphology of CNW was found to be more distinct during growth at small electrode spacing and denser with increasing deposition time due to better flux of hydrocarbon radicals to the substrate and higher rate of reaction, respectively. Typical characteristics of CNW were observed from strong D band, narrow bandwidth of G band and single broad peak of 2D band of Raman spectra indicating the presence of disordered nanocrystalline graphite structure with high degree of graphitization.

  19. Graphene-based tunable non-foster circuit for VHF applications

    Energy Technology Data Exchange (ETDEWEB)

    Tian, Jing; Nagarkoti, Deepak Singh; Rajab, Khalid Z.; Hao, Yang, E-mail: y.hao@qmul.ac.uk [School of Electronic Engineering and Computer Science, Queen Mary, University of London, London, E1 4NS (United Kingdom)

    2016-06-15

    This paper presents a negative impedance converter (NIC) based on graphene field effect transistors (GFETs) for VHF applications. The NIC is designed following Linvill’s open circuit stable (OCS) topology. The DC modelling parameters of GFET are extracted from a device measured by Meric et al. [IEEE Electron Devices Meeting, 23.2.1 (2010)] Estimated parasitics are also taken into account. Simulation results from Keysight Advanced Design System (ADS) show good NIC performance up to 200 MHz and the value of negative capacitance is directly proportional to the capacitive load. In addition, it has been shown that by varying the supply voltage the value of negative capacitance can also be tuned. The NIC stability has been tested up to 2 GHz (10 times the maximum operation frequency) using Nyquist stability criterion to ensure there are no oscillation issues.

  20. Development of a High-Brightness VHF Electron Source at LBNL

    International Nuclear Information System (INIS)

    Lidia, Steven M.; Sannibale, Fernando; Staples, John W.; Virostek, Steve P.; Wells, Russell P.

    2007-01-01

    Currently proposed ERL and high average power FEL projects require electron beam sources that can generate ∼1nC bunch charges at high repetition rates. Many proposed sources are based around either high voltage DC or microwave RF guns, each with its particular set of technological limits and system complications. We propose a novel solution that greatly diminishes high voltage breakdown issues while also decreasing peak RF power requirements in a warm copper device, and that has the benefit of mapping the rf oscillation period much more closely to the required beam repetition rate. We present the initial RF and mechanical design for a 750kV electron source and beam injection system utilizing a gun resonant in the VHF band. Beam dynamics simulations demonstrate excellent beam quality preservation and transport

  1. Graphene-based tunable non-foster circuit for VHF applications

    Directory of Open Access Journals (Sweden)

    Jing Tian

    2016-06-01

    Full Text Available This paper presents a negative impedance converter (NIC based on graphene field effect transistors (GFETs for VHF applications. The NIC is designed following Linvill’s open circuit stable (OCS topology. The DC modelling parameters of GFET are extracted from a device measured by Meric et al. [IEEE Electron Devices Meeting, 23.2.1 (2010] Estimated parasitics are also taken into account. Simulation results from Keysight Advanced Design System (ADS show good NIC performance up to 200 MHz and the value of negative capacitance is directly proportional to the capacitive load. In addition, it has been shown that by varying the supply voltage the value of negative capacitance can also be tuned. The NIC stability has been tested up to 2 GHz (10 times the maximum operation frequency using Nyquist stability criterion to ensure there are no oscillation issues.

  2. A VHF Class E DC-DC Converter with Self-Oscillating Gate Driver

    DEFF Research Database (Denmark)

    Andersen, Toke Meyer; Christensen, Søren K.; Knott, Arnold

    2011-01-01

    , is inherently resonant, and switching losses are greatly reduced by ensuring Zero Voltage Switching (ZVS) of the power semiconductor devices. A design method to ensure ZVS operation when combining the inverter, rectifier, and gate driver is provided. Several parasitic effects and their influence on converter......This paper describes the analysis and design of a DC-DC converter topology which is operational at frequencies in the Very High Frequency (VHF) band ranging from 30 MHz − 300 MHz. The presented topology, which consists of a class E inverter, class E rectifier, and self-oscillating gate driver...... operation are discussed, and measurement results of a 100 MHz prototype converter are presented and evaluated. The designed prototype converter verifies the described topology....

  3. Partial Discharge Spectral Characterization in HF, VHF and UHF Bands Using Particle Swarm Optimization.

    Science.gov (United States)

    Robles, Guillermo; Fresno, José Manuel; Martínez-Tarifa, Juan Manuel; Ardila-Rey, Jorge Alfredo; Parrado-Hernández, Emilio

    2018-03-01

    The measurement of partial discharge (PD) signals in the radio frequency (RF) range has gained popularity among utilities and specialized monitoring companies in recent years. Unfortunately, in most of the occasions the data are hidden by noise and coupled interferences that hinder their interpretation and renders them useless especially in acquisition systems in the ultra high frequency (UHF) band where the signals of interest are weak. This paper is focused on a method that uses a selective spectral signal characterization to feature each signal, type of partial discharge or interferences/noise, with the power contained in the most representative frequency bands. The technique can be considered as a dimensionality reduction problem where all the energy information contained in the frequency components is condensed in a reduced number of UHF or high frequency (HF) and very high frequency (VHF) bands. In general, dimensionality reduction methods make the interpretation of results a difficult task because the inherent physical nature of the signal is lost in the process. The proposed selective spectral characterization is a preprocessing tool that facilitates further main processing. The starting point is a clustering of signals that could form the core of a PD monitoring system. Therefore, the dimensionality reduction technique should discover the best frequency bands to enhance the affinity between signals in the same cluster and the differences between signals in different clusters. This is done maximizing the minimum Mahalanobis distance between clusters using particle swarm optimization (PSO). The tool is tested with three sets of experimental signals to demonstrate its capabilities in separating noise and PDs with low signal-to-noise ratio and separating different types of partial discharges measured in the UHF and HF/VHF bands.

  4. Mechanical design and fabrication of the VHF-gun, the Berkeley normal-conducting continuous-wave high-brightness electron source

    Science.gov (United States)

    Wells, R. P.; Ghiorso, W.; Staples, J.; Huang, T. M.; Sannibale, F.; Kramasz, T. D.

    2016-02-01

    A high repetition rate, MHz-class, high-brightness electron source is a key element in future high-repetition-rate x-ray free electron laser-based light sources. The VHF-gun, a novel low frequency radio-frequency gun, is the Lawrence Berkeley National Laboratory (LBNL) response to that need. The gun design is based on a normal conducting, single cell cavity resonating at 186 MHz in the VHF band and capable of continuous wave operation while still delivering the high accelerating fields at the cathode required for the high brightness performance. The VHF-gun was fabricated and successfully commissioned in the framework of the Advanced Photo-injector EXperiment, an injector built at LBNL to demonstrate the capability of the gun to deliver the required beam quality. The basis for the selection of the VHF-gun technology, novel design features, and fabrication techniques are described.

  5. A Tower-based Prototype VHF/UHF Radar for Subsurface Sensing: System Description and Data Inversion Results

    Science.gov (United States)

    Moghaddam, Mahta; Pierce, Leland; Tabatabaeenejad, Alireza; Rodriguez, Ernesto

    2005-01-01

    Knowledge of subsurface characteristics such as permittivity variations and layering structure could provide a breakthrough in many terrestrial and planetary science disciplines. For Earth science, knowledge of subsurface and subcanopy soil moisture layers can enable the estimation of vertical flow in the soil column linking surface hydrologic processes with that in the subsurface. For planetary science, determining the existence of subsurface water and ice is regarded as one of the most critical information needs for the study of the origins of the solar system. The subsurface in general can be described as several near-parallel layers with rough interfaces. Each homogenous rough layer can be defined by its average thickness, permittivity, and rms interface roughness assuming a known surface spectral distribution. As the number and depth of layers increase, the number of measurements needed to invert for the layer unknowns also increases, and deeper penetration capability would be required. To nondestructively calculate the characteristics of the rough layers, a multifrequency polarimetric radar backscattering approach can be used. One such system is that we have developed for data prototyping of the Microwave Observatory of Subcanopy and Subsurface (MOSS) mission concept. A tower-mounted radar makes backscattering measurements at VHF, UHF, and L-band frequencies. The radar is a pulsed CW system, which uses the same wideband antenna to transmit and receive the signals at all three frequencies. To focus the beam at various incidence angles within the beamwidth of the antenna, the tower is moved vertically and measurements made at each position. The signals are coherently summed to achieve focusing and image formation in the subsurface. This requires an estimate of wave velocity profiles. To solve the inverse scattering problem for subsurface velocity profile simultaneously with radar focusing, we use an iterative technique based on a forward numerical solution of

  6. Diversity receiver

    NARCIS (Netherlands)

    2005-01-01

    The invention is directed to the reception of high rate radio signals (for example DVB-T signals) while the receiver is moving at a high speed (for example in or with a car). Two or more antennas (12, 16) are closely spaced and arranged behind each other in the direction of motion (v) for receiving

  7. First Joint Observations of Radio Aurora by the VHF and HF Radars of the ISTP SB RAS

    Science.gov (United States)

    Berngardt, O. I.; Lebedev, V. P.; Kutelev, K. A.; Kushnarev, D. S.; Grkovich, K. V.

    2018-01-01

    Two modern radars for diagnosis of the ionosphere by the radio-wave backscattering method, namely, the Irkutsk incoherent scatter radar at VHF (IISR, 154-162 MHz) and the Ekaterinburg coherent radar at HF (EKB, 8-20 MHz) are operated at the Institute of Solar-Terrestrial Physics, Siberian Branch of the Russian Academy of Sciences (ISTP SB RAS). The paper analyzes the results of joint observations of strong scattering (radio aurora) on June 8, 2015. To determine the geographical position of the radio aurora, we developed original methods that take into account both the features of the radio-wave propagation and the features of the radar antenna systems. It is shown that there are areas where the spatial position of the HF and VHF radio aurora can coincide. This permits using the radars as a single complex for diagnosis of the characteristics of small-scale high-latitude irregularities in the ionospheric E and F layers. A comparative analysis of the characteristics and temporal dynamics of the radio-aurora region in the HF and VHF ranges is performed. Using the DMSP satellite data, it has been shown that the radio aurora dynamics during this experiment with the EKB radar can be related with the spatial dynamics of the localized area with high electric field, which moves from high to equatorial latitudes. It is found that due to the broader field of view, radio aurora at the HF radar was stably observed 6-12 min earlier than at the VHF radar. This permits using the EKB radar data for prediction of the radio-aurora detection by the IISR radar.

  8. Meteor head echo altitude distributions and the height cutoff effect studied with the EISCAT HPLA UHF and VHF radars

    Directory of Open Access Journals (Sweden)

    A. Westman

    2004-04-01

    Full Text Available Meteor head echo altitude distributions have been derived from data collected with the EISCAT VHF (224MHz and UHF (930MHz high-power, large-aperture (HPLA radars. At the high-altitude end, the distributions cut off abruptly in a manner reminiscent of the trail echo height ceiling effect observed with classical meteor radars. The target dimensions are shown to be much smaller than both the VHF and the UHF probing wavelengths, but the cutoff heights for the two systems are still clearly different, the VHF cutoff being located several km above the UHF one. A single-collision meteor-atmosphere interaction model is used to demonstrate that meteors in the (1.3–7.2µg mass range will ionise such that critical electron density at 224MHz is first reached at or around the VHF cutoff altitude and critical density at 930MHz will be reached at the UHF cutoff altitude. The observed seasonal variation in the cutoff altitudes is shown to be a function of the seasonal variation of atmospheric density with altitude. Assuming that the electron density required for detection is in the order of the critical density, the abrupt altitude cutoffs can be explained as a consequence of the micrometeoroid joint size-speed distribution dropping off so fast at the large-mass, high-velocity end that above a certain altitude the number of detectable events becomes vanishingly small. Conversely, meteors at the low-mass end of the distribution will be gradually retarded such that the ionisation they generate never reaches critical density. These particles will remain unobservable.Key words. Radio science (instruments and techniques – Interplatery physics (interplanetary dust – General or miscellaneous (new fields

  9. Broadband VHF Interferometer Observations of an Energetic In-cloud Pulse (EIP)

    Science.gov (United States)

    Tilles, J.; Krehbiel, P. R.; Stanley, M. A.; Rison, W.; Lyu, F.; Cummer, S.; Liu, N.; Dwyer, J. R.; Brown, R. G.; Wilson, J. G.

    2017-12-01

    Energetic in-cloud pulses (EIPs) are a little-known in-cloud subprocess of lightning. While they may be best identified by their large peak current (>200 kA) [Lyu et al., Geophys. Res. Lett., 42, 2015], they differ from narrow bipolar events (NBEs) - another type of in-cloud, high peak-current process - in that the sferic of an EIP lasts an order of magnitude longer ( ˜100 us) than that of a typical NBE ( ˜10 us). To further differentiate them from NBEs, EIPs are generally embedded within other electrical activity, whereas NBEs are known to primarily occur in isolation or as a lightning-initiating event [Smith et al., J. Geophys. Res., 104, D4, 4189-4212, 1999; Rison et al., Nat. Commun., 7, 10721, 2016]. Moreover, EIPs may have an intrinsic connection with the production of terrestrial gamma ray flashes (TGFs) [Cummer et al., Geophys. Res. Lett., 41, 8586-8593, 2014].Here we present coincident broadband VHF interferometer (INTF) observations and electric and magnetic field waveforms of an EIP with an associated NLDN peak current of 247 kA. The EIP occurs nearly 4 ms into a normal-polarity intracloud flash as part of the upward extension of the negative-polarity lightning leader. For this reason, we suspect that EIPs are a more energetic version of initial breakdown pulses (IBPs), which accompany the development of negative stepped leaders [e.g. Marshall et al., J. Geophys. Res. Atmos., 119, 445-460, 2014]. In addition, we show similarities with NBE-producing fast breakdown [Rison et al., 2016; Tilles et al., AE12A-03, AGU Fall Meeting, 2016], in that the breakdown accompanying the EIP propagates over a similar vertical extent ( ˜0.5-1 km) and with similar propagation speed ( ˜3×107 m/s). The INTF was developed by New Mexico Tech and has been deployed at Kennedy Space Center since July 2016. It employed three 100-m baselines in 2016, has a bandwidth of 14-88 MHz and samples at 180 MS/s with 16-bit resolution. A synchronously digitized fast antenna (FA), with

  10. Disturbances in VHF/UHF telemetry links as a possible effect of the 2003 Hokkaido Tokachi-oki earthquake

    Directory of Open Access Journals (Sweden)

    H. Nagamoto

    2008-08-01

    Full Text Available The data on radio telemetry links (for water information at VHF/UHF in Hokkaido are used to investigate the rate of disturbances on radio links (or connection failure and its association with a huge earthquake, Tokachi-oki earthquake on 26 September 2003. Especially, the telemetry links at the Tokachi region closest to the earthquake epicenter, showed a significant increase in disturbances on radio links two weeks to a few days before the earthquake on the basis of analysis during a long interval from 1 June 2002 to 3 November 2007 (over 5 years. We suggest that these severe disturbances in VHF/UHF telemetry links are attributed to the generation of seismogenic VHF/UHF radio noises (emissions. Based on this idea, we have estimated that the intensity of these seismogenic emissions is on the order of 10–19 dB μV/m. Finally, the present result was compared with other physical parameters already obtained for this earthquake.

  11. Study of CNT growth using nanocatalyst Ag precursor by HWC-VHF-PECVD

    International Nuclear Information System (INIS)

    Eliyana, Ajeng; Rosikin, Ahmad; Winata, Toto

    2015-01-01

    The study of CNT growth has been done by using silver (Ag) nanocatalyst as a guide precursor on corning glass 7059 substrate. The silver catalyst was prepared by the evaporation method by varying deposition time for 50, 25, and 14 seconds. The silver films were then annealed at temperature of 400°C for 4 hours. From Scanning Electron Microscope (SEM) and Energy Dispersive X-ray Spectroscopy (EDX) results the grain sizes are 65 nm, 57 nm, and 33 nm, and also the atomic compositions are 6,06%, 4,52%, and 3,73% for 14, 25 and 50 seconds samples, respectively. The 33 nm samples were then used for CNT growth by using Hot Wire Cell (HWC) – Very High Frequency (VHF) – Plasma Enhanced Chemical Vapor Deposition (PECVD) at 275 ° C deposition temperature and pressure of 300 mTorr. The rf power was varied from 8 to 20 watts, with deposition time for 60 minutes. The methane (CH4) 99.999% was used as Carbon sources. Hydrogen gas (H2) was used to etch the oxide layer formed during the pre-deposition process. The diameter and length for the CNT are 125 nm and 1.650 to 2.989 nm respectively

  12. Ion upflow and downflow at the topside ionosphere observed by the EISCAT VHF radar

    Directory of Open Access Journals (Sweden)

    M. Endo

    2000-02-01

    Full Text Available We have determined the MLT distribution and KP dependence of the ion upflow and downflow of the thermal bulk oxygen ion population based on a data analysis using the EISCAT VHF radar CP-7 data obtained at Tromsø during the period between 1990 and 1996: (1 both ion upflow and downflow events can be observed at any local time (MLT, irrespective of dayside and nightside, and under any magnetic disturbance level, irrespective of quiet and disturbed levels; (2 these upflow and downflow events are more frequently observed in the nightside than in the dayside; (3 the upflow events are more frequently observed than the downflow events at any local time except midnight and at any KP level and the difference of the occurrence frequencies between the upflow and downflow events is smaller around midnight; and (4 the occurrence frequencies of both the ion upflow and downflow events appear to increase with increasing KP level, while the occurrence frequency of the downflow appears to stop increasing at some KP level.Key words: Ionosphere (particle acceleration; plasma waves and instabilities - Space plasma physics (transport processes

  13. Anisotropy of Doppler spectral parameters in the VHF radar observations at MU and White Sands

    Directory of Open Access Journals (Sweden)

    G. D. Nastrom

    2001-08-01

    Full Text Available Significant differences are found between the mean spectral widths from beams in the meridional plane and in the zonal plane at both the MU and the White Sands VHF radars. The spectral width in the beam directed perpendicular to the prevailing wind is greater than that in the beam parallel to the wind. The magnitudes of the differences in spectral width show a linear relationship with wind speed, with the greatest differences at the greatest wind speeds. The differences in spectral width show a positive correlation with the differences in backscattered power. The anisotropy in backscattered power is well-known and is usually attributed to aspect sensitivity effects. However, the anisotropy in spectral width does not appear to be due to the same mechanism, and while several hypotheses to account for this are considered, including finite range-volume effects, effects from the tilting of isentropic layers, and anisotropic turbulence effects, it is seen that each of these suggestions has its shortcomings.Key words. Meteorology and atmospheric dynamics (turbulence; instruments and techniques

  14. Study of CNT growth using nanocatalyst Ag precursor by HWC-VHF-PECVD

    Energy Technology Data Exchange (ETDEWEB)

    Eliyana, Ajeng; Rosikin, Ahmad; Winata, Toto, E-mail: toto@fi.itb.ac.id [Physics of Electronics Material Research Division, Physics Programme, Faculty of Mathematics and Natural Sciences, Institut Teknologi Bandung, Jl. Ganesha 10, Bandung 40132, West Java (Indonesia)

    2015-04-16

    The study of CNT growth has been done by using silver (Ag) nanocatalyst as a guide precursor on corning glass 7059 substrate. The silver catalyst was prepared by the evaporation method by varying deposition time for 50, 25, and 14 seconds. The silver films were then annealed at temperature of 400°C for 4 hours. From Scanning Electron Microscope (SEM) and Energy Dispersive X-ray Spectroscopy (EDX) results the grain sizes are 65 nm, 57 nm, and 33 nm, and also the atomic compositions are 6,06%, 4,52%, and 3,73% for 14, 25 and 50 seconds samples, respectively. The 33 nm samples were then used for CNT growth by using Hot Wire Cell (HWC) – Very High Frequency (VHF) – Plasma Enhanced Chemical Vapor Deposition (PECVD) at 275 ° C deposition temperature and pressure of 300 mTorr. The rf power was varied from 8 to 20 watts, with deposition time for 60 minutes. The methane (CH4) 99.999% was used as Carbon sources. Hydrogen gas (H2) was used to etch the oxide layer formed during the pre-deposition process. The diameter and length for the CNT are 125 nm and 1.650 to 2.989 nm respectively.

  15. VHF and HF radar measurements of E and R region plasma drifts at the magnetic equator

    International Nuclear Information System (INIS)

    Viswanathan, K.S.; Namboothiri, S.P.; Rao, P.B.

    1992-01-01

    Simultaneous observations of E region horizontal irregularity drifts by VHF backscatter radar and of F region vertical plasma drift by HF Doppler radar conducted during daytime on a few magnetically quiet days at Trivandrum (dip 0.2 degree N) are presented. A comparative study of the two measurements indicates broadly (1) a resemblance in the daytime changes of the E-W component between the electric field and (2) evidence of quasi-periodic electric field variations with periods ranging mostly from 1 to 2 hours. The electric fields derived from HF Doppler radar observations are somewhat lower than those deduced by HVHF radar observations. The correlation coefficient for the variations of the electric fields measured by the two experimental techniques is found to be in the range of about 0.5 to 0.9. The observed difference in the E and F region electric fields at the magnetic equator is discussed in terms of the measurement uncertainties and the limitations involved in deriving E-W electric fields. The observations are suggestive of a latitudinal variation in the E-W component of the electric field in the equatorial ionosphere

  16. The relationship between VHF radar auroral backscatter amplitude and Doppler velocity: a statistical study

    Directory of Open Access Journals (Sweden)

    B. A. Shand

    Full Text Available A statistical investigation of the relationship between VHF radar auroral backscatter intensity and Doppler velocity has been undertaken with data collected from 8 years operation of the Wick site of the Sweden And Britain Radar-auroral Experiment (SABRE. The results indicate three different regimes within the statistical data set; firstly, for Doppler velocities <200 m s–1, the backscatter intensity (measured in decibels remains relatively constant. Secondly, a linear relationship is observed between the backscatter intensity (in decibels and Doppler velocity for velocities between 200 m s–1 and 700 m s–1. At velocities greater than 700 m s–1 the backscatter intensity saturates at a maximum value as the Doppler velocity increases. There are three possible geophysical mechanisms for the saturation in the backscatter intensity at high phase speeds: a saturation in the irregularity turbulence level, a maximisation of the scattering volume, and a modification of the local ambient electron density. There is also a difference in the dependence of the backscatter intensity on Doppler velocity for the flow towards and away from the radar. The results for flow towards the radar exhibit a consistent relationship between backscatter intensity and measured velocities throughout the solar cycle. For flow away from the radar, however, the relationship between backscatter intensity and Doppler velocity varies during the solar cycle. The geometry of the SABRE system ensures that flow towards the radar is predominantly associated with the eastward electrojet, and flow away is associated with the westward electrojet. The difference in the backscatter intensity variation as a function of Doppler velocity is attributed to asymmetries between the eastward and westward electrojets and the geophysical parameters controlling the backscatter amplitude.

  17. The relationship between VHF radar auroral backscatter amplitude and Doppler velocity: a statistical study

    Directory of Open Access Journals (Sweden)

    B. A. Shand

    1996-08-01

    Full Text Available A statistical investigation of the relationship between VHF radar auroral backscatter intensity and Doppler velocity has been undertaken with data collected from 8 years operation of the Wick site of the Sweden And Britain Radar-auroral Experiment (SABRE. The results indicate three different regimes within the statistical data set; firstly, for Doppler velocities <200 m s–1, the backscatter intensity (measured in decibels remains relatively constant. Secondly, a linear relationship is observed between the backscatter intensity (in decibels and Doppler velocity for velocities between 200 m s–1 and 700 m s–1. At velocities greater than 700 m s–1 the backscatter intensity saturates at a maximum value as the Doppler velocity increases. There are three possible geophysical mechanisms for the saturation in the backscatter intensity at high phase speeds: a saturation in the irregularity turbulence level, a maximisation of the scattering volume, and a modification of the local ambient electron density. There is also a difference in the dependence of the backscatter intensity on Doppler velocity for the flow towards and away from the radar. The results for flow towards the radar exhibit a consistent relationship between backscatter intensity and measured velocities throughout the solar cycle. For flow away from the radar, however, the relationship between backscatter intensity and Doppler velocity varies during the solar cycle. The geometry of the SABRE system ensures that flow towards the radar is predominantly associated with the eastward electrojet, and flow away is associated with the westward electrojet. The difference in the backscatter intensity variation as a function of Doppler velocity is attributed to asymmetries between the eastward and westward electrojets and the geophysical parameters controlling the backscatter amplitude.

  18. Effect of solar and magnetic activity on VHF scintillations near the equatorial anomaly crest

    Directory of Open Access Journals (Sweden)

    R. P. Singh

    2004-09-01

    Full Text Available The VHF amplitude scintillation recorded during the period January 1991 to December 1993 in the declining phase of a solar cycle and April 1998 to December 1999 in the ascending phase of the next solar cycle at Varanasi (geogr. lat.=25.3°, long.=83.0°, dip=37°N have been analyzed to study the behavior of ionospheric irregularities during active solar periods and magnetic storms. It is shown that irregularities occur at arbitrary times and may last for <30min. A rise in solar activity increases scintillations during winter (November-February and near equinoxes (March-April; September-October, whereas it depresses the scintillations during the summer (May-July. In general, the role of magnetic activity is to suppress scintillations in the pre-midnight period and to increase it in the post-midnight period during equinox and winter seasons, whilst during summer months the effect is reversed. The pre-midnight scintillation is sometimes observed when the main phase of Dst corresponds to the pre-midnight period. The annual variation shows suppression of scintillations on disturbed days, both during pre-midnight and post-midnight period, which becomes more effective during years of high solar activity. It is observed that for magnetic storms for which the recovery phase starts post-midnight, the probability of occurrence of irregularities is enhanced during this time. If the magnetic storm occurred during daytime, then the probability of occurrence of scintillations during the night hours is decreased. The penetration of magnetospheric electric fields to the magnetic equator affects the evolution of low-latitude irregularities. A delayed disturbance dynamo electric field also affects the development of irregularities.

  19. Simulation of Controller Pilot Data Link Communications over VHF Digital Link Mode 3

    Science.gov (United States)

    Bretmersky, Steven C.; Murawski, Robert; Nguyen, Thanh C.; Raghavan, Rajesh S.

    2004-01-01

    The Federal Aviation Administration (FAA) has established an operational plan for the future Air Traffic Management (ATM) system, in which the Controller Pilot Data Link Communications (CPDLC) is envisioned to evolve into digital messaging that will take on an ever increasing role in controller to pilot communications, significantly changing the way the National Airspace System (NAS) is operating. According to FAA, CPDLC represents the first phase of the transition from the current analog voice system to an International Civil Aviation Organization (ICAO) compliant system in which digital communication becomes the alternate and perhaps primary method of routine communication. The CPDLC application is an Air Traffic Service (ATS) application in which pilots and controllers exchange messages via an addressed data link. CPDLC includes a set of clearance, information, and request message elements that correspond to existing phraseology employed by current Air Traffic Control (ATC) procedures. These message elements encompass altitude assignments, crossing constraints, lateral deviations, route changes and clearances, speed assignments, radio frequency assignments, and various requests for information. The pilot is provided with the capability to respond to messages, to request clearances and information, to report information, and to declare/rescind an emergency. A 'free text' capability is also provided to exchange information not conforming to defined formats. This paper presents simulated results of the aeronautical telecommunication application Controller Pilot Data Link Communications over VHF Digital Link Mode 3 (VDL Mode 3). The objective of this simulation study was to determine the impact of CPDLC traffic loads, in terms of timely message delivery and capacity of the VDL Mode 3 subnetwork. The traffic model is based on and is used for generating air/ground messages with different priorities. Communication is modeled for the en route domain of the Cleveland

  20. Radar efficiency and the calculation of decade-long PMSE backscatter cross-section for the Resolute Bay VHF radar

    Directory of Open Access Journals (Sweden)

    N. Swarnalingam

    2009-04-01

    Full Text Available The Resolute Bay VHF radar, located in Nunavut, Canada (75.0° N, 95.0° W and operating at 51.5 MHz, has been used to investigate Polar Mesosphere Summer Echoes (PMSE since 1997. PMSE are a unique form of strong coherent radar echoes, and their understanding has been a challenge to the scientific community since their discovery more than three decades ago. While other high latitude radars have recorded strong levels of PMSE activities, the Resolute Bay radar has observed relatively lower levels of PMSE strengths. In order to derive absolute measurements of PMSE strength at this site, a technique is developed to determine the radar efficiency using cosmic (sky noise variations along with the help of a calibrated noise source. VHF radars are only rarely calibrated, but determination of efficiency is even less common. Here we emphasize the importance of efficiency for determination of cross-section measurements. The significant advantage of this method is that it can be directly applied to any MST radar system anywhere in the world as long as the sky noise variations are known. The radar efficiencies for two on-site radars at Resolute Bay are determined. PMSE backscatter cross-section is estimated, and decade-long PMSE strength variations at this location are investigated. It was noticed that the median of the backscatter cross-section distribution remains relatively unchanged, but over the years a great level of variability occurs in the high power tail of the distribution.

  1. High-Rate Fabrication of a-Si-Based Thin-Film Solar Cells Using Large-Area VHF PECVD Processes

    Energy Technology Data Exchange (ETDEWEB)

    Deng, Xunming [University of Toledo; Fan, Qi Hua

    2011-12-31

    The University of Toledo (UT), working in concert with it’s a-Si-based PV industry partner Xunlight Corporation (Xunlight), has conducted a comprehensive study to develop a large-area (3ft x 3ft) VHF PECVD system for high rate uniform fabrication of silicon absorber layers, and the large-area VHF PECVD processes to achieve high performance a-Si/a-SiGe or a-Si/nc-Si tandem junction solar cells during the period of July 1, 2008 to Dec. 31, 2011, under DOE Award No. DE-FG36-08GO18073. The project had two primary goals: (i) to develop and improve a large area (3 ft × 3 ft) VHF PECVD system for high rate fabrication of > = 8 Å/s a-Si and >= 20 Å/s nc-Si or 4 Å/s a-SiGe absorber layers with high uniformity in film thicknesses and in material structures. (ii) to develop and optimize the large-area VHF PECVD processes to achieve high-performance a-Si/nc-Si or a-Si/a-SiGe tandem-junction solar cells with >= 10% stable efficiency. Our work has met the goals and is summarized in “Accomplishments versus goals and objectives”.

  2. Utilizing Yagi antennas in Lightning Mapping Array to detect low-power VHF signals

    Science.gov (United States)

    Tilles, J.; Thomas, R. J.; Edens, H. E.; Krehbiel, P. R.; Rison, W.

    2013-12-01

    The New Mexico Tech VHF Lightning Mapping Array (LMA) being operated at Langmuir Laboratory in central New Mexico is comprised of 22 time-of-arrival stations spanning an area approximately 60 km north-south and 45 km east-west. Nine stations are at high altitude (3.1-3.3 km GPS) over a 3 x 4 km area around the mountain-top Laboratory, and 13 are on the surrounding plains and the Rio Grande valley, at altitudes between 1.4 and 2.2 km. Each station utilizes a vertical half-wave dipole antenna having about 2 dBi gain at horizontal incidence and providing omnidirectional azimuthal coverage. In 2012, four additional stations utilizing higher gain (11 dBi) Yagi antennas were co-located at four of the surrounding sites within 10-15 km of the laboratory, each pointed over the laboratory area. The purpose was to test if directional antennas would improve detection of low-power sources in the laboratory vicinity, such as those associated with positive breakdown or weak precursor events. The test involved comparing the number and quality of radiation sources obtained by processing data from two sets of stations: first for a 17-station network in which all stations were omnidirectional, and then for the same network with Yagi-based measurements substituted in place of the omni measurements at the four co-located stations. For radiation events located in both datasets, the indicated source power values from Yagi stations were typically 5-10 dB greater than their omnidirectional counterpart for sources over or near the laboratory, consistent with the 9 dB difference in on-axis gain values. The difference decreased through zero and to negative values with increasing distance from the laboratory, confirming that it was due to the directionality of the Yagi antennas. It was expected that a network having Yagi antennas at all outlying stations would improve the network's detection of lower power sources in its central region. Rather, preliminary results show that there is no

  3. Three-Dimensional Reconstruction of Cloud-to-Ground Lightning Using High-Speed Video and VHF Broadband Interferometer

    Science.gov (United States)

    Li, Yun; Qiu, Shi; Shi, Lihua; Huang, Zhengyu; Wang, Tao; Duan, Yantao

    2017-12-01

    The time resolved three-dimensional (3-D) spatial reconstruction of lightning channels using high-speed video (HSV) images and VHF broadband interferometer (BITF) data is first presented in this paper. Because VHF and optical radiations in step formation process occur with time separation no more than 1 μs, the observation data of BITF and HSV at two different sites provide the possibility of reconstructing the time resolved 3-D channel of lightning. With the proposed procedures for 3-D reconstruction of leader channels, dart leaders as well as stepped leaders with complex multiple branches can be well reconstructed. The differences between 2-D speeds and 3-D speeds of leader channels are analyzed by comparing the development of leader channels in 2-D and 3-D space. Since return stroke (RS) usually follows the path of previous leader channels, the 3-D speeds of the return strokes are first estimated by combination with the 3-D structure of the preceding leaders and HSV image sequences. For the fourth RS, the ratios of the 3-D to 2-D RS speeds increase with height, and the largest ratio of the 3-D to 2-D return stroke speeds can reach 2.03, which is larger than the result of triggered lightning reported by Idone. Since BITF can detect lightning radiation in a 360° view, correlated BITF and HSV observations increase the 3-D detection probability than dual-station HSV observations, which is helpful to obtain more events and deeper understanding of the lightning process.

  4. Investigation of atmospheric high-energy phenomena onboard International Space Station: microsatellite ''Chibis-AI'' and VHF interferometer ''Kite''

    International Nuclear Information System (INIS)

    Dolgonosov, M.; Gotlib, V.; Karedin, V.; Kosov, A.; Nazarov, V.; Zelenyi, L.; Klimov, S.

    2017-01-01

    Space Research Institute of the RAS is gradually developing its own program of the space-born experiments to study high- energy process in the terrestrial atmosphere. Terrestrial Gamma-ray Flashes (TGFS) and Compact Intracloud Discharges (CIDs) are among principal goals of the scientific research of the program. To conduct research is supposed to produce new «instruments»: microsatellite «ChibiS-AI» and VHF interferometer «Kite» aboard International Space Station. Microsatellite ”Chibis-AI” will be constructed on the platform originally designed at the Special Engineering Department of Space Research Institute of the Russian Academy of Sciences in 2011. It's forerunner «Chibis-M» was successfully launched in 2012. Expected date of «Chibis-AI» launch is 2019. The principal idea underlying design of the scientific payload of the microsatellite ”Chibis-AI” is the joint observations of the TGF and CID emissions by different detectors installed onboard: Radio Frequency Analyzer (RFA) and Neutron and Gamma spectrometer (N GS). RFA contained two passbands in the range 15-26 and 26-48 MHZ with a digitization at 96 megasamples/s. NGS is based on LaBr3(Ce3+) crystal with the maximum achievable today spectral resolution and efficiency of gamma rays in the energy range 100 Kev - 10 MeV among scintillation crystals. The microsatellite orbit will be circular with inclination 51° with initial elevation above sea level around 550 km. VHF interferometer «Kite» to be installed in 2019-2020 aboard 188. To implement interferometric scheme 4 antennas will be installed on the 188 surface. The passband of the instrument will be ∼50-100 MHZ. Technical details of both experiments, its current stage and features as well results of the previous experiment «Chibis-M» will be discussed. (author)

  5. Auxiliary VHF transmitter to aid recovery of solar Argos/GPS PTTs

    Science.gov (United States)

    Christopher P. Hansen; Mark A. Rumble; R. Scott Gamo; Joshua J. Millspaugh

    2014-01-01

    While conducting greater sage-grouse (Centrocercus urophasianus) research, we found that solar-powered global positioning systems platform transmitter terminals (GPS PTTs) can be lost if the solar panel does not receive adequate sunlight. Thus, we developed 5-g (mortality sensor included; Prototype A) and 9.8-g (no mortality sensor; Prototype B) auxiliary very high...

  6. Electronic warfare receivers and receiving systems

    CERN Document Server

    Poisel, Richard A

    2014-01-01

    Receivers systems are considered the core of electronic warfare (EW) intercept systems. Without them, the fundamental purpose of such systems is null and void. This book considers the major elements that make up receiver systems and the receivers that go in them.This resource provides system design engineers with techniques for design and development of EW receivers for modern modulations (spread spectrum) in addition to receivers for older, common modulation formats. Each major module in these receivers is considered in detail. Design information is included as well as performance tradeoffs o

  7. Calculating the azimuth of mountain waves, using the effect of tilted fine-scale stable layers on VHF radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    1999-02-01

    Full Text Available A simple method is described, based on standard VHF wind-profiler data, where imbalances of echo power between four off-vertical radar beams, caused by mountain waves, can be used to calculate the orientation of the wave pattern. It is shown that the mountain wave azimuth (direction of the horizontal component of the wavevector, is given by the vector [ W (PE - P W ,W (PN - P S ]; PN, PS, PE, PW are radar echo powers, measured in dB, in beams pointed away from vertical by the same angle towards north, south, east and west respectively, and W is the vertical wind velocity. The method is applied to Aberystwyth MST radar data, and the calculated wave vector usually, but not always, points into the low-level wind direction. The mean vertical wind at Aberystwyth, which may also be affected by tilted aspect-sensitive layers, is investigated briefly using the entire radar output 1990-1997. The mean vertical-wind profile is inconsistent with existing theories, but a new mountain-wave interpretation is proposed.Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; waves and tides; instruments and techniques.

  8. Vertical structure of the vhf backscattering region in the equatorial electrojet and the gradient drift instability

    International Nuclear Information System (INIS)

    Fejer, B.G.; Farley, D.T.; Balsley, B.B.; Woodman, R.F.

    1974-01-01

    Radar measurements made with high spatial resolution and large dynamic range at the Jicamarca Radar Observatory near the time of reversal of the electrojet current provide further proof that the gradient drift instability is in fact responsible for the type-2 irregularities. Echoes are received over a much wider range of altitudes at night than during the day, partly because of the change in character of the background electron density profile and partly because of recombination effects, which can be important during the day. One must be cautious, particularly at night, in associating the mean Doppler shift of oblique radar echoes with the maximum east--west electron drift velocity

  9. Vertical structure of the VHF backscattering region in the equatorial electrojet and the gradient drift instability

    International Nuclear Information System (INIS)

    Fejer, B.G.; Farley, D.T.; Balsley, B.B.; Woodman, R.F.

    1975-01-01

    Radar measurements made with high spatial resolution and large dynamic range at the Jicamarca Radar Observatory near the time of reversal of the electrojet current provide further proof that the gradient drift instability is in fact responsible for the type 2 irregularities. Echoes are received over a much wider range of altitudes at night than during the day partly because of the change in character of the background electron density profile and partly because of recombination effects, which can be important during the day. It is also shown that one must be cautious, particularly at night, in associating the mean Doppler shift of oblique radar echoes with the maximum east-west electron drift velocity

  10. Spatial variability of the aspect sensitivity of VHF radar echoes in the troposphere and lower stratosphere during jet stream passages

    Directory of Open Access Journals (Sweden)

    J. G. Yoe

    Full Text Available The aspect sensitivity of SOUSY-VHF-radar oblique-beam echoes from the troposphere and lower stratosphere has been examined for a number of jet stream passages during the years 1990 - 1992. When the core of the jet is overhead or nearly so, vertical profiles of the aspect sensitivity display two notable features. First, the distinction between mainly isotropic and strongly aspect-sensitive echoes in the troposphere and the lower stratosphere, respectively, often reported for measurements made during calm conditions, does not necessarily prevail in the vicinity of the jet stream. Second, echoes obtained at altitudes near the height of the horizontal wind maximum are found to be more aspect sensitive for beams directed parallel to the horizontal flow or nearly so, than for other beam directions. It is demonstrated that time-averaged horizontal wind speeds estimated from the radar data, taking into account the reduced effective oblique-beam zenith angle resulting from aspect sensitivity, may exceed uncorrected wind speeds by as much as 10 m s-1 in these circumstances. Implications for wind profiling and for describing the backscattering process are discussed. Doppler spectral widths examined for one jet stream passage are found to be narrower in a beam aligned with the horizontal wind at heights near the wind speed maximum than corresponding widths measured in a beam projected at right angles to the jet. The narrowest spectra thus coincide with the most aspect-sensitive echoes, consistent with the hypothesis that such returns result from specular backscattering processes.

  11. A no-tune no-match wideband probe for nuclear quadrupole resonance spectroscopy in the VHF range

    Science.gov (United States)

    Scharfetter, Hermann; Petrovic, Andreas; Eggenhofer, Heidi; Stollberger, Rudolf

    2014-12-01

    Nuclear quadrupole resonance (NQR) spectroscopy is a method for the characterization of chemical compounds containing so-called quadrupolar nuclei. Similar to nuclear magnetic resonance (NMR), the sample under investigation is irradiated with strong radiofrequency (RF) pulses, which stimulate the emission of weak RF signals from the quadrupolar nuclei. The signals are then amplified and Fourier transformed so as to obtain a spectrum. In principle, narrowband NQR spectra can be measured with NMR spectrometers. However, pure NQR signals require the absence of a static magnetic field and several special applications require the characterization of a substance over a large bandwidth, e.g. 50-100% of the central frequency, which is hardly possible with standard NMR equipment. Dedicated zero-field NQR equipment is not widespread and current concepts employ resonating probes which are tuned and matched over a wide range by using mechanical capacitors driven by stepper motors. While providing the highest signal to noise ratio (SNR) such probes are slow in operation and can only be operated from dedicated NMR consoles. We developed a low-cost NQR wideband probe without tuning and matching for applications in the very high frequency (VHF) range below 300 MHz. The probe coil was realized as part of a reactive network which approximates an exponential transmission line. The input reflection coefficient of the two developed prototype probe coils is ≤ 20 dB between 90-145 MHz and 74.5-99.5 MHz, respectively. Two wideband NQR spectra of published test substances were acquired with an SNR of better than 20 dB after sufficient averaging. The measured signals and the SNR correspond very well to the theoretically expected values and demonstrate the feasibility of the method. Because there is no need for tuning and matching, our probes can be operated easily from any available NMR console.

  12. Morphological study of the field-aligned E-layer irregularities observed by the Gadanki VHF radar

    Directory of Open Access Journals (Sweden)

    C. J. Pan

    2004-11-01

    Full Text Available We report on the field-aligned irregularities observed in the low-latitude sporadic E-layer (Es with the Gadanki (13.5° N, 79.2° E; geomagnetic latitude 6.3° N VHF radar. The radar was operated intermittently for 15 days during the summer months in 1998 and 1999, for both daytime and nighttime observation. The total observation periods are 161h for the nighttime and 68h for the daytime. The observations were used to study the percentage of occurrence of the E-region echoes for both daytime and nighttime. The statistical characteristics of the mean radial velocity and spectral width are presented for three cases based on the echo occurrence characteristics and the altitude of observations (from 90 to 140km ranges, namely, the lower E-region daytime (90-110km, the lower E-region nighttime (90-105km and the upper E-region nighttime (105-140km echoes. The results are compared with that of Piura, a low-latitude station located at about the same geomagnetic latitude, but to the south of the equator. By comparing the behaviors of the lower E-region radar echoes of the summer months between Gadanki and Piura, we find that the lower altitude echoes below about 100km are rarely reported in Piura but commonly seen in Gadanki. Features of the nighttime echoes observed by these two radars are quite similar but daytime FAI echoes are again seldom detected by Piura.

  13. Receiver Test Selection Criteria

    Science.gov (United States)

    2015-03-12

    The DOT requests that GPS manufacturers submit receivers for test in the following TWG categories: - Aviation (non-certified), cellular, general location/navigation, high precision, timing, networks, and space-based receivers - Each receiver should b...

  14. Tropospheric VHF radiowave propagation measurements in a tropical location in Nigeria

    International Nuclear Information System (INIS)

    Aboaba, O.A.

    2006-04-01

    A major task for the radiocommunication engineer in designing a communication system is to be able to predict the behaviour of the radio signal from the point of transmission to the receiving point. Usually, the radiocommunication engineer would have available propagation data that will enable him to demonstrate that the radiocommunications system will meet both the performance and the availability objectives. The data obtained from a 10-month period of terrestrial over-the-horizon propagation measurements, carried out in southwestern part of Nigeria, have been statistically analyzed in this study. The findings from the analysis show that the measured values of field strength were significantly high during the dry months of November to March, the night time and early morning hours while lower values were obtained during the wet months of April to October. In particular, it is observed that the dry month of March recorded the highest median value of field strength while the wet month of July recorded the lowest. These high values of field strength observed during the dry months are attributed to anomalous propagation effects such as extreme super-refractivity and ducting which are often prevalent in the West African tropical sub-region. (author)

  15. A meteor head echo analysis algorithm for the lower VHF band

    Directory of Open Access Journals (Sweden)

    J. Kero

    2012-04-01

    Full Text Available We have developed an automated analysis scheme for meteor head echo observations by the 46.5 MHz Middle and Upper atmosphere (MU radar near Shigaraki, Japan (34.85° N, 136.10° E. The analysis procedure computes meteoroid range, velocity and deceleration as functions of time with unprecedented accuracy and precision. This is crucial for estimations of meteoroid mass and orbital parameters as well as investigations of the meteoroid-atmosphere interaction processes. In this paper we present this analysis procedure in detail. The algorithms use a combination of single-pulse-Doppler, time-of-flight and pulse-to-pulse phase correlation measurements to determine the radial velocity to within a few tens of metres per second with 3.12 ms time resolution. Equivalently, the precision improvement is at least a factor of 20 compared to previous single-pulse measurements. Such a precision reveals that the deceleration increases significantly during the intense part of a meteoroid's ablation process in the atmosphere. From each received pulse, the target range is determined to within a few tens of meters, or the order of a few hundredths of the 900 m long range gates. This is achieved by transmitting a 13-bit Barker code oversampled by a factor of two at reception and using a novel range interpolation technique. The meteoroid velocity vector is determined from the estimated radial velocity by carefully taking the location of the meteor target and the angle from its trajectory to the radar beam into account. The latter is determined from target range and bore axis offset. We have identified and solved the signal processing issue giving rise to the peculiar signature in signal to noise ratio plots reported by Galindo et al. (2011, and show how to use the range interpolation technique to differentiate the effect of signal processing from physical processes.

  16. Cryocooled wideband digital channelizing radio-frequency receiver based on low-pass ADC

    International Nuclear Information System (INIS)

    Vernik, Igor V; Kirichenko, Dmitri E; Dotsenko, Vladimir V; Miller, Robert; Webber, Robert J; Shevchenko, Pavel; Talalaevskii, Andrei; Gupta, Deepnarayan; Mukhanov, Oleg A

    2007-01-01

    We have demonstrated a digital receiver performing direct digitization of radio-frequency signals over a wide frequency range from kilohertz to gigahertz. The complete system, consisting of a cryopackaged superconductor all-digital receiver (ADR) chip followed by room-temperature interface electronics and a field programmable gate array (FPGA) based post-processing module, has been developed. The ADR chip comprises a low-pass analog-to-digital converter (ADC) delta modulator with phase modulation-demodulation architecture together with digital in-phase and quadrature mixer and a pair of digital decimation filters. The chip is fabricated using a 4.5 kA cm -2 process and is cryopackaged using a commercial-off-the-shelf cryocooler. Experimental results in HF, VHF, UHF and L bands and their analysis, proving consistent operation of the cryopackaged ADR chip up to 24.32 GHz clock frequency, are presented and discussed

  17. Microcrystalline thin-film solar cell deposition on moving substrates using a linear VHF-PECVD reactor and a cross-flow geometry

    International Nuclear Information System (INIS)

    Flikweert, A J; Zimmermann, T; Merdzhanova, T; Weigand, D; Appenzeller, W; Gordijn, A

    2012-01-01

    A concept for high-rate plasma deposition (PECVD) of hydrogenated microcrystalline silicon on moving substrates (dynamic deposition) is developed and evaluated. The chamber allows for substrates up to a size of 40 × 40 cm 2 . The deposition plasma is sustained between linear VHF electrodes (60 MHz) and a moving substrate. Due to the gas flow geometry and the high degree of source gas depletion, from the carrier's point of view the silane concentration varies when passing the electrodes. This is known to lead to different growth conditions which can induce transitions from microcrystalline to amorphous growth. The effect of different silane concentrations is simulated at a standard RF showerhead electrode by intentionally varying the silane concentration during deposition in static mode. This variation may decrease the layer quality of microcrystalline silicon, due to a shift of the crystallinity away from the optimum. However, adapting the input silane concentration, state-of-the-art solar cells are obtained. Microcrystalline cells (ZnO : Al/Ag back contacts) produced by the linear VHF plasma sources show an efficiency of 7.9% and 6.6% for depositions in static and dynamic mode, respectively. (paper)

  18. SISTEMA WEB DE GEOLOCALIZACIÓN Y MONITOREO DE LA TORTUGA PODOCNEMIS LEWYANA EN EL RÍO SINÚ, MEDIANTE EL USO DE ANTENAS VHF Y DISPOSITIVOS GPS

    Directory of Open Access Journals (Sweden)

    Mario Macea Anaya

    2016-03-01

    Full Text Available Este trabajo tiene como finalidad el diseño e implementación de una aplicación para el monitoreo de las Tortugas de Río Podocnemis Lewyana, utilizando las tecnologías GPS (Global Positioning System y VHF (Very High Frequency. La aplicación permite apoyar los procesos de conservación y recuperación de la especie en el Departamento de Córdoba, en las poblaciones de Caño Viejo y Cotocá Arriba del municipio Santa Cruz de Lorica, Colombia. El uso de esa herramienta está dirigido a biólogos y personas de las comunidades rurales dedicadas a conservar dicha especie. En el desarrollo del proyecto se utilizaron 18 Tortugas de Río para su monitoreo. El resultado del trabajo es la aplicación Web Podocnemis-Soft. Su funcionamiento se basa en un dispositivo GPS y VHF, ubicado en una o varias de las tortugas Podocnemis Lewyana; los dispositivos envían los datos de la ubicación de la tortuga hasta un servidor para su procesamiento y posterior visualización de la información.

  19. A flexible WLAN receiver

    NARCIS (Netherlands)

    Schiphorst, Roelof; Hoeksema, F.W.; Slump, Cornelis H.

    2003-01-01

    Flexible radio receivers are also called Software Defined Radios (SDRs) [1], [2]. The focus of our SDR project [3] is on designing the front end, from antenna to demodulation in bits, of a °exible, multi-standard WLAN receiver. We try to combine an instance of a (G)FSK receiver (Bluetooth) with an

  20. Highly Sensitive Optical Receivers

    CERN Document Server

    Schneider, Kerstin

    2006-01-01

    Highly Sensitive Optical Receivers primarily treats the circuit design of optical receivers with external photodiodes. Continuous-mode and burst-mode receivers are compared. The monograph first summarizes the basics of III/V photodetectors, transistor and noise models, bit-error rate, sensitivity and analog circuit design, thus enabling readers to understand the circuits described in the main part of the book. In order to cover the topic comprehensively, detailed descriptions of receivers for optical data communication in general and, in particular, optical burst-mode receivers in deep-sub-µm CMOS are presented. Numerous detailed and elaborate illustrations facilitate better understanding.

  1. Low-Profile Multiband and Flush-Mountable Wideband Antennas for HF/VHF and K/Ka Band Applications

    Science.gov (United States)

    Garrido Lopez, David

    This thesis introduces several novel antenna systems with extended performance capabilities achieved by either enabling multiple operation bands or by widening the bandwidth. Proposed theoretical concepts are successfully tested through simulations and experiments with excellent agreement are demonstrated. The designs developed in this thesis research are low-profile or flush mountable, enabling simple platform integration. In the HF/VHF bands, the development of a novel low-profile multiband antenna for vehicular applications is presented. Specifically, an inverted-F antenna is used as a driven element, to operate at the lowest frequency of 27 MHz, whereas two parasitic elements are built as inverted-L monopoles to enable resonances at 49 and 53 MHz. To eliminate the need for an external matching network, an offset feeding technique is used. When the antenna is mounted on a vehicle and bent to follow its profile, a very low-profile is achieved (lambda/44) while good impedance and far-field performance are maintained across all three bands. The developed antenna system is not only electrically smallest among others found in the literature, but it is easily modified for other band selections and tuning of each band can be readily achieved. Vehicular antennas are often used for high power applications, which may cause exposure of nearby individuals to possibly dangerous electromagnetic fields. To assess this hazard, the RF exposure of a vehicle's crew is discussed and an original and fast modeling approach for prediction thereof is demonstrated. The modeling approach is based on eigenmode analysis for acquiring a range of frequencies where the shielding effectiveness of a vehicle cabin is expected to be lower than average. This approach is typically much faster and requires less computational resources as compared to classical full-wave analyses. This analysis also shows that the position of an antenna system is critical and must be considered when high-power RF

  2. Delphi Accounts Receivable Module -

    Data.gov (United States)

    Department of Transportation — Delphi accounts receivable module contains the following data elements, but are not limited to customer information, cash receipts, line of accounting details, bill...

  3. VHF and L-band scintillation characteristics over an Indian low latitude station, Waltair (17.7° N, 83.3° E

    Directory of Open Access Journals (Sweden)

    P. V. S. Rama Rao

    2005-10-01

    Full Text Available Characteristics of simultaneous VHF (244 MHz and L-band (1.5 GHz scintillations recorded at a low-latitude station, Waltair (17.7° N, 83.3° E, during the low sunspot activity year of March 2004 to March 2005, suggest that the occurrence of scintillations is mainly due to two types, namely the Plasma Bubble Induced (PBI, which maximizes during the post sunset hours of winter and equinoctial months, and the Bottom Side Sinusoidal (BSS type, which maximizes during the post-midnight hours of the summer solstice months. A detailed study on the spectral characteristics of the scintillations at both the frequencies show that the post-sunset scintillations are strong with fast fading (≈40 fad/min and are multiple in nature in scattering, giving rise to steep spectral slopes, whereas the post-midnight scintillations, which occur mostly on the VHF signal with low fading rate (≈4 fad/min, are of the BSS type, often showing typical Fresnel oscillations with reduced roll off spectral slopes, indicating that the type of irregularity resembles a thin screen structure giving rise to weak scattering. Using the onset times of several similar scintillation patches across the two satellite (FLEETSAT 73° E, INMARSAT 65° E ray paths (sub-ionospheric points are separated by 82 km, the East ward movement of the irregularity patches is found to vary from 150 to 250 m/s during the post sunset hours and decrease slowly during the post midnight hours. Further, the east-west extent of the PBI type of irregularities is found to vary from 100 to 500 km, while that of the BSS type extend up to a few thousand kilometers. Keywords. Ionosphere (Ionospheric irregularities; Auroral ionosphere; Electric fields and currents

  4. Solar energy receiver

    Science.gov (United States)

    Schwartz, Jacob

    1978-01-01

    An improved long-life design for solar energy receivers provides for greatly reduced thermally induced stress and permits the utilization of less expensive heat exchanger materials while maintaining receiver efficiencies in excess of 85% without undue expenditure of energy to circulate the working fluid. In one embodiment, the flow index for the receiver is first set as close as practical to a value such that the Graetz number yields the optimal heat transfer coefficient per unit of pumping energy, in this case, 6. The convective index for the receiver is then set as closely as practical to two times the flow index so as to obtain optimal efficiency per unit mass of material.

  5. Cryogenic microwave channelized receiver

    International Nuclear Information System (INIS)

    Rauscher, C.; Pond, J.M.; Tait, G.B.

    1996-01-01

    The channelized receiver being presented demonstrates the use of high temperature superconductor technology in a microwave system setting where superconductor, microwave-monolithic-integrated-circuit, and hybrid-integrated-circuit components are united in one package and cooled to liquid-nitrogen temperatures. The receiver consists of a superconducting X-band four-channel demultiplexer with 100-MHz-wide channels, four commercial monolithically integrated mixers, and four custom-designed hybrid-circuit detectors containing heterostructure ramp diodes. The composite receiver unit has been integrated into the payload of the second-phase NRL high temperature superconductor space experiment (HTSSE-II). Prior to payload assembly, the response characteristics of the receiver were measured as functions of frequency, temperature, and drive levels. The article describes the circuitry, discusses the key issues related to design and implementation, and summarizes the experimental results

  6. Alexandrite Lidar Receiver

    National Research Council Canada - National Science Library

    Wilkerson, Thomas

    2000-01-01

    ...". The chosen vendor, Orca Photonics, In. (Redmond, WA), in close collaboration with USU personnel, built a portable, computerized lidar system that not only is suitable as a receiver for a near IR alexandrite laser, but also contains an independent Nd...

  7. Receiver Gain Modulation Circuit

    Science.gov (United States)

    Jones, Hollis; Racette, Paul; Walker, David; Gu, Dazhen

    2011-01-01

    A receiver gain modulation circuit (RGMC) was developed that modulates the power gain of the output of a radiometer receiver with a test signal. As the radiometer receiver switches between calibration noise references, the test signal is mixed with the calibrated noise and thus produces an ensemble set of measurements from which ensemble statistical analysis can be used to extract statistical information about the test signal. The RGMC is an enabling technology of the ensemble detector. As a key component for achieving ensemble detection and analysis, the RGMC has broad aeronautical and space applications. The RGMC can be used to test and develop new calibration algorithms, for example, to detect gain anomalies, and/or correct for slow drifts that affect climate-quality measurements over an accelerated time scale. A generalized approach to analyzing radiometer system designs yields a mathematical treatment of noise reference measurements in calibration algorithms. By treating the measurements from the different noise references as ensemble samples of the receiver state, i.e. receiver gain, a quantitative description of the non-stationary properties of the underlying receiver fluctuations can be derived. Excellent agreement has been obtained between model calculations and radiometric measurements. The mathematical formulation is equivalent to modulating the gain of a stable receiver with an externally generated signal and is the basis for ensemble detection and analysis (EDA). The concept of generating ensemble data sets using an ensemble detector is similar to the ensemble data sets generated as part of ensemble empirical mode decomposition (EEMD) with exception of a key distinguishing factor. EEMD adds noise to the signal under study whereas EDA mixes the signal with calibrated noise. It is mixing with calibrated noise that permits the measurement of temporal-functional variability of uncertainty in the underlying process. The RGMC permits the evaluation of EDA by

  8. An Advanced VHF/UHF Short Range, Groundwave Propagation Model for Paths With Near-Earth Antennas

    National Research Council Canada - National Science Library

    Cross, Marshall W; Fung, Tat Y

    2006-01-01

    ... the earth such as: Unattended Ground Sensors (UGS) and Intelligent Munitions Systems (IMS), are attenuated above free space values by the lossy earth itself and any obstructions between a transmitter and receiver pair...

  9. 'Chaos' in superregenerative receivers

    International Nuclear Information System (INIS)

    Commercon, Jean-Claude; Badard, Robert

    2005-01-01

    The superregenerative principle has been known since the early 1920s. The circuit is extremely simple and extremely sensitive. Today, superheterodyne receivers generally supplant superregenerative receivers in most applications because there are several undesirable characteristics: poor selectivity, reradiation, etc. Superregenerative receivers undergo a revival in recent papers for wireless systems, where low cost and very low power consumption are relevant: house/building meters (such as water, energy, gas counter), personal computer environment (keyboard, mouse), etc. Another drawback is the noise level which is higher than that of a well-designed superheterodyne receiver; without an antenna input signal, the output of the receiver hears in an earphone as a waterfall noise; this sound principally is the inherent input noise amplified and detected by the circuit; however, when the input noise is negligible with respect of an antenna input signal, we are faced to an other source of 'noise' self-generated by the superregenerative working. The main objective of this paper concerns this self-generated noise coming from an exponential growing followed by a re-injection process for which the final state is a function of the phase of the input signal

  10. Solar thermal central receivers

    International Nuclear Information System (INIS)

    Vant-Hull, L.L.

    1993-01-01

    Market issues, environmental impact, and technology issues related to the Solar Central Receiver concept are addressed. The rationale for selection of the preferred configuration and working fluid are presented as the result of a joint utility-industry analysis. A $30 million conversion of Solar One to an external molten salt receiver would provide the intermediate step to a commercial demonstration plant. The first plant in this series could produce electricity at 11.2 cents/kWhr and the seventh at 8.2 cents/kWhr, completely competitive with projected costs of new utility plants in 1992

  11. Wideband CMOS receivers

    CERN Document Server

    Oliveira, Luis

    2015-01-01

    This book demonstrates how to design a wideband receiver operating in current mode, in which the noise and non-linearity are reduced, implemented in a low cost single chip, using standard CMOS technology.  The authors present a solution to remove the transimpedance amplifier (TIA) block and connect directly the mixer’s output to a passive second-order continuous-time Σ∆ analog to digital converter (ADC), which operates in current-mode. These techniques enable the reduction of area, power consumption, and cost in modern CMOS receivers.

  12. Receiver gain function: the actual NMR receiver gain

    OpenAIRE

    Mo, Huaping; Harwood, John S.; Raftery, Daniel

    2010-01-01

    The observed NMR signal size depends on the receiver gain parameter. We propose a receiver gain function to characterize how much the raw FID is amplified by the receiver as a function of the receiver gain setting. Although the receiver is linear for a fixed gain setting, the actual gain of the receiver may differ from what the gain setting suggests. Nevertheless, for a given receiver, we demonstrate that the receiver gain function can be calibrated. Such a calibration enables accurate compar...

  13. Campus Projects Receiving "Earmarks."

    Science.gov (United States)

    Schonberger, Benjamin

    1991-01-01

    Specific campus projects that Congress has directed federal agencies to support this year at over 120 colleges and universities are listed. The agencies neither requested support nor sponsored merit-based competitions for the awards. In some cases, the institutions have a history of receiving special federal treatment. (MSE)

  14. Digital Receiver Phase Meter

    Science.gov (United States)

    Marcin, Martin; Abramovici, Alexander

    2008-01-01

    The software of a commercially available digital radio receiver has been modified to make the receiver function as a two-channel low-noise phase meter. This phase meter is a prototype in the continuing development of a phase meter for a system in which radiofrequency (RF) signals in the two channels would be outputs of a spaceborne heterodyne laser interferometer for detecting gravitational waves. The frequencies of the signals could include a common Doppler-shift component of as much as 15 MHz. The phase meter is required to measure the relative phases of the signals in the two channels at a sampling rate of 10 Hz at a root power spectral density measurements in laser metrology of moving bodies. To illustrate part of the principle of operation of the phase meter, the figure includes a simplified block diagram of a basic singlechannel digital receiver. The input RF signal is first fed to the input terminal of an analog-to-digital converter (ADC). To prevent aliasing errors in the ADC, the sampling rate must be at least twice the input signal frequency. The sampling rate of the ADC is governed by a sampling clock, which also drives a digital local oscillator (DLO), which is a direct digital frequency synthesizer. The DLO produces samples of sine and cosine signals at a programmed tuning frequency. The sine and cosine samples are mixed with (that is, multiplied by) the samples from the ADC, then low-pass filtered to obtain in-phase (I) and quadrature (Q) signal components. A digital signal processor (DSP) computes the ratio between the Q and I components, computes the phase of the RF signal (relative to that of the DLO signal) as the arctangent of this ratio, and then averages successive such phase values over a time interval specified by the user.

  15. Silicon Nitride Deposition for Flexible Organic Electronic Devices by VHF (162 MHz)-PECVD Using a Multi-Tile Push-Pull Plasma Source.

    Science.gov (United States)

    Kim, Ki Seok; Kim, Ki Hyun; Ji, You Jin; Park, Jin Woo; Shin, Jae Hee; Ellingboe, Albert Rogers; Yeom, Geun Young

    2017-10-19

    Depositing a barrier film for moisture protection without damage at a low temperature is one of the most important steps for organic-based electronic devices. In this study, the authors investigated depositing thin, high-quality SiN x film on organic-based electronic devices, specifically, very high-frequency (162 MHz) plasma-enhanced chemical vapor deposition (VHF-PECVD) using a multi-tile push-pull plasma source with a gas mixture of NH 3 /SiH 4 at a low temperature of 80 °C. The thin deposited SiN x film exhibited excellent properties in the stoichiometry, chemical bonding, stress, and step coverage. Thin film quality and plasma damage were investigated by the water vapor transmission rate (WVTR) and by electrical characteristics of organic light-emitting diode (OLED) devices deposited with SiN x , respectively. The thin deposited SiN x film exhibited a low WVTR of 4.39 × 10 -4  g (m 2 · day) -1 for a single thin (430 nm thick) film SiN x and the electrical characteristics of OLED devices before and after the thin SiN x film deposition on the devices did not change, which indicated no electrical damage during the deposition of SiN x on the OLED device.

  16. Estimation of mesospheric vertical winds from a VHF meteor radar at King Sejong Station, Antarctica (62.2S, 58.8W)

    Science.gov (United States)

    Kim, Y.; Lee, C.; Kim, J.; Jee, G.

    2013-12-01

    For the first time, vertical winds near the mesopause region were estimated from radial velocities of meteor echoes detected by a VHF meteor radar at King Sejong Station (KSS) in 2011 and 2012. Since the radar usually detects more than a hundred echoes every hour in an altitude bin of 88 - 92 km, much larger than other radars, we were able to fit measured radial velocities of these echoes with a 6 component model that consists of horizontal winds, spatial gradients of horizontal winds and vertical wind. The conventional method of deriving horizontal winds from meteor echoes utilizes a 2 component model, assuming that vertical winds and spatial gradients of horizontal winds are negligible. We analyzed the radar data obtained for 8400 hours in 2012 and 8100 hours in 2011. We found that daily mean values of vertical winds are mostly within +/- 1 m/s, whereas those of zonal winds are a few tens m/s mostly eastward. The daily mean vertical winds sometimes stay positive or negative for more than 20 days, implying that the atmosphere near the mesopause experiences episodically a large scale low and high pressure environments, respectively, like the tropospheric weather system. By conducting Lomb-normalized periodogram analysis, we also found that the vertical winds have diurnal, semidiurnal and terdiurnal tidal components with about equal significance, in contrast to horizontal winds that show a dominant semidiurnal one. We will discuss about uncertainties of the estimated vertical wind and possible reasons of its tidal and daily variations.

  17. Mesospheric Temperatures and Winds measured by a VHF Meteor Radar at King Sejong Station (62.2S, 58.8W), Antarctica

    Science.gov (United States)

    Kim, Yongha; Kim, Jeong-Han; Jee, Geonwha; Lee, Chang-Sup

    2010-05-01

    A VHF radar at King Sejong Station, Antarctica has been measuring meteor echoes since March 2007. Temperatures near the mesopause are derived from meteor decay times with an improved method of selecting meteor echo samples, and compared with airglow temperatures simultaneously observed by a spectral airglow temperature imager (SATI). The temperatures derived from meteor decay times are mostly consistent with the rotational temperatures of SATI OH(6-2) and O2(0-1) emissions from March through October. During southern summer when SATI cannot be operated due to brief night time, the meteor radar observation shows cold mesospheric temperatures, significantly lower than the CIRA86 model. The meteor radar observation also provides wind field information between 80 and 100 km of altitude. The measured meridional winds seem to follow the summer pole to winter pole circulation, and thus are correlated with the measured seasonal temperature change. However, the correlation between meridional winds and temperatures is not found in day by day base, as a previous study reported. Tidal characteristics of both zonal and meridional winds will also be compared with those of other Antarctic stations.

  18. Seasonal temperature variation around the mesopause inferred from a VHF meteor radar at King Sejong Station (62S, 59W), Antarctica

    Science.gov (United States)

    Kim, Yongha; Kim, Jeong-Han; Lee, Changsup; Jee, Gun-Hwa

    A VHF meteor radar, installed at King Sejong Station in March, 2007, has been detecting echoes from more than 20,000 meteors per day. Meteor echoes are decayed typically within seconds as meteors spread away by atmospheric diffusion. The diffusion coefficients can thus be obtained from decay times of meteor echo signals, providing with information on the atmospheric temperatures and pressures at meteor altitudes from 70 to 100 km. In this study, we present altitude profiles of 15-min averaged diffusion coefficients in each month, which clearly show a minimum at 80 - 85 km. The minimum appears at higher altitude during austral summer than winter, and seems to be near the lower level of two temperature minimum structure around the mesopause seen by TIMED/SABER data at high latitudes. The higher mesopause level (95-100 km) of the SABER data does not appear in our diffusion profiles probably because it is too close the limit of meaningful diffusion coefficients that can be derived from meteor decay detection. In order to understand temperature variation around the mesopause more directly, we will discuss various methods to extract temperature profiles from the diffusion profiles. We will also present monthly averaged OH and O2 airglow temperatures observed at the same site, and compare them with those derived from the meteor radar observation.

  19. Spatial and temporal variations of small-scale plasma turbulence parameters in the equatorial electrojet: HF and VHF radar observational results

    Directory of Open Access Journals (Sweden)

    G. Manju

    2005-06-01

    Full Text Available The spatial and temporal variations of various parameters associated with plasma wave turbulence in the equatorial electrojet (EEJ at the magnetic equatorial location of Trivandrum (8.5° N, 77° E; dip 0.5° N are studied for the first time, using co-located HF (18MHz and VHF (54.95MHz coherent backscatter radar observations (daytime in the altitude region of 95-110km, mostly on magnetically quiet days. The derived turbulence parameters are the mean electron density irregularity strength (δn/n, anomalous electron collision frequency (νe* and the corrected east-west electron drift velocity (Vey. The validity of the derived parameters is confirmed using radar data at two different frequencies and comparing with in-situ measurements. The behaviour of δn/n in relation to the backscattered power during weak and strong EEJ conditions is also examined to understand the growth and evolution of turbulence in the electrojet.

  20. Spatial and temporal variations of small-scale plasma turbulence parameters in the equatorial electrojet: HF and VHF radar observational results

    Directory of Open Access Journals (Sweden)

    G. Manju

    2005-06-01

    Full Text Available The spatial and temporal variations of various parameters associated with plasma wave turbulence in the equatorial electrojet (EEJ at the magnetic equatorial location of Trivandrum (8.5° N, 77° E; dip 0.5° N are studied for the first time, using co-located HF (18MHz and VHF (54.95MHz coherent backscatter radar observations (daytime in the altitude region of 95-110km, mostly on magnetically quiet days. The derived turbulence parameters are the mean electron density irregularity strength (δn/n, anomalous electron collision frequency (νe* and the corrected east-west electron drift velocity (Vey. The validity of the derived parameters is confirmed using radar data at two different frequencies and comparing with in-situ measurements. The behaviour of δn/n in relation to the backscattered power during weak and strong EEJ conditions is also examined to understand the growth and evolution of turbulence in the electrojet.

  1. A Reliable File Group Sending Method Based on Low-bandwidth VHF Radio%一种超短波电台低带宽下文件可靠群发方法

    Institute of Scientific and Technical Information of China (English)

    杨紫薇; 丁敬海; 张士军

    2016-01-01

    在现代连队指挥系统内,普遍采用无线超短波电台传输文件作为通信方式。传统的发送方式是发送方不断检测接收节点的应答帧来判断是否需要续传文件,但在文件群发过程中,发送方频繁查询接收方是否成功接收会严重占用带宽,造成网络瘫痪,从而导致文件传输成功率低下。然而作为连队指挥系统的可靠性要求之一,在超短波电台传输带宽较低(4800 KBps)的情况下,指挥车对作战单元群发文件的成功率决不能低于90%。为了解决这一难题,提出了一种新的文件可靠群发方法,该方法对发送方设计通信首帧,将文件分割编序封装并按周期顺序发送,同时各个接收节点对文件进行CRC校验,索引漏帧并主动发起补传要求。通过这种通信方法,连队通信网络内,指挥车可以一次将10 KB的文件发送至10个作战单元,经过测试,数据通信成功率保持在90%以上。%In company’ s modern command system,files transmission by wireless FM radio is a universal communication method. The traditional sending method is that the sender determines whether to resume files or not by detecting response frame continuously from the receiver. But during the file group sending process,if the sender checks the file transfer result from the receiver frequently,then bandwidth may be consumed seriously and network paralysis even arises,thus the low success rate of file transfer will be caused. As one of the reliability requirements of company command system,the success rate of file group transfer must reach more than 90% by low bandwidth VHF radio (4 800 Kbps). In order to solve this problem,a reliable file group sending method is proposed in this paper,in which a kind of head frame is designed for the sender. The files are divided into several frames,a sequence number is assigned to each frame,and then each file frame is sent in order. Meanwhile, the receivers

  2. Pressure difference receiving ears

    DEFF Research Database (Denmark)

    Michelsen, Axel; Larsen, Ole Næsbye

    2007-01-01

    Directional sound receivers are useful for locating sound sources, and they can also partly compensate for the signal degradations caused by noise and reverberations. Ears may become inherently directional if sound can reach both surfaces of the eardrum. Attempts to understand the physics...... of the eardrum. The mere existence of sound transmission to the inner surface does not ensure a useful directional hearing, since a proper amplitude and phase relationship must exist between the sounds acting on the two surfaces of the eardrum. The gain of the sound pathway must match the amplitude and phase...... of the sounds at the outer surfaces of the eardrums, which are determined by diffraction and by the arrival time of the sound, that is by the size and shape of the animal and by the frequency of sound. Many users of hearing aids do not obtain a satisfactory improvement of their ability to localize sound sources...

  3. Solar thermal energy receiver

    Science.gov (United States)

    Baker, Karl W. (Inventor); Dustin, Miles O. (Inventor)

    1992-01-01

    A plurality of heat pipes in a shell receive concentrated solar energy and transfer the energy to a heat activated system. To provide for even distribution of the energy despite uneven impingement of solar energy on the heat pipes, absence of solar energy at times, or failure of one or more of the heat pipes, energy storage means are disposed on the heat pipes which extend through a heat pipe thermal coupling means into the heat activated device. To enhance energy transfer to the heat activated device, the heat pipe coupling cavity means may be provided with extensions into the device. For use with a Stirling engine having passages for working gas, heat transfer members may be positioned to contact the gas and the heat pipes. The shell may be divided into sections by transverse walls. To prevent cavity working fluid from collecting in the extensions, a porous body is positioned in the cavity.

  4. CERN apprentice receives award

    CERN Multimedia

    2008-01-01

    Another CERN apprentice has received an award for the quality of his work. Stéphane Küng (centre), at the UIG ceremony last November, presided over by Geneva State Councillor Pierre-François Unger, Head of the Department of Economics and Health. Electronics technician Stéphane Küng was honoured in November by the Social Foundation of the Union Industrielle Genevoise (UIG) as one of Geneva’s eight best apprentices in the field of mechatronics. The 20-year-old Genevan obtained his Federal apprentice’s certificate (Certificat fédéral de capacité - CFC) in June 2007, achieving excellent marks in his written tests at the Centre d’Enseignement Professionnel Technique et Artisanal (CEPTA). Like more than 200 youngsters before him, Stéphane Küng spent part of his four-year sandwich course working at CERN, where he followed many practical training courses and gained valuable hands-on experience in various technical groups and labs. "It’ always very gr...

  5. Investigation of inertia-gravity waves in the upper troposphere/lower stratosphere over Northern Germany observed with collocated VHF/UHF radars

    Directory of Open Access Journals (Sweden)

    A. Serafimovich

    2005-01-01

    Full Text Available A case study to investigate the properties of inertia-gravity waves in the upper troposphere/lower stratosphere has been carried out over Northern Germany during the occurrence of an upper tropospheric jet in connection with a poleward Rossby wave breaking event from 17-19 December 1999. The investigations are based on the evaluation of continuous radar measurements with the OSWIN VHF radar at Kühlungsborn (54.1 N, 11.8 E and the 482 MHz UHF wind profiler at Lindenberg (52.2 N, 14.1 E. Both radars are separated by about 265 km. Based on wavelet transformations of both data sets, the dominant vertical wavelengths of about 2-4 km for fixed times as well as the dominant observed periods of about 11 h and weaker oscillations with periods of  6 h for the altitude range between 5 and 8 km are comparable. Gravity wave parameters have been estimated at both locations separately and by a complex cross-spectral analysis of the data of both radars. The results show the appearance of dominating inertia-gravity waves with characteristic horizontal wavelengths of  300 km moving in the opposite direction than the mean background wind and a secondary less pronounced wave with a horizontal wavelength in the order of about 200 km moving with the wind. Temporal and spatial differences of the observed waves are discussed.

  6. GNSS Software Receiver for UAVs

    DEFF Research Database (Denmark)

    Olesen, Daniel Madelung; Jakobsen, Jakob; von Benzon, Hans-Henrik

    2016-01-01

    This paper describes the current activities of GPS/GNSS Software receiver development at DTU Space. GNSS Software receivers have received a great deal of attention in the last two decades and numerous implementations have already been presented. DTU Space has just recently started development of ...... of our own GNSS software-receiver targeted for mini UAV applications, and we will in in this paper present our current progress and briefly discuss the benefits of Software Receivers in relation to our research interests....

  7. Solar advanced internal film receiver

    International Nuclear Information System (INIS)

    Torre Cabezas, M. de la

    1990-01-01

    In a Solar Central Internal Film Receiver, the heat absorbing fluid (a molten nitrate salt) flows in a thin film down over the non illuminated side of an absorber panel. Since the molten salt working fluid is not contained in complicated tube manifolds, the receiver design is simples than a conventional tube type-receiver resulting in a lower cost and a more reliable receiver. The Internal Film Receiver can be considered as an alternative to the Direct Absorption Receiver, in the event that the current problems of the last one can not be solved. It also describes here the test facility which will be used for its solar test, and the test plans foreseen. (Author) 17 refs

  8. Communications receivers principles and design

    CERN Document Server

    Rohde, Ulrich L; Zahnd, Hans

    2017-01-01

    This thoroughly updated guide offers comprehensive explanations of the science behind today’s radio receivers along with practical guidance on designing, constructing, and maintaining real-world communications systems. You will explore system planning, antennas and antenna coupling, amplifiers and gain control, filters, mixers, demodulation, digital communication, and the latest software defined radio (SDR) technology. Written by a team of telecommunication experts, Communications Receivers: Principles and Design, Fourth Edition, features technical illustrations, schematic diagrams, and detailed examples. Coverage includes: • Basic radio considerations • Radio receiver characteristics • Receiver system planning • Receiver implementation considerations • RF and baseband techniques for Software-Defined Radios • Transceiver SDR considerations • Antennas and antenna coupling • Mixers • Frequency sources and control • Ancillary receiver circuits • Performance measurement

  9. Ionospheric plasma by VHF waves

    Indian Academy of Sciences (India)

    The amplitude scintillations of very high frequency electromagnetic wave ... Scintillations at low latitude are known to occur in discrete patches [5,6] and are part .... weakly ionized plasma with a density gradient and a relative drift of ions and ...

  10. Stability of heterodyne terahertz receivers

    NARCIS (Netherlands)

    Kooi, J.W.; Baselmans, J.J.A.; Baryshev, A.; Schieder, R.; Hajenius, M.; Gao, J.R.; Klapwijk, T.M.; Voronov, B.; Gol'tsman, G.

    2006-01-01

    In this paper we discuss the stability of heterodyne terahertz receivers based on small volume NbN phonon cooled hot electron bolometers (HEBs). The stability of these receivers can be broken down in two parts: the intrinsic stability of the HEB mixer and the stability of the local oscillator (LO)

  11. High Gain Advanced GPS Receiver

    National Research Council Canada - National Science Library

    Brown, Alison; Zhang, Gengsheng

    2006-01-01

    NAVSYS High Gain Advanced GPS Receiver (HAGR) uses a digital beam-steering antenna array to enable up to eight GPS satellites to be tracked, each with up to 10 dBi of additional antenna gain over a conventional receiver solution...

  12. UWB delay and multiply receiver

    Energy Technology Data Exchange (ETDEWEB)

    Dallum, Gregory E.; Pratt, Garth C.; Haugen, Peter C.; Romero, Carlos E.

    2013-09-10

    An ultra-wideband (UWB) delay and multiply receiver is formed of a receive antenna; a variable gain attenuator connected to the receive antenna; a signal splitter connected to the variable gain attenuator; a multiplier having one input connected to an undelayed signal from the signal splitter and another input connected to a delayed signal from the signal splitter, the delay between the splitter signals being equal to the spacing between pulses from a transmitter whose pulses are being received by the receive antenna; a peak detection circuit connected to the output of the multiplier and connected to the variable gain attenuator to control the variable gain attenuator to maintain a constant amplitude output from the multiplier; and a digital output circuit connected to the output of the multiplier.

  13. Sistema de adquisición de datos para la medición de parámetros radioeléctricos en antenas lineales en la banda de TV de VHF y UHF System of acquisition of information for measurement of radioelectric parameters in linear antennas in the band of VHF and UHF’s television

    Directory of Open Access Journals (Sweden)

    María del Pilar Celemín

    2007-06-01

    Full Text Available Este proyecto desarrolla un sistema de adquisición y procesamiento de datos para la medición y ajuste de parámetros radioeléctricos de antenas lineales en las bandas de VHF y UHF. Como señal de prueba se utilizan algunas de las señales de televisión que se encuentran en el espectro radioeléctrico, provenientes de los transmisores que radian señales de canales nacionales. El receptor implementado incluye un sintonizador comercial de televisión que toma como muestra la señal portadora de video. Esta señal es amplificada, filtrada, almacenada y acondicionada, para ser leída por el puerto serial de un computador personal y procesada empleando un programa en Visual Basic, con una interfaz gráfica que permite una interacción amigable con el usuario. Desde acá se interactúa con un microcontrolador que controla el mecanismo de posicionamiento de la antena receptora por medio de una estructura electromecánica, que le permite ejecutar movimientos en dos grados de libertad: en azimut y en elevación. Con esto se logra un sistema capaz de determinar automáticamente el apuntamiento óptimo de la antena de acuerdo al máximo nivel de recepción de señal. Así mismo, se determinan parámetros propios de la antena tales como: el patrón de radiación (tanto en el plano horizontal como vertical, la ganancia directiva de la antena, la ganancia en cada uno de los puntos que conforman el plano principal, y otros parámetros de interés para el análisis de las características reales de antenas lineales.This project develops a data acquisition and processing system for measuring and adjusting lineal-antenna radioelectric parameters in VHF and UHF. Television signals are used as test signal. They can be found in radio electric spectrum, as they come from commercial transmitters that broadcast signals of national channels. The achieved receptor includes a television commercial tuner for obtaining video signal. Later, this signal is conditioning to

  14. Customizable Digital Receivers for Radar

    Science.gov (United States)

    Moller, Delwyn; Heavey, Brandon; Sadowy, Gregory

    2008-01-01

    Compact, highly customizable digital receivers are being developed for the system described in 'Radar Interferometer for Topographic Mapping of Glaciers and Ice Sheets' (NPO-43962), NASA Tech Briefs, Vol. 31, No. 7 (August 2007), page 72. The receivers are required to operate in unison, sampling radar returns received by the antenna elements in a digital beam-forming (DBF) mode. The design of these receivers could also be adapted to commercial radar systems. At the time of reporting the information for this article, there were no commercially available digital receivers capable of satisfying all of the operational requirements and compact enough to be mounted directly on the antenna elements. A provided figure depicts the overall system of which the digital receivers are parts. Each digital receiver includes an analog-to-digital converter (ADC), a demultiplexer (DMUX), and a field-programmable gate array (FPGA). The ADC effects 10-bit band-pass sampling of input signals having frequencies up to 3.5 GHz. The input samples are demultiplexed at a user-selectable rate of 1:2 or 1:4, then buffered in part of the FPGA that functions as a first-in/first-out (FIFO) memory. Another part of the FPGA serves as a controller for the ADC, DMUX, and FIFO memory and as an interface between (1) the rest of the receiver and (2) a front-panel data port (FPDP) bus, which is an industry-standard parallel data bus that has a high data-rate capability and multichannel configuration suitable for DBF. Still other parts of the FPGA in each receiver perform signal-processing functions. The digital receivers can be configured to operate in a stand-alone mode, or in a multichannel mode as needed for DBF. The customizability of the receiver makes it applicable to a broad range of system architectures. The capability for operation of receivers in either a stand-alone or a DBF mode enables the use of the receivers in an unprecedentedly wide variety of radar systems.

  15. 47 CFR 80.959 - Radiotelephone transmitter.

    Science.gov (United States)

    2010-10-01

    ... watts into 50 ohms nominal resistance when operated with its rated supply voltage. The transmitter must... capability of the transmitter, measurements of primary supply voltage and transmitter output power must be... voltage measured at the power input terminals to the transmitter terminated in a matching artificial load...

  16. Microwave components for cellular portable radiotelephone

    Science.gov (United States)

    Muraguchi, Masahiro; Aikawa, Masayoshi

    1995-09-01

    Mobile and personal communication systems are expected to represent a huge market for microwave components in the coming years. A number of components in silicon bipolar, silicon Bi-CMOS, GaAs MESFET, HBT and HEMT are now becoming available for system application. There are tradeoffs among the competing technologies with regard to performance, cost, reliability and time-to-market. This paper describes process selection and requirements of cost and r.f. performances to microwave semiconductor components for digital cellular and cordless telephones. Furthermore, new circuit techniques which were developed by NTT are presented.

  17. HIGH-EFFICIENCY INFRARED RECEIVER

    Directory of Open Access Journals (Sweden)

    A. K. Esman

    2016-01-01

    Full Text Available Recent research and development show promising use of high-performance solid-state receivers of the electromagnetic radiation. These receivers are based on the low-barrier Schottky diodes. The approach to the design of the receivers on the basis of delta-doped low-barrier Schottky diodes with beam leads without bias is especially actively developing because for uncooled receivers of the microwave radiation these diodes have virtually no competition. The purpose of this work is to improve the main parameters and characteristics that determine the practical relevance of the receivers of mid-infrared electromagnetic radiation at the operating room temperature by modifying the electrodes configuration of the diode and optimizing the distance between them. Proposed original design solution of the integrated receiver of mid-infrared radiation on the basis of the low-barrier Schottky diodes with beam leads allows to effectively adjust its main parameters and characteristics. Simulation of the electromagnetic characteristics of the proposed receiver by using the software package HFSS with the basic algorithm of a finite element method which implemented to calculate the behavior of electromagnetic fields on an arbitrary geometry with a predetermined material properties have shown that when the inner parts of the electrodes of the low-barrier Schottky diode is performed in the concentric elliptical convex-concave shape, it can be reduce the reflection losses to -57.75 dB and the standing wave ratio to 1.003 while increasing the directivity up to 23 at a wavelength of 6.09 μm. At this time, the rounded radii of the inner parts of the anode and cathode electrodes are equal 212 nm and 318 nm respectively and the gap setting between them is 106 nm. These parameters will improve the efficiency of the developed infrared optical-promising and electronic equipment for various purposes intended for work in the mid-infrared wavelength range. 

  18. GIVING AND RECEIVING CONSTRUCTIVE FEEDBACK

    Directory of Open Access Journals (Sweden)

    Ірина Олійник

    2015-05-01

    Full Text Available The article scrutinizes the notion of feedback applicable in classrooms where team teaching is provided. The experience of giving and receiving feedback has been a good practice in cooperation between a U.S. Peace Corps volunteer and a Ukrainian counterpart. Giving and receiving feedback is an effective means of classroom observation that provides better insight into the process of teaching a foreign language. The article discusses the stages of feedback and explicates the notion of sharing experience between two teachers working simultaneously in the same classroom. The guidelines for giving and receiving feedback have been provided as well as the most commonly used vocabulary items have been listed. It has been proved that mutual feedback leads to improving teaching methods and using various teaching styles and techniques.

  19. Receiver-exciter controller design

    Science.gov (United States)

    Jansma, P. A.

    1982-01-01

    A description of the general design of both the block 3 and block 4 receiver-exciter controllers for the Deep Space Network (DSN) Mark IV-A System is presented along with the design approach. The controllers are designed to enable the receiver-exciter subsystem (RCV) to be configured, calibrated, initialized and operated from a central location via high level instructions. The RECs are designed to be operated under the control of the DMC subsystem. The instructions are in the form of standard subsystem blocks (SSBs) received via the local area network (LAN). The centralized control provided by RECs and other DSCC controllers in Mark IV-A is intended to reduce DSN operations costs from the Mark III era.

  20. Stability of heterodyne terahertz receivers

    OpenAIRE

    Kooi, J. W.; Baselmans, J. J. A.; Baryshev, A.; Schieder, R.; Hajenius, M.; Gao, J. R.; Klapwijk, T. M.; Voronov, B.; Gol'tsman, G.

    2006-01-01

    In this paper we discuss the stability of heterodyne terahertz receivers based on small volume NbN phonon cooled hot electron bolometers (HEBs). The stability of these receivers can be broken down in two parts: the intrinsic stability of the HEB mixer and the stability of the local oscillator (LO) signal injection scheme. Measurements show that the HEB mixer stability is limited by gain fluctuations with a 1/f spectral distribution. In a 60 MHz noise bandwidth this results in an Allan varian...

  1. 47 CFR 80.1095 - Survival craft equipment.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Survival craft equipment. 80.1095 Section 80... for Ship Stations § 80.1095 Survival craft equipment. (a) At least three two-way VHF radiotelephone... they can be rapidly placed in any survival craft other than life rafts required by Regulation III/26.1...

  2. 47 CFR 87.475 - Frequencies.

    Science.gov (United States)

    2010-10-01

    ... with simultaneous radiotelephone channels and their associated glide path station frequency from the...) VHF omni-range (VOR) stations are to be assigned frequencies in the 112.050-117.950 MHz band (50 kHz channel spacing) and the following frequencies in the 108-112 MHz band: 108.200 108.250 108.400 108.450...

  3. Femtosecond Photon-Counting Receiver

    Science.gov (United States)

    Krainak, Michael A.; Rambo, Timothy M.; Yang, Guangning; Lu, Wei; Numata, Kenji

    2016-01-01

    An optical correlation receiver is described that provides ultra-precise distance and/or time/pulse-width measurements even for weak (single photons) and short (femtosecond) optical signals. A new type of optical correlation receiver uses a fourth-order (intensity) interferometer to provide micron distance measurements even for weak (single photons) and short (femtosecond) optical signals. The optical correlator uses a low-noise-integrating detector that can resolve photon number. The correlation (range as a function of path delay) is calculated from the variance of the photon number of the difference of the optical signals on the two detectors. Our preliminary proof-of principle data (using a short-pulse diode laser transmitter) demonstrates tens of microns precision.

  4. Scintillation-Hardened GPS Receiver

    Science.gov (United States)

    Stephens, Donald R.

    2015-01-01

    CommLargo, Inc., has developed a scintillation-hardened Global Positioning System (GPS) receiver that improves reliability for low-orbit missions and complies with NASA's Space Telecommunications Radio System (STRS) architecture standards. A software-defined radio (SDR) implementation allows a single hardware element to function as either a conventional radio or as a GPS receiver, providing backup and redundancy for platforms such as the International Space Station (ISS) and high-value remote sensing platforms. The innovation's flexible SDR implementation reduces cost, weight, and power requirements. Scintillation hardening improves mission reliability and variability. In Phase I, CommLargo refactored an open-source GPS software package with Kalman filter-based tracking loops to improve performance during scintillation and also demonstrated improved navigation during a geomagnetic storm. In Phase II, the company generated a new field-programmable gate array (FPGA)-based GPS waveform to demonstrate on NASA's Space Communication and Navigation (SCaN) test bed.

  5. Communication received from South Africa

    International Nuclear Information System (INIS)

    1984-02-01

    The document reproduces the press release with a statement by Dr. J.W.L. de Villiers, Executive Chairman of the Atomic Energy Corporation of South Africa Limited, issued on 31 January 1984 and included in the letter received by the Director General of the IAEA from the Resident Representative of South Africa to the Agency on 31 January 1984. This statement refers to the transfer of nuclear material equipment and technology by South Africa to other countries and the Non-Proliferation Treaty

  6. Absorption Efficiency of Receiving Antennas

    DEFF Research Database (Denmark)

    Andersen, Jørgen Bach; Frandsen, Aksel

    2005-01-01

    A receiving antenna with a matched load will always scatter some power. This paper sets an upper and a lower bound on the absorption efficiency (absorbed power over sum of absorbed and scattered powers), which lies between 0 and 100% depending on the directivities of the antenna and scatter...... patterns. It can approach 100% as closely as desired, although in practice this may not be an attractive solution. An example with a small endfire array of dipoles shows an efficiency of 93%. Several examples of small conical horn antennas are also given, and they all have absorption efficiencies less than...

  7. Solar receiver with integrated optics

    Science.gov (United States)

    Jiang, Lun; Winston, Roland

    2012-10-01

    The current challenge for PV/Thermal (PV/T) systems is the reduction of radiation heat loss. Compared to solar thermal selective coating, the solar cells cannot be used as an efficient thermal absorber due to their large emissivity of the encapsulation material. Many commercial PV/T products therefore require a high concentration (more than 10x) to reach an acceptable thermal efficiency for their receivers. Such a concentration system inevitably has to track or semi-track, which induces additional cost and collects only the direct radiation from the sun. We propose a new PV/T design using a vacuum encapsulated thin film cell to solve this problem. The proposed design also collects the diffuse sun light efficiently by using an external compound parabolic concentrator (XCPC). Since the transparent electrode (TCO) of thin film cell is inherently transparent in visible light and reflective beyond infrared, this design uses this layer instead of the conventional solar cell encapsulation as the outmost heat loss surface. By integrating such a vacuum design with a tube shaped absorber, we reduce the complexity of conducting the heat energy and electricity out of the device. A low concentration standalone non-tracking solar collector is proposed in this paper. We also analyzed the thermosyphon system configuration using heat transfer and ray tracing models. The economics of such a receiver are presented.

  8. Broadband direct RF digitization receivers

    CERN Document Server

    Jamin, Olivier

    2014-01-01

    This book discusses the trade-offs involved in designing direct RF digitization receivers for the radio frequency and digital signal processing domains.  A system-level framework is developed, quantifying the relevant impairments of the signal processing chain, through a comprehensive system-level analysis.  Special focus is given to noise analysis (thermal noise, quantization noise, saturation noise, signal-dependent noise), broadband non-linear distortion analysis, including the impact of the sampling strategy (low-pass, band-pass), analysis of time-interleaved ADC channel mismatches, sampling clock purity and digital channel selection. The system-level framework described is applied to the design of a cable multi-channel RF direct digitization receiver. An optimum RF signal conditioning, and some algorithms (automatic gain control loop, RF front-end amplitude equalization control loop) are used to relax the requirements of a 2.7GHz 11-bit ADC. A two-chip implementation is presented, using BiCMOS and 65nm...

  9. Development of wide band digital receiver for atmospheric radars using COTS board based SDR

    Science.gov (United States)

    Yasodha, Polisetti; Jayaraman, Achuthan; Thriveni, A.

    2016-07-01

    Digital receiver extracts the received echo signal information, and is a potential subsystem for atmospheric radar, also referred to as wind profiling radar (WPR), which provides the vertical profiles of 3-dimensional wind vector in the atmosphere. This paper presents the development of digital receiver using COTS board based Software Defined Radio technique, which can be used for atmospheric radars. The developmental work is being carried out at National Atmospheric Research Laboratory (NARL), Gadanki. The digital receiver consists of a commercially available software defined radio (SDR) board called as universal software radio peripheral B210 (USRP B210) and a personal computer. USRP B210 operates over a wider frequency range from 70 MHz to 6 GHz and hence can be used for variety of radars like Doppler weather radars operating in S/C bands, in addition to wind profiling radars operating in VHF, UHF and L bands. Due to the flexibility and re-configurability of SDR, where the component functionalities are implemented in software, it is easy to modify the software to receive the echoes and process them as per the requirement suitable for the type of the radar intended. Hence, USRP B210 board along with the computer forms a versatile digital receiver from 70 MHz to 6 GHz. It has an inbuilt direct conversion transceiver with two transmit and two receive channels, which can be operated in fully coherent 2x2 MIMO fashion and thus it can be used as a two channel receiver. Multiple USRP B210 boards can be synchronized using the pulse per second (PPS) input provided on the board, to configure multi-channel digital receiver system. RF gain of the transceiver can be varied from 0 to 70 dB. The board can be controlled from the computer via USB 3.0 interface through USRP hardware driver (UHD), which is an open source cross platform driver. The USRP B210 board is connected to the personal computer through USB 3.0. Reference (10 MHz) clock signal from the radar master oscillator

  10. CERN physicist receives Einstein Medal

    CERN Multimedia

    2006-01-01

    On 29 June the CERN theorist Gabriele Veneziano was awarded the prestigious Albert Einstein Medal for significant contributions to the understanding of string theory. This award is given by the Albert Einstein Society in Bern to individuals whose scientific contributions relate to the work of Einstein. Former recipients include exceptional physicists such as Murray Gell-Mann last year, but also Stephen Hawking and Victor Weisskopf. Gabriele Veneziano, a member of the integrated CERN Theory Team since 1977, led the Theory Division from 1994 to 1997 and has already received many prestigious prizes for his outstanding work, including the Enrico Fermi Prize (see CERN Courier, November 2005), the Dannie Heineman Prize for mathematical physics of the American Physical Society in 2004 (see Bulletin No. 47/2003), and the I. Ya. Pomeranchuk Prize of the Institute of Theoretical and Experimental Physics (Moscow) in 1999.

  11. Enlaces de datos En VHF (VDL dentro del contexto CNS/ATM para la prestación de los servicios de tránsito aéreo en Colombia

    Directory of Open Access Journals (Sweden)

    Édgar Leonardo Gómez Gómez

    2012-09-01

    Full Text Available En este artículo se analiza el protocolo de comunicaciones por enlaces de datos en VHF (VDL, el cual, junto con técnicas de posicionamiento satelital, es uno de los pilares fundamentales dentro del concepto CNS/ATM planteado por la Organización de Aviación Civil Internacional (OACI, el cual busca la implantación de nuevas tecnologías para la prestación de los servicios de tránsito aéreo en las áreas de comunicaciones, navegación y vigilancia de aeronaves a nivel mundial. Se presenta el tipo de sistemas usados actualmente por la Unidad Administrativa Especial de Aeronáutica Civil (UAEAC para la prestación de estos servicios en Colombia, y se hace un comparativo para establecer las ventajas que tiene la implantación de las nuevas tecnologías planteadas en el concepto CNS/ATM, teniendo en cuenta las condiciones particulares de terreno y de flujo de tránsito aéreo que presenta Colombia. Además, se presentan los proyectos de implementación de subredes basadas en enlaces de datos VDL más relevantes a nivel mundial, los cuales permiten obtener resultados de pruebas de funcionamiento, como un paso fundamental hacia la consolidación a nivel mundial de este tipo de tecnología.

  12. Water jacket for solid particle solar receiver

    Science.gov (United States)

    Wasyluk, David T.

    2018-03-20

    A solar receiver includes: water jacket panels each having a light-receiving side and a back side with a watertight sealed plenum defined in-between; light apertures passing through the watertight sealed plenums to receive light from the light-receiving sides of the water jacket panels; a heat transfer medium gap defined between the back sides of the water jacket panels and a cylindrical back plate; and light channeling tubes optically coupled with the light apertures and extending into the heat transfer medium gap. In some embodiments ends of the light apertures at the light receiving side of the water jacket panel are welded together to define at least a portion of the light-receiving side. A cylindrical solar receiver may be constructed using a plurality of such water jacket panels arranged with their light-receiving sides facing outward.

  13. Design of double capacitances infrasonic receiver

    International Nuclear Information System (INIS)

    Wang Changhai; Han Kuixia; Wang Fei

    2003-01-01

    The article introduces the theory of infrasonic generation and reception of nuclear explosion. An idea of the design of double capacitances infrasonic receiver using CPLD technology is given in it. Compare with the single capacitance infrasonic receiver, sensitivity of the improved receiver can be improved scores of times, dynamic range can be improved largely, and the whole performance gets improvement a lots

  14. 29 CFR 1917.155 - Air receivers.

    Science.gov (United States)

    2010-07-01

    .... This section applies to compressed air receivers and equipment used for operations such as cleaning... transportation applications as railways, vehicles or cranes. (b) Gauges and valves. (1) Air receivers shall be... 29 Labor 7 2010-07-01 2010-07-01 false Air receivers. 1917.155 Section 1917.155 Labor Regulations...

  15. 49 CFR 393.88 - Television receivers.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Television receivers. 393.88 Section 393.88... NECESSARY FOR SAFE OPERATION Miscellaneous Parts and Accessories § 393.88 Television receivers. Any motor vehicle equipped with a television viewer, screen or other means of visually receiving a television...

  16. 21 CFR 1020.10 - Television receivers.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Television receivers. 1020.10 Section 1020.10 Food...) RADIOLOGICAL HEALTH PERFORMANCE STANDARDS FOR IONIZING RADIATION EMITTING PRODUCTS § 1020.10 Television receivers. (a) Applicability. The provisions of this section are applicable to television receivers...

  17. More Efficient Solar Thermal-Energy Receiver

    Science.gov (United States)

    Dustin, M. O.

    1987-01-01

    Thermal stresses and reradiation reduced. Improved design for solar thermal-energy receiver overcomes three major deficiencies of solar dynamic receivers described in literature. Concentrator and receiver part of solar-thermal-energy system. Receiver divided into radiation section and storage section. Concentrated solar radiation falls on boiling ends of heat pipes, which transmit heat to thermal-energy-storage medium. Receiver used in number of applications to produce thermal energy directly for use or to store thermal energy for subsequent use in heat engine.

  18. Concentrated solar power generation using solar receivers

    Science.gov (United States)

    Anderson, Bruce N.; Treece, William Dean; Brown, Dan; Bennhold, Florian; Hilgert, Christoph

    2017-08-08

    Inventive concentrated solar power systems using solar receivers, and related devices and methods, are generally described. Low pressure solar receivers are provided that function to convert solar radiation energy to thermal energy of a working fluid, e.g., a working fluid of a power generation or thermal storage system. In some embodiments, low pressure solar receivers are provided herein that are useful in conjunction with gas turbine based power generation systems.

  19. RF subsystem design for microwave communication receivers

    Science.gov (United States)

    Bickford, W. J.; Brodsky, W. G.

    A system review of the RF subsystems of (IFF) transponders, tropscatter receivers and SATCOM receivers is presented. The quantity potential for S-band and X-band IFF transponders establishes a baseline requirement. From this, the feasibility of a common design for these and other receivers is evaluated. Goals are established for a GaAs MMIC (monolithic microwave integrated circuit) device and related local oscillator preselector and self-test components.

  20. Receiver function estimated by maximum entropy deconvolution

    Institute of Scientific and Technical Information of China (English)

    吴庆举; 田小波; 张乃铃; 李卫平; 曾融生

    2003-01-01

    Maximum entropy deconvolution is presented to estimate receiver function, with the maximum entropy as the rule to determine auto-correlation and cross-correlation functions. The Toeplitz equation and Levinson algorithm are used to calculate the iterative formula of error-predicting filter, and receiver function is then estimated. During extrapolation, reflective coefficient is always less than 1, which keeps maximum entropy deconvolution stable. The maximum entropy of the data outside window increases the resolution of receiver function. Both synthetic and real seismograms show that maximum entropy deconvolution is an effective method to measure receiver function in time-domain.

  1. Effects of Oxytocin Administration on Receiving Help.

    Science.gov (United States)

    Human, Lauren J; Woolley, Joshua D; Mendes, Wendy Berry

    2017-11-27

    Receiving help can be a "mixed blessing." Despite the many psychosocial benefits it can carry, it sometimes has negative psychological consequences, such as loss in self-esteem or enhanced guilt. It is, therefore, important to understand the factors that modify responses to receiving help from others. We explored the role of the hormone oxytocin (OT) on affective and social responses to receiving help, given the putative role of OT in social bonding and attunement. To this end, we manipulated whether help was received from a same-sex interaction partner (confederate) versus a control condition, crossed with a double-blind administration of intranasal OT (vs. placebo), and examined subjective and observer-rated participant responses to help. We observed significant interactions between OT and the help manipulation. In the placebo condition, receiving help from the interaction partner compared with the control condition had negative consequences, such that participants reported greater negative affect and came to view themselves and their interaction partners more negatively after interacting together on several tasks. What is important, however, is that OT administration buffered against these negative subjective responses to receiving help. Further, outside observers rated participants who received OT administration as expressing greater happiness and gratitude in response to help, relative to those who received placebo. In sum, in the context of receiving help from a stranger, oxytocin administration fostered more positive affective and social responses. (PsycINFO Database Record (c) 2017 APA, all rights reserved).

  2. Shipping/Receiving and Quality Control

    Data.gov (United States)

    Federal Laboratory Consortium — Shipping receiving, quality control, large and precise inspection and CMM machines. Coordinate Measuring Machines, including "scanning" probes, optical comparators,...

  3. Compressive Sensing for Spread Spectrum Receivers

    DEFF Research Database (Denmark)

    Fyhn, Karsten; Jensen, Tobias Lindstrøm; Larsen, Torben

    2013-01-01

    With the advent of ubiquitous computing there are two design parameters of wireless communication devices that become very important: power efficiency and production cost. Compressive sensing enables the receiver in such devices to sample below the Shannon-Nyquist sampling rate, which may lead...... the bit error rate performance is degraded by the subsampling in the CS-enabled receivers, this may be remedied by including quantization in the receiver model.We also study the computational complexity of the proposed receiver design under different sparsity and measurement ratios. Our work shows...

  4. An SDR based AIS receiver for satellites

    DEFF Research Database (Denmark)

    Larsen, Jesper Abildgaard; Mortensen, Hans Peter; Nielsen, Jens Frederik Dalsgaard

    2011-01-01

    For a few years now, there has been a high interest in monitoring the global ship traffic from space. A few satellite, capable of listening for ship borne AIS transponders have already been launched, and soon the AAUSAT3, carrying two different types of AIS receivers will also be launched. One...... of the AIS receivers onboard AAUSAT3 is an SDR based AIS receiver. This paper serves to describe the background of the AIS system, and how the SDR based receiver has been integrated into the AAUSAT3 satellite. Amongst some of the benefits of using an SDR based receiver is, that due to its versatility, new...... detection algorithms are easily deployed, and it is easily adapted the new proposed AIS transmission channels....

  5. Heat receiving plates in thermonuclear device

    International Nuclear Information System (INIS)

    Kitamura, Kazunori.

    1988-01-01

    Purpose: To obtain a heat receiving plate structure capable of withstanding sputtering wear and retaining the thermal deformation and residual stress low upon junction and available at a reduced cost. Constitution: Junction structures between heat sinks and armours are the same as usual, whereas high melting armour (for example, made of tungsten) are used at the portion on a heat receiving plate where the thermal load and particle load are higher while materials having a heat expansion coefficient similar to that of the heat sink (stainless steel) are used at the portion where the thermal load and particle load are lower on a heat receiving plate depending on the thermal load and particle load distribution. This can reduce the thermal deformation for the entire divertor heat receiving plate to obtain a heat receiving plate of a good surface dimensional accuracy. (Takahashi, M.)

  6. High thermal load receiving heat plate

    International Nuclear Information System (INIS)

    Shibutani, Jun-ichi; Shibayama, Kazuhito; Yamamoto, Keiichi; Uchida, Takaho.

    1993-01-01

    The present invention concerns a high thermal load heat receiving plate such as a divertor plate of a thermonuclear device. The high thermal load heat receiving plate of the present invention has a cooling performance capable of suppressing the temperature of an armour tile to less than a threshold value of the material against high thermal loads applied from plasmas. Spiral polygonal pipes are inserted in cooling pipes at a portion receiving high thermal loads in the high temperature load heat receiving plate of the present invention. Both ends of the polygonal pipes are sealed by lids. An area of the flow channel in the cooling pipes is thus reduced. Heat conductivity on the cooling surface of the cooling pipes is increased in the high thermal load heat receiving plate having such a structure. Accordingly, temperature elevation of the armour tile can be suppressed. (I.S.)

  7. Fundamentals of GPS Receivers A Hardware Approach

    CERN Document Server

    Doberstein, Dan

    2012-01-01

    While much of the current literature on GPS receivers is aimed at those intimately familiar with their workings, this volume summarizes the basic principles using as little mathematics as possible, and details the necessary specifications and circuits for constructing a GPS receiver that is accurate to within 300 meters. Dedicated sections deal with the features of the GPS signal and its data stream, the details of the receiver (using a hybrid design as exemplar), and more advanced receivers and topics including time and frequency measurements. Later segments discuss the Zarlink GPS receiver chip set, as well as providing a thorough examination of the TurboRogue receiver, one of the most accurate yet made. Guiding the reader through the concepts and circuitry, from the antenna to the solution of user position, the book’s deployment of a hybrid receiver as a basis for discussion allows for extrapolation of the core ideas to more complex, and more accurate designs. Digital methods are used, but any analogue c...

  8. GPU Acceleration of DSP for Communication Receivers.

    Science.gov (United States)

    Gunther, Jake; Gunther, Hyrum; Moon, Todd

    2017-09-01

    Graphics processing unit (GPU) implementations of signal processing algorithms can outperform CPU-based implementations. This paper describes the GPU implementation of several algorithms encountered in a wide range of high-data rate communication receivers including filters, multirate filters, numerically controlled oscillators, and multi-stage digital down converters. These structures are tested by processing the 20 MHz wide FM radio band (88-108 MHz). Two receiver structures are explored: a single channel receiver and a filter bank channelizer. Both run in real time on NVIDIA GeForce GTX 1080 graphics card.

  9. Global Positioning System receiver evaluation results

    Energy Technology Data Exchange (ETDEWEB)

    Byrne, R.H.

    1993-09-01

    A Sandia project currently uses an outdated Magnavox 6400 Global Positioning System (GPS) receiver as the core of its navigation system. The goal of this study was to analyze the performance of the current GPS receiver compared to newer, less expensive models and to make recommendations on how to improve the performance of the overall navigation system. This paper discusses the test methodology used to experimentally analyze the performance of different GPS receivers, the test results, and recommendations on how an upgrade should proceed. Appendices contain detailed information regarding the raw data, test hardware, and test software.

  10. Decoding algorithm for vortex communications receiver

    Science.gov (United States)

    Kupferman, Judy; Arnon, Shlomi

    2018-01-01

    Vortex light beams can provide a tremendous alphabet for encoding information. We derive a symbol decoding algorithm for a direct detection matrix detector vortex beam receiver using Laguerre Gauss (LG) modes, and develop a mathematical model of symbol error rate (SER) for this receiver. We compare SER as a function of signal to noise ratio (SNR) for our algorithm and for the Pearson correlation algorithm. To our knowledge, this is the first comprehensive treatment of a decoding algorithm of a matrix detector for an LG receiver.

  11. Exploiting Redundancy in an OFDM SDR Receiver

    Directory of Open Access Journals (Sweden)

    Tomas Palenik

    2009-01-01

    Full Text Available Common OFDM system contains redundancy necessary to mitigate interblock interference and allows computationally effective single-tap frequency domain equalization in receiver. Assuming the system implements an outer error correcting code and channel state information is available in the receiver, we show that it is possible to understand the cyclic prefix insertion as a weak inner ECC encoding and exploit the introduced redundancy to slightly improve error performance of such a system. In this paper, an easy way to implement modification to an existing SDR OFDM receiver is presented. This modification enables the utilization of prefix redundancy, while preserving full compatibility with existing OFDM-based communication standards.

  12. 29 CFR 1926.306 - Air receivers.

    Science.gov (United States)

    2010-07-01

    ... transportation vehicles such as steam railroad cars, electric railway cars, and automotive equipment. (2) New and... manholes therein are easily accessible. Under no circumstances shall an air receiver be buried underground...

  13. 29 CFR 1910.169 - Air receivers.

    Science.gov (United States)

    2010-07-01

    ... and equipment used on transportation vehicles such as steam railroad cars, electric railway cars, and... therein are easily accessible. Under no circumstances shall an air receiver be buried underground or...

  14. 47 CFR 32.1170 - Receivables.

    Science.gov (United States)

    2010-10-01

    ... FOR TELECOMMUNICATIONS COMPANIES Instructions for Balance Sheet Accounts § 32.1170 Receivables. (a... of interest accrued to the date of the balance sheet on bonds, notes, and other commercial paper...

  15. Optical Coherent Receiver Enables THz Wireless Bridge

    DEFF Research Database (Denmark)

    Yu, Xianbin; Liu, Kexin; Zhang, Hangkai

    2016-01-01

    We experimentally demonstrated a 45 Gbit/s 400 GHz photonic wireless communication system enabled by an optical coherent receiver, which has a high potential in fast recovery of high data rate connections, for example, in disaster....

  16. Storage rack for fuel cell receiving shrouds

    International Nuclear Information System (INIS)

    Mollon, L.

    1978-01-01

    Disclosed is a rack for receiving a multiplicity of vertical tubular shrouds or tubes for storing spent nuclear fuel cells. The rack comprises a plurality of horizontally reticulated frames interconnected by tension rods and spacing tubes surrounding the rods

  17. List of Nuclear Materials Licensing Actions Received

    Data.gov (United States)

    Nuclear Regulatory Commission — A catalog of all Materials Licensing Actions received for review. The catalog lists the name of the entity submitting the license application, their city and state,...

  18. 47 CFR 80.911 - VHF transmitter.

    Science.gov (United States)

    2010-10-01

    ... resistance when operated with a primary supply voltage of 13.6 volts DC. (d) When an individual demonstration... paragraph must be met as follows: (1) Measurements of primary supply voltage and transmitter output power must be made with the equipment drawing energy only from ship's battery; (2) The primary supply voltage...

  19. Single-Receiver GPS Phase Bias Resolution

    Science.gov (United States)

    Bertiger, William I.; Haines, Bruce J.; Weiss, Jan P.; Harvey, Nathaniel E.

    2010-01-01

    Existing software has been modified to yield the benefits of integer fixed double-differenced GPS-phased ambiguities when processing data from a single GPS receiver with no access to any other GPS receiver data. When the double-differenced combination of phase biases can be fixed reliably, a significant improvement in solution accuracy is obtained. This innovation uses a large global set of GPS receivers (40 to 80 receivers) to solve for the GPS satellite orbits and clocks (along with any other parameters). In this process, integer ambiguities are fixed and information on the ambiguity constraints is saved. For each GPS transmitter/receiver pair, the process saves the arc start and stop times, the wide-lane average value for the arc, the standard deviation of the wide lane, and the dual-frequency phase bias after bias fixing for the arc. The second step of the process uses the orbit and clock information, the bias information from the global solution, and only data from the single receiver to resolve double-differenced phase combinations. It is called "resolved" instead of "fixed" because constraints are introduced into the problem with a finite data weight to better account for possible errors. A receiver in orbit has much shorter continuous passes of data than a receiver fixed to the Earth. The method has parameters to account for this. In particular, differences in drifting wide-lane values must be handled differently. The first step of the process is automated, using two JPL software sets, Longarc and Gipsy-Oasis. The resulting orbit/clock and bias information files are posted on anonymous ftp for use by any licensed Gipsy-Oasis user. The second step is implemented in the Gipsy-Oasis executable, gd2p.pl, which automates the entire process, including fetching the information from anonymous ftp

  20. Flexible receiver adapter formal design review

    International Nuclear Information System (INIS)

    Krieg, S.A.

    1995-01-01

    This memo summarizes the results of the Formal (90%) Design Review process and meetings held to evaluate the design of the Flexible Receiver Adapters, support platforms, and associated equipment. The equipment is part of the Flexible Receiver System used to remove, transport, and store long length contaminated equipment and components from both the double and single-shell underground storage tanks at the 200 area tank farms

  1. Anatomy of a digital coherent receiver

    DEFF Research Database (Denmark)

    Borkowski, Robert; Zibar, Darko; Tafur Monroy, Idelfonso

    2014-01-01

    , orthonormaliation, chromatic dispersion compensation/nonlinear compensation, resampling a nd timing recovery, polarization demultiplexing and equalization, frequency and phase recovery, digital demodulation. We also describe novel subsystems of a digital coherent receiver: modulation format recognition......Digital coherent receivers have gained significant attention in the last decade. The reason for this is that coherent detection, along with digital signal processing (DSP) allows for substantial increase of the channel capacity by employing advanced detection techniques. In this paper, we first...

  2. Efficient receiver tuning using differential evolution strategies

    Science.gov (United States)

    Wheeler, Caleb H.; Toland, Trevor G.

    2016-08-01

    Differential evolution (DE) is a powerful and computationally inexpensive optimization strategy that can be used to search an entire parameter space or to converge quickly on a solution. The Kilopixel Array Pathfinder Project (KAPPa) is a heterodyne receiver system delivering 5 GHz of instantaneous bandwidth in the tuning range of 645-695 GHz. The fully automated KAPPa receiver test system finds optimal receiver tuning using performance feedback and DE. We present an adaptation of DE for use in rapid receiver characterization. The KAPPa DE algorithm is written in Python 2.7 and is fully integrated with the KAPPa instrument control, data processing, and visualization code. KAPPa develops the technologies needed to realize heterodyne focal plane arrays containing 1000 pixels. Finding optimal receiver tuning by investigating large parameter spaces is one of many challenges facing the characterization phase of KAPPa. This is a difficult task via by-hand techniques. Characterizing or tuning in an automated fashion without need for human intervention is desirable for future large scale arrays. While many optimization strategies exist, DE is ideal for time and performance constraints because it can be set to converge to a solution rapidly with minimal computational overhead. We discuss how DE is utilized in the KAPPa system and discuss its performance and look toward the future of 1000 pixel array receivers and consider how the KAPPa DE system might be applied.

  3. ASTRID© - Advanced Solar Tubular ReceIver Design: A powerful tool for receiver design and optimization

    Science.gov (United States)

    Frantz, Cathy; Fritsch, Andreas; Uhlig, Ralf

    2017-06-01

    In solar tower power plants the receiver is one of the critical components. It converts the solar radiation into heat and must withstand high heat flux densities and high daily or even hourly gradients (due to passage of clouds). For this reason, the challenge during receiver design is to find a reasonable compromise between receiver efficiency, reliability, lifetime and cost. There is a strong interaction between the heliostat field, the receiver and the heat transfer fluid. Therefore, a proper receiver design needs to consider these components within the receiver optimization. There are several design and optimization tools for receivers, but most of them focus only on the receiver, ignoring the heliostat field and other parts of the plant. During the last years DLR developed the ASTRIDcode for tubular receiver concept simulation. The code comprises both a high and a low-detail model. The low-detail model utilizes a number of simplifications which allow the user to screen a high number of receiver concepts for optimization purposes. The high-detail model uses a FE model and is able to compute local absorber and salt temperatures with high accuracy. One key strength of the ASTRIDcode is its interface to a ray tracing software which simulates a realistic heat flux distributions on the receiver surface. The results generated by the ASTRIDcode have been validated by CFD simulations and measurement data.

  4. 'Chaos' in superregenerative receivers

    Energy Technology Data Exchange (ETDEWEB)

    Commercon, Jean-Claude [INSA, Department d' Informatiques, Ba-hat t B. Pascal, 20 Avenue Albert Einsten, 69621 Villeurbaune (France)]. E-mail: jean-claude.commercon@insa-lyon.fr; Badard, Robert [INSA, Department d' Informatiques, Bat B. Pascal, 20 Avenue Albert Einsten, 69621 Villeurbaune (France)]. E-mail: robert.badard@insa-lyon.fr

    2005-02-01

    The superregenerative principle has been known since the early 1920s. The circuit is extremely simple and extremely sensitive. Today, superheterodyne receivers generally supplant superregenerative receivers in most applications because there are several undesirable characteristics: poor selectivity, reradiation, etc. Superregenerative receivers undergo a revival in recent papers for wireless systems, where low cost and very low power consumption are relevant: house/building meters (such as water, energy, gas counter), personal computer environment (keyboard, mouse), etc. Another drawback is the noise level which is higher than that of a well-designed superheterodyne receiver; without an antenna input signal, the output of the receiver hears in an earphone as a waterfall noise; this sound principally is the inherent input noise amplified and detected by the circuit; however, when the input noise is negligible with respect of an antenna input signal, we are faced to an other source of 'noise' self-generated by the superregenerative working. The main objective of this paper concerns this self-generated noise coming from an exponential growing followed by a re-injection process for which the final state is a function of the phase of the input signal.

  5. Dish/stirling hybrid-receiver

    Science.gov (United States)

    Mehos, Mark S.; Anselmo, Kenneth M.; Moreno, James B.; Andraka, Charles E.; Rawlinson, K. Scott; Corey, John; Bohn, Mark S.

    2002-01-01

    A hybrid high-temperature solar receiver is provided which comprises a solar heat-pipe-receiver including a front dome having a solar absorber surface for receiving concentrated solar energy, a heat pipe wick, a rear dome, a sidewall joining the front and the rear dome, and a vapor and a return liquid tube connecting to an engine, and a fossil fuel fired combustion system in radial integration with the sidewall for simultaneous operation with the solar heat pipe receiver, the combustion system comprising an air and fuel pre-mixer, an outer cooling jacket for tangentially introducing and cooling the mixture, a recuperator for preheating the mixture, a burner plenum having an inner and an outer wall, a porous cylindrical metal matrix burner firing radially inward facing a sodium vapor sink, the mixture ignited downstream of the matrix forming combustion products, an exhaust plenum, a fossil-fuel heat-input surface having an outer surface covered with a pin-fin array, the combustion products flowing through the array to give up additional heat to the receiver, and an inner surface covered with an extension of the heat-pipe wick, a pin-fin shroud sealed to the burner and exhaust plenums, an end seal, a flue-gas diversion tube and a flue-gas valve for use at off-design conditions to limit the temperature of the pre-heated air and fuel mixture, preventing pre-ignition.

  6. The Communication Between Designer and Design Receiver

    DEFF Research Database (Denmark)

    Dai, Zheng; Dai, Yan

    2009-01-01

    When people think about a product,the first impression always mainly influences the result.Product is the medium of communication between designer and designer receiver.Because both of them have varied different experience and background,the information would be biased during the transferring...... process.The common symbols which can be recognized by both of designer and receiver are the key tools for communication.In some case,the same symbol in one product would be leads to different receiver impression.Generally,impression includes 3 aspects:aesthetics,function, and emotion.Designer needs...... to create an attractive and accurate impression in product from these 3 aspects.For facing the dilemma of communication,some experimental approaches can help designer deal with unique and diversity situations.Solving the detail problem in each step could keep the original meaning of designer....

  7. The ARSQ: the athletes' received support questionnaire.

    Science.gov (United States)

    Freeman, Paul; Coffee, Pete; Moll, Tjerk; Rees, Tim; Sammy, Nadine

    2014-04-01

    To address calls for context-specific measurement of social support, this article reports the development of the Athletes' Received Support Questionnaire (ARSQ) and demonstrates initial evidence for its validity. Across four studies there was support for a four-dimensional structure reflecting emotional, esteem, informational, and tangible received support. There was also support for unidimensional and higher-order models. Further, Study 3 provided some support for convergent validity, with significant correlations between the corresponding dimensions of the ARSQ and the Inventory of Socially Supportive Behaviors. Study 4 provided evidence for the nomological validity of the ARSQ. Emotional and esteem support significantly predicted self-confidence and positive affect, and tangible support significantly moderated the relationship between stress and negative affect. Collectively, these results provide initial evidence for the validity of the ARSQ, and offer researchers flexibility to adopt either a multidimensional or aggregated approach to measuring received support.

  8. Precision Continuum Receivers for Astrophysical Applications

    Science.gov (United States)

    Wollack, Edward J.

    2011-01-01

    Cryogenically cooled HEMT (High Electron Mobility Transistor) amplifiers find widespread use in radioastronomy receivers. In recent years, these devices have also been commonly employed in broadband receivers for precision measurements of the Cosmic Microwave Background (CMB) radiation. In this setting, the combination of ultra-low-noise and low-spectral-resolution observations reinforce the importance achieving suitable control over the device environment to achieve fundamentally limited receiver performance. The influence of the intrinsic amplifier stability at low frequencies on data quality (e.g., achievable noise and residual temporal correlations), observational and calibration strategies, as well as architectural mitigation approaches in this setting will be discussed. The implications of device level 1/f fluctuations reported in the literature on system performance will be reviewed.

  9. Multistandard Receiver Design for Telemedicine Monitoring System

    Directory of Open Access Journals (Sweden)

    Hongmei Wang

    2018-01-01

    Full Text Available In short-distance wireless communications for telemedicine monitoring, different medical data measurement equipment has different wireless transmission modes. A multistandard receiver is designed that can adapt to different medical data measuring equipment. Using a second-order bandpass sampling for the design of antialiasing filters, two aliasing signals can be separated. Simultaneously, constraint conditions for sampling frequency are not as critical. The design is useful for a multistandard receiver in a telemedicine monitoring system and has the advantages such as saving spectrum resources and facilitating spectrum planning.

  10. Analog fourier transform channelizer and OFDM receiver

    OpenAIRE

    2007-01-01

    An OFDM receiver having an analog multiplier based I-Q channelizing filter, samples and holds consecutive analog I-Q samples of an I-Q baseband, the I-Q basebands having OFDM sub-channels. A lattice of analog I-Q multipliers and analog I-Q summers concurrently receives the held analog I-Q samples, performs analog I-Q multiplications and analog I-Q additions to concurrently generate a plurality of analog I-Q output signals, representing an N-point discrete Fourier transform of the held analog ...

  11. Building and Testing a Portable VLF Receiver

    Science.gov (United States)

    McLaughlin, Robert; Krause, L.

    2014-01-01

    Unwanted emissions or signal noise is a major problem for VLF radio receivers. These can occur from man made sources such as power line hum, which can be prevalent for many harmonics after the fundamental 50 or 60 Hz AC source or from VLF radio transmissions such as LORAN, used for navigation and communications. Natural emissions can also be detrimental to the quality of recordings as some of the more interesting natural emissions such as whistlers or auroral chorus may be drowned out by the more common sferic emissions. VLF receivers must selectively filter out unwanted emissions and amplify the filtered signal to a record-able level without degrading the quality.

  12. Billing and accounts receivable: fundamentals for improvement.

    Science.gov (United States)

    Bizon, M M

    1993-07-01

    If a healthcare facility's accounts receivable operation is experiencing problems, the patient accounts manager should survey all areas of his or her responsibility to determine the best method of resolving the difficulties. One effective technique to reduce billing problems is to take a proactive--not reactive--approach. If mistakes can be corrected before they get out of control, and if the patient accounts manager can ensure that claims will not be denied, a healthcare facility's accounts receivable should remain in good condition.

  13. Improved timing recovery in wireless mobile receivers

    CSIR Research Space (South Africa)

    Olwal, TO

    2007-06-01

    Full Text Available are transmitted to the receiver. In the proposed method, the receiver exploits the soft decisions computed at each turbo decoding iteration to provide reliable estimates of a soft timing signal, which in turn, improves the decoding time. The derived method... as ( ) ( )( )1 2 1 2, ,..., , ,...,Q Qk k k k k k k k ka a x x x P a x x xη∗ ∗∈Β= ∑ (29) where ( )1 2, ,..., Qk k kx x x are the Q coded bits in a multilevel symbol modulation scheme [32]. According to [29], the soft information demapper computes posteriori...

  14. Measuring Balance Across Multiple Radar Receiver Channels.

    Energy Technology Data Exchange (ETDEWEB)

    Doerry, Armin W.; Bickel, Douglas L.

    2018-03-01

    When radar receivers employ multiple channels, the general intent is for the receive channels to be as alike as possible, if not as ideal as possible. This is usually done via prudent hardware design, supplemented by system calibration. Towards this end, we require a quality metric for ascertaining the goodness of a radar channel, and the degree of match to sibling channels. We propose a relevant and useable metric to do just that. Acknowledgements This report was the result of an unfunded research and development activity.

  15. Richard W. Ziolkowski Receives Honorary Doctorate

    DEFF Research Database (Denmark)

    Breinbjerg, Olav

    2012-01-01

    At the annual Commemoration of the Technical University of Denmark (DTU) on April 27, 2012, Prof. Richard W. Ziolkowski, University of Arizona (UoA), received DTU's highest academic degree, the Honorary Doctor degree: Doctor Technices Honoris Causa (Figure 1). Prof. Ziolkowski has been a close...

  16. Howard Feiertag receives hospitality industry award

    OpenAIRE

    Ho, Sookhan

    2004-01-01

    Howard Feiertag, of Blacksburg, an instructor in hospitality and tourism management at Virginia Tech's Pamplin College of Business, received the inaugural Excellence in Sales and Marketing Strategy Award at the Hospitality Sales and Marketing Association/New York University Strategy Conference in New York recently.

  17. 7 CFR 966.124 - Approved receiver.

    Science.gov (United States)

    2010-01-01

    ... limited to, the following information: (1) Name, address, contact person, telephone number, and e-mail... 7 Agriculture 8 2010-01-01 2010-01-01 false Approved receiver. 966.124 Section 966.124 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements...

  18. Optimization of Passive Coherent Receiver System Placement

    Science.gov (United States)

    2013-09-01

    spheroid object with a constant radar cross section (RCS). Additionally, the receiver and transmitters are assumed to be notional isotropic antennae...software- defined radio for equatorial plasma instability studies,” Radio Science, vol. 48, pp. 1–11. Aug. 2013. [2] P. C. Zhang and B. Y. Li, “Passive

  19. A 24GHz Radar Receiver in CMOS

    NARCIS (Netherlands)

    Kwok, K.C.

    2015-01-01

    This thesis investigates the system design and circuit implementation of a 24GHz-band short-range radar receiver in CMOS technology. The propagation and penetration properties of EM wave offer the possibility of non-contact based remote sensing and through-the-wall imaging of distance stationary or

  20. 8. Prevalence of Epistaxis among Patients Receiving ...

    African Journals Online (AJOL)

    user

    The aim of this study was thus to determine the prevalence, aetiology and treatment modalities of epistaxis among patients receiving otorhinolaryngology services at MNH and MOI. Materials and Methods: A cross-sectional, hospital based study was done to 427 patients at Muhimbili. National Hospital (MNH) and Muhimbili.

  1. Receiving Assistance and Local Food System Participation

    Directory of Open Access Journals (Sweden)

    Rebecca L. Som Castellano

    2017-02-01

    Full Text Available A body of literature has noted that local food systems (LFSs may not involve active participation by individuals with lower incomes. This is, in part, a function of racial and class hegemony, as well as physical and financial accessibility of LFSs. LFS institutions, such as farmers’ markets, have been working to facilitate receipt of food assistance programs, such as the Supplemental Nutrition Assistance Program (SNAP. Charitable assistance programs, such as food banks, have also been actively working to engage in LFSs, for example, by making local foods available. However, little research has explored the role that receiving public or charitable assistance can play in influencing LFS participation. In this article, I utilize quantitative and qualitative data collected from across the state of Ohio to examine the relationship between receiving assistance and LFS participation for women, who remain predominately responsible for food provisioning in the U.S., including among those who participate in LFSs. Quantitative results suggest that receiving assistance can increase participation in LFSs. Qualitative data provides more nuanced information about the importance of food assistance for women who want to participate in LFSs, and suggest that it is essential that food cooperatives and farmers’ markets are equipped to receive food assistance programs, such as SNAP, in order for women with lower incomes to participate in LFSs.

  2. Reasons Parents Exempt Children from Receiving Immunizations

    Science.gov (United States)

    Luthy, Karlen E.; Beckstrand, Renea L.; Callister, Lynn C.; Cahoon, Spencer

    2012-01-01

    School nurses are on the front lines of educational efforts to promote childhood vaccinations. However, some parents still choose to exempt their children from receiving vaccinations for personal reasons. Studying the beliefs of parents who exempt vaccinations allows health care workers, including school nurses, to better understand parental…

  3. Social effects of migration in receiving countries.

    Science.gov (United States)

    Ohndorf, W

    1989-06-01

    This paper examines the impact of post-1945 migration into Western, Middle, and Northern Europe from Southern Europe, Turkey, and Northern Africa, and migration to the traditional immigration countries by Asian and Latin American immigrants, on the social structures of receiving countries. Between 1955 and 1974, 1) traditional migration to the US and Australia became less important for European countries while traditional receiving countries accepted many immigrants from developing countries; and 2) rapid economic revival in Western and Northern Europe caused a considerable labor shortage which was filled by migrant workers especially from Southern Europe, Turkey, and Northern Africa, who stayed only until they reached their economic goals. Since 1974, job vacancies have declined and unemployment has soared. This employment crisis caused some migrants 1) to return to their countries of origin, 2) to bring the rest of their families to the receiving country, or 3) to lengthen their stay considerably. The number of refugees has also significantly increased since the mid-970s, as has the number of illegal migrants. After the mid-1970s, Europe began to experience integration problems. The different aspects of the impact of migration on social structures include 1) improvement of the housing situation for foreigners, 2) teaching migrants the language of the receiving country, 3) solving the unemployment problem of unskilled migrants, 4) improvement of educational and vocational qualifications of 2nd generation migrants, 5) development of programs to help unemployed wives of migrants to learn the language and meet indigenous women, 6) encouraging migrants to maintain their cultural identity and assisting them with reintegration if they return to their original country, 7) coping with the problems of refugees, and 8) solving the problems of illegal migration. Almost all receiving countries now severely restrict further immigration. [Those policies should result in

  4. CERN Press Office receives award from Euroscience

    CERN Multimedia

    2009-01-01

    The CERN Communication group has received an award for its efforts in communicating the LHC first beam to the media and the public. James Gillies, head of the Communication group was presented the AlphaGalileo Research Public Relations Award on Wednesday, 14 October during the Euroscience Media Award Ceremony in Hannover. "It’s great to receive this recognition," said Gillies. "Of course, we had great material to work with: the LHC is a fantastic story and one that is going to get even better. Angels, Demons and black holes also had their roles to play, but behind the media interest there’s been a lot of hard work by my team. This is for them." The CERN Communication group also works with communication professionals in all the CERN Member States and major physics labs around the world through the European Particle Physics Communication Network, and the InterAction collaboration. "Without them," says Gillies, &am...

  5. Nutritional survey of neoplasm patients receiving radiotherapy

    International Nuclear Information System (INIS)

    Li Xinli; Zhu Shengtao

    2001-01-01

    Objective: In order to know the nutriture of neoplasm patients receiving radiotherapy and give nutritional guidance properly, the authors make the following survey. Methods: A dietary survey of twenty-four-hour retrospective method was used; The patients' activity was recorded and their twenty-four hours caloric consumption was calculated. Results: Of all the patients, the intake of protein is more than recommended, percentage of calorific proportion is about 15%-19% of gross caloric. A larger portion of patients' caloric intake, especially female patients, is lower than caloric consumption. Among all the patients, the intake of vegetables is not enough; The consumption of milk and milky products is lower; it is common and serious that neoplasm patients receiving radiotherapy have vitamine and mineral's scarcity. Conclusions: Nutriture of neoplasm patients is not optimistic, it is imperative to improve their nutriture

  6. Graphene radio frequency receiver integrated circuit.

    Science.gov (United States)

    Han, Shu-Jen; Garcia, Alberto Valdes; Oida, Satoshi; Jenkins, Keith A; Haensch, Wilfried

    2014-01-01

    Graphene has attracted much interest as a future channel material in radio frequency electronics because of its superior electrical properties. Fabrication of a graphene integrated circuit without significantly degrading transistor performance has proven to be challenging, posing one of the major bottlenecks to compete with existing technologies. Here we present a fabrication method fully preserving graphene transistor quality, demonstrated with the implementation of a high-performance three-stage graphene integrated circuit. The circuit operates as a radio frequency receiver performing signal amplification, filtering and downconversion mixing. All circuit components are integrated into 0.6 mm(2) area and fabricated on 200 mm silicon wafers, showing the unprecedented graphene circuit complexity and silicon complementary metal-oxide-semiconductor process compatibility. The demonstrated circuit performance allow us to use graphene integrated circuit to perform practical wireless communication functions, receiving and restoring digital text transmitted on a 4.3-GHz carrier signal.

  7. Hypersensitivity reactions in patients receiving hemodialysis.

    Science.gov (United States)

    Butani, Lavjay; Calogiuri, Gianfranco

    2017-06-01

    To describe hypersensitivity reactions in patients receiving maintenance hemodialysis. PubMed search of articles published during the past 30 years with an emphasis on publications in the past decade. Case reports and review articles describing hypersensitivity reactions in the context of hemodialysis. Pharmacologic agents are the most common identifiable cause of hypersensitivity reactions in patients receiving hemodialysis. These include iron, erythropoietin, and heparin, which can cause anaphylactic or pseudoallergic reactions, and topical antibiotics and anesthetics, which lead to delayed-type hypersensitivity reactions. Many hypersensitivity reactions are triggered by complement activation and increased bradykinin resulting from contact system activation, especially in the context of angiotensin-converting enzyme inhibitor use. Several alternative pharmacologic preparations and dialyzer membranes are available, such that once an etiology for the reaction is established, recurrences can be prevented without affecting the quality of care provided to patients. Although hypersensitivity reactions are uncommon in patients receiving hemodialysis, they can be life-threatening. Moreover, considering the large prevalence of the end-stage renal disease population, the implications of such reactions are enormous. Most reactions are pseudoallergic and not mediated by immunoglobulin E. The multiplicity of potential exposures and the complexity of the environment to which patients on dialysis are exposed make it challenging to identify the precise cause of these reactions. Great diligence is needed to investigate hypersensitivity reactions to avoid recurrence in this high-risk population. Copyright © 2017 American College of Allergy, Asthma & Immunology. Published by Elsevier Inc. All rights reserved.

  8. TDRSS S-shuttle unique receiver equipment

    Science.gov (United States)

    Weinberg, A.; Schwartz, J. J.; Spearing, R.

    1985-01-01

    Beginning with STS-9, the Tracking and Date Relay Satellite system (TDRSS) will start providing S- and Ku-band communications and tracking support to the Space Shuttle and its payloads. The most significant element of this support takes place at the TDRSS White Sands Ground Terminal, which processes the Shuttle return link S- and Ku-band signals. While Ku-band hardware available to other TDRSS users is also applied to Ku-Shuttle, stringent S-Shuttle link margins have precluded the application of the standard TDRSS S-band processing equipment to S-Shuttle. It was therfore found necessary to develop a unique S-Shuttle Receiver that embodies state-of-the-art digital technology and processing techniques. This receiver, developed by Motorola, Inc., enhances link margins by 1.5 dB relative to the standard S-band equipment and its bit error rate performance is within a few tenths of a dB of theory. An overview description of the Space Shuttle Receiver Equipment (SSRE) is presented which includes the presentation of block diagrams and salient design features. Selected, measured performance results are also presented.

  9. A Decentralized Receiver in Gaussian Interference

    Directory of Open Access Journals (Sweden)

    Christian D. Chapman

    2018-04-01

    Full Text Available Bounds are developed on the maximum communications rate between a transmitter and a fusion node aided by a cluster of distributed receivers with limited resources for cooperation, all in the presence of an additive Gaussian interferer. The receivers cannot communicate with one another and can only convey processed versions of their observations to the fusion center through a Local Array Network (LAN with limited total throughput. The effectiveness of each bound’s approach for mitigating a strong interferer is assessed over a wide range of channels. It is seen that, if resources are shared effectively, even a simple quantize-and-forward strategy can mitigate an interferer 20 dB stronger than the signal in a diverse range of spatially Ricean channels. Monte-Carlo experiments for the bounds reveal that, while achievable rates are stable when varying the receiver’s observed scattered-path to line-of-sight signal power, the receivers must adapt how they share resources in response to this change. The bounds analyzed are proven to be achievable and are seen to be tight with capacity when LAN resources are either ample or limited.

  10. Multifunction waveform generator for EM receiver testing

    Science.gov (United States)

    Chen, Kai; Jin, Sheng; Deng, Ming

    2018-01-01

    In many electromagnetic (EM) methods - such as magnetotelluric, spectral-induced polarization (SIP), time-domain-induced polarization (TDIP), and controlled-source audio magnetotelluric (CSAMT) methods - it is important to evaluate and test the EM receivers during their development stage. To assess the performance of the developed EM receivers, controlled synthetic data that simulate the observed signals in different modes are required. In CSAMT and SIP mode testing, the waveform generator should use the GPS time as the reference for repeating schedule. Based on our testing, the frequency range, frequency precision, and time synchronization of the currently available function waveform generators on the market are deficient. This paper presents a multifunction waveform generator with three waveforms: (1) a wideband, low-noise electromagnetic field signal to be used for magnetotelluric, audio-magnetotelluric, and long-period magnetotelluric studies; (2) a repeating frequency sweep square waveform for CSAMT and SIP studies; and (3) a positive-zero-negative-zero signal that contains primary and secondary fields for TDIP studies. In this paper, we provide the principles of the above three waveforms along with a hardware design for the generator. Furthermore, testing of the EM receiver was conducted with the waveform generator, and the results of the experiment were compared with those calculated from the simulation and theory in the frequency band of interest.

  11. Russian institute receives CMS Gold Award

    CERN Multimedia

    Patrice Loïez

    2003-01-01

    The Snezhinsk All-Russian Institute of Scientific Research for Technical Physics (VNIITF) of the Russian Federal Nuclear Centre (RFNC) is one of twelve CMS suppliers to receive awards for outstanding performance this year. The CMS Collaboration took the opportunity of the visit to CERN of the Director of VNIITF and his deputy to present the CMS Gold Award, which the institute has received for its exceptional performance in the assembly of steel plates for the CMS forward hadronic calorimeter. This calorimeter consists of two sets of 18 wedge-shaped modules arranged concentrically around the beam-pipe at each end of the CMS detector. Each module consists of steel absorber plates with quartz fibres inserted into them. The institute developed a special welding technique to assemble the absorber plates, enabling a high-quality detector to be produced at relatively low cost.RFNC-VNIITF Director Professor Georgy Rykovanov (right), is seen here receiving the Gold Award from Felicitas Pauss, Vice-Chairman of the CMS ...

  12. Submillimeter heterodyne receiver for the CSO telescope

    International Nuclear Information System (INIS)

    Gulkis, S.

    1988-01-01

    This task is to build a cryogenically cooled 620 to 700 GHz astronomical receiver that will be used as a facility instrument at the CalTech Submillimeter Observatory (CSO) on Mauna Kea, Hawaii. The receiver will have applications as a very high resolution spectrometer to investigate spectral lines in planetary and satellite atmospheres, and comets. The receiver will also be used to make continuum measurements of planets, satellites, and asteroids. During FY88, a scale model (200 GHz) SIS mixer radiometer was built and intrgrated into a cryostat designed for use on the CSO telescope. This system will serve as a model to guide the work on the higher frequency mixer. A solid state local oscillator source that covers two bands in the 600 to 700 GHz has been developed under contract JPL and will be delivered before the end of the year. Work has continued on the SIS materials needed for the 620 to 700 GHz mixer. Test hardware has been developed which allow the 1 to 5 curves for SIS material to be easily measured

  13. Towards Self-Clocked Gated OCDMA Receiver

    Science.gov (United States)

    Idris, S.; Osadola, T.; Glesk, I.

    2013-02-01

    A novel incoherent OCDMA receiver with incorporated all-optical clock recovery for self-synchronization of a time gate for the multi access interferences (MAI) suppression and minimizing the effect of data time jitter in incoherent OCDMA system was successfully developed and demonstrated. The solution was implemented and tested in a multiuser environment in an out of the laboratory OCDMA testbed with two-dimensional wavelength-hopping time-spreading coding scheme and OC-48 (2.5 Gbp/s) data rate. The self-clocked all-optical time gate uses SOA-based fibre ring laser optical clock, recovered all-optically from the received OCDMA traffic to control its switching window for cleaning the autocorrelation peak from the surrounding MAI. A wider eye opening was achieved when the all-optically recovered clock from received data was used for synchronization if compared to a static approach with the RF clock being generated by a RF synthesizer. Clean eye diagram was also achieved when recovered clock is used to drive time gating.

  14. Ground receiving station (GRS) of UMS - receiving and processing the electromagnetic wave data from satellite

    International Nuclear Information System (INIS)

    Mohammad Syahmi Nordin; Fauziah Abdul Aziz

    2007-01-01

    The low resolution Automatic Picture Transmission (APT) data from the National Oceanic and Atmospheric Administration (NOAA) polar-orbiting satellites Advanced Very High Resolution Radiometer (AVHRR) is being received and recorded in real-time mode at ground receiving station in School of Science and Technology, Universiti Malaysia Sabah. The system is suitable for the developing and undeveloped countries in south and Southeast Asia and is said to be acceptable for engineering, agricultural, climatological and environmental applications. The system comprises a personal computer attached with a small APT receiver. The data transmission between the ground receiving station and NOAA satellites is using the electromagnetic wave. The relation for receiving and processing the electromagnetic wave in the transmission will be discussed. (Author)

  15. 47 CFR 80.268 - Technical requirements for radiotelephone installation.

    Science.gov (United States)

    2010-10-01

    ... a visual indication whenever the transmitter is supplying power to the antenna. (4) Have a two-tone... between masts or other supports subject to whipping, a safety link must be installed which under heavy stress will reduce breakage of the antenna, the halyards, or any other supporting elements. (d) The...

  16. Superconducting Submm Integrated Receiver for TELIS

    Energy Technology Data Exchange (ETDEWEB)

    Koshelets, V P [Institute of Radio Engineering and Electronics (IREE) (Russian Federation); Ermakov, A B [Institute of Radio Engineering and Electronics (IREE) (Russian Federation); Filippenko, L V [Institute of Radio Engineering and Electronics (IREE) (Russian Federation); Koryukin, O V [Institute of Radio Engineering and Electronics (IREE) (Russian Federation); Khudchenko, A V [Institute of Radio Engineering and Electronics (IREE) (Russian Federation); Sobolev, A S [Institute of Radio Engineering and Electronics (IREE) (Russian Federation); Torgashin, M Yu [Institute of Radio Engineering and Electronics (IREE) (Russian Federation); Yagoubov, P A [SRON National Institute for Space Research (Netherlands); Hoogeveen, R W M [SRON National Institute for Space Research (Netherlands); Vreeling, W J [SRON National Institute for Space Research (Netherlands); Wild, W [SRON National Institute for Space Research (Netherlands); Pylypenko, O M [State Research Center of Superconducting Electronics ' Iceberg' (Ukraine)

    2006-06-01

    In this report we present design and first experimental results for development of the submm superconducting integrated receiver spectrometer for Terahertz Limb Sounder (TELIS). TELIS is a collaborative European project to build up a three-channel heterodyne balloon-based spectrometer for measuring a variety of atmospheric constituents of the stratosphere. The 550 - 650 GHz channel of TELIS is based on a phase-locked Superconducting Integrated Receiver (SIR). SIR is an on-chip combination of a low-noise Superconductor-Insulator-Superconductor (SIS) mixer with quasioptical antenna, a superconducting Flux Flow Oscillator (FFO) acting as Local Oscillator (LO), and SIS harmonic mixer (HM) for FFO phase locking. A number of new solutions were implemented in the new generation of SIR chips. To achieve the wide-band performance of the spectrometer, a side-feed twin-SIS mixer and balanced SIS mixer with 0.8 {mu}m{sup 2} junctions integrated with a double-dipole (or double-slot) antenna is used. An improved design of the FFO for TELIS has been developed and optimized providing a free-running linewidth between 10 and 2 MHz in the frequency range 500 - 700 GHz. It is important to ensure that tuning of a phase-locked (PL) SIR can be performed remotely by telecommand. For this purpose a number of approaches for the PL SIR automatic computer control have been developed. All receiver components (including input optical elements and Martin-Puplett polarization rotating interferometer for single side band operation) will be mounted on a single 4.2 K plate inside a 40 x 180 x 80 mm{sup 3} box. First measurements give an uncorrected double side band (DSB) noise temperature below 250 K measured with the phase-locked FFO; more detailed results are presented at the conference.

  17. Superconducting Submm Integrated Receiver for TELIS

    International Nuclear Information System (INIS)

    Koshelets, V P; Ermakov, A B; Filippenko, L V; Koryukin, O V; Khudchenko, A V; Sobolev, A S; Torgashin, M Yu; Yagoubov, P A; Hoogeveen, R W M; Vreeling, W J; Wild, W; Pylypenko, O M

    2006-01-01

    In this report we present design and first experimental results for development of the submm superconducting integrated receiver spectrometer for Terahertz Limb Sounder (TELIS). TELIS is a collaborative European project to build up a three-channel heterodyne balloon-based spectrometer for measuring a variety of atmospheric constituents of the stratosphere. The 550 - 650 GHz channel of TELIS is based on a phase-locked Superconducting Integrated Receiver (SIR). SIR is an on-chip combination of a low-noise Superconductor-Insulator-Superconductor (SIS) mixer with quasioptical antenna, a superconducting Flux Flow Oscillator (FFO) acting as Local Oscillator (LO), and SIS harmonic mixer (HM) for FFO phase locking. A number of new solutions were implemented in the new generation of SIR chips. To achieve the wide-band performance of the spectrometer, a side-feed twin-SIS mixer and balanced SIS mixer with 0.8 μm 2 junctions integrated with a double-dipole (or double-slot) antenna is used. An improved design of the FFO for TELIS has been developed and optimized providing a free-running linewidth between 10 and 2 MHz in the frequency range 500 - 700 GHz. It is important to ensure that tuning of a phase-locked (PL) SIR can be performed remotely by telecommand. For this purpose a number of approaches for the PL SIR automatic computer control have been developed. All receiver components (including input optical elements and Martin-Puplett polarization rotating interferometer for single side band operation) will be mounted on a single 4.2 K plate inside a 40 x 180 x 80 mm 3 box. First measurements give an uncorrected double side band (DSB) noise temperature below 250 K measured with the phase-locked FFO; more detailed results are presented at the conference

  18. Compressed Sensing-Based Direct Conversion Receiver

    DEFF Research Database (Denmark)

    Pierzchlewski, Jacek; Arildsen, Thomas; Larsen, Torben

    2012-01-01

    Due to the continuously increasing computational power of modern data receivers it is possible to move more and more processing from the analog to the digital domain. This paper presents a compressed sensing approach to relaxing the analog filtering requirements prior to the ADCs in a direct......-converted radio signals. As shown in an experiment presented in the article, when the proposed method is used, it is possible to relax the requirements for the quadrature down-converter filters. A random sampling device and an additional digital signal processing module is the price to pay for these relaxed...

  19. Radiation Doses Received by the Irish Population

    International Nuclear Information System (INIS)

    Colgan, P.A.; Organo, C.; Hone, C.; Fenton, D.

    2008-05-01

    Some chemical elements present in the environment since the Earth was formed are naturally radioactive and exposure to these sources of radiation cannot be avoided. There have also been additions to this natural inventory from artificial sources of radiation that did not exist before the 1940s. Other sources of radiation exposure include cosmic radiation from outer space and the use of radiation in medical diagnosis and treatment. There can be large variability in the dose received by invividual members of the population from any given source. Some sources of radiation expose every member of the population while, in other cases, only selected individuals may be exposed. For example, natural radioactivity is found in all soils and therefore everybody receives some radiation dose from this activity. On the other hand, in the case of medical exposures, only those who undergo a medical procedure using radiation will receive a radiation dose. The Radiological Protection Institute of Ireland (RPII) has undertaken a comprehensive review of the relevant data on radiation exposure in Ireland. Where no national data have been identified, the RPII has either undertaken its own research or has referred to the international literature to provide a best estimate of what the exposure in Ireland might be. This has allowed the relative contribution of each source to be quantified. This new evaluation is the most up-to-date assessment of radiation exposure and updates the assessment previously reported in 2004. The dose quoted for each source is the annual 'per caput' dose calculated on the basis of the most recently available data. This is an average value calculated by adding the doses received by each individual exposed to a given radiation source and dividing the total by the current population of 4.24 million. All figures have been rounded, consistent with the accuracy of the data. In line with accepted international practice, where exposure takes place both indoors and

  20. Superconductor Digital-RF Receiver Systems

    Science.gov (United States)

    Mukhanov, Oleg A.; Kirichenko, Dmitri; Vernik, Igor V.; Filippov, Timur V.; Kirichenko, Alexander; Webber, Robert; Dotsenko, Vladimir; Talalaevskii, Andrei; Tang, Jia Cao; Sahu, Anubhav; Shevchenko, Pavel; Miller, Robert; Kaplan, Steven B.; Sarwana, Saad; Gupta, Deepnarayan

    Digital superconductor electronics has been experiencing rapid maturation with the emergence of smaller-scale, lower-cost communications applications which became the major technology drivers. These applications are primarily in the area of wireless communications, radar, and surveillance as well as in imaging and sensor systems. In these areas, the fundamental advantages of superconductivity translate into system benefits through novel Digital-RF architectures with direct digitization of wide band, high frequency radio frequency (RF) signals. At the same time the availability of relatively small 4K cryocoolers has lowered the foremost market barrier for cryogenically-cooled digital electronic systems. Recently, we have achieved a major breakthrough in the development, demonstration, and successful delivery of the cryocooled superconductor digital-RF receivers directly digitizing signals in a broad range from kilohertz to gigahertz. These essentially hybrid-technology systems combine a variety of superconductor and semiconductor technologies packaged with two-stage commercial cryocoolers: cryogenic Nb mixed-signal and digital circuits based on Rapid Single Flux Quantum (RSFQ) technology, room-temperature amplifiers, FPGA processing and control circuitry. The demonstrated cryocooled digital-RF systems are the world's first and fastest directly digitizing receivers operating with live satellite signals in X-band and performing signal acquisition in HF to L-band at ˜30GHz clock frequencies.

  1. Eosinophils increase in animals that received biotherapic

    Directory of Open Access Journals (Sweden)

    Pedro Gilberto Silva Morais

    2012-12-01

    Full Text Available Dairy industry is an important Brazilian economic activity participating of income generation. European breeds cattle aren’t adapted to parasites found in the tropics, like the Rhipicephalus microplus tick. Parasites can acquire resistance to allopathic products, but not to homeopathic products. We evaluate the efficacy of an antiparasiticide biotherapic against the R. microplus tick. The biotherapic was prepared according to the homeopathic pharmacopoeia recommendations from vegetable (Abrotanum and animal products (Rhipicephalus microplus, Amblyomma cajenennense, Haematobia irritans, Musca domestica, Dermatobia hominis, all diluted and vigorous shaken (dynamized in water or alcohol at a ratio of 1:99, in the 12th Centesimal Hahnemann (CH12, with limestone as the carrier. This homeophatic product found in veterinary pharmacies of Ituiutaba’s region, Minas Gerais State, is registered at Ministério da Agricultura, Pecuária e Abastecimento (MAPA. Natural tick infestation was accessed in thirty Girolando (Gir x Holstein cows with 7 to 13 year-old, by monthly counting of tick female bigger than 6 mm, from October/2009 to July/2011. Cows were divided in three groups of 10 similar animals. The treated group (T1 received roughage, concentrate and biotherapic. The placebo group (T2 received roughage, concentrate and limestone and the control group (T3 received only roughage and concentrate. T1 and T2 groups were managed together and remained in the same paddock. T3 group was separed from T1 and T2 by a wire fence. From October 2009 to September 2010 blood cell counts and serum biochemical tests were performed monthly only in T1 and T2, but visual clinical observations were made in all animals. Any group was treated with acaricide when the count’s average reached 50 or more ticks. It was necessary 7 baths with acaricide in T1 and T2, while in T3 group (control group it was necessary 19 acaricide baths to control the cattle tick. We verified

  2. Radioactive contamination in monitors received for calibration

    International Nuclear Information System (INIS)

    Dias, Paulo S.; Santos, Gilvan C. dos; Brunelo, Maria Antonieta G.; Paula, Tiago C. de; Pires, Marina A.; Borges, Jose C.

    2013-01-01

    The Calibration Laboratory - LABCAL, from the Research Center for Metrology and Testing - METROBRAS, MRA Comercio de Instrumentos Eletronicos Ltda., began activities in October 2008 and, in August 2009, decided to establish a procedure for monitoring tests, external and internal, of all packages received from customers, containing instruments for calibration. The aim was to investigate possible contamination radioactive on these instruments. On July 2011, this procedure was extended to packagings of personal thermoluminescent dosemeters - TLD, received by the newly created Laboratory Laboratorio de Dosimetria Pessoal - LDP . In the monitoring procedure were used monitors with external probe, type pancake, MRA brand, models GP - 500 and MIR 7028. During the 37 months in which this investigation was conducted, were detected 42 cases of radioactive contamination, with the following characteristics: 1) just one case was personal dosimeter, TLD type; 2) just one case was not from a packing from nuclear medicine service - was from a mining company; 3) contamination occurred on packs and instruments, located and/or widespread; 4) contamination values ranged from slightly above the level of background radiation to about a thousand fold. Although METROBRAS has facilities for decontamination, in most cases, especially those of higher contamination, the procedure followed was to store the contaminated material in a room used for storage of radioactive sources. Periodically, each package and/or instrument was monitored, being released when the radiation level matched the background radiation. Every contamination detected, the client and/or owner of the instrument was informed. The Brazilian National Energy Commission - CNEN, was informed, during your public consultation for reviewing the standard for nuclear medicine services, held in mid-2012, having received from METROBRAS the statistical data available at the time. The high frequency of contamination detected and the high

  3. Signal Processing for Improved Wireless Receiver Performance

    DEFF Research Database (Denmark)

    Christensen, Lars P.B.

    2007-01-01

    This thesis is concerned with signal processing for improving the performance of wireless communication receivers for well-established cellular networks such as the GSM/EDGE and WCDMA/HSPA systems. The goal of doing so, is to improve the end-user experience and/or provide a higher system capacity...... by allowing an increased reuse of network resources. To achieve this goal, one must first understand the nature of the problem and an introduction is therefore provided. In addition, the concept of graph-based models and approximations for wireless communications is introduced along with various Belief...... Propagation (BP) methods for detecting the transmitted information, including the Turbo principle. Having established a framework for the research, various approximate detection schemes are discussed. First, the general form of linear detection is presented and it is argued that this may be preferable...

  4. The BINP receives its Golden Hadron award

    CERN Multimedia

    2002-01-01

    On Thursday, 14 September, the LHC Project Leader, Lyn Evans, handed over a Golden Hadron award to Alexander Skrinsky of Russia's Budker Institute of Nuclear Physics (BINP). The prize is awarded in recognition of exceptional performances by suppliers and this year prizes were awarded to two firms, Cockerill-Sambre (Belgium) and Wah-Chang (United States), and to the Budker Institute, which was unable to receive the award at the same time as the two other recipients (see Bulletin No 34/2002, of 19 August 2002). The Russian institute has been rewarded for the particularly high-quality production of 360 dipole magnets and 185 quadrupole magnets for the LHC proton beam transfer lines.

  5. Humboldt SK pilot biodigester receives funding

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    2005-09-30

    The Canada-Saskatchewan Western Economic Partnership Agreement (WEPA) will provide funding for Canada's first pilot-scale biodigester to be built in Humboldt, Saskatchewan. The $208,138 pilot facility will use household garbage as well as agricultural waste such as manure and livestock operations, abattoirs and food processing to create heat or power and fertilizer. Support for this bio-energy facility, which could also reduce greenhouse gases, will come from the Prairie Agricultural Machinery Institute which has received $186,138 from Canada and Saskatchewan in the form of cost-shared federal-provincial funding. The pilot plant will test different combinations of waste material feedstocks and the characteristics of the resulting gas end products. The pilot facility will also provide design information for full-scale biodigester manufacturers in Canada. It is expected that 25 full-scale biodigesters will be constructed in Canada in the near future.

  6. Receiver based PAPR reduction in OFDMA

    KAUST Repository

    Ali, Anum Z.; Al-Zahrani, Ali Y.; Al-Naffouri, Tareq Y.; Naguib, Ayman F.

    2014-01-01

    High peak-to-average power ratio is one of the major drawbacks of orthogonal frequency division multiplexing (OFDM). Clipping is the simplest peak reduction scheme, however, it requires clipping mitigation at the receiver. Recently compressed sensing has been used for clipping mitigation (by exploiting the sparse nature of clipping signal). However, clipping estimation in multi-user scenario (i.e., OFDMA) is not straightforward as clipping distortions overlap in frequency domain and one cannot distinguish between distortions from different users. In this work, a collaborative clipping removal strategy is proposed based on joint estimation of the clipping distortions from all users. Further, an effective data aided channel estimation strategy for clipped OFDM is also outlined. Simulation results are presented to justify the effectiveness of the proposed schemes. © 2014 IEEE.

  7. Fast digitization and digital receiver technology

    International Nuclear Information System (INIS)

    Kimball, Ralph C.

    2002-01-01

    The potentially lucrative wireless market has led to technological advances in mixed signal devices such as high speed, high resolution A/D and D/A converters. This same market has also driven the development of high performance multi-channel digital receiver and digital transmitter ICs. Similarly, advances in semiconductor processes, coupled with the need for reduced time-to-market, has led to the development of large, enhanced performance, in-circuit programmable logic devices. A review of the key characteristics of these mixed-signal, signal processing and programmable logic devices is presented. The application of these devices and technologies to the instrumentation of Accelerators and Storage Rings is discussed and presented by way of examples. Issues relating to the requirements associated with real-time processing, I/O throughput, reconfigurability, reliability, maintainability and packaging requirements are also addressed

  8. Morel Receives 2005 Maurice Ewing Medal

    Science.gov (United States)

    Schrag, Daniel P.; Morel, François M. M.

    2006-02-01

    François M. M. Morel received the Ewing Medal at the AGU Fall Meeting Honors Ceremony, which was held on 7 December 2005, in San Francisco, Calif. The medal is given for significant original contributions to the scientific understanding of the processes in the ocean; for the advancement of oceanographic engineering, technology, and instrumentation; and for outstanding service to marine sciences. François Morel has led the search to understand the role of metals in the ocean, starting with a focus on inorganic processes and aquatic chemistry, and leading to a blend of geochemistry, microbiology, biochemistry, and genetics. His influence comes from his research and from the way he has educated an entire community of scientists with his textbooks, with his teaching, and through his former students and postdocs who hold faculty positions at universities throughout the world.

  9. Receiver operator characteristic (ROC) analysis without truth

    International Nuclear Information System (INIS)

    Henkelman, R.M.; Kay, I.; Bronskill, M.J.

    1990-01-01

    Receiver operator characteristic (ROC) analysis, the preferred method of evaluating diagnostic imaging tests, requires an independent assessment of the true state of disease, which can be difficult to obtain and is often of questionable accuracy. A new method of analysis is described which does not require independent truth data and which can be used when several accurate tests are being compared. This method uses correlative information to estimate the underlying model of multivariate normal distributions of disease-positive and disease-negative patients. The method is shown to give results equivalent to conventional ROC analysis in a comparison of computed tomography, radionuclide scintigraphy, and magnetic resonance imaging for liver metastasis. When independent truth is available, the method can be extended to incorporate truth data or to evaluate the consistency of the truth data with the imaging data

  10. Received View of Addiction, Relapse and Treatment.

    Science.gov (United States)

    Ndasauka, Yamikani; Wei, Zhengde; Zhang, Xiaochu

    2017-01-01

    It is important to highlight that attempts at understanding and explaining addiction have been made for centuries. It is, however, just five decades ago, with the growth of science and technology that more interest has been observed in this field. This chapter examines different views and theories that have been posited to understand and explain addiction. More attention will be given to prominent views that seem to draw consensus among researchers and medical practitioners. The first section of the chapter introduces the addiction debate, the different theories that have been provided to explain it from different perspectives and disciplines such as neurosciences, philosophy and psychology. Then, the chapter discusses different views on the role of relapse and what it entails in understanding addiction. The second section discusses different proposed and used forms of treating addiction. Thus, the chapter discusses the received view of addiction, the understanding of relapse as a critical element in addiction and treatments.

  11. MRI in children receiving total parenteral nutrition

    International Nuclear Information System (INIS)

    Quaghebeur, G.; Taylor, W.J.; Kingsley, D.P.E.; Fell, J.M.E.; Reynolds, A.P.; Milla, P.J.

    1996-01-01

    Cranial MRI was obtained in 13 of a group of 57 children receiving long-term parenteral nutrition, who were being investigated for hypermanganasaemia. Increased signal intensity on T1-weighted images has been reported in adult patients on long-term parenteral nutrition and with encephalopathy following chronic manganese exposure in arc welding. It has been postulated that these changes are due to deposition of the paramagnetic trace element manganese. In excess manganese is hepato- and neurotoxic and we present the correlation of whole blood manganese levels with imaging findings. The age range of our patients was 6 months to 10 years, and the duration of therapy 3 months to 10 years. In 7 children we found characteristic increased signal intensity on T1-weighted images, with no abnormality on T2-weighted images. All patients had elevated whole blood manganese levels, suggesting that the basis for this abnormality is indeed deposition of manganese within the tissues. (orig.). With 3 figs

  12. New Packing Structure of Concentration Solar Receiver

    International Nuclear Information System (INIS)

    Tsai, Shang-Yu; Lee, Yueh-Mu; Shih, Zun-Hao; Hong, Hwen-Fen; Shin, Hwa-Yuh; Kuo, Cherng-Tsong

    2010-01-01

    This paper presents a solution to the temperature issue in High Concentration Photovoltaic (HCPV) module device by using different thermal conductive material and packing structure. In general, the open-circuited voltage of a device reduces with the increase of temperature and therefore degrades its efficiency. The thermal conductive material we use in this paper, silicon, has a high thermal conductive coefficient (149 W/m·K) and steady semiconductor properties which are suitable for the application of solar receiver in HCPV module. Solar cell was soldered on a metal-plated Si substrate with a thicker SiO 2 film which acts as an insulating layer. Then it was mounted on an Al-based plate to obtain a better heat dissipating result.

  13. Receiver based PAPR reduction in OFDMA

    KAUST Repository

    Ali, Anum Z.

    2014-05-01

    High peak-to-average power ratio is one of the major drawbacks of orthogonal frequency division multiplexing (OFDM). Clipping is the simplest peak reduction scheme, however, it requires clipping mitigation at the receiver. Recently compressed sensing has been used for clipping mitigation (by exploiting the sparse nature of clipping signal). However, clipping estimation in multi-user scenario (i.e., OFDMA) is not straightforward as clipping distortions overlap in frequency domain and one cannot distinguish between distortions from different users. In this work, a collaborative clipping removal strategy is proposed based on joint estimation of the clipping distortions from all users. Further, an effective data aided channel estimation strategy for clipped OFDM is also outlined. Simulation results are presented to justify the effectiveness of the proposed schemes. © 2014 IEEE.

  14. IAEA receives Iraq's nuclear-related declaration

    International Nuclear Information System (INIS)

    2002-01-01

    Full text: The Director General of the International Atomic Energy Agency, Mohamed ElBaradei, announced that the IAEA received this evening, Sunday, 8 December 2002, at its Headquarters in Vienna, an approximately 2400 page declaration on Iraq's nuclear programme. The declaration consists of about 2100 pages in English and 300 pages in Arabic. The declaration was submitted by the Government of Iraq in response to paragraph 3 of Security Council resolution 1441 (8 November 2002), which requires Iraq to provide to UNMOVIC, the IAEA and to the Security Council, not later than 30 days of the date of that resolution, with 'currently accurate, full, and complete declaration of all aspects of its programmes to develop chemical, biological, and nuclear weapons, ballistic missiles, and other delivery systems... as well as all other chemical, biological, and nuclear programmes, including any which it claims are for purposes not related to weapon production or material'. 'The IAEA will immediately begin to assess this important new document,' said Mr. ElBaradei, 'including the painstaking and systematic cross-checking of the information provided by Iraq against information which the IAEA already has, information that it expects to receive from other Member States, as contemplated in resolution 1441, and results of past and present Agency verification activities.' Complete assessment of the declaration will be time consuming, particularly in light of the need to translate the 300 pages of Arabic text into English. However, the IAEA expects to be able to provide a preliminary analysis of the document to the Security Council within the next ten days, with a fuller assessment to be provided when it reports to the Council at the end of January. (IAEA)

  15. Transmit-receive eddy current probes

    International Nuclear Information System (INIS)

    Obrutsky, L.S.; Sullivan, S.P.; Cecco, V.S.

    1997-01-01

    In the last two decades, due to increased inspection demands, eddy current instrumentation has advanced from single-frequency, single-output instruments to multifrequency, computer-aided systems. This has significantly increased the scope of eddy current testing, but, unfortunately, it has also increased the cost and complexity of inspections. In addition, this approach has not always improved defect detectability or signal-to-noise. Most eddy current testing applications are still performed with impedance probes, which have well known limitations. However, recent research at AECL has led to improved eddy current inspections through the design and development of transmit-receive (T/R) probes. T/R eddy current probes, with laterally displaced transmit and receive coils, present a number of advantages over impedance probes. They have improved signal-to-noise ratio in the presence of variable lift-off compared to impedance probes. They have strong directional properties, permitting probe optimization for circumferential or axial crack detection, and possess good phase discrimination to surface defects. They can significantly increase the scope of eddy current testing permitting reliable detection and sizing of cracks in heat exchanger tubing as well as in welded areas of both ferritic and non-ferromagnetic components. This presentation will describe the operating principles of T/R probes with the help of computer-derived normalized voltage diagrams. We will discuss their directional properties and analyze the advantages of using single and multiple T/R probes over impedance probes for specific inspection cases. Current applications to surface and tube testing and some typical inspection results will be described. (author)

  16. Full-wave receiver architecture for the homodyne motion sensor

    Science.gov (United States)

    Haugen, Peter C; Dallum, Gregory E; Welsh, Patrick A; Romero, Carlos E

    2013-11-19

    A homodyne motion sensor or detector based on ultra-wideband radar utilizes the entire received waveform through implementation of a voltage boosting receiver. The receiver includes a receiver input and a receiver output. A first diode is connected to the receiver output. A first charge storage capacitor is connected from between the first diode and the receiver output to ground. A second charge storage capacitor is connected between the receiver input and the first diode. A second diode is connected from between the second charge storage capacitor and the first diode to ground. The dual diode receiver performs voltage boosting of a RF signal received at the receiver input, thereby enhancing receiver sensitivity.

  17. Full-wave receiver architecture for the homodyne motion sensor

    Energy Technology Data Exchange (ETDEWEB)

    Haugen, Peter C.; Dallum, Gregory E.; Welsh, Patrick A.; Romero, Carlos E.

    2015-09-29

    A homodyne motion sensor or detector based on ultra-wideband radar utilizes the entire received waveform through implementation of a voltage boosting receiver. The receiver includes a receiver input and a receiver output. A first diode is connected to the receiver output. A first charge storage capacitor is connected from between the first diode and the receiver output to ground. A second charge storage capacitor is connected between the receiver input and the first diode. A second diode is connected from between the second charge storage capacitor and the first diode to ground. The dual diode receiver performs voltage boosting of a RF signal received at the receiver input, thereby enhancing receiver sensitivity.

  18. Phase Noise Tolerant QPSK Receiver Using Phase Sensitive Wavelength Conversion

    DEFF Research Database (Denmark)

    Da Ros, Francesco; Xu, Jing; Lei, Lei

    2013-01-01

    A novel QPSK receiver based on a phase noise reduction pre-stage exploiting PSA in a HNLF and balanced detection is presented. Receiver sensitivity improvement over a conventional balanced receiver is demonstrated.......A novel QPSK receiver based on a phase noise reduction pre-stage exploiting PSA in a HNLF and balanced detection is presented. Receiver sensitivity improvement over a conventional balanced receiver is demonstrated....

  19. The stability of a terahertz receiver based on a superconducting integrated receiver

    International Nuclear Information System (INIS)

    Ozhegov, R V; Gorshkov, K N; Gol'tsman, G N; Kinev, N V; Koshelets, V P

    2011-01-01

    We present the results of stability testing of a terahertz radiometer based on a superconducting receiver with a SIS tunnel junction as the mixer and a flux-flow oscillator as the local oscillator. In the continuum mode, the receiver with a noise temperature of 95 K at 510 GHz measured over the intermediate frequency (IF) passband of 4-8 GHz offered a noise equivalent temperature difference of 10 ± 1 mK at an integration time of 1 s. We offer a method to significantly increase the integration time without the use of complex measurement equipment. The receiver observed a strong signal over a final detection bandwidth of 4 GHz and offered an Allan time of 5 s.

  20. The stability of a terahertz receiver based on a superconducting integrated receiver

    Energy Technology Data Exchange (ETDEWEB)

    Ozhegov, R V; Gorshkov, K N; Gol' tsman, G N [Department of Physics, Moscow State Pedagogical University, Moscow 119992 (Russian Federation); Kinev, N V; Koshelets, V P, E-mail: Ozhegov@rplab.ru [Institute of Radio Engineering and Electronics, 125009 Moscow (Russian Federation)

    2011-03-15

    We present the results of stability testing of a terahertz radiometer based on a superconducting receiver with a SIS tunnel junction as the mixer and a flux-flow oscillator as the local oscillator. In the continuum mode, the receiver with a noise temperature of 95 K at 510 GHz measured over the intermediate frequency (IF) passband of 4-8 GHz offered a noise equivalent temperature difference of 10 {+-} 1 mK at an integration time of 1 s. We offer a method to significantly increase the integration time without the use of complex measurement equipment. The receiver observed a strong signal over a final detection bandwidth of 4 GHz and offered an Allan time of 5 s.

  1. Apparatus for delivering and receiving radioactive gas

    International Nuclear Information System (INIS)

    Dansky, B.; Epifano, L.; Farella, R.

    1980-01-01

    An apparatus for delivering and receiving gas to and from a patient, such as for lung ventilation studies. In accordance with the invention there is provided a restrictive breathing chamber adapted for coupling to the patient's breathing organs. A system, including a first check valve, is provided for coupling the breathing chamber to an inflatable gas receptacle so as to allow flow only toward the inflatable gas receptacle. Active gas input apparatus, including a second check valve, is also coupled to the breathing chamber, the second check valve allowing flow only toward the breathing chamber means. First and second auxiliary tubes and a gas filter are also provided. A system is provided for coupling the first auxiliary tube from the inflatable receptacle through the gas filter and to an ambient air environment. The second auxiliary tube is coupled from the inflatable receptacle to an ambient air environment. Finally, a gas pump is switchably coupled as between the first and second auxiliary tubes and operative to selectively cause gas flow in the first auxiliary tube toward the ambient environment, and in the second auxiliary tube toward the inflatable receptacle. A gas trap structure is also disclosed

  2. Patrick Janot receives the CNRS silver medal

    CERN Multimedia

    2005-01-01

    Patrick Janot during the award ceremony. (Photo Schwemling, Paris) On 25 November, Patrick Janot of the CERN Physics Department received the CNRS silver medal for IN2P3 (Institut national de physique nucléaire et de physique des particules). This prize, one of the most prestigious awarded by the French research centre, is given to scientists for the 'originality, quality and importance of their work, as recognised both nationally and internationally'. Patrick Janot joined the ALEPH collaboration, one of the four experiments at LEP, then under construction, in 1987. First a CERN Fellow, he went on to work for the CNRS at LAL in 1989. Together with his team, he developed innovative algorithms for the reconstruction of events. This work and others earned him the bronze CNRS medal in 1993, which is awarded to scientists for their first achievements. In 1997, he became a permanent physicist at CERN, where he continued to work for ALEPH. He was appointed LEP scientific co-ordinator for the last two years of the ac...

  3. CERN safety expert receives international award

    CERN Multimedia

    2005-01-01

    On 18 December 2004, the President of the Swiss Electro-technical Committee, Martin Reichle (left), presented the award to Helmut Schönbacher. Helmut Schönbacher, of the Safety Commission at CERN, has received, the "1906 Award" of the International Electrotechnical Commission (IEC) for his standardisation work on the influence of ionizing radiation on insulating materials. From 1986 until 2004, Schönbacher was leader of a working group on radiation composed of internationally recognised experts. It edited standards of the IEC 60544 series on the determination of the effects of ionizing radiation on electrical insulating materials. The working group also edited three IEC Technical Reports on the determination of long-term radiation ageing in polymers. This standardisation work and long-term experience from CERN on the radiation ageing of materials also contributed to research coordination programmes of the International Atomic Energy Agency (IAEA). From 1968 until 1988, Schönbacher was a member of the Rad...

  4. Paterson Receives 2004 Walter H. Bucher Medal

    Science.gov (United States)

    Jackson, Ian

    2005-01-01

    Mervyn S. Paterson received the Bucher Medal at the 2004 Fall Meeting Honors Ceremony on 15 December, in San Francisco, California. The medal is given for original contributions to the basic knowledge of the crust and lithosphere. Citation. It is the nature of modern research in the Earth sciences that observations of natural phenomena are often made and interpreted through the prism provided by the enabling sciences and technologies. Thus it has been with Mervyn Paterson's career. His undergraduate training in engineering in Adelaide formed the basis for his Ph.D. study of X-ray line-broadening in cold-worked metals under Orowan at Cambridge. This interest in the deformation of metals was fostered during his employment at the Aeronautical Research Laboratories in Melbourne and by postdoctoral experience at the Institute of Metals at the University of Chicago. Mervyn's general background in engineering and his particular interest in mechanical behavior have underpinned a distinguished career at the Australian National University in the experimental deformation of rocks, providing fundamental new insight into the mechanical behavior of the Earth's crust.

  5. Every second cancer patient receives radiotherapy

    International Nuclear Information System (INIS)

    Ojala, A.

    1996-01-01

    Radiotherapy to treat cancer was given for the first time exactly one hundred years ago. Today, radiotherapy and surgery are the two main modes of treating cancer. One in two cancer patients receives radiotherapy at some point during the course of treatment for the disease. Radiotherapy is applied most commonly in cases where surgery is not possible. Moreover, these two modes of treatment are often used together to supplement each other. About half of new cancer cases detected today can be ordered. The estimate given by the EU for cancers cured is 45 per cent, which is divided between the various treatment modes as follows: surgery 22 %, radiotherapy 12 %, surgery plus radiotherapy 6 %, and drug therapy 6 %. In addition to curative treatment, radiotherapy plays a crucial role in palliative treatment, i.e. treatment that alleviates symptoms. The sensitivity of malignant tumours to radiotherapy varies over a wide range; the same is true for healthy tissues. Radiotherapy can only be used to cure a tumour that is more sensitive to radiation than the surrounding healthy tissue. The tumour must also be sufficiently small in size and limited to a relatively small area. (orig.)

  6. Design and simulation analysis of non-receiver aware and receiver ...

    African Journals Online (AJOL)

    We present multicast extensions to our recently proposed Location Prediction Based Routing (LPBR) protocol, referred to as NR-MLPBR and R-MLPBR, to simultaneously reduce the number of multicast tree discoveries and number of links per tree and/or the hop count per source-receiver path in mobile ad hoc networks ...

  7. Qualification test for the flexible receiver

    International Nuclear Information System (INIS)

    Keller, C.M.

    1994-01-01

    This document provides the test plan and procedures to certify and design verify the 42 inch and 4--6 inch Flexible Receiver (FR) is a safety class 3 system. Verification of the design will be handled in two parts. The first part will be to show that it meets design requirements set forth by documents and the second part will perform test(s) to verify its operational aspects. To qualify the design of the FR systems for field use this test will demonstrate environmentally safe removal of a Tank Farm pump mock-up from a Tank Farm riser mock-up. Testing will also demonstrate the performance of supporting equipment. The FR and the Secondary Bagging (SB) equipment shall be tested to verify successful operation of the equipment to the following criteria: The FR can be placed on a riser and connections made to the supporting equipment; The FR bag can accept equipment and be successfully sealed; The SB system encases the seal of the primary FR bag; The flexible bag(s) do not tear and maintain integrity during the entire test; The FR control system operates in the fail safe forced sequence mode; The FR control system will operate in the manual override mode (out of sequence operations); The CCTV Video system monitors and records the removal of the test item; The spray wash system operates without leaks and effectively provides coverage; The item being removed can be reinserted to a depth of 8 feet and the bag reinstalled onto the vertical bag supports; and The system prohibits momentary mechanical fluctuations due to the application of system power, including power interruptions

  8. Crustal Structure beneath Alaska from Receiver Functions

    Science.gov (United States)

    Zhang, Y.; Li, A.

    2017-12-01

    The crustal structure in Alaska has not been well resolved due to the remote nature of much of the state. The USArray Transportable Array (TA), which is operating in Alaska and northwestern Canada, significantly increases the coverage of broadband seismic stations in the region and allows for a more comprehensive study of the crust. We have analyzed P-receiver functions from earthquake data recorded by 76 stations of the TA and AK networks. Both common conversion point (CCP) and H-K methods are used to estimate the mean crustal thickness. The results from the CCP stacking method show that the Denali fault marks a sharp transition from thick crust in the south to thin crust in the north. The thickest crust up to 52 km is located in the St. Elias Range, which has been formed by oblique collision between the Yakutat microplate and North America. A thick crust of 48 km is also observed beneath the eastern Alaska Range. These observations suggest that high topography in Alaska is largely compensated by the thick crust root. The Moho depth ranges from 28 km to 35 km beneath the northern lowlands and increases to 40-45 km under the Books Range. The preliminary crustal thickness from the H-K method generally agrees with that from the CCP stacking with thicker crust beneath high mountain ranges and thinner crust beneath lowlands and basins. However, the offshore part is not well constrained due to the limited coverage of stations. The mean Vp/Vs ratio is around 1.7 in the Yukon-Tanana terrane and central-northern Alaska. The ratio is about 1.9 in central and southern Alaska with higher values at the Alaska Range, Wrangell Mountains, and St. Elias Range. Further data analyses are needed for obtaining more details of the crustal structure in Alaska to decipher the origin and development of different tectonic terranes.

  9. Hypoglycaemia monitoring in a medical receiving ward.

    Science.gov (United States)

    Ellis, Ryan

    2015-01-01

    It has been suggested that current care for diabetes inpatients remains inadequate and that greater attention is required for high quality management. In this project the aspect of hypoglycaemia was studied in a busy medical receiving ward at the Glasgow Royal Infirmary. A large proportion of inpatients have diabetes and episodes of hypoglycaemia experienced by this population can delay discharge and indeed be detrimental to health. Thus it is important from both an organisational and patient perspective to manage this population well. In this project BM machine data was analysed to identify patients who were hypoglycaemic. These patients were then tracked down to study the subsequent management and compared this against recommended guidance. Following this an intervention was made to promote identification, management, documentation, and prevention of hypoglycaemia. This was deliberately a simple intervention involving discussions with staff and provision of basic documented guidance next to every BM machine. In the first phase 17 patients were identified and in a second and third phase 16 patients each time were further identified. Patients in the study were both type 1 and type 2 diabetics. Initial results in phase I were compared to results in phase II and III respectively. This intervention produced significant improvements in management with correct monitoring of low BMs (i.e. upon identification of low BM repeat within 1 hour) improving from 47% to 100% (for Phase II and III). Also, recording of preventative measures of hypoglycaemia improved from 35% to 88% and 94% with an improvement from 24% to 69% and 75% in recording of treatment given if needed. In conclusion, the study successfully demonstrated that simple measures can significantly improve the quality care of inpatient diabetic patients in relation to hypoglycaemia management.

  10. Investigation of the receivability of VLF standard time and frequency ...

    African Journals Online (AJOL)

    This study is on the receivability of some standard time and frequency signals in the VLF range in Zaria, Nigeria. Signal field strengths of various stations were estimated, and a suitable radio receiving system was set up to receive them. Using the assembled receiver, some of the transmissions, including the Omega W/L at ...

  11. 37 CFR 1.412 - The United States Receiving Office.

    Science.gov (United States)

    2010-07-01

    ... Information § 1.412 The United States Receiving Office. (a) The United States Patent and Trademark Office is a Receiving Office only for applicants who are residents or nationals of the United States of America. (b) The... “United States Receiving Office” or by the abbreviation “RO/US.” (c) The major functions of the Receiving...

  12. Superior Coherent Receivers for AF Relaying with Distributed Alamouti Code

    KAUST Repository

    Khan, Fahd Ahmed

    2012-01-01

    Coherent receivers are derived for a pilot-symbol aided distributed Alamouti-coded system with imperfect channel state information. The derived coherent receivers do not perform channel estimation but rather use the received pilot signals for decoding. The derived receiver metrics use the statistics of the channel to give improved performance. The performance is further improved by using the decision history. Simulation results show that a performance gain of up to 1.8 dB can be achieved for the new receivers with decision history as compared with the conventional mismatched coherent receiver. © 2011 IEEE.

  13. FFT Based VLSI Digital One Bit Electronic Warfare Receiver

    National Research Council Canada - National Science Library

    Chien-In, Henry

    1998-01-01

    ... (1 GHz) digital receiver designed for electronic warfare applications. The receiver can process two simultaneous signals and has the potential for fabrication on a single multi-chip module (MCM...

  14. A Correlating Receiver for OFDM at Low SNR

    NARCIS (Netherlands)

    Kokkeler, Andre B.J.; Smit, Gerardus Johannes Maria

    By extending OFDM symbols, acceptable BER performance can be achieved at low SNRs. Two alternative differential receiver architectures are presented, a receiver based on a FX correlator (Fourier transformation before correlation) and based on an XF correlator (correlation before Fourier

  15. Initial results for compressive sensing in electronic support receiver systems

    CSIR Research Space (South Africa)

    Du Plessis, WP

    2011-04-01

    Full Text Available determined by the antenna and microwave system comprising the transmitter and receiver, while the instantaneous bandwidth is mainly determined by the Analog-to-Digital Converter (ADC) in the receiver. A radar can thus operate at any frequency within its... Electronic/Electromagnetic Support Measures (ESM) was used historically [1], [2]. Modern ES receiver systems are based on digital receivers allowing powerful signal processing techniques to be used [3], [4]. Recent developments in sampling technology...

  16. 20 CFR 404.1042 - Wages when paid and received.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Wages when paid and received. 404.1042... DISABILITY INSURANCE (1950- ) Employment, Wages, Self-Employment, and Self-Employment Income Wages § 404.1042 Wages when paid and received. (a) In general. Wages are received by an employee at the time they are...

  17. 5 CFR 551.425 - Time spent receiving medical attention.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Time spent receiving medical attention... Relation to Other Activities § 551.425 Time spent receiving medical attention. (a) Time spent waiting for and receiving medical attention for illness or injury shall be considered hours of work if: (1) The...

  18. THE CORRELATED TRACK RECEIVER OF TONE TRACK CIRCUITS

    Directory of Open Access Journals (Sweden)

    K. V. Goncharov

    2011-05-01

    Full Text Available The work is devoted to further improvement of processing algorithm of checking signals of rail line. The simulation modeling of correlation track receiver of tone rail circuits has been executed; the benchmark analysis of correlation receiver and direct amplifier receiver has been executed.

  19. Noise and intercept point calculation for modern radio receiver planning

    DEFF Research Database (Denmark)

    Iversen, Christian Rye; Kolding, T. E.

    2001-01-01

    The paper presents analytical expressions for determining noise and intercept points for cascaded radio receiver stages. The theory allows for active receiver stages with frequency selectivity and flexible impedance levels. This makes the method highly usable for planning of modem receivers where...

  20. IMPROVEMENT WAYS OF ACCOUNTING AND INTERNAL AUDIT OF ENTERPRISE RECEIVABLES

    Directory of Open Access Journals (Sweden)

    V. D. Zelikman

    2014-06-01

    Full Text Available Purpose. Determination and substantiation of ways to improve accounting and internal audit of receivables at the enterprises. Methodology.The basic principles and ways for improvement of accounting and internal audit systems that should help Ukrainian enterprises to optimize receivables are considered. Findings. It is proved that the receivables optimization is possible on the basis of improving its accounting and internal audit. The basic ways for improvement of accounting and internal audit of receivable are determined. They are: improvement of normative coverage of receivables at the enterprises; providing further harmonization of financial and tax accounting in the part of formation of the doubtful debt receivables, accounting of bad and doubtful receivables and etc. The formation of department for internal audit to control the doubtful and bad debts; providing the timely control of the receivables and payables ratio; determination and support of the optimal value of the receivables at the enterprises. Originality. Improvement of accounting and internal audit of receivables at the enterprises by the way of development of internal audit system and optimization of the receivables size. Practical value. The proposed recommendations will improve the accounting and internal audit system of receivables at the enterprises of Ukraine.

  1. 75 FR 26843 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2010-05-12

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of any petition or its final disposition. DATES: Comments on petitions received must...

  2. Communications Satellite Receiver Systems for Public Schools: A Technical Primer.

    Science.gov (United States)

    Texas Education Agency, Austin.

    Designed to aid school districts contemplating use of some of the telecommunications services now available by satellite, this document contains information on home satellite receiving dishes (Television Receive-Only--TVROs), which can receive radio signals carrying television, sound, and data. This information includes: some factors involved in…

  3. Communications/Electronics Receiver Performance Degradation Handbook (Second Edition)

    Science.gov (United States)

    1975-08-01

    receiver to another in the Rf and IF filter characteristics modify the transfer of inter- forence power through the receiver to the IF output, and so the...modulation system the transmitted and received messages arce in general different bemaus* of small inte, forence or noise perturbations. The probability of

  4. 33 CFR 17.01-10 - Authority to receive gifts.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Authority to receive gifts. 17.01... GENERAL UNITED STATES COAST GUARD GENERAL GIFT FUND General Provisions § 17.01-10 Authority to receive gifts. (a) The Commandant, United States Coast Guard, may accept, receive, hold, or administer gifts...

  5. Sideband ratio in double sideband receivers with a Michelson interferometer

    NARCIS (Netherlands)

    Romanini, M.; Baryshev, A. M.; Hesper, R.; Mena, F. P.; Wild, W.

    2007-01-01

    Terahertz heterodyne receivers typically use double sideband (DSB) mixers. The precise knowledge of the receiver sideband ratio (SBR) is a fundamental requirement for the calibration of the data taken with this type of receivers. At the moment the spectroscopic techniques developed for submillimeter

  6. BPSK Receiver Based on Recursive Adaptive Filter with Remodulation

    Directory of Open Access Journals (Sweden)

    N. Milosevic

    2011-12-01

    Full Text Available This paper proposes a new binary phase shift keying (BPSK signal receiver intended for reception under conditions of significant carrier frequency offsets. The recursive adaptive filter with least mean squares (LMS adaptation is used. The proposed receiver has a constant, defining the balance between the recursive and the nonrecursive part of the filter, whose proper choice allows a simple construction of the receiver. The correct choice of this parameter could result in unitary length of the filter. The proposed receiver has performance very close to the performance of the BPSK receiver with perfect frequency synchronization, in a wide range of frequency offsets (plus/minus quarter of the signal bandwidth. The results obtained by the software simulation are confirmed by the experimental results measured on the receiver realized with the universal software radio peripheral (USRP, with the baseband signal processing at personal computer (PC.

  7. Solar advanced internal film receiver; Receptor avanzado de pelicular interna

    Energy Technology Data Exchange (ETDEWEB)

    Torre Cabezas, M. de la

    1990-07-01

    In a Solar Central Internal Film Receiver, the heat absorbing fluid (a molten nitrate salt) flows in a thin film down over the non illuminated side of an absorber panel. Since the molten salt working fluid is not contained in complicated tube manifolds, the receiver design is simples than a conventional tube type-receiver resulting in a lower cost and a more reliable receiver. The Internal Film Receiver can be considered as an alternative to the Direct Absorption Receiver, in the event that the current problems of the last one can not be solved. It also describes here the test facility which will be used for its solar test, and the test plans foreseen. (Author) 17 refs.

  8. Ways to rational management of accounts receivable at enterprises

    Directory of Open Access Journals (Sweden)

    Yevtushenko N. O.

    2015-05-01

    Full Text Available This article investigated the principal reasons of management problems an account receivable of enterprises. Credit politics of management is worked out by an account receivable of enterprises. Essence of the stages of construction of rational management an account receivable of enterprises is exposed. In the article are exposed the basic elements of control system for an account receivable such as mission, aims, strategy as politics of management. The basic stages of management politics are described for an account receivable of enterprises: analysis; organization of forming of principles of credit politics, terms of delivery of credit and procedure of collection of accounts receivable; planning of the use of modern forms of refunding, and similarly control.

  9. Ultrabroadband Phased-Array Receivers Based on Optical Techniques

    Science.gov (United States)

    2016-02-26

    bandwidths, and with it receiver noise floors , are unavoidable. Figure 1. SNR of a thermally limited receiver based on Friis equation showing the...techniques for RF and photonic integration based on liquid crystal polymer substrates were pursued that would aid in the realization of potential imaging...These models assumed that sufficient LNA gain was used on the antenna to set the noise floor of the imaging receiver, which necessitated physical

  10. PENENTUAN RECEIVED DATE DENGAN LOAD-ORIENTED MANUFACRURING CONTROL

    Directory of Open Access Journals (Sweden)

    Sri Hartini

    2012-02-01

    Full Text Available Salah satu kunci kompetitif sebuah perusahaan make to order adalah ketepatan dalam pemenuhan waktu penerimaan pesanan pada konsumen yang telah dijanjikan perusahaan ( received date. Penentuan received date yang selama ini dilakukan oleh JI  kurang tepat karena hanya memperkirakan waktu sekitar 10 – 12 minggu tanpa mempertimbangkan faktor produksi. Penelitian ini merancang received date dengan model load-oriented manufacturing control dimana penentuan received date didasarkan pada perhitungan manufacturing lead time yang mempertimbangkan waktu pengiriman order ke konsumen, kapasitas yang tersedia pada tiap stasiun kerja, waktu proses pada stasiun kerja dan aliran produksi di lantai produksi. Hasil validasi perhitungan  penentuan received date order sesuai  dengan sistem produksi PT JI dan lebih valid dibanding sistem awal. Kata kunci : make to order, received date, manufacturing leadtime, load-oriented manufacturing control   One of the competitive key of a make to order company is the accuracy in fulfilling orders which has been promised by the company towards the consumers (received date. Determining received date which has been applied by JI recently is not sufficient because it only predicts 10-12 weeks of time without considering production factors. This research designs received date with load-oriented manufacturing control model where determining received date is based on calculating manufacturing lead time that considers the time needed to deliver orders to the consumer, capacity available for each work station, work station process time, and production flow within the production floor.  Validation results from the calculations for determining received date order is adjusted to PT JI  production system and is more valid than the first system. Keywords : make to order, received date, manufacturing leadtime, load-oriented manufacturing control

  11. Molecular Spectroscopy With a Compact 557-GHz Heterodyne Receiver

    DEFF Research Database (Denmark)

    Neumaier, Philipp F.-X.; Richter, Heiko; Stake, Jan

    2014-01-01

    We report on a heterodyne terahertz spectrometer based on a fully integrated 557-GHz receiver and a digital fast Fourier transform spectrometer. The receiver consists of a chain of multipliers and power amplifiers, followed by a heterostructure barrier varactor tripler that subharmonically pumps...... a membrane GaAs Schottky diode mixer. All sub-components are newly developed and optimized with regard to the overall receiver performance such as noise temperature, power consumption, weight and physical size. The receiver works at room temperature, has a double sideband noise temperature as low as 2000 K...

  12. List of documents received by the INDC Secretariat

    International Nuclear Information System (INIS)

    1987-09-01

    The Nuclear Data Section of the International Atomic Energy Agency receives documents originated by or for the International Nuclear Data Committee for distribution. This list includes all INDC documents received and distributed by the INDC Secretariat during the period January 1984 to March 1986. This list is produced directly from computer printout in two sorts: one ordered by accession number, and the other ordered by document number within each origin series (e.g. listing all INDC(SEC)-documents in one block). In addition to the INDC documents received by the INDC Secretariat for distribution, this document also lists the titles of reports received as single copies for information

  13. Personal monitoring and assessment of doses received by radiation workers

    International Nuclear Information System (INIS)

    Swindon, T.N.; Morris, N.D.

    1981-12-01

    The Personal Radiation Monitoring Service operated by the Australian Radiation Laboratory is outlined and the types of monitors used for assessment of doses received by radiation workers are described. The distribution of doses received by radiation workers in different occupational categories is determined. From these distributions, the average doses received have been assessed and the maximum likely additional increase in cancer deaths in Australia as a result of occupational exposure estimated. This increase is shown to be very small. There is, however, a considerable spread of doses received by individuals within occupational groups

  14. Frequency Estimator Performance for a Software-Based Beacon Receiver

    Science.gov (United States)

    Zemba, Michael J.; Morse, Jacquelynne Rose; Nessel, James A.; Miranda, Felix

    2014-01-01

    As propagation terminals have evolved, their design has trended more toward a software-based approach that facilitates convenient adjustment and customization of the receiver algorithms. One potential improvement is the implementation of a frequency estimation algorithm, through which the primary frequency component of the received signal can be estimated with a much greater resolution than with a simple peak search of the FFT spectrum. To select an estimator for usage in a QV-band beacon receiver, analysis of six frequency estimators was conducted to characterize their effectiveness as they relate to beacon receiver design.

  15. Accounting for Defense Logistics Agency Supply Management Receivables

    National Research Council Canada - National Science Library

    Lane, F

    1998-01-01

    .... For this part of the audit, we determined whether Defense Logistics Agency supply management receivables were accurately accounted for, classified, and reported in the Statement of Financial Position...

  16. Multi-DSP and FPGA based Multi-channel Direct IF/RF Digital receiver for atmospheric radar

    Science.gov (United States)

    Yasodha, Polisetti; Jayaraman, Achuthan; Kamaraj, Pandian; Durga rao, Meka; Thriveni, A.

    2016-07-01

    Modern phased array radars depend highly on digital signal processing (DSP) to extract the echo signal information and to accomplish reliability along with programmability and flexibility. The advent of ASIC technology has made various digital signal processing steps to be realized in one DSP chip, which can be programmed as per the application and can handle high data rates, to be used in the radar receiver to process the received signal. Further, recent days field programmable gate array (FPGA) chips, which can be re-programmed, also present an opportunity to utilize them to process the radar signal. A multi-channel direct IF/RF digital receiver (MCDRx) is developed at NARL, taking the advantage of high speed ADCs and high performance DSP chips/FPGAs, to be used for atmospheric radars working in HF/VHF bands. Multiple channels facilitate the radar t be operated in multi-receiver modes and also to obtain the wind vector with improved time resolution, without switching the antenna beam. MCDRx has six channels, implemented on a custom built digital board, which is realized using six numbers of ADCs for simultaneous processing of the six input signals, Xilinx vertex5 FPGA and Spartan6 FPGA, and two ADSPTS201 DSP chips, each of which performs one phase of processing. MCDRx unit interfaces with the data storage/display computer via two gigabit ethernet (GbE) links. One of the six channels is used for Doppler beam swinging (DBS) mode and the other five channels are used for multi-receiver mode operations, dedicatedly. Each channel has (i) ADC block, to digitize RF/IF signal, (ii) DDC block for digital down conversion of the digitized signal, (iii) decoding block to decode the phase coded signal, and (iv) coherent integration block for integrating the data preserving phase intact. ADC block consists of Analog devices make AD9467 16-bit ADCs, to digitize the input signal at 80 MSPS. The output of ADC is centered around (80 MHz - input frequency). The digitized data is fed

  17. Comparison of Attitudes Toward Death Between University Students Who Receive Nursing Education and Who Receive Religious Education.

    Science.gov (United States)

    Bakan, Ayse Berivan; Arli, Senay Karadag

    2018-03-22

    This study aims to compare attitudes toward death between university students who receive nursing education and who receive religious education. This study is cross-sectional in nature. It was conducted with the participation of 197 university students in a university located in the Eastern part of Turkey between June and August, 2017. Data were collected using the socio-demographic form and Turkish form of Death Attitudes Profile-Revised. Of all the students participating in the study, 52.8% received nursing education and 47.2% received religious education. It was found that majority of both groups had no education about death, or found the education they received insufficient. Besides, no significant differences were found between the students who received nursing education and who received religious education in terms of their attitudes toward death (p > 0.05). Results showed that students who received nursing education and who received religious education had similar attitudes toward death. In conclusion, the education given to students about the religious or health aspects of death in accordance with the curriculum seemed to have no effects on students' developing positive attitudes toward death.

  18. 49 CFR 1110.5 - Consideration of comments received.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 8 2010-10-01 2010-10-01 false Consideration of comments received. 1110.5 Section 1110.5 Transportation Other Regulations Relating to Transportation (Continued) SURFACE TRANSPORTATION... PROCEEDINGS § 1110.5 Consideration of comments received. All timely comments will be considered before final...

  19. Qualification test for the Flexible Receiver. Revision 1

    International Nuclear Information System (INIS)

    Keller, C.M.

    1994-01-01

    This document provides the test plan and procedures to certify and design verify the 42 in. and 4 in. -- 6 in. Flexible Receiver as a safety class 3 system. The Flexible Receiver will be used by projects W-151 and W-320 for removing equipment from tanks C-106 and Az-101

  20. Fuel Receiving and Storage Station. License application, amendment 4

    International Nuclear Information System (INIS)

    1975-04-01

    Amendment No. 4 of the application for licensing the Barnwell Fuel Processing Plant is presented. Information is included on: the quantity and characteristics of nuclear fuel assemblies which can be received and stored; specifications limiting the outside washdown of contaminated casks received for unloading; and definition of environmental monitoring program. (U.S.)

  1. Assessment of hospital-based adult triage at emergency receiving ...

    African Journals Online (AJOL)

    The study was conducted in 6 of the 7 hospitals in the region. ... gency department, the rest receive emergency patients/perform triage from .... gional Referral Hospital (government facility) with emer- ... sionals who were involved in daily initial management of ..... for receiving emergency cases can be complex especially.

  2. Qualification test for the flexible receiver. Revision 2

    International Nuclear Information System (INIS)

    Tedeschi, D.J.

    1994-01-01

    This document provides the test plan and procedures to certify and design verify the 42 double-prime and 4 double-prime-6 double-prime Flexible Receiver as a safety class 3 system. The Flexible Receiver will be used by projects W-151 and W-320 for removing equipment from tanks C-106 and AZ-101

  3. Qualification test for the flexible receiver. Revision 2

    Energy Technology Data Exchange (ETDEWEB)

    Tedeschi, D.J.

    1994-12-12

    This document provides the test plan and procedures to certify and design verify the 42{double_prime} and 4{double_prime}-6{double_prime} Flexible Receiver as a safety class 3 system. The Flexible Receiver will be used by projects W-151 and W-320 for removing equipment from tanks C-106 and AZ-101.

  4. Reconfigurable digital receiver design and application for instantaneous polarimetric measurement

    NARCIS (Netherlands)

    Wang, Z.; Krasnov, O.A.; Babur, G.P.; Ligthart, L.P.; Van der Zwan, F.

    2011-01-01

    This paper presents the development of a reconfigurable receiver to undertake challenging signal processing tasks for a novel polarimetric radar system. The field-programmable gate arrays (FPGAs)-based digital receiver samples incoming signals at intermediate frequency (IF) and processes signals

  5. 12 CFR 614.4700 - Financing foreign trade receivables.

    Science.gov (United States)

    2010-01-01

    ... OPERATIONS Banks for Cooperatives and Agricultural Credit Banks Financing International Trade § 614.4700 Financing foreign trade receivables. (a) Banks for cooperatives and agricultural credit banks, under policies adopted by their boards of directors, are authorized to finance foreign trade receivables on...

  6. Hearing Instrument using receivers with different performance characteristics

    DEFF Research Database (Denmark)

    2009-01-01

    The invention regards a signal processing device in a hearing aid, wherein the signal processing device is electrically coupled to a connection socket operable to detachably connect a receiver to the socket and whereby the signal processing device further comprise a detector operable to detect...... a characteristics of the receiver which is connected to the signal processing device through the connection socket....

  7. List of documents received by the INDC secretariat

    International Nuclear Information System (INIS)

    1983-05-01

    The Nuclear Data Section of the International Atomic Energy Agency receives documents originated by or for the International Nuclear Data Committee for distribution. This list includes all INDC documents received and distributed by the INDC secretariat during the last ten years, and supersedes last year's edition of this report

  8. Distributed Iterative Processing for Interference Channels with Receiver Cooperation

    DEFF Research Database (Denmark)

    Badiu, Mihai Alin; Manchón, Carles Navarro; Bota, Vasile

    2012-01-01

    We propose a method for the design and evaluation of distributed iterative algorithms for receiver cooperation in interference-limited wireless systems. Our approach views the processing within and collaboration between receivers as the solution to an inference problem in the probabilistic model...

  9. Gluconeogenesis continues in premature infants receiving total parenteral nutrition

    Science.gov (United States)

    To determine the contribution of total gluconeogenesis, to glucose production in preterm infants receiving total parenteral nutrition (TPN) providing glucose exceeding normal infant glucose turnover rate, eight infants (0.955 +/- 0.066 kg, 26.5 - 0.5 wks, 4-1 d) were studied while receiving routine ...

  10. Autonomous Operation of Super-Regenerative Receiver in BAN

    NARCIS (Netherlands)

    Kalyanasundaram, P.; Huang, L.; Dolmans, G.; Imamura, K.

    2012-01-01

    Super-regenerative receiver is one of the potential candidates to achieve ultra low power wireless communication in body area network (BAN). The main limitations of the super-regenerative receiver include the difficulty in choosing a good quench waveform to optimize its sensitivity and selectivity,

  11. 75 FR 80106 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2010-12-21

    ... training facilities requirements given the school's use of online training material, as well as the ground...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition...

  12. 75 FR 20881 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2010-04-21

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  13. 76 FR 33807 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2011-06-09

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  14. 76 FR 39976 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2011-07-07

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATE: Comments on this petition must...

  15. 75 FR 60859 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2010-10-01

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  16. 77 FR 35103 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2012-06-12

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  17. 78 FR 17746 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2013-03-22

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... information in the summary is intended to affect the legal status of the petition or its final disposition...

  18. 78 FR 53185 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2013-08-28

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... information in the summary is intended to affect the legal status of the petition or its final disposition...

  19. 77 FR 36333 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2012-06-18

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  20. 75 FR 19672 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2010-04-15

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... summary is intended to affect the legal status of the petition or its final disposition. DATES: Comments...

  1. 78 FR 46673 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2013-08-01

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... information in the summary is intended to affect the legal status of the petition or its final disposition...

  2. 78 FR 57676 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2013-09-19

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  3. 75 FR 60164 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2010-09-29

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... information in the summary is intended to affect the legal status of the petition or its final disposition...

  4. 76 FR 65772 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2011-10-24

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  5. 78 FR 53186 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2013-08-28

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATE: Comments on this petition must...

  6. 76 FR 16653 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2011-03-24

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  7. 78 FR 56768 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2013-09-13

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  8. 75 FR 26839 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2010-05-12

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  9. 77 FR 2120 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2012-01-13

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... information in the summary is intended to affect the legal status of the petition or its final disposition...

  10. 78 FR 73918 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2013-12-09

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... summary is intended to affect the legal status of the petition or its final disposition. [[Page 73919...

  11. 78 FR 13745 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2013-02-28

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  12. 78 FR 13746 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2013-02-28

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... summary is intended to affect the legal status of the petition or its final disposition. DATES: Comments...

  13. 77 FR 58210 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2012-09-19

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  14. 76 FR 39975 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2011-07-07

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... summary is intended to affect the legal status of the petition or its final disposition. DATES: Comments...

  15. 78 FR 46672 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2013-08-01

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... information in the summary is intended to affect the legal status of the petition or its final disposition...

  16. 75 FR 10016 - Petition for Exemption; Summary of Petitions Received

    Science.gov (United States)

    2010-03-04

    ...] Petition for Exemption; Summary of Petitions Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of two petitions seeking relief from specified requirements of 14 CFR. The purpose of this notice is to improve the...

  17. 75 FR 65396 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2010-10-22

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  18. 77 FR 71865 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2012-12-04

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  19. 78 FR 73919 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2013-12-09

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  20. 78 FR 34139 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2013-06-06

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  1. 78 FR 978 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2013-01-07

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... information in the summary is intended to affect the legal status of the petition or its final disposition...

  2. 77 FR 50760 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2012-08-22

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  3. 76 FR 2746 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2011-01-14

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  4. 76 FR 14744 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2011-03-17

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... summary is intended to affect the legal status of the petition or its final disposition. DATES: Comments...

  5. 75 FR 21388 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2010-04-23

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petitions or their final disposition. DATES: Comments on these petitions must...

  6. 78 FR 36294 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2013-06-17

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... information in the summary is intended to affect the legal status of the petition or its final disposition...

  7. 76 FR 51119 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2011-08-17

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  8. 76 FR 9852 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2011-02-22

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  9. 75 FR 80107 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2010-12-21

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  10. 78 FR 979 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2013-01-07

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  11. 75 FR 21389 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2010-04-23

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petitions or their final disposition. DATES: Comments on these petitions must...

  12. 77 FR 71864 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2012-12-04

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATE: Comments on this petition must...

  13. 78 FR 66098 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2013-11-04

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  14. 75 FR 21387 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2010-04-23

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  15. 76 FR 24560 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2011-05-02

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  16. 75 FR 10016 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2010-03-04

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATE: Comments on this petition must...

  17. 78 FR 53818 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2013-08-30

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  18. 77 FR 5087 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2012-02-01

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  19. 75 FR 51525 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2010-08-20

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petitions or their final disposition. DATES: Comments on these petitions must...

  20. 78 FR 35353 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2013-06-12

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  1. 77 FR 44309 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2012-07-27

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  2. 77 FR 31064 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2012-05-24

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  3. 78 FR 66986 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2013-11-07

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... information in the summary is intended to affect the legal status of the petition or its final disposition...

  4. 78 FR 39824 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2013-07-02

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... information in the summary is intended to affect the legal status of the petition or its final disposition...

  5. 78 FR 24290 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2013-04-24

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  6. 78 FR 66099 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2013-11-04

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  7. 78 FR 39825 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2013-07-02

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  8. 76 FR 20806 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2011-04-13

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  9. 78 FR 21701 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2013-04-11

    ...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...

  10. Design of a 1 Tb/s superchannel coherent receiver

    NARCIS (Netherlands)

    Millar, D.S.; Maher, R.; Lavery, D.; Koike-Akino, T.; Pajovic, M.; Alvarado, A.; Paskov, M.; Kojima, K.; Parsons, K.; Thomsen, B.C.; Savory, S.J.; Bayvel, P.

    2016-01-01

    We describe the design of a trained and pilot-aided digital coherent receiver, capable of detecting a 1 Tb/s superchannel with a single optical front-end. Algorithms for receiver training are described, which calculate the equalizer coefficients, subchannel SNRs, and centroids of the transmitted

  11. Compact wideband CMOS receiver frontends for wireless communication

    NARCIS (Netherlands)

    Blaakmeer, S.C.

    2010-01-01

    Abstract Wireless communication is an integral part of our daily life, the mobile phone is an example of a very popular wireless communication device. A communication link consists of a transmitter, a receiver and the transmission medium, which air or vacuum for a wireless link. Part of the receiver

  12. Wireless receiver architectures towards 5G : where are we?

    NARCIS (Netherlands)

    Bronckers, L.A.; Roc'h, A.; Smolders, A.B.

    2017-01-01

    With 5G posing different requirements to the mobile (handset) receiver than earlier generations, the receiver architecture needs to be carefully reconsidered. However, an up-to-date and complete overview is not yet available in literature. In this paper such a review of the currently available

  13. Three scientists to receive presidential Enrico Fermi award

    CERN Multimedia

    2003-01-01

    "Secretary of Energy Spencer Abraham today named John Bahcall, Raymond Davis, Jr. and Seymour Sack as winners of the Enrico Fermi Award. ... Drs. Bahcall and Davis will receive the award for their research in neutrino physics. Dr. Sack will receive the award for his contributions to national security" (1 page).

  14. Improved noise-adding radiometer for microwave receivers

    Science.gov (United States)

    Batelaan, P. D.; Stelzried, C. T.; Goldstein, R. M.

    1973-01-01

    Use of input switch and noise reference standard is avoided by using noise-adding technique. Excess noise from solid state noise-diode is coupled into receiver through directional coupler and square-wave modulated at low rate. High sensitivity receivers for radioastronomy applications are utilized with greater confidence in stability of radiometer.

  15. Enzymuria in neonates receiving continuous intravenous infusion of gentamicin

    DEFF Research Database (Denmark)

    Colding, H; Brygge, K; Brendstrup, L

    1992-01-01

    with non-treatment periods in the same newborn infant (33 infants). The same tendency applied to AAP. Newborn infants receiving continuous intravenous infusion of gentamicin were not found to be at greater risk of nephrotoxicity than those receiving intermittent gentamicin treatment, using NAG and AAP...

  16. 7 CFR 981.472 - Report of almonds received.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Report of almonds received. 981.472 Section 981.472... Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE ALMONDS GROWN IN CALIFORNIA Administrative Rules and Regulations § 981.472 Report of almonds received. (a) Each handler shall report to the...

  17. among People Receiving Antiretroviral Treatment in Western Uganda

    African Journals Online (AJOL)

    In this paper, we use survey (n=87) and interview (n=30) data to investigate orientations towards future childbearing among people receiving antiretroviral treatment and their family members in western Uganda. We investigate how reproductive options are perceived, by those receiving treatment and those closest to them, ...

  18. Which Preschool Children with Specific Language Impairment Receive Language Intervention?

    Science.gov (United States)

    Wittke, Kacie; Spaulding, Tammie J.

    2018-01-01

    Purpose: Potential biases in service provision for preschool children with specific language impairment (SLI) were explored. Method: In Study 1, children with SLI receiving treatment (SLI-T) and those with SLI not receiving treatment (SLI-NT) were compared on demographic characteristics and developmental abilities. Study 2 recruited children with…

  19. Evaluation and Error Analysis for a Solar Thermal Receiver

    International Nuclear Information System (INIS)

    Pfander, M.

    2001-01-01

    In the following study a complete balance over the REFOS receiver module, mounted on the tower power plant CESA-1 at the Plataforma Solar de Almeria (PSA), is carried out. Additionally an error inspection of the various measurement techniques used in the REFOS project is made. Especially the flux measurement system Pro hermes that is used to determine the total entry power of the receiver module and known as a major error source is analysed in detail. Simulations and experiments on the particular instruments are used to determine and quantify possible error sources. After discovering the origin of the errors they are reduced and included in the error calculation. The ultimate result is presented as an overall efficiency of the receiver module in dependence on the flux density at the receiver modules entry plane and the receiver operating temperature. (Author) 26 refs

  20. Advanced Signal Processing for MIMO-OFDM Receivers

    DEFF Research Database (Denmark)

    Manchón, Carles Navarro

    This thesis deals with a wide range of topics within the research area of advanced baseband receiver design for wireless communication systems. In particular, the work focuses on signal processing algorithms for receivers in multiple-input multiple-output (MIMO) orthogonal frequency-division mult......This thesis deals with a wide range of topics within the research area of advanced baseband receiver design for wireless communication systems. In particular, the work focuses on signal processing algorithms for receivers in multiple-input multiple-output (MIMO) orthogonal frequency...... the structure of the receiver with the hope that the resulting heuristic architecture will exhibit the desired behavior and performance. On the other hand, one can employ analytical frameworks to pose the problem as the optimization of a global objective function subject to certain constraints. This work...

  1. FFT analysis of sensible-heat solar-dynamic receivers

    Science.gov (United States)

    Lund, Kurt O.

    The use of solar dynamic receivers with sensible energy storage in single-phase materials is considered. The feasibility of single-phase designs with weight and thermal performance comparable to existing two-phase designs is addressed. Linearized heat transfer equations are formulated for the receiver heat storage, representing the periodic input solar flux as the sum of steady and oscillating distributions. The steady component is solved analytically to produce the desired receiver steady outlet gas temperature, and the FFT algorithm is applied to the oscillating components to obtain the amplitudes and mode shapes of the oscillating solid and gas temperatures. The results indicate that sensible-heat receiver designs with performance comparable to state-of-the-art two-phase receivers are available.

  2. List of documents received by the INDC secretariat

    International Nuclear Information System (INIS)

    1986-04-01

    The Nuclear Data Section of the International Atomic Energy Agency receives documents originated by or for the International Nuclear Data Committee for distribution. This list includes all INDC documents received and distributed by the INDC secretariat during the period January 1984 to March 1986. In addition to the INDC documents received by the INDC Secretariat for distribution, this document also lists the titles of reports received as single copies for information. These documents cannot be obtained from the INDC Secretariat, but should be requested from the originating laboratory or organization. All of the single copy documents, which have been received between January 1984 and March 1986 are listed in Appendix A to this document

  3. List of documents received by the INDC Secretariat

    International Nuclear Information System (INIS)

    1984-08-01

    The Nuclear Data Section of the International Atomic Energy Agency receives documents originated by or for the International Nuclear Data Committee for distribution. The present list includes all INDC documents received and distributed by the INDC secretariat during the period January 1982 to June 1984, and supersedes last years' edition of this report, INDC(SEC)-85/UN. This list is produced directly from computer printout in two sorts: one ordered by accession number, and the other ordered by document number within each origin series (e.g. listing all INDC(SEC)-documents in one block). In addition to the INDC documents received by the INDC Secretariat for distribution, this document also lists the titles of reports received as single copies for information. All of the single copy documents which have been received between June 1983 and July 1984 are listed in Appendix A to this document

  4. Joint Transmitter-Receiver Optimization in the Downlink CDMA Systems

    Directory of Open Access Journals (Sweden)

    Mohammad Saquib

    2002-08-01

    Full Text Available To maximize the downlink code-division multiple access (CDMA system capacity, we propose to minimize the total transmitted power of the system subject to users′ signal-to-interference ratio (SIR requirements via designing optimum transmitter sequences and utilizing linear optimum receivers (minimum mean square error (MMSE receiver. In our work on joint transmitter-receiver design for the downlink CDMA systems with multiple antennas and multipath channels, we develop several optimization algorithms by considering various system constraints and prove their convergence. We empirically observed that under the optimization algorithm with no constraint on the system, the optimum receiver structure matches the received transmitter sequences. A simulation study is performed to see how the different practical system constraints penalize the system with respect to the optimum algorithm with no constraint on the system.

  5. Intermediate Frequency Digital Receiver Based on Multi-FPGA System

    Directory of Open Access Journals (Sweden)

    Chengchang Zhang

    2016-01-01

    Full Text Available Aiming at high-cost, large-size, and inflexibility problems of traditional analog intermediate frequency receiver in the aerospace telemetry, tracking, and command (TTC system, we have proposed a new intermediate frequency (IF digital receiver based on Multi-FPGA system in this paper. Digital beam forming (DBF is realized by coordinated rotation digital computer (CORDIC algorithm. An experimental prototype has been developed on a compact Multi-FPGA system with three FPGAs to receive 16 channels of IF digital signals. Our experimental results show that our proposed scheme is able to provide a great convenience for the design of IF digital receiver, which offers a valuable reference for real-time, low power, high density, and small size receiver design.

  6. Evaluation and Error Analysis for a Solar thermal Receiver

    Energy Technology Data Exchange (ETDEWEB)

    Pfander, M.

    2001-07-01

    In the following study a complete balance over the REFOS receiver module, mounted on the tower power plant CESA-1 at the Plataforma Solar de Almeria (PSA), is carried out. Additionally an error inspection of the various measurement techniques used in the REFOS project is made. Especially the flux measurement system Prohermes that is used to determine the total entry power of the receiver module and known as a major error source is analysed in detail. Simulations and experiments on the particular instruments are used to determine and quantify possible error sources. After discovering the origin of the errors they are reduced and included in the error calculation. the ultimate result is presented as an overall efficiency of the receiver module in dependence on the flux density at the receiver module's entry plane and the receiver operating temperature. (Author) 26 refs.

  7. Uncertainty In Measuring Noise Parameters Of a Communication Receiver

    International Nuclear Information System (INIS)

    Korcz, Karol; Palczynska, Beata; Spiralski, Ludwik

    2005-01-01

    The paper presents the method of assessing uncertainty in measuring the usable sensitivity Es of communication receiver. The influence of partial uncertainties of measuring the noise factor F and the energy pass band of the receiver Δf on the combined standard uncertainty level is analyzed. The method to assess the uncertainty in measuring the noise factor on the basis of the systematic component of uncertainty, assuming that the main source of measurement uncertainty is the hardware of the measuring system, is proposed. The assessment of uncertainty in measuring the pass band of the receiver is determined with the assumption that input quantities of the measurement equation are not correlated. They are successive, discrete values of the spectral power density of the noise on the output of receiver. The results of the analyses of particular uncertainties components of measuring the sensitivity, which were carried out for a typical communication receiver, are presented

  8. Heat receivers for solar dynamic space power systems

    Science.gov (United States)

    Perez-Davis, Marla Esther

    A review of state-of-the-art technology is presented and discussed for phase change materials. Some of the advanced solar dynamic designs developed as part of the Advanced Heat Receiver Conceptual Design Study performed for LeRC are discussed. The heat receivers are analyzed and several recommendations are proposed, including two new concepts. The first concept evaluated the effect of tube geometries inside the heat receiver. It was found that a triangular configuration would provide better heat transfer to the working fluid, although not necessarily with a reduction in receiver size. A sensible heat receiver considered in this study uses vapor grown graphite fiber-carbon (VGCF/C) composite as the thermal storage media and was designed for a 7 kW Brayton engine. The proposed heat receiver stores the required energy to power the system during eclipse in the VGCF/C composite. The heat receiver analysis was conducted through the Systems Improved Numerical Differencing Analyzer and Fluid Integrator (SINDA) software package. The proposed heat receiver compares well with other latent and advanced sensible heat receivers while avoiding the problems associated with latent heat storage salts and liquid metal heat pipes. The weight and size of the system can be optimized by changes in geometry and technology advances for this new material. In addition to the new concepts, the effect of atomic oxygen on several materials is reviewed. A test was conducted for atomic oxygen attack on boron nitride, which experienced a negligible mass loss when exposed to an atomic oxygen fluence of 5 x 10 exp 21 atoms/sq cm. This material could be used to substitute the graphite aperture plate of the heat receiver.

  9. Structural analysis of a reflux pool-boiler solar receiver

    Energy Technology Data Exchange (ETDEWEB)

    Hoffman, E.L.; Stone, C.M.

    1991-06-01

    Coupled thermal-structural finite element calculations of a reflux pool-boiler solar receiver were performed to characterize the operating stresses and to address issues affecting the service life of the receiver. Analyses performed using shell elements provided information for receiver material selection and design optimization. Calculations based on linear elastic fracture mechanics principles were performed using continuum elements to assess the vulnerability of a seam-weld to fatigue crack growth. All calculations were performed using ABAQUS, a general purpose finite element code, and elements specifically formulated for coupled thermal-structural analysis. Two materials were evaluated: 316L SS and Haynes 230 alloys. The receiver response was simulated for a combination of structural and thermal loads that represent the startup and operating conditions of the receiver. For both materials, maximum stresses in the receiver developed shortly after startup due to uneven temperature distribution across the receiver surface. The largest effective stress was near yield in the 316L SS receiver and below 39 percent of yield in the Haynes 230 receiver. The calculations demonstrated that stress reductions of over 25 percent could be obtained by reducing the aft dome thickness to one closer to the absorber. The fatigue calculations demonstrated that the stress distribution near the seam-weld notch depends primarily on the structural load created by internal pressurization of the receiver rather than the thermal, indicating that the thermal loads can be neglected when assessing the stress intensity near the seam-weld notch. The stress intensity factor, computed using the J-integral method and crack opening-displacement field equations, was significantly below the fatigue threshold for most steels. The calculations indicated that the weld notch was always loaded in compression, a condition which is not conducive to fatigue crack growth. 15 refs., 30 figs., 3 tabs.

  10. Analysis of signal acquisition in GPS receiver software

    Directory of Open Access Journals (Sweden)

    Vlada S. Sokolović

    2011-01-01

    Full Text Available This paper presents a critical analysis of the flow signal processing carried out in GPS receiver software, which served as a basis for a critical comparison of different signal processing architectures within the GPS receiver. It is possible to achieve Increased flexibility and reduction of GPS device commercial costs, including those of mobile devices, by using radio technology software (SDR, Software Defined Radio. The SDR application can be realized when certain hardware components in a GPS receiver are replaced. Signal processing in the SDR is implemented using a programmable DSP (Digital Signal Processing or FPGA (Field Programmable Gate Array circuit, which allows a simple change of digital signal processing algorithms and a simple change of the receiver parameters. The starting point of the research is the signal generated on the satellite the structure of which is shown in the paper. Based on the GPS signal structure, a receiver is realized with a task to extract an appropriate signal from the spectrum and detect it. Based on collected navigation data, the receiver calculates the position of the end user. The signal coming from the satellite may be at the carrier frequencies of L1 and L2. Since the SPS is used in the civil service, all the tests shown in the work were performed on the L1 signal. The signal coming to the receiver is generated in the spread spectrum technology and is situated below the level of noise. Such signals often interfere with signals from the environment which presents a difficulty for a receiver to perform proper detection and signal processing. Therefore, signal processing technology is continually being improved, aiming at more accurate and faster signal processing. All tests were carried out on a signal acquired from the satellite using the SE4110 input circuit used for filtering, amplification and signal selection. The samples of the received signal were forwarded to a computer for data post processing, i. e

  11. SEPIA - a new single pixel receiver at the APEX telescope

    Science.gov (United States)

    Belitsky, V.; Lapkin, I.; Fredrixon, M.; Meledin, D.; Sundin, E.; Billade, B.; Ferm, S.-E.; Pavolotsky, A.; Rashid, H.; Strandberg, M.; Desmaris, V.; Ermakov, A.; Krause, S.; Olberg, M.; Aghdam, P.; Shafiee, S.; Bergman, P.; Beck, E. De; Olofsson, H.; Conway, J.; Breuck, C. De; Immer, K.; Yagoubov, P.; Montenegro-Montes, F. M.; Torstensson, K.; Pérez-Beaupuits, J.-P.; Klein, T.; Boland, W.; Baryshev, A. M.; Hesper, R.; Barkhof, J.; Adema, J.; Bekema, M. E.; Koops, A.

    2018-04-01

    Context. We describe the new Swedish-ESO PI Instrument for APEX (SEPIA) receiver, which was designed and built by the Group for Advanced Receiver Development (GARD), at Onsala Space Observatory (OSO) in collaboration with ESO. It was installed and commissioned at the APEX telescope during 2015 with an ALMA Band 5 receiver channel and updated with a new frequency channel (ALMA Band 9) in February 2016. Aim. This manuscript aims to provide, for observers who use the SEPIA receiver, a reference in terms of the hardware description, optics and performance as well as the commissioning results. Methods: Out of three available receiver cartridge positions in SEPIA, the two current frequency channels, corresponding to ALMA Band 5, the RF band 158-211 GHz, and Band 9, the RF band 600-722 GHz, provide state-of-the-art dual polarization receivers. The Band 5 frequency channel uses 2SB SIS mixers with an average SSB noise temperature around 45 K with IF (intermediate frequency) band 4-8 GHz for each sideband providing total 4 × 4 GHz IF band. The Band 9 frequency channel uses DSB SIS mixers with a noise temperature of 75-125 K with IF band 4-12 GHz for each polarization. Results: Both current SEPIA receiver channels are available to all APEX observers.

  12. Design of coherent receiver optical front end for unamplified applications.

    Science.gov (United States)

    Zhang, Bo; Malouin, Christian; Schmidt, Theodore J

    2012-01-30

    Advanced modulation schemes together with coherent detection and digital signal processing has enabled the next generation high-bandwidth optical communication systems. One of the key advantages of coherent detection is its superior receiver sensitivity compared to direct detection receivers due to the gain provided by the local oscillator (LO). In unamplified applications, such as metro and edge networks, the ultimate receiver sensitivity is dictated by the amount of shot noise, thermal noise, and the residual beating of the local oscillator with relative intensity noise (LO-RIN). We show that the best sensitivity is achieved when the thermal noise is balanced with the residual LO-RIN beat noise, which results in an optimum LO power. The impact of thermal noise from the transimpedance amplifier (TIA), the RIN from the LO, and the common mode rejection ratio (CMRR) from a balanced photodiode are individually analyzed via analytical models and compared to numerical simulations. The analytical model results match well with those of the numerical simulations, providing a simplified method to quantify the impact of receiver design tradeoffs. For a practical 100 Gb/s integrated coherent receiver with 7% FEC overhead, we show that an optimum receiver sensitivity of -33 dBm can be achieved at GFEC cliff of 8.55E-5 if the LO power is optimized at 11 dBm. We also discuss a potential method to monitor the imperfections of a balanced and integrated coherent receiver.

  13. United States Department of Energy solar receiver technology development

    Science.gov (United States)

    Klimas, P. C.; Diver, R. B.; Chavez, J. M.

    The United States Department of Energy (DOE), through Sandia National Laboratories, has been conducting a Solar Thermal Receiver Technology Development Program, which maintains a balance between analytical modeling, bench and small scale testing, and experimentation conducted at scales representative of commercially-sized equipment. Central receiver activities emphasize molten salt-based systems on large scales and volumetric devices in the modeling and small scale testing. These receivers are expected to be utilized in solar power plants rated between 100 and 200 MW. Distributed receiver research focuses on liquid metal refluxing devices. These are intended to mate parabolic dish concentrators with Stirling cycle engines in the 5 to 25 kW(sub e) power range. The effort in the area of volumetric receivers is less intensive and highly cooperative in nature. A ceramic foam absorber of Sandia design was successfully tested on the 200 kW(sub t) test bed at Plataforma Solar during 1989. Material integrity during the approximately 90-test series was excellent. Significant progress has been made with parabolic dish concentrator-mounted receivers using liquid metals (sodium or a potassium/sodium mixture) as heat transport media. Sandia has successfully solar-tested a pool boiling reflux receiver sized to power a 25 kW Stirling engine. Boiling stability and transient operation were both excellent. This document describes these activities in detail and will outline plans for future development.

  14. Spread Spectrum Receiver Electromagnetic Interference (EMI) Test Guide

    Science.gov (United States)

    Wheeler, M. L.

    1998-01-01

    The objective of this test guide is to document appropriate unit level test methods and techniques for the performance of EMI testing of Direct Sequence (DS) spread spectrum receivers. Consideration of EMI test methods tailored for spread spectrum receivers utilizing frequency spreading, techniques other than direct sequence (such as frequency hopping, frequency chirping, and various hybrid methods) is beyond the scope of this test guide development program and is not addressed as part of this document EMI test requirements for NASA programs are primarily developed based on the requirements contained in MIL-STD-46 1 D (or earlier revisions of MIL-STD-46 1). The corresponding test method guidelines for the MIL-STD-461 D tests are provided in MIL-STD-462D. These test methods are well documented with the exception of the receiver antenna port susceptibility tests (intermodulation, cross modulation, and rejection of undesired signals) which must be tailored to the specific type of receiver that is being tested. Thus, test methods addressed in this guide consist only of antenna port tests designed to evaluate receiver susceptibility characteristics. MIL-STD-462D should be referred for guidance pertaining to test methods for EMI tests other than the antenna port tests. The scope of this test guide includes: (1) a discussion of generic DS receiver performance characteristics; (2) a summary of S-band TDRSS receiver operation; (3) a discussion of DS receiver EMI susceptibility mechanisms and characteristics; (4) a summary of military standard test guidelines; (5) recommended test approach and methods; and (6) general conclusions and recommendations for future studies in the area of spread spectrum receiver testing.

  15. An Array of Optical Receivers for Deep-Space Communications

    Science.gov (United States)

    Vilnrotter, Chi-Wung; Srinivasan, Meera; Andrews, Kenneth

    2007-01-01

    An array of small optical receivers is proposed as an alternative to a single large optical receiver for high-data-rate communications in NASA s Deep Space Network (DSN). Because the telescope for a single receiver capable of satisfying DSN requirements must be greater than 10 m in diameter, the design, building, and testing of the telescope would be very difficult and expensive. The proposed array would utilize commercially available telescopes of 1-m or smaller diameter and, therefore, could be developed and verified with considerably less difficulty and expense. The essential difference between a single-aperture optical-communications receiver and an optical-array receiver is that a single-aperture receiver focuses all of the light energy it collects onto the surface of an optical detector, whereas an array receiver focuses portions of the total collected energy onto separate detectors, optically detects each fractional energy component, then combines the electrical signal from the array of detector outputs to form the observable, or "decision statistic," used to decode the transmitted data. A conceptual block diagram identifying the key components of the optical-array receiver suitable for deep-space telemetry reception is shown in the figure. The most conspicuous feature of the receiver is the large number of small- to medium-size telescopes, with individual apertures and number of telescopes selected to make up the desired total collecting area. This array of telescopes is envisioned to be fully computer- controlled via the user interface and prediction-driven to achieve rough pointing and tracking of the desired spacecraft. Fine-pointing and tracking functions then take over to keep each telescope pointed toward the source, despite imperfect pointing predictions, telescope-drive errors, and vibration caused by wind.

  16. Low proportion of high school senior athletes receiving recommended immunizations.

    Science.gov (United States)

    Karpinos, Ashley Rowatt; Rizzone, Katherine H; Cribbs, Sarah P; Roumie, Christianne L

    2014-05-01

    The preparticipation physical evaluation (PPE) often serves as the only preventive health care visit for athletes, but immunization status is not uniformly addressed in such visits. Thus, athletes may not be receiving recommended immunizations. Our aim was to determine the proportion of high school senior athletes who received all recommended immunizations. Our hypothesis was that females would be less likely than males to receive all recommended immunizations given suboptimal human papillomavirus (HPV) vaccine uptake. We conducted a cross-sectional survey evaluation of the immunization status of high school senior athletes in Davidson County, TN. The primary composite outcome was receipt of recommended immunizations for tetanus, meningococcal, and seasonal influenza. For females, the primary outcome also included completion of the HPV series. A total of 162 participants, 104 males and 58 females, were included. More males than females received all recommended immunizations (15.4% vs 3.5%; P = 0.02). When HPV immunization was excluded from the composite outcome, there was no difference in the proportion of males and females who received all recommended immunizations (15.4% vs 15.5%; P = 0.98). The odds of receiving all recommended immunizations was 0.14 (95% CI, 0.03-0.72) for females compared with males when adjusted for covariates. Athletes seen at retail-based clinics for their PPE were less likely to receive all recommended immunizations compared with athletes seen in primary care (OR, 0.13; 95% CI, 0.02-0.69). Only 1 in 6 high school senior athletes received the recommended tetanus, meningococcal, and influenza immunizations. A lower proportion of females, only 1 in 28, received all recommended immunizations due to the HPV series. Policy changes requiring a review of immunizations at the PPE would benefit many high school athletes.

  17. Reasons for receiving or not receiving HPV vaccination in primary schoolgirls in Tanzania: a case control study.

    Science.gov (United States)

    Watson-Jones, Deborah; Tomlin, Keith; Remes, Pieter; Baisley, Kathy; Ponsiano, Riziki; Soteli, Selephina; de Sanjosé, Silvia; Changalucha, John; Kapiga, Saidi; Hayes, Richard J

    2012-01-01

    There are few data on factors influencing human papillomavirus (HPV) vaccination uptake in sub-Saharan Africa. We examined the characteristics of receivers and non-receivers of HPV vaccination in Tanzania and identified reasons for not receiving the vaccine. We conducted a case control study of HPV vaccine receivers and non-receivers within a phase IV cluster-randomised trial of HPV vaccination in 134 primary schools in Tanzania. Girls who failed to receive vaccine (pupil cases) and their parents/guardians (adult cases) and girls who received dose 1 (pupil controls) of the quadrivalent vaccine (Gardasil™) and their parents/guardians (adult controls) were enrolled from 39 schools in a 1∶1 ratio and interviewed about cervical cancer, HPV vaccine knowledge and reasons why they might have received or not received the vaccine. Conditional logistic regression was used to determine factors independently associated with not receiving HPV vaccine. We interviewed 159 pupil/adult cases and 245 pupil/adult controls. Adult-factors independently associated with a daughter being a case were older age, owning fewer household items, not attending a school meeting about HPV vaccine, and not knowing anyone with cancer. Pupil-factors for being a case included having a non-positive opinion about the school de-worming programme, poor knowledge about the location of the cervix, and not knowing that a vaccine could prevent cervical cancer. Reasons for actively refusing vaccination included concerns about side effects and infertility. Most adult and pupil cases reported that they would accept the HPV vaccine if it were offered again (97% and 93% respectively). Sensitisation messages, especially targeted at older and poorer parents, knowledge retention and parent meetings are critical for vaccine acceptance in Tanzania. Vaccine side effects and fertility concerns should be addressed prior to a national vaccination program. Parents and pupils who initially decline vaccination should be

  18. Reasons for receiving or not receiving HPV vaccination in primary schoolgirls in Tanzania: a case control study.

    Directory of Open Access Journals (Sweden)

    Deborah Watson-Jones

    Full Text Available There are few data on factors influencing human papillomavirus (HPV vaccination uptake in sub-Saharan Africa. We examined the characteristics of receivers and non-receivers of HPV vaccination in Tanzania and identified reasons for not receiving the vaccine.We conducted a case control study of HPV vaccine receivers and non-receivers within a phase IV cluster-randomised trial of HPV vaccination in 134 primary schools in Tanzania. Girls who failed to receive vaccine (pupil cases and their parents/guardians (adult cases and girls who received dose 1 (pupil controls of the quadrivalent vaccine (Gardasil™ and their parents/guardians (adult controls were enrolled from 39 schools in a 1∶1 ratio and interviewed about cervical cancer, HPV vaccine knowledge and reasons why they might have received or not received the vaccine. Conditional logistic regression was used to determine factors independently associated with not receiving HPV vaccine.We interviewed 159 pupil/adult cases and 245 pupil/adult controls. Adult-factors independently associated with a daughter being a case were older age, owning fewer household items, not attending a school meeting about HPV vaccine, and not knowing anyone with cancer. Pupil-factors for being a case included having a non-positive opinion about the school de-worming programme, poor knowledge about the location of the cervix, and not knowing that a vaccine could prevent cervical cancer. Reasons for actively refusing vaccination included concerns about side effects and infertility. Most adult and pupil cases reported that they would accept the HPV vaccine if it were offered again (97% and 93% respectively.Sensitisation messages, especially targeted at older and poorer parents, knowledge retention and parent meetings are critical for vaccine acceptance in Tanzania. Vaccine side effects and fertility concerns should be addressed prior to a national vaccination program. Parents and pupils who initially decline vaccination

  19. List of documents received by the INDC Secretariat

    International Nuclear Information System (INIS)

    1979-05-01

    The Nuclear Data Section of the International Atomic Energy Agency receives documents originated by or for the International Nuclear Data Committee for distribution. This list includes all INDC documents received and distributed between January 1968 and May 1979, and supersedes INDC(SEC)-66/UN. This list is produced directly from computer printout in two sorts: one ordered by accession number, and the other ordered by document number with-in each origin series (e.g. listing all INDC(SEC)-documents in one block). Reference to earlier INDSWG and ''interim'' INDC reports received between 1962 and 1967 are listed in report INDC/199 (dated November 1967)

  20. List of documents received by the INDC Secretariat

    International Nuclear Information System (INIS)

    1991-01-01

    The Nuclear Data Section of the IAEA receives documents originated by or for the International Nuclear Data Committee (INDC) for distribution. This list includes all INDC documents received and distributed by the INDC Secretariat during the period March 1989 to June 1990. The list is produced directly from computer printout, into two groups: one ordered by accession number, and the other ordered by document number within each origin series. The document lists also in an appendix the titles of reports received as single copies for information

  1. Digital processing optical transmission and coherent receiving techniques

    CERN Document Server

    Binh, Le Nguyen

    2013-01-01

    With coherent mixing in the optical domain and processing in the digital domain, advanced receiving techniques employing ultra-high speed sampling rates have progressed tremendously over the last few years. These advances have brought coherent reception systems for lightwave-carried information to the next stage, resulting in ultra-high capacity global internetworking. Digital Processing: Optical Transmission and Coherent Receiving Techniques describes modern coherent receiving techniques for optical transmission and aspects of modern digital optical communications in the most basic lines. The

  2. List of documents received by the INDC Secretariat

    International Nuclear Information System (INIS)

    1989-05-01

    The Nuclear Data Section of the IAEA receives documents originated by or for the International Nuclear Data Committee for distribution. This list includes all INDC documents received and distributed by the INDC Secretariat during the period September 1987 to February 1989. The list is produced directly from computer printouts into two groups: one ordered by accession number, and the other ordered by document number within each series. The document lists also in an Appendix the titles of reports received as single copies for information

  3. Flexible Receiver Radiation Detection System (FRRDS) Users Manual

    International Nuclear Information System (INIS)

    Troyer, G.L.

    1996-01-01

    The Flexible Receiver Radiation Detection System (FRRDS) comprises a control computer, a remote data acquisition subsystem, and three hyperpure germanium gamma radiation detectors. The scope of this document is the description of various steps for the orderly start-up, use, and shutdown of the FRRDS. Only those items necessary for these oprations are included. This document is a companion to WHC-SD-W151-UM-002, 'Operating Instructions for the 42 Inch Flexible Receiver,' WHC-SD-W151-UM-003, 'Operating Instructions for the 4-6 Inch Flexible Receiver,' and the vendor supplied system users guide (Ref. 6)

  4. Solar central receiver reformer system for ammonia plants

    Science.gov (United States)

    1980-07-01

    An overview of a study to retrofit the Valley Nitrogen Producers, Inc., El Centro, California 600 ST/SD Ammonia Plant with Solar Central Receiver Technology is presented. The retrofit system consists of a solar central receiver reformer (SCRR) operating in parallel with the existing fossil fired reformer. Steam and hydrocarbon react in the catalyst filled tubes of the inner cavity receiver to form a hydrogen rich mixture which is the syngas feed for the ammonia production. The SCRR system will displace natural gas presently used in the fossil reformer combustion chamber.

  5. Financial reserve. Hospitals leery of credit lines, factoring receivables.

    Science.gov (United States)

    Edwards, D E; Hamilton, W C; Hauser, R

    1991-10-01

    Opening lines of credit and factoring (selling) accounts receivable are two ways to generate operating cash that non-healthcare industries have long used successfully. A recent survey of hospital officials across the nation, however, showed these techniques are used infrequently in health care. Among the 281 hospitals responding: Only 45 percent use lines of credit; Less than 5 percent pursue accounts receivable factoring; and Only 12 percent plan to begin factoring receivables in the future. As hospitals look for ways to offset depleted cash reserves, these percentages may increase.

  6. Low Complexity Receiver Design for MIMO-Radar

    KAUST Repository

    Ahmed, Sajid; Alouini, Mohamed-Slim

    2012-01-01

    In this work, an algorithm for the multiple-input multiple-output (MIMO) radar is proposed. It has low computational complexity compared to the available schemes, and relatively low side-lobe-levels in the receive beampattern compared to the phased-array and MIMO-radar. In the proposed algorithm, the received signal vector of MIMO-radar is divided into sub-vectors, and each sub-vector is multiplied with the corresponding weight vector. The number of sub-vectors and weight vectors are optimally found to maximise the received signal power from the target of interest direction. The proposed scheme can be effectively applied in passive radars to minimise the side-lobe levels and place deep nulls for interferers in the receive beampattern. Simulation results show that the proposed scheme has relatively lower side lobe levels and better detection capabilities compared to MIMO-radar and phased-array.

  7. Water Fluoridation Statistics - Percent of PWS population receiving fluoridated water

    Data.gov (United States)

    U.S. Department of Health & Human Services — 2000-2014. Water Fluoridation Statistics is a biennial report of the percentage and number of people receiving fluoridated water from 2000 through 2014, originally...

  8. Next generation GNSS single receiver cycle slip reliability

    NARCIS (Netherlands)

    Teunissen, P.J.G.; De Bakker, P.F.

    2009-01-01

    In this contribution we study the multi-frequency, carrier-phase slip detection capabilities of a single receiver. Our analysis is based on an analytical expression that we present for themulti-frequencyminimal detectable carrier phase cycle slip.

  9. S.K. De Datta receives Clifton Garvin Fellowship

    OpenAIRE

    Felker, Susan B.

    2004-01-01

    S.K. De Datta, of Blacksburg, associate provost for international affairs at Virginia Tech, received the university's Clifton Garvin Fellowship Award. The award was conferred by the Virginia Tech Board of Visitors at its quarterly meeting Monday, Nov. 8.

  10. MULTI-GNSS RECEIVER FOR AEROSPACE NAVIGATION AND POSITIONING APPLICATIONS

    Directory of Open Access Journals (Sweden)

    T. R. Peres

    2014-03-01

    Full Text Available The upcoming Galileo system opens a wide range of new opportunities in the Global Navigation Satellite System (GNSS market. However, the characteristics of the future GNSS signals require the development of new GNSS receivers. In the frame of the REAGE project, DEIMOS and ISEL have developed a GNSS receiver targeted for aerospace applications, supporting current and future GPS L1 and Galileo E1 signals, based on commercial (or, in the furthest extent, industrial grade components. Although the REAGE project aimed at space applications, the REAGE receiver is also applicable to many terrestrial applications (ground or airborne, such as Georeferencing and Unmanned Aerial Vehicle (UAV navigation. This paper presents the architecture and features of the REAGE receiver, as well as some results of the validation campaign with GPS L1 and Galileo E1 signals.

  11. Watt-level wireless power transmission to multiple compact receivers

    International Nuclear Information System (INIS)

    Garraud, A; Munzer, D J; Althar, M; Garraud, N; Arnold, D P

    2015-01-01

    This paper reports an electrodynamic wireless power transmission (EWPT) system using a low-frequency (300 Hz) magnetic field to transmit watt-scale power levels to multiple compact receivers. As compared to inductively or resonantly coupled coils, EWPT facilitates transmission to multiple non-interacting receivers with little restriction on their orientation. A single 3.0 cm 3 receiver achieves 1.25 W power transmission with 8% efficiency at a distance of 1 cm (350 mW/cm 3 power density) from the transmitter. The same prototype achieves 9 mW at a distance of 9 cm. Moreover, we demonstrate simultaneous recharge of two wearable devices, using two receivers located in arbitrary positions and orientations. (paper)

  12. Low Complexity Receiver Design for MIMO-Radar

    KAUST Repository

    Ahmed, Sajid

    2012-09-08

    In this work, an algorithm for the multiple-input multiple-output (MIMO) radar is proposed. It has low computational complexity compared to the available schemes, and relatively low side-lobe-levels in the receive beampattern compared to the phased-array and MIMO-radar. In the proposed algorithm, the received signal vector of MIMO-radar is divided into sub-vectors, and each sub-vector is multiplied with the corresponding weight vector. The number of sub-vectors and weight vectors are optimally found to maximise the received signal power from the target of interest direction. The proposed scheme can be effectively applied in passive radars to minimise the side-lobe levels and place deep nulls for interferers in the receive beampattern. Simulation results show that the proposed scheme has relatively lower side lobe levels and better detection capabilities compared to MIMO-radar and phased-array.

  13. David Nolfi Receives NAHRS Award for Professional Excellence

    Directory of Open Access Journals (Sweden)

    Maureen Diana Sasso

    2013-09-01

    Full Text Available News AnnouncementDavid A. Nolfi, MLS, AHIP, Health Sciences Librarian & Library Assessment Coordinator at Duquesne University’s Gumberg Library, received the 2013 NAHRS Award for Professional Excellence at the One Health Conference in Boston, MA.

  14. Metal Mesh Filters for Terahertz Receivers, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — The technical objective of this SBIR program is to develop and demonstrate metal mesh filters for use in NASA's low noise receivers for terahertz astronomy and...

  15. An Evaluation of Hepatotoxicity in Breast Cancer Patients Receiving ...

    African Journals Online (AJOL)

    hanumantp

    investigation was a prospective study that was conducted in cancer patients receiving Inj. Doxorubicin .... patients. Pre-Chem o. I - Cycle. II - Cycle III - Cycle. IV - Cycle. 0. 1. 2. 3. 4 .... vitamin E, vitamin C, vitamin A, antioxidant components.

  16. Using a referee to resolve shipper-receiver differences

    International Nuclear Information System (INIS)

    Tietjen, G.L.

    1981-01-01

    Within the nuclear community, shipper-receiver differences generate considerable concern. Current methods of resolving these differences are discussed, prticularly the use of an umpire or referee. Numerous statistical problems connected with the present procedures are also considered

  17. Global Positioning System (GPS) Receiver Design For Multipaths Mitigation

    National Research Council Canada - National Science Library

    Gadallah, El-Sayed

    1998-01-01

    .... This research introduces a new estimator that can detect the presence of multipath, can determine the unknown number of multipath components and can estimate multipath parameters in the GPS receiver...

  18. Low-cost digital GPS receiver with software carrier detection

    Science.gov (United States)

    Wolf, M. H.

    1988-08-01

    The satellite navigation system global positioning system (GPS) will play a major role in the field of navigation. It will be able to compete with all previously existing radio navigation systems. Low-cost receivers will be built for a number of civilian users, such as general aviation, sea and land navigation. To permit production at low cost for the civil market, a new technique for a C/A (course and acquisition) code receiver has been developed. All the signal detecting and processing is carried out with the digital signal processing software in a Texas Instruments TMS 320C10. The advantage of this method is that complex functions can be effected in a computer program instead of in analog or digital circuits. This reduces the costs of the parts used in the receiver and also avoids calibration. Taken together, these two features greatly reduce the price of a navigation set. This paper discusses the underlying principles leading to this new receiver.

  19. RFI mitigating receiver back end for radiometers, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — This SBIR Phase I proposal requests support for Alphacore, Inc. to design and a low power application specific integrated circuit (ASIC) RFI mitigating receiver back...

  20. developing skills of giving and receiving feedbacks between

    African Journals Online (AJOL)

    User

    could be by developing the skill of giving and receiving feedbacks among the individuals involved in the ... education rather than damaging their self esteem against to improve the teaching – process (David ..... A better skill of communication.

  1. Optical Communication over Plastic Optical Fibers Integrated Optical Receiver Technology

    CERN Document Server

    Atef, Mohamed

    2013-01-01

    This book presents high-performance data transmission over plastic optical fibers (POF) using integrated optical receivers having good properties with multilevel modulation, i.e. a higher sensitivity and higher data rate transmission over a longer plastic optical fiber length. Integrated optical receivers and transmitters with high linearity are introduced for multilevel communication. For binary high-data rate transmission over plastic optical fibers, an innovative receiver containing an equalizer is described leading also to a high performance of a plastic optical fiber link. The cheap standard PMMA SI-POF (step-index plastic optical fiber) has the lowest bandwidth and the highest attenuation among multimode fibers. This small bandwidth limits the maximum data rate which can be transmitted through plastic optical fibers. To overcome the problem of the plastic optical fibers high transmission loss, very sensitive receivers must be used to increase the transmitted length over POF. The plastic optical fiber li...

  2. German Antarctic Receiving Station (GARS) O'Higgins

    Science.gov (United States)

    Neidhardt, Alexander; Ploetz, Christian; Kluegel, Thomas

    2013-01-01

    In 2012, the German Antarctic Receiving Station (GARS) O'Higgins contributed to the IVS observing program with four observation sessions. Maintenance and upgrades were made, and a new replacement dewar is under construction in the observatory at Yebes, Spain.

  3. Administering truncated receive functions in a parallel messaging interface

    Science.gov (United States)

    Archer, Charles J; Blocksome, Michael A; Ratterman, Joseph D; Smith, Brian E

    2014-12-09

    Administering truncated receive functions in a parallel messaging interface (`PMI`) of a parallel computer comprising a plurality of compute nodes coupled for data communications through the PMI and through a data communications network, including: sending, through the PMI on a source compute node, a quantity of data from the source compute node to a destination compute node; specifying, by an application on the destination compute node, a portion of the quantity of data to be received by the application on the destination compute node and a portion of the quantity of data to be discarded; receiving, by the PMI on the destination compute node, all of the quantity of data; providing, by the PMI on the destination compute node to the application on the destination compute node, only the portion of the quantity of data to be received by the application; and discarding, by the PMI on the destination compute node, the portion of the quantity of data to be discarded.

  4. RF-Frontend Design for Process-Variation-Tolerant Receivers

    CERN Document Server

    Sakian, Pooyan; van Roermund, Arthur

    2012-01-01

    This book discusses a number of challenges faced by designers of wireless receivers, given complications caused by the shrinking of electronic and mobile devices circuitry into ever-smaller sizes and the resulting complications on the manufacturability, production yield, and the end price of the products.  The authors describe the impact of process technology on the performance of the end product and equip RF designers with countermeasures to cope with such problems.  The mechanisms by which these problems arise are analyzed in detail and novel solutions are provided, including design guidelines for receivers with robustness to process variations and details of circuit blocks that obtain the required performance level. Describes RF receiver frontends and their building blocks from a system- and circuit-level perspective; Provides system-level analysis of a generic RF receiver frontend with robustness to process variations; Includes details of CMOS circuit design at 60GHz and reconfigurable circuits at 60GHz...

  5. Asymmetric Hardware Distortions in Receive Diversity Systems: Outage Performance Analysis

    KAUST Repository

    Javed, Sidrah; Amin, Osama; Ikki, Salama S.; Alouini, Mohamed-Slim

    2017-01-01

    This paper studies the impact of asymmetric hardware distortion (HWD) on the performance of receive diversity systems using linear and switched combining receivers. The asymmetric attribute of the proposed model motivates the employment of improper Gaussian signaling (IGS) scheme rather than the traditional proper Gaussian signaling (PGS) scheme. The achievable rate performance is analyzed for the ideal and non-ideal hardware scenarios using PGS and IGS transmission schemes for different combining receivers. In addition, the IGS statistical characteristics are optimized to maximize the achievable rate performance. Moreover, the outage probability performance of the receive diversity systems is analyzed yielding closed form expressions for both PGS and IGS based transmission schemes. HWD systems that employ IGS is proven to efficiently combat the self interference caused by the HWD. Furthermore, the obtained analytic expressions are validated through Monte-Carlo simulations. Eventually, non-ideal hardware transceivers degradation and IGS scheme acquired compensation are quantified through suitable numerical results.

  6. Defense Logistics Agency Past Due Federal Accounts Receivable

    National Research Council Canada - National Science Library

    Lane, F

    1998-01-01

    .... The overall objective of this audit was to determine whether the accounts receivable on the FY 1996 Consolidated Financial Statements of the DBOF are presented fairly in accordance with the "other...

  7. Water Fluoridation Statistics - Percent of PWS population receiving fluoridated water

    Data.gov (United States)

    U.S. Department of Health & Human Services — 2000-2014 Water Fluoridation Statistics is a biennial report of the percentage and number of people receiving fluoridated water from 2000 through 2014, originally...

  8. NavCube: A fully realized modernized GPS receiver

    Data.gov (United States)

    National Aeronautics and Space Administration — The goal of this IRAD project is to complete the technology development of the modernized Navigator-SpaceCube GPS receiver (named the NavCube), enabling a potential...

  9. The Quality of Health Care Received by Older Adults

    National Research Council Canada - National Science Library

    2004-01-01

    .... Older adults suffer from a multitude of conditions and are especially susceptible to the effects of poor care, yet we know relatively little about the quality of health care older people receive...

  10. Monolithic optoelectronic integrated broadband optical receiver with graphene photodetectors

    Directory of Open Access Journals (Sweden)

    Cheng Chuantong

    2017-07-01

    Full Text Available Optical receivers with potentially high operation bandwidth and low cost have received considerable interest due to rapidly growing data traffic and potential Tb/s optical interconnect requirements. Experimental realization of 65 GHz optical signal detection and 262 GHz intrinsic operation speed reveals the significance role of graphene photodetectors (PDs in optical interconnect domains. In this work, a novel complementary metal oxide semiconductor post-backend process has been developed for integrating graphene PDs onto silicon integrated circuit chips. A prototype monolithic optoelectronic integrated optical receiver has been successfully demonstrated for the first time. Moreover, this is a firstly reported broadband optical receiver benefiting from natural broadband light absorption features of graphene material. This work is a perfect exhibition of the concept of monolithic optoelectronic integration and will pave way to monolithically integrated graphene optoelectronic devices with silicon ICs for three-dimensional optoelectronic integrated circuit chips.

  11. Monolithic optoelectronic integrated broadband optical receiver with graphene photodetectors

    Science.gov (United States)

    Cheng, Chuantong; Huang, Beiju; Mao, Xurui; Zhang, Zanyun; Zhang, Zan; Geng, Zhaoxin; Xue, Ping; Chen, Hongda

    2017-07-01

    Optical receivers with potentially high operation bandwidth and low cost have received considerable interest due to rapidly growing data traffic and potential Tb/s optical interconnect requirements. Experimental realization of 65 GHz optical signal detection and 262 GHz intrinsic operation speed reveals the significance role of graphene photodetectors (PDs) in optical interconnect domains. In this work, a novel complementary metal oxide semiconductor post-backend process has been developed for integrating graphene PDs onto silicon integrated circuit chips. A prototype monolithic optoelectronic integrated optical receiver has been successfully demonstrated for the first time. Moreover, this is a firstly reported broadband optical receiver benefiting from natural broadband light absorption features of graphene material. This work is a perfect exhibition of the concept of monolithic optoelectronic integration and will pave way to monolithically integrated graphene optoelectronic devices with silicon ICs for three-dimensional optoelectronic integrated circuit chips.

  12. Higher performance and lower cost optical DPSK receiver

    Data.gov (United States)

    National Aeronautics and Space Administration — To demonstrate (benchtop experiment) a DPSK receiver with a free-space interferometer, showing that fiber-optic coupling, associated adaptive optics, and optical...

  13. Asymmetric Hardware Distortions in Receive Diversity Systems: Outage Performance Analysis

    KAUST Repository

    Javed, Sidrah

    2017-02-22

    This paper studies the impact of asymmetric hardware distortion (HWD) on the performance of receive diversity systems using linear and switched combining receivers. The asymmetric attribute of the proposed model motivates the employment of improper Gaussian signaling (IGS) scheme rather than the traditional proper Gaussian signaling (PGS) scheme. The achievable rate performance is analyzed for the ideal and non-ideal hardware scenarios using PGS and IGS transmission schemes for different combining receivers. In addition, the IGS statistical characteristics are optimized to maximize the achievable rate performance. Moreover, the outage probability performance of the receive diversity systems is analyzed yielding closed form expressions for both PGS and IGS based transmission schemes. HWD systems that employ IGS is proven to efficiently combat the self interference caused by the HWD. Furthermore, the obtained analytic expressions are validated through Monte-Carlo simulations. Eventually, non-ideal hardware transceivers degradation and IGS scheme acquired compensation are quantified through suitable numerical results.

  14. A novel mirror diversity receiver for indoor MIMO visible light

    KAUST Repository

    Park, Ki-Hong; Alheadary, Wael G.; Alouini, Mohamed-Slim

    2016-01-01

    In this paper, we propose and study a non-imaging receiver design reducing the correlation of channel matrix for indoor multiple-input multiple-output (MIMO) visible light communication (VLC) systems. Contrary to previous works, our proposed mirror

  15. Using TV Receiver Information to Increase Cognitive White Space Spectrum

    OpenAIRE

    Ellingsæter, Brage; Bezabih, Hemdan; Noll, Josef; Maseng, Torleiv

    2012-01-01

    In this paper we investigate the usage of cognitive radio devices within the service area of TV broadcast stations. Until now the main approach for a cognitive radio to operate in the TV bands has been to register TV broadcast stations locations and thus protecting the broadcast stations service area. Through information about TV receivers location, we show that a cognitive radio should be able to operate within this service area without causing harmful interference to the TV receivers as def...

  16. Heat loss investigation from spherical cavity receiver of solar concentrator

    Energy Technology Data Exchange (ETDEWEB)

    Shewale, V. C. [Dept. of Mechanical Engineering, NDMVPS KBT College of Engineering, Nashik (India); Dongarwar, P. R. [Dept. of Mechanical Engineering, College of Military Engineering, Pune (India); Gawande, R. P. [Dept. of Mechanical Engineering, B.D.C.O.E. Wardha, Nagpur University, NagpurI (India)

    2016-11-15

    The heat losses are mainly affects on the performance of cavity receiver of solar concentrator. In this paper, the experimental and numerical study is carried out for different heat losses from spherical cavity receiver of 0.385 m cavity diameter and 0.154 m opening diameter. The total and convection losses are studied experimentally to no wind and wind conditions for the temperature range of 150 °C to 300 °C at 0°, 30°, 45°, 60° and 90° inclination angle of cavity receiver. The experimental set up mainly consists of copper tube material cavity receiver wrapped with nichrome heating coil to heat the cavity and insulated with glasswool insulation. The numerical analysis was carried out with Fluent Computational fluid dynamics (CFD) software, to study connective heat losses for no wind condition only. The numerical results are compared with experimental results and found good agreement with maximum deviation of 12 %. The effect of inclination angle of cavity receiver on total losses and convection losses shows that as the inclination angle increases from 0o to 90o, both losses decreased due to decreased in convective zone into the cavity receiver. The effect of operating temperature of cavity shows that as the temperature of cavity receiver increases, the total and convective losses goes on increasing. The effect of external wind at 2 m/s and 4 m/s in two directions (side-on wind and head-on wind) is also studied experimentally for total and convective heat losses. The result shows that the heat losses are higher for head-on wind condition compared to side-on wind and no wind condition at all inclination angle of cavity receiver. The present results are also compared to the convective losses obtained from the correlations of Stine and Mcdonald and M. Prakash. The convective loss from these correlations shows nearest prediction to both experimental and numerical results.

  17. Heat loss investigation from spherical cavity receiver of solar concentrator

    International Nuclear Information System (INIS)

    Shewale, V. C.; Dongarwar, P. R.; Gawande, R. P.

    2016-01-01

    The heat losses are mainly affects on the performance of cavity receiver of solar concentrator. In this paper, the experimental and numerical study is carried out for different heat losses from spherical cavity receiver of 0.385 m cavity diameter and 0.154 m opening diameter. The total and convection losses are studied experimentally to no wind and wind conditions for the temperature range of 150 °C to 300 °C at 0°, 30°, 45°, 60° and 90° inclination angle of cavity receiver. The experimental set up mainly consists of copper tube material cavity receiver wrapped with nichrome heating coil to heat the cavity and insulated with glasswool insulation. The numerical analysis was carried out with Fluent Computational fluid dynamics (CFD) software, to study connective heat losses for no wind condition only. The numerical results are compared with experimental results and found good agreement with maximum deviation of 12 %. The effect of inclination angle of cavity receiver on total losses and convection losses shows that as the inclination angle increases from 0o to 90o, both losses decreased due to decreased in convective zone into the cavity receiver. The effect of operating temperature of cavity shows that as the temperature of cavity receiver increases, the total and convective losses goes on increasing. The effect of external wind at 2 m/s and 4 m/s in two directions (side-on wind and head-on wind) is also studied experimentally for total and convective heat losses. The result shows that the heat losses are higher for head-on wind condition compared to side-on wind and no wind condition at all inclination angle of cavity receiver. The present results are also compared to the convective losses obtained from the correlations of Stine and Mcdonald and M. Prakash. The convective loss from these correlations shows nearest prediction to both experimental and numerical results

  18. Photonic integrated transmitter and receiver for NG-PON2

    Science.gov (United States)

    Tavares, Ana; Lopes, Ana; Rodrigues, Cláudio; Mãocheia, Paulo; Mendes, Tiago; Brandão, Simão.; Rodrigues, Francisco; Ferreira, Ricardo; Teixeira, António

    2014-08-01

    In this paper the authors present a monolithic Photonic Integrated Circuit which includes a transmitter and a receiver for NG-PON2. With this layout it is possible to build an OLT and, by redesigning some filters, also an ONU. This technology allows reducing the losses in the transmitter and in the receiver, increasing power budget, and also reducing the OEO conversions, which has been a major problem that operators want to surpass.

  19. Hybrid solar central receiver for combined cycle power plant

    Science.gov (United States)

    Bharathan, Desikan; Bohn, Mark S.; Williams, Thomas A.

    1995-01-01

    A hybrid combined cycle power plant including a solar central receiver for receiving solar radiation and converting it to thermal energy. The power plant includes a molten salt heat transfer medium for transferring the thermal energy to an air heater. The air heater uses the thermal energy to preheat the air from the compressor of the gas cycle. The exhaust gases from the gas cycle are directed to a steam turbine for additional energy production.

  20. Waste Receiving and Processing (WRAP) Weight Scale Analysis Results

    International Nuclear Information System (INIS)

    JOHNSON, M.D.

    2000-01-01

    Fairbanks Weight Scales are used at the Waste Receiving and Processing (WRAP) facility to determine the weight of waste drums as they are received, processed, and shipped. Due to recent problems, discovered during calibration, the WRAP Engineering Department has completed this document which outlines both the investigation of the infeed conveyor scale failure in September of 1999 and recommendations for calibration procedure modifications designed to correct deficiencies in the current procedures

  1. Long-Term Heating to Improve Receiver Performance

    Energy Technology Data Exchange (ETDEWEB)

    Glatzmaier, Greg C.; Cable, Robert; Newmarker, Marc

    2017-06-27

    The buildup of hydrogen in the heat transfer fluid (HTF) that circulates through components of parabolic trough power plants decreases receiver thermal efficiency, and ultimately, it decreases plant performance and electricity output. The generation and occurrence of hydrogen in the HTF provides the driving force for hydrogen to permeate from the HTF through the absorber tube wall and into the receiver annulus. Getters adsorb hydrogen from the annulus volume until they saturate and are no longer able to maintain low hydrogen pressure. The increase in hydrogen pressure within the annulus significantly degrades thermal performance of the receiver and decreases overall power-plant efficiency. NREL and Acciona Energy North America (Acciona) are developing a method to control the levels of dissolved hydrogen in the circulating HTF. The basic approach is to remove hydrogen from the expansion tanks of the HTF subsystem at a rate that maintains hydrogen in the circulating HTF to a target level. Full-plant steady-state models developed by the National Renewable Energy Laboratory (NREL) predict that if hydrogen is removed from the HTF within the expansion tanks, the HTF that circulates through the collector field remains essentially free of hydrogen until the HTF returns to the power block in the hot headers. One of the key findings of our modeling is the prediction that hydrogen will reverse-permeate out of the receiver annulus if dissolved hydrogen in the HTF is kept sufficiently low. To test this prediction, we performed extended heating of an in-service receiver that initially had high levels of hydrogen in its annulus. The heating was performed using NREL's receiver test stand. Results of our testing showed that receiver heat loss steadily decreased with daily heating, resulting in a corresponding improvement in receiver thermal efficiency.

  2. Many southwest hosptials will receive decreased CMS reimbursement

    OpenAIRE

    Robbins RA

    2013-01-01

    No abstract available. Article truncated at 150 words. More hospitals are receiving penalties than bonuses in the second year of the Centers for Medicare and Medicaid Services’ (CMS) quality incentive program, and the average penalty is steeper than last year according to a report from Jordan Rau in Kaiser Health News (1). Southwest hospitals reflect that trend with New Mexico and Arizona exceeding the US average both in percentage of hospitals receiving penalties and the average size of the ...

  3. Ultrasound sounding in air by fast-moving receiver

    Science.gov (United States)

    Sukhanov, D.; Erzakova, N.

    2018-05-01

    A method of ultrasound imaging in the air for a fast receiver. The case, when the speed of movement of the receiver can not be neglected with respect to the speed of sound. In this case, the Doppler effect is significant, making it difficult for matched filtering of the backscattered signal. The proposed method does not use a continuous repetitive noise-sounding signal. generalized approach applies spatial matched filtering in the time domain to recover the ultrasonic tomographic images.

  4. Quality of life of lung cancer patients receiving outpatient chemotherapy

    OpenAIRE

    MATSUDA, AYAKO; KOBAYASHI, MIKA; SAKAKIBARA, YUMI; TAMAOKA, MEIYO; FURUIYE, MASASHI; INASE, NAOHIKO; MATSUSHIMA, EISUKE

    2011-01-01

    An increasing number of cancer patients receive outpatient chemotherapy as an alternative to inpatient chemotherapy. The aim of this study was to investigate whether quality of life (QOL) during outpatient chemotherapy was better than QOL prior to hospital discharge, and to explore possible related factors prior to hospital discharge that affected the QOL of lung cancer patients who received outpatient chemotherapy. Lung cancer inpatients who were scheduled for outpatient chemotherapy were as...

  5. Management of hepatitis B reactivation in patients receiving cancer chemotherapy

    OpenAIRE

    Huang, Yi-Wen; Chung, Raymond T.

    2012-01-01

    Hepatitis B virus (HBV) reactivation is well documented in previously resolved or inactive HBV carriers who receive cancer chemotherapy. The consequences of HBV reactivation range from self-limited conditions to fulminant hepatic failure and death. HBV reactivation also leads to premature termination of chemotherapy or delay in treatment schedules. This review summarizes current knowledge of management of HBV reactivation in patients receiving cancer chemotherapy. HBV surface antigen (HBsAg) ...

  6. Testing the Grandchildren's Received Affection Scale using Affection Exchange Theory.

    Science.gov (United States)

    Mansson, Daniel H

    2013-04-01

    The purpose of this study was to test the Grandchildren's Received Affection Scale (GRAS) using Affection Exchange Theory (Floyd, 2006). In accordance with Affection Exchange Theory, it was hypothesized that grandchildren's scores on the Trait Affection Received Scale (i.e., the extent to which individuals by nature receive affection) would be related significantly and positively to their reports of received affection from their grandparents (i.e., their scores on the GRAS). Additionally, a research question was asked to explore if grandchildren's received affection from their grandparents is dependent on their grandparent's biological sex or lineage (i.e., maternal vs paternal). Thus, young adult grandchildren (N = 422) completed the GRAS and the Trait Affection Received Scale. The results of zero-order Pearson correlational analyses provided support for the hypothesis, whereas the results of MANOVAs tests only partially support extant grandparent-grandchild theory and research. These findings broaden the scope of Affection Exchange Theory and also bolster the GRAS's utility in future grandparent-grandchild affectionate communication research.

  7. Wake-up receiver based ultra-low-power WBAN

    CERN Document Server

    Lont, Maarten; Roermund, Arthur van

    2014-01-01

    This book presents the cross-layer design and optimization of wake-up receivers for wireless body area networks (WBAN), with an emphasis on low-power circuit design. This includes the analysis of medium access control (MAC) protocols, mixer-first receiver design, and implications of receiver impairments on wideband frequency-shift-keying (FSK) receivers. Readers will learn how the overall power consumption is reduced by exploiting the characteristics of body area networks. Theoretical models presented are validated with two different receiver implementations, in 90nm and 40nm CMOS technology.   • Provides an overview of wireless body area network design from the network layer to the circuit implementation, and an overview of the cross-layer design trade-offs; • Discusses design at both the network or MAC-layer and circuit-level, with an emphasis on circuit design; • Covers the design of low-power frequency shift keying (FSK) wake-up-receivers; • Validates theory presented with two different recei...

  8. Multi-parameter optimization design of parabolic trough solar receiver

    International Nuclear Information System (INIS)

    Guo, Jiangfeng; Huai, Xiulan

    2016-01-01

    Highlights: • The optimal condition can be obtained by multi-parameter optimization. • Exergy and thermal efficiencies are employed as objective function. • Exergy efficiency increases at the expense of heat losses. • The heat obtained by working fluid increases as thermal efficiency grows. - Abstract: The design parameters of parabolic trough solar receiver are interrelated and interact with one another, so the optimal performance of solar receiver cannot be obtained by the convectional single-parameter optimization. To overcome the shortcoming of single-parameter optimization, a multi-parameter optimization of parabolic trough solar receiver is employed based on genetic algorithm in the present work. When the thermal efficiency is taken as the objective function, the heat obtained by working fluid increases while the average temperature of working fluid and wall temperatures of solar receiver decrease. The average temperature of working fluid and the wall temperatures of solar receiver increase while the heat obtained by working fluid decreases generally by taking the exergy efficiency as an objective function. Assuming that the solar radiation intensity remains constant, the exergy obtained by working fluid increases by taking exergy efficiency as the objective function, which comes at the expense of heat losses of solar receiver.

  9. Autonomous Integrated Receive System (AIRS) requirements definition. Volume 4: Functional specification for the prototype Automated Integrated Receive System (AIRS)

    Science.gov (United States)

    Chie, C. M.

    1984-01-01

    The functional requirements for the performance, design, and testing for the prototype Automated Integrated Receive System (AIRS) to be demonstrated for the TDRSS S-Band Single Access Return Link are presented.

  10. Conceptual design of advanced central receiver power systems sodium-cooled receiver concept. Volume 2, Book 2. Appendices. Final report

    Energy Technology Data Exchange (ETDEWEB)

    1979-03-01

    The appendices include: (A) design data sheets and P and I drawing for 100-MWe commercial plant design, for all-sodium storage concept; (B) design data sheets and P and I drawing for 100-MWe commercial plant design, for air-rock bed storage concept; (C) electric power generating water-steam system P and I drawing and equipment list, 100-MWe commercial plant design; (D) design data sheets and P and I drawing for 281-MWe commercial plant design; (E) steam generator system conceptual design; (F) heat losses from solar receiver surface; (G) heat transfer and pressure drop for rock bed thermal storage; (H) a comparison of alternative ways of recovering the hydraulic head from the advanced solar receiver tower; (I) central receiver tower study; (J) a comparison of mechanical and electromagnetic sodium pumps; (K) pipe routing study of sodium downcomer; and (L) sodium-cooled advanced central receiver system simulation model. (WHK)

  11. Receiving more than data - a signal model, theory and implementation of a cognitive IEEE 802.15.4 receiver

    Directory of Open Access Journals (Sweden)

    Tim Esemann

    2016-09-01

    Full Text Available Standard medium access schemes sense the channel immediately prior transmission, but are blind during the transmission. Therefore, standard transceivers have limited cognitive capabilities which are important for operation in heterogeneous radio environments. Specifically, mobile interferers move gradually into the reception range before actually causing collisions. These gradual interferences cannot yet be detected, and upcoming collisions cannot be predicted. We present a theoretical analysis of the received and demodulated signal. This analysis and the derived signal model verifies that the received signal contains more than transmitted data exclusively. Enhanced signal processing extracts signal components of an interference at the receiver and enables advanced interference detection to provide information about approaching mobile interferers. Our theoretical analysis is evaluated by simulations and experiments with an IEEE 802.15.4 transmitter and an extended cognitive receiver.

  12. Wide-band coherent receiver development for enhanced surveillance

    International Nuclear Information System (INIS)

    Simpson, M.L.; Richards, R.K.; Hutchinson, D.P.

    1998-03-01

    Oak Ridge National Laboratory (ORNL) has been developing advanced coherent IR heterodyne receivers for plasma diagnostics in fusion reactors for over 20 years. Recent progress in wide band IR detectors and high speed electronics has significantly enhanced the measurement capabilities of coherent receivers. In addition, developments in new HgCdTe and quantum well IR photodetector (QWIP) focal plane arrays are providing the possibility of both active and passive coherent imaging. In this paper the authors discuss the implications of these new enabling technologies to the IR remote sensing community for enhanced surveillance. Coherent receivers, as opposed to direct or thermal detection, provide multiple dimensions of information about a scene or target in a single detector system. Combinations of range, velocity, temperature, and chemical species information are all available from a coherent heterodyne receiver. They present laboratory data showing measured noise equivalent power (NEP) of new QWIP detectors with heterodyne bandwidths greater than 7 GHz. For absorption measurements, a wide band coherent receiver provides the capability of looking between CO 2 lines at off-resonance peaks and thus the measurement of lines normally inaccessible with conventional heterodyne or direct detection systems. Also described are differential absorption lidar (DIAL) and Doppler laboratory measurements using an 8 x 8 HgCdTe focal plane array demonstrating the snapshot capability of coherent receiver detector arrays for enhanced chemical plume and moving hardbody capture. Finally they discuss a variety of coherent receiver configurations that can suppress (or enhance) sensitivity of present active remote sensing systems to speckle, glint, and other measurement anomalies

  13. Software for Adapting Dspz Receivers to the Uran Interferometer Network

    Science.gov (United States)

    Isaeva, E. A.; Lytvynenko, O. A.; Shepelev, V. A.

    More than 10 years ago, URAN interferometer network (Megn A.V.,1997; Konovalenko A.A., 2014) had been equipped with newly designed receivers with a pass band extended up to 250 kHz and software rejection of interferences (Rashkovskii, 2012). The broadening of bandwidth of received signal increase the sensitivity of the receivers significantly and let us to investigate the angular structure about one hundred radio sources. A software package had been developed that allows: preparing a program of observations, carrying out observations automatically, making data cross-correlation, calculating visibility functions for all pairs of antennae, and fitting models of an angular structure of the sources. Data storage formats were elaborated for each stage of recording or processing. At present, new digital radio astronomy receiver DSPZ have been developed by IRA NASU (Zakharenko, 2016). The receiver allows recording an entire bandwidth of signals of a decameter range from 8 to 32 MHz. It is used at UTR-2 and URAN radio telescopes operated in a single dish mode. Application of the receivers for interferometer observation with the URAN network provides additional advantages in accuracy and sensitivity of studies. In this report we consider the data formats and synchronization methods used in URAN equipment and DSPZ receivers, and discuss algorithms of their transformation. Newly elaborated software is described, that allows selecting a set of frequency bands of signals recorded with DSPZ and converting them to the form used by the URAN software. This approach allows us to carry out the interferometer observations in an the extended frequency range provided by DSPZ and to use as much as possible the software package developed for the URAN network for data reduction.

  14. An experimental study of thermal characterization of parabolic trough receivers

    International Nuclear Information System (INIS)

    Lei, Dongqiang; Li, Qiang; Wang, Zhifeng; Li, Jian; Li, Jianbin

    2013-01-01

    Highlights: ► A new test stand of heat loss has been developed at IEECAS. ► A correlation between heat loss and absorber temperature is presented, 270 W/m 400 °C. ► The ratio of end loss in total heat loss increases with decreasing the temperature. ► The emittance test stand using a high vacuum system and vacuum gauge is built. ► Emittance first decreases, then rapidly increases with increasing the temperature. - Abstract: The receiver is a key component of the parabolic trough solar station. The receiver requires the most challenging technology and has a decisive influence on the thermal and economic performance of a power plant. The Institute of Electrical Engineering Chinese Academy Sciences (IEECAS) and Himin Solar Co., Ltd. (HSC) cooperated to develop solar receivers for the first 50 MW parabolic trough project in Inner Mongolia, China. This paper examines overall heat loss, end loss and thermal emittance of the coating of a newly designed receiver in order to evaluate its thermal characterization. A series of heat loss tests are conducted in a newly developed test stand following the steady state equilibrium method. The tests provide a correlation between heat loss and the absorber temperature. This paper presents a new testing method to accurately test the coating emittance. The method uses a receiver with a high vacuum system and a vacuum gauge to maintain continuous exhaust and high vacuum throughout the heat loss testing. A heat loss comparison between the receiver and other existing receivers provides a reference that enabled further optimization. Theoretical and experimental analysis examines the effects of end loss both with and without a heat insulator and a coil heater. The emittance curves of different coatings are acquired and the reasons for initial emittance decrease and then remarkable increase versus temperature are analyzed

  15. Performance and durability testing of parabolic trough receivers

    Science.gov (United States)

    Lei, Dongqiang; Fu, Xuqiang; Zhao, Dongming; Yuan, Guofeng; Wang, Zhifeng; Guo, Minghuan

    2017-06-01

    The paper describes the key performance and durability testing facilities of the parabolic trough receiver developed by Institute of Electrical Engineering, Chinese Academy of Sciences. The indoor heat loss test can be applied at 4-7 different temperature levels within 200-550 on receivers. The optical efficiency test bench consists of 12 metal halide lamps as the solar simulator and a 5 m length half-elliptical cylinder reflector with flat end reflectors. 3 ultra-precision temperature sensors are used in receiver each end to get the temperature difference. The residual gas analysis test bench is applied to analyze and predict the vacuum lifetime of the receiver. It can test the variations of composition and partial pressure of residual gases with temperature and time in the receiver annulus space by a high sensitivity quadrupole mass spectrometer gas analyzer. A coating accelerated ageing test bench, which is also used to test the thermal cycle, has been developed. This test bench uses the absorber tube of the recevier as the resistance heater to heat up the whole receiver. The coating lifetime can be predicted by the Arrhenius parameters. For the cycling test, the compressed air is used to directly cool the inner surface of the absorber tube. The thermal cycling test is performed with temperature cycles from 150 °C to 450 °C for 160 cycles. The maximum thermal cycling frequency is 8 cycles per day. The mechanical fatigue test bench is used to test the bellows and the glass-to-metal seals durability at the same time. Both bellows are expanded and compressed to 6.5 mm in turn with 10,000 cycles. A new rotating test bench was also developed to test the thermal efficiency of the receiver.

  16. Review and future perspective of central receiver design and performance

    Science.gov (United States)

    Zhu, Guangdong; Libby, Cara

    2017-06-01

    Concentrating solar power (CSP) technology provides a commercial solar option to the utility-scale electricity market. CSP is unique in its ability to include low-cost thermal storage; thus, it can generate electricity when the sun is not available and dispatch electricity to meet varying load requirements. Within the suite of CSP technologies, the central receiver design represents the state-of-the-art technology, promising low cost, high performance, and dispatchable energy production. Current total capacity of central receiver plants worldwide is about 1.0 gigawatt (electric) with operating plants in Spain and the United States, as well as projects under construction in Asia, the Middle East, and North Africa. Central receiver technology has been under development since the 1950s, and a variety of central receiver designs have been explored. A distinguishing feature is the heat transfer medium. Central receiver designs exist that use dense fluids, gases, and solid particles in this role. Water/steam and molten salt receivers have been adopted in current commercial plants and are often coupled with a steam-Rankine power cycle with an operating temperature of less than 600°C. Many new central receiver concepts, such as the volumetric air, supercritical carbon dioxide (sCO2), solid particle, and liquid-metal receiver designs, are under active research and development (R&D). New designs target operating temperatures generally higher than 700°C-800°C—and even above 1000°C—so that higher-performance power cycles such as the sCO2-Brayton cycle or air-Brayton/steam-Rankine combined cycle can be used to promote greater overall system efficiency. Central receiver thermal storage provides dispatchability unavailable from variable-output renewables such as solar photovoltaic and wind power. Case study analysis of the California grid shows that there is a limit on the amount of non-dispatchable renewable generation that the grid can accommodate, beyond which

  17. Review and Future Perspective of Central Receiver Design and Performance

    Energy Technology Data Exchange (ETDEWEB)

    Zhu, Guangdong; Libby, Cara

    2017-06-27

    Concentrating solar power (CSP) technology provides a commercial solar option to the utility-scale electricity market. CSP is unique in its ability to include low-cost thermal storage; thus, it can generate electricity when the sun is not available and dispatch electricity to meet varying load requirements. Within the suite of CSP technologies, the central receiver design represents the state-of-the-art technology, promising low cost, high performance, and dispatchable energy production. Current total capacity of central receiver plants worldwide is about 1.0 gigawatt (electric) with operating plants in Spain and the United States, as well as projects under construction in Asia, the Middle East, and North Africa. Central receiver technology has been under development since the 1950s, and a variety of central receiver designs have been explored. A distinguishing feature is the heat transfer medium. Central receiver designs exist that use dense fluids, gases, and solid particles in this role. Water/steam and molten salt receivers have been adopted in current commercial plants and are often coupled with a steam-Rankine power cycle with an operating temperature of less than 600 degrees C. Many new central receiver concepts, such as the volumetric air, supercritical carbon dioxide (sCO2), solid particle, and liquid-metal receiver designs, are under active research and development (R&D). New designs target operating temperatures generally higher than 700 degrees C-800 degrees C -- and even above 1000 degrees C -- so that higher-performance power cycles such as the sCO2-Brayton cycle or air-Brayton/steam-Rankine combined cycle can be used to promote greater overall system efficiency. Central receiver thermal storage provides dispatchability unavailable from variable-output renewables such as solar photovoltaic and wind power. Case study analysis of the California grid shows that there is a limit on the amount of non-dispatchable renewable generation that the grid can

  18. Performance Evaluation of Irbene RT-16 Radio Telescope Receiving System

    Directory of Open Access Journals (Sweden)

    Bleiders M.

    2017-12-01

    Full Text Available In the present paper, recent measurement results of refurbished Irbene RT-16 radio telescope receiving system performance are presented. The aim of the research is to evaluate characteristics of RT-16, which will allow carrying out necessary amplitude calibration in both single dish and VLBI observations, to improve the performance of existing system as well as to monitor, control and compare performance if possible changes in the receiving system will occur in future. The evaluated receiving system is 16 m Cassegrain antenna equipped with a cryogenic receiver with frequency range from 4.5 to 8.8 GHz, which is divided into four sub-bands. Multiple calibration sessions have been carried out by observing stable astronomical sources with known flux density by using in-house made total power registration backend. First, pointing offset calibration has been carried out and pointing model coefficients calculated and applied. Then, amplitude calibration, namely antenna sensitivity, calibration diode equivalent flux density and gain curve measurements have been carried out by observing calibration sources at different antenna elevations at each of the receiver sub-bands. Beam patterns have also been evaluated at different frequency bands. As a whole, acquired data will serve as a reference point for comparison in future performance evaluation of RT-16.

  19. The Issues of the Management of Receivables: Lithuanian Case

    Directory of Open Access Journals (Sweden)

    Remeikiene Rita

    2016-06-01

    Full Text Available Constant changes in business environment determine the significance of receivables to business. The analysis of the current situation in Lithuania has revealed that a substantial part of business enterprises are facing the problem of overdue receivables. This issue emerged as extremely topical after the beginning of the economic crisis in 2008. A number of scientific studies confirmed that the level of receivables has a significant impact not only on smooth business operation but also on operational results and serves as the cause of numerous economic and social problems, faced by both business enterprises and the state. Rising level of receivables determines slower recovery of total economics because it has a negative impact on the sustainability of the public sector of the country. In addition, the scientists highlight economic problems such as production capacity losses, general decrease in competitiveness and failure to satisfy the debt claims. The social problems include the increase in unemployment rate, fall of living standards, dissatisfaction with poor economics of the country and uncertainty about the future. The aim of this article is to analyse the impact of receivables on business in Lithuania. The methods of the research include scientific literature analysis and statistical data analysis.

  20. Smooth time-dependent receiver operating characteristic curve estimators.

    Science.gov (United States)

    Martínez-Camblor, Pablo; Pardo-Fernández, Juan Carlos

    2018-03-01

    The receiver operating characteristic curve is a popular graphical method often used to study the diagnostic capacity of continuous (bio)markers. When the considered outcome is a time-dependent variable, two main extensions have been proposed: the cumulative/dynamic receiver operating characteristic curve and the incident/dynamic receiver operating characteristic curve. In both cases, the main problem for developing appropriate estimators is the estimation of the joint distribution of the variables time-to-event and marker. As usual, different approximations lead to different estimators. In this article, the authors explore the use of a bivariate kernel density estimator which accounts for censored observations in the sample and produces smooth estimators of the time-dependent receiver operating characteristic curves. The performance of the resulting cumulative/dynamic and incident/dynamic receiver operating characteristic curves is studied by means of Monte Carlo simulations. Additionally, the influence of the choice of the required smoothing parameters is explored. Finally, two real-applications are considered. An R package is also provided as a complement to this article.

  1. Design of DGPS Receiver Based on the Net of VRS

    Directory of Open Access Journals (Sweden)

    Yun XU

    2014-02-01

    Full Text Available To improve the positioning accuracy of the GPS system, the differential technology based on real time kinematic is utilized. Comparing with the conventional differential technology, the differential technology based on the virtual reference station can minimize the size of the rover station which is of great significance for the small system such as the mini-type unmanned vehicle, smart ammunitions and so on. Due to the high cost of the GPS receivers in the market which can’t be redeveloped and the limitation of their interface, it is not suitable for the application of the embedded system. In this paper, the receiver based on the aforementioned method is proposed to realize the real time differential positioning. Firstly, the concept of differential positioning based on real time kinematic is explained. Next, the composition of the virtual reference system and its working principle are introduced. And then, the design of differential GPS receiver based on the virtual reference system for rover station is illustrated. Finally, from the repeatability test, the result shows that by means of getting the differential corrections from the virtual reference station, the designed differential GPS receiver can correct the errors caused by ionosphere, troposphere and atmospheric refraction. Moreover, it can improve the positioning accuracy to centimeter-level. With low cost, small size and convertibility of the interface of the designed differential GPS receiver according to the embedded system, it will be popular in the future market.

  2. Quad channel software defined receiver for passive radar application

    Directory of Open Access Journals (Sweden)

    Pető Tamás

    2017-03-01

    Full Text Available In recent times the growing utilization of the electromagnetic environment brings the passive radar researches more and more to the fore. For the utilization of the wide range of illuminators of opportunity the application of wideband radio receivers is required. At the same time the multichannel receiver structure has also critical importance in target direction finding and interference suppression. This paper presents the development of a multichannel software defined receiver specifically for passive radar applications. One of the relevant feature of the developed receiver platform is its up-to-date SoC (System on hip based structure, which greatly enhance the integration and signal processing capacity of the system, all while keeping the costs low. The software defined operation of the discussed receiver system is demonstrated with using DVB-T (Digital Video Broadcast – Terrestrial signal as illuminator of opportunity. During this demonstration the multichannel capabilities of the realized system are also tested with real data using direction finding and beamforming algorithms.

  3. Is phenytoin contraindicated in patients receiving cranial irradiation?

    Energy Technology Data Exchange (ETDEWEB)

    Borg, M.F. [Royal Adelaide Hospital, SA (Australia); Probert, J.C. [Auckland Hospital, Auckland (New Zealand). Dept. of Radiation Oncology; Zwi, L.J. [Auckland Univ. (New Zealand). Dept. of Medicine and Surgery

    1995-02-01

    Three recent publications have reported the development of erythema multiforme and Stevens-Johnson syndrome in patients receiving cranial irradiation and sodium phenytoin. Some authors have recommended that patients receiving whole brain radiation therapy and who have had seizures should not be prescribed phenytoin but an alternative anticonvulsant. This article reviews the current literature pertaining to the development of this potentially lethal complication in patients receiving whole brain radiation and phenytoin, with reference to the single recorded case of Stevens-Johnson syndrome in a patient receiving cranial irradiation and phenytoin in Auckland, New Zealand. While the clinical picture in the 16 patients reported in the literature and the current case report differed from the classical form of erythema multiforme, a similar pattern of presentation and outcome appeared in all patients reviewed, suggesting that the combination of phenytoin, cranial irradiation and the gradual reduction of concomitant steroids seem to lead to the development of erythema multiforme and/or Stevens-Johnson syndrome. The data presented, although sparse, suggest that phenytoin should not be prescribed in patients receiving cranial irradiation. 21 refs., 2 tabs., 3 figs.

  4. Graphene integrated circuits: new prospects towards receiver realisation.

    Science.gov (United States)

    Saeed, Mohamed; Hamed, Ahmed; Wang, Zhenxing; Shaygan, Mehrdad; Neumaier, Daniel; Negra, Renato

    2017-12-21

    This work demonstrates a design approach which enables the fabrication of fully integrated radio frequency (RF) and millimetre-wave frequency direct-conversion graphene receivers by adapting the frontend architecture to exploit the state-of-the-art performance of the recently reported wafer-scale CVD metal-insulator-graphene (MIG) diodes. As a proof-of-concept, we built a fully integrated microwave receiver in the frequency range 2.1-2.7 GHz employing the strong nonlinearity and the high responsivity of MIG diodes to successfully receive and demodulate complex, digitally modulated communication signals at 2.45 GHz. In addition, the fabricated receiver uses zero-biased MIG diodes and consumes zero dc power. With the flexibility to be fabricated on different substrates, the prototype receiver frontend is fabricated on a low-cost, glass substrate utilising a custom-developed MMIC process backend which enables the high performance of passive components. The measured performance of the prototype makes it suitable for Internet-of-Things (IoT) and Radio Frequency Identification (RFID) systems for medical and communication applications.

  5. Distributed sensing of ionospheric irregularities with a GNSS receiver array

    Science.gov (United States)

    Su, Yang; Datta-Barua, Seebany; Bust, Gary S.; Deshpande, Kshitija B.

    2017-08-01

    We present analysis methods for studying the structuring and motion of ionospheric irregularities at the subkilometer scale sizes that produce L band scintillations. Spaced-receiver methods are used for Global Navigation Satellite System (GNSS) receivers' phase measurements over approximately subkilometer to kilometer length baselines for the first time. The quantities estimated by these techniques are plasma drift velocity, diffraction anisotropy magnitude and orientation, and characteristic velocity. Uncertainties are quantified by ensemble simulation of noise on the phase signals carried through to the observations of the spaced-receiver linear system. These covariances are then propagated through to uncertainties on drifts through linearization about the estimated values of the state. Five receivers of SAGA, the Scintillation Auroral Global Positioning System (GPS) Array, provide 100 Hz power and phase data for each channel at L1 frequency. The array is sited in the auroral zone at Poker Flat Research Range, Alaska. A case study of a single scintillating satellite observed by the array is used to demonstrate the spaced-receiver and uncertainty estimation process. A second case study estimates drifts as measured by multiple scintillating channels. These scintillations are correlated with auroral activity, based on all-sky camera images. Measurements and uncertainty estimates made over a 30 min period are compared to a collocated incoherent scatter radar and show good agreement in horizontal drift speed and direction during periods of scintillation for which the characteristic velocity is less than the drift velocity.

  6. Is phenytoin contraindicated in patients receiving cranial irradiation?

    International Nuclear Information System (INIS)

    Borg, M.F.; Probert, J.C.; Zwi, L.J.

    1995-01-01

    Three recent publications have reported the development of erythema multiforme and Stevens-Johnson syndrome in patients receiving cranial irradiation and sodium phenytoin. Some authors have recommended that patients receiving whole brain radiation therapy and who have had seizures should not be prescribed phenytoin but an alternative anticonvulsant. This article reviews the current literature pertaining to the development of this potentially lethal complication in patients receiving whole brain radiation and phenytoin, with reference to the single recorded case of Stevens-Johnson syndrome in a patient receiving cranial irradiation and phenytoin in Auckland, New Zealand. While the clinical picture in the 16 patients reported in the literature and the current case report differed from the classical form of erythema multiforme, a similar pattern of presentation and outcome appeared in all patients reviewed, suggesting that the combination of phenytoin, cranial irradiation and the gradual reduction of concomitant steroids seem to lead to the development of erythema multiforme and/or Stevens-Johnson syndrome. The data presented, although sparse, suggest that phenytoin should not be prescribed in patients receiving cranial irradiation. 21 refs., 2 tabs., 3 figs

  7. Performance evaluation of GPS receiver under equatorial scintillation

    Directory of Open Access Journals (Sweden)

    Alison de Oliveira Moraes

    2009-06-01

    Full Text Available Equatorial scintillation is a phenomenon that occurs daily in the equatorial region after the sunset and affects radio signals that propagate through the ionosphere. Depending on the temporal and spatial situation, equatorial scintillation can represent a problem in the availability and precision of the Global Positioning System (GPS. This work is concerned with evaluating the impact of equatorial scintillation on the performance of GPS receivers. First, the morphology and statistical model of equatorial scintillation is briefly presented. A numerical model that generates synthetic scintillation data to simulate the effects of equatorial scintillation is presented. An overview of the main theoretical principles on GPS receivers is presented. The analytical models that describe the effects of scintillation at receiver level are presented and compared with numerical simulations using a radio software receiver and synthetic data. The results achieved by simulation agreed quite well with those predicted by the analytical models. The only exception is for links with extreme levels of scintillation and when weak signals are received.

  8. MR-based conductivity imaging using multiple receiver coils.

    Science.gov (United States)

    Lee, Joonsung; Shin, Jaewook; Kim, Dong-Hyun

    2016-08-01

    To propose a signal combination method for MR-based tissue conductivity mapping using a standard clinical scanner with multiple receiver coils. The theory of the proposed method is presented with two practical approaches, a coil-specific approach and a subject-specific approach. Conductivity maps were reconstructed using the transceive phase of the combined signal. The sensitivities of the coefficients used for signal combination were analyzed and the method was compared with other signal combination methods. For validation, multiple receiver brain coils and multiple receiver breast coils were used in phantom, in vivo brain, and in vivo breast studies. The variation among the conductivity estimates was conductivity estimates. MR-based tissue conductivity mapping is feasible when using a standard clinical MR scanner with multiple receiver coils. The proposed method reduces systematic errors in phase-based conductivity mapping that can occur due to the inhomogeneous magnitude of the combined receive profile. Magn Reson Med 76:530-539, 2016. © 2015 Wiley Periodicals, Inc. © 2015 Wiley Periodicals, Inc.

  9. Integrated synchronous receiver channel for optical instrumentation applications

    Science.gov (United States)

    Benten, Harold G. P. H.; Ruotsalainen, Tarmo; Maekynen, Anssi J.; Rahkonen, Timo E.; Kopola, Harri K.

    1997-09-01

    A two-channel synchronous receiver circuit for optical instrumentation applications has been designed and implemented. Each receiver channel comprises a.o. transimpedance preamplifier, voltage amplifiers, programmable feedback networks, and a synchronous detector. The function of the channel is to extract the slowly varying information carrying signal from a modulated carrier which is accompanied by relatively high levels of noise. As a whole, the channel can be characterized as a narrow band filter around the frequency of interest. Medical applications include arterial oxygen saturation (SaO2) measurement and dental pulp vitality measurement. In both cases, two optical signals with different frequencies are received by a single photodiode. The measured performance of the optical receiver shows its suitability for the above mentioned applications. Therefore the circuit will be used in a small sized, battery-operated sensor prototype to test the sensing method in a clinical environment. Other applications include the signal processing of optical position-sensitive detectors. A summary of measured receiver channel performance: input reduced noise current spectral density between 0.20 and 0.30 pA/(root)Hz at all relevant frequencies, total programmable channel transimpedance between 7 M(Omega) and 500 M(Omega) , lower -3 dB frequency of at least 50 Hz, upper -3 dB frequency of 40 kHz, maximum voltage swing at the demodulator output of 2.4 V.

  10. Thermal State-of-Charge in Solar Heat Receivers

    Science.gov (United States)

    Hall, Carsie, A., III; Glakpe, Emmanuel K.; Cannon, Joseph N.; Kerslake, Thomas W.

    1998-01-01

    A theoretical framework is developed to determine the so-called thermal state-of-charge (SOC) in solar heat receivers employing encapsulated phase change materials (PCMS) that undergo cyclic melting and freezing. The present problem is relevant to space solar dynamic power systems that would typically operate in low-Earth-orbit (LEO). The solar heat receiver is integrated into a closed-cycle Brayton engine that produces electric power during sunlight and eclipse periods of the orbit cycle. The concepts of available power and virtual source temperature, both on a finite-time basis, are used as the basis for determining the SOC. Analytic expressions for the available power crossing the aperture plane of the receiver, available power stored in the receiver, and available power delivered to the working fluid are derived, all of which are related to the SOC through measurable parameters. Lower and upper bounds on the SOC are proposed in order to delineate absolute limiting cases for a range of input parameters (orbital, geometric, etc.). SOC characterization is also performed in the subcooled, two-phase, and superheat regimes. Finally, a previously-developed physical and numerical model of the solar heat receiver component of NASA Lewis Research Center's Ground Test Demonstration (GTD) system is used in order to predict the SOC as a function of measurable parameters.

  11. Design of a cavity heat pipe receiver experiment

    Science.gov (United States)

    Schneider, Michael G.; Brege, Mark H.; Greenlee, William J.

    1992-01-01

    A cavity heat pipe experiment has been designed to test the critical issues involved with incorporating thermal energy storage canisters into a heat pipe. The experiment is a replication of the operation of a heat receiver for a Brayton solar dynamic power cycle. The heat receiver is composed of a cylindrical receptor surface and an annular heat pipe with thermal energy storage canisters and gaseous working fluid heat exchanger tubes surrounding it. Hardware for the cavity heat pipe experiment will consist of a sector of the heat pipe, complete with gas tube and thermal energy storage canisters. Thermal cycling tests will be performed on the heat pipe sector to simulate the normal energy charge/discharge cycle of the receiver in a spacecraft application.

  12. Sensing of the atmospheric variation using Low Cost GNSS Receiver

    Science.gov (United States)

    Bramanto, Brian; Gumilar, Irwan; Sidiq, Teguh P.; Kuntjoro, Wedyanto; Tampubolon, Daniel A.

    2018-05-01

    As the GNSS signals transmitted through the atmosphere, they are delayed by interference of TEC (Total Electron Content) in the ionosphere and water vapor in the troposphere. By using inverse-problem, name GNSS Meteorology, those parameters can be obtained precisely and several researches has approved and supported that method. However, the geodetic GNSS receivers are relatively high cost (30,000 to 70,000 each) to be established on a regular and uniform network. This research aims to investigate the potential use of low cost GNSS receiver (less than 2,000) to observe the atmospheric dynamic both in ionosphere and troposphere. Results indicated that low cost GNSS receiver is a promising tools to sensing the atmospheric dynamic, however, further processing is needed to enhance the data quality. It is found that both of ionosphere and troposphere dynamic has diurnal periodic component.

  13. Fabrication of Detector Arrays for the SPT-3G Receiver

    Science.gov (United States)

    Posada, C. M.; Ade, P. A. R.; Ahmed, Z.; Anderson, A. J.; Austermann, J. E.; Avva, J. S.; Thakur, R. Basu; Bender, A. N.; Benson, B. A.; Carlstrom, J. E.; Carter, F. W.; Cecil, T.; Chang, C. L.; Cliche, J. F.; Cukierman, A.; Denison, E. V.; de Haan, T.; Ding, J.; Divan, R.; Dobbs, M. A.; Dutcher, D.; Everett, W.; Foster, A.; Gannon, R. N.; Gilbert, A.; Groh, J. C.; Halverson, N. W.; Harke-Hosemann, A. H.; Harrington, N. L.; Henning, J. W.; Hilton, G. C.; Holzapfel, W. L.; Huang, N.; Irwin, K. D.; Jeong, O. B.; Jonas, M.; Khaire, T.; Kofman, A. M.; Korman, M.; Kubik, D.; Kuhlmann, S.; Kuo, C. L.; Lee, A. T.; Lowitz, A. E.; Meyer, S. S.; Michalik, D.; Miller, C. S.; Montgomery, J.; Nadolski, A.; Natoli, T.; Nguyen, H.; Noble, G. I.; Novosad, V.; Padin, S.; Pan, Z.; Pearson, J.; Rahlin, A.; Ruhl, J. E.; Saunders, L. J.; Sayre, J. T.; Shirley, I.; Shirokoff, E.; Smecher, G.; Sobrin, J. A.; Stan, L.; Stark, A. A.; Story, K. T.; Suzuki, A.; Tang, Q. Y.; Thompson, K. L.; Tucker, C.; Vale, L. R.; Vanderlinde, K.; Vieira, J. D.; Wang, G.; Whitehorn, N.; Yefremenko, V.; Yoon, K. W.; Young, M. R.

    2018-05-01

    The South Pole Telescope third-generation (SPT-3G) receiver was installed during the austral summer of 2016-2017. It is designed to measure the cosmic microwave background across three frequency bands centered at 95, 150, and 220 GHz. The SPT-3G receiver has ten focal plane modules, each with 269 pixels. Each pixel features a broadband sinuous antenna coupled to a niobium microstrip transmission line. In-line filters define the desired band-passes before the signal is coupled to six bolometers with Ti/Au/Ti/Au transition edge sensors (three bands × two polarizations). In total, the SPT-3G receiver is composed of 16,000 detectors, which are read out using a 68× frequency-domain multiplexing scheme. In this paper, we present the process employed in fabricating the detector arrays.

  14. A novel mirror diversity receiver for indoor MIMO visible light

    KAUST Repository

    Park, Ki-Hong

    2016-03-01

    In this paper, we propose and study a non-imaging receiver design reducing the correlation of channel matrix for indoor multiple-input multiple-output (MIMO) visible light communication (VLC) systems. Contrary to previous works, our proposed mirror diversity receiver (MDR) not only blocks the reception of light on one specific direction but also improves the channel gain on the other direction by receiving the light reflected by a mirror deployed between the photodetectors. We analyze the channel capacity and optimal height of mirror in terms of maximum channel capacity for a 2 -by-2 MIMO-VLC system in a 2-dimensional geometric model.We prove that this constructive and destructive effects in channel matrix resulting from our proposed MDR are more beneficial to obtain well-conditioned channel matrix which is suitable for implementing spatial-multiplexing MIMO-VLC systems in order to support high data rate.

  15. Functional design criteria 241-AP-102 Flexible Receiver System

    International Nuclear Information System (INIS)

    Roblyer, S.P.

    1995-01-01

    A mixer pump was installed in the 1.07 m (42-in.) riser of the central pump pit of tank 241-AP-102 to mitigate potential fluid separation particle sedimentation by mixing the tank's contents. The mixer pump performed this function until failure. Its removal is now necessary to meet possible tank content removal commitments or other corrective actions. The proposed removal procedure requires a flexible receiver that will provide a barrier to contamination during removal and transfer of the pump to the mixer pump storage container. This document describes the functional design criteria of the flexible receiver. These criteria include the functional and performance requirements of the flexible receiver as a barrier to contamination during normal conditions and contingencies and the instrumentation requirements

  16. Actors with Multi-Headed Message Receive Patterns

    DEFF Research Database (Denmark)

    Sulzmann, Martin; Lam, Edmund Soon Lee; Van Weert, Peter

    2008-01-01

    style actors with receive clauses containing multi-headed message patterns. Patterns may be non-linear and constrained by guards. We provide a number of examples to show the usefulness of the extension. We also explore the design space for multi-headed message matching semantics, for example first-match......The actor model provides high-level concurrency abstractions to coordinate simultaneous computations by message passing. Languages implementing the actor model such as Erlang commonly only support single-headed pattern matching over received messages. We propose and design an extension of Erlang...... and rule priority-match semantics. The various semantics are inspired by the multi-set constraint matching semantics found in Constraint Handling Rules. This provides us with a formal model to study actors with multi-headed message receive patterns. The system can be implemented efficiently and we have...

  17. Central receiver power plant: an environmental, ecological, and socioeconomic analysis

    Energy Technology Data Exchange (ETDEWEB)

    Davison, M.; Grether, D.

    1977-06-01

    The technical details of the central receiver design are reviewed. Socio-economic questions are considered including: market penetration, air industrial sector model, demands on industry, employment, effluents associated with manufacture of components, strains due to intensive construction, water requirements, and land requirements. The ecological effects in the vicinity of the central receiver plant site are dealt with, with emphasis on effects on land surface, mammals, and reptiles and amphibians. Climatological considerations are reviewed including: desert types, effects of surface albedo modification, effects of aerosols, effects on evaporation rates, the heliostat canopy, effects on turbulent transfer rates, effects on the wind profile, a model of convection about a central receiver plant, and a global scenario. Drawings of heliostat and plant design are included in appendices. (MHR)

  18. An Analog Correlator for Ultra-Wideband Receivers

    Directory of Open Access Journals (Sweden)

    Tu Chunjiang

    2005-01-01

    Full Text Available We present a new analog circuit exhibiting high bandwidth and low distortion, specially designed for signal correlation in an ultra-wideband receiver front end. The ultra-wideband short impulse signals are correlated with a local pulse template by the correlator. A comparator then samples the output for signal detection. A typical Gilbert mixer core is adopted for multiplication of broadband signals up to . As a result of synchronization of the received signal and the local template, the output voltage level after integration and sampling can reach up to , which is sufficient for detection by the comparator. The circuit dissipates about from double voltage supplies of and using SiGe BiCMOS technology. Simulation results are presented to show the feasibility of this circuit design for use in ultra-wideband receivers.

  19. Use of commercial robotics in radioactive waste shipping and receiving

    International Nuclear Information System (INIS)

    Berger, J.D.

    1985-01-01

    Radioactive waste shipping and receiving facilities presently planned for commercial and defense nuclear waste will handle waste packages at frequencies far in excess of those in common practice today. Unacceptable personnel exposure to ionizing radiation is projected to occur if current limits for radiation levels at the cask surface and current handling methods are used. To reduce these exposure levels, alternate handling methods are being developed and demonstrated. The production nature of cask receiving operations suggests commercial robotics be incorporated into a remote handling system to reduce predicted worker exposure to acceptable levels, while maintaining or increasing throughput. The first phase of cask handling system development culminated in a proof-of-principle test demonstrating the feasibility of performing cask receiving and unloading operations in a remote and partially automated manner. 6 refs., 12 figs

  20. Cryogen-free dilution refrigerator for ACTPOL polarization- sensitive receiver

    Science.gov (United States)

    Shvarts, V.; Zhao, Z.; Devlin, M. J.; Klein, J.; Lungu, M.; Schmitt, B.; Thornton, R.

    2014-12-01

    We present a new cryogenic receiver for the Atacama Cosmology Telescope (ACT), a six-meter diameter off-axis Gregorian telescope located at an altitude of 5,200 meters (17,000 ft.) on Cerro Toco, in Northern Chile. The focal plane contains 3000 polarization-sensitive transition edge sensor (TES) bolometers, and is cooled to below 100 mK with a removable pulse-tube based customised JDry-100 dilution refrigerator insert. The optical tubes and the rest of the receiver are cooled with a dedicated pulse tube to below 3 K. Details of the receiver- to-telescope integration and first season on-site operation are described, including detector base temperature stability in vertical and tilted position as well as remote operation via Ethernet link.

  1. Cryogen-free dilution refrigerator for ACTPOL polarization- sensitive receiver

    International Nuclear Information System (INIS)

    Shvarts, V; Zhao, Z; Devlin, M J; Klein, J; Lungu, M; Schmitt, B; Thornton, R

    2014-01-01

    We present a new cryogenic receiver for the Atacama Cosmology Telescope (ACT), a six-meter diameter off-axis Gregorian telescope located at an altitude of 5,200 meters (17,000 ft.) on Cerro Toco, in Northern Chile. The focal plane contains 3000 polarization-sensitive transition edge sensor (TES) bolometers, and is cooled to below 100 mK with a removable pulse-tube based customised JDry-100 dilution refrigerator insert. The optical tubes and the rest of the receiver are cooled with a dedicated pulse tube to below 3 K. Details of the receiver- to-telescope integration and first season on-site operation are described, including detector base temperature stability in vertical and tilted position as well as remote operation via Ethernet link

  2. New type of nonglossy image-receiving sheet

    Science.gov (United States)

    Aono, Toshiaki; Shibata, Takeshi; Nakamura, Yoshisada

    1990-07-01

    We have developed a new type of non-glossy surface of an image receiving sheet for a photothermographic color hardcopy system. There is a basic conflict in realizing uniform dye transfer with use of a receiving sheet having a matted surface, because when the degree of roughness exceeds a certain extent, uneven dye transfer readily takes place. It: has been solved by use of "microscopic" phase separation of a certain water-soluble polymer blend which constitutes the surface layer of the image receiving sheet. One of the preferable polymer blends for our purpose proved to be a ternary system, consisting of sodium salt of polymethacrylic acid (PMAA-Na), ammonium salt of polyacrylic acid (PAA-NH4) and water. Phase separation, which proceeded during the evaporation of water from the coated mixture, turned out to be of a spinodal decomposition type and thus capable of stably providing a desirable non-glossy surface.

  3. Thermal characteristics of tubular receivers of solar radiation line concentrators

    International Nuclear Information System (INIS)

    Klychev, Sh.I.; Zakhidov, R.A.; Khuzhanov, R. et al.

    2013-01-01

    A stationary thermal model of an LCS-HR system is considered, taking into account the basic parameters of the problem: availability of a transparent screen, selectivity of the receiver, characteristics of the heat carrier and average concentration on the surface of the tubular receiver C"". Based on this model, an algorithm and program of numerical research of the thermal characteristics of the HR-temperature of heating and local and average coefficients of efficiency are developed. For possible concentrations, the selectivity of the receiver and the transparency of the screen in linear concentrators, the potential stationary heating temperatures, and the coefficients of efficiency for main three types of heat carriers - air, water, and liquid metal coolant are studied. The time of achieving stationary values by the temperatures of the heat carrier is estimated. (author)

  4. A Fast Adaptive Receive Antenna Selection Method in MIMO System

    Directory of Open Access Journals (Sweden)

    Chaowei Wang

    2013-01-01

    Full Text Available Antenna selection has been regarded as an effective method to acquire the diversity benefits of multiple antennas while potentially reduce hardware costs. This paper focuses on receive antenna selection. According to the proportion between the numbers of total receive antennas and selected antennas and the influence of each antenna on system capacity, we propose a fast adaptive antenna selection algorithm for wireless multiple-input multiple-output (MIMO systems. Mathematical analysis and numerical results show that our algorithm significantly reduces the computational complexity and memory requirement and achieves considerable system capacity gain compared with the optimal selection technique in the same time.

  5. Electrodynamic Wireless Power Transmission to Rotating Magnet Receivers

    International Nuclear Information System (INIS)

    Garraud, A; Jimenez, J D; Garraud, N; Arnold, D P

    2014-01-01

    This paper presents an approach for electrodynamic wireless power transmission (EWPT) using a synchronously rotating magnet located in a 3.2 cm 3 receiver. We demonstrate wireless power transmission up to 99 mW (power density equal to 31 mW/cm 3 ) over a 5-cm distance and 5 mW over a 20-cm distance. The maximum operational frequency, and hence maximal output power, is constrained by the magnetic field amplitude. A quadratic relationship is found between the maximal output power and the magnetic field. We also demonstrate simultaneous, power transmission to multiple receivers positioned at different locations

  6. Simulation of the MRS receiving and handling facility

    International Nuclear Information System (INIS)

    Triplett, M.B.; Imhoff, C.H.; Hostick, C.J.

    1984-02-01

    Monitored retrievable storage (MRS) will be required to handle a large volume of spent fuel or high-level waste (HLW) in case of delays in repository deployment. The quantities of materials to be received and repackaged for storage far exceed the requirements of existing waste mangement facilities. A computer simulation model of the MRS receiving and handling (R and H) fcility has been constructed and used to evaluate design alternatives. Studies have identified processes or activities which may constrain throughput performance. In addition, the model has helped to assess design tradeoffs such as those to be made among improved process times, redundant service lines, and improved component availability. 1 reference, 5 figures

  7. Anxiety and depression in patients receiving radiotherapy. Prospective study

    International Nuclear Information System (INIS)

    Chaturvedi, S.K.; Chandra, P.S.; Channabasavanna, S.M.; Anantha, N.; Reddy, B.K.M.; Sharma, S.

    1994-01-01

    The objective of this study was to detect the prevalence of anxiety and depressive disorders using the Hospital Anxiety and Depression Scale (HADS) prospectively in patients receiving Radiotherapy (RT) during and after treatment. 140 consecutive cancer patients referred for radiotherapy and their care givers were included. All patients were administered the Hospital Anxiety and Depression Scale (HADS) conducted at intake, just before starting RT, after finishing the course of RT, and at 3-4 months follow-up. Anxiety and depression are detected frequently in patients receiving RT both prior to treatment and later during follow-up

  8. Reimbursement of VAT on written-off Receivables

    DEFF Research Database (Denmark)

    Florentsen, Bjarne; Møller, Michael; Nielsen, Niels Chr.

    2003-01-01

    In many OECD countries, a seller has a right to reimbursement of VAT (RVAT) she has paid on goods sold, but for which she has not yet received payment. Such reimbursement of VAT on receivables is economically inefficient. It leads to:@* Distortion of credit markets, by subsidizing direct credit...... at the cost of financial intermediaries.@* Price discrimination, by subsidizing buyers with low creditworthiness.@* A less efficient collection of bad debts, as trade with bad debts is made extremely expensive.The finance literature presents several `good' arguments in favor of trade credits, e.g. transaction...

  9. Low noise omnidirectional optical receiver for the mobile FSO networks

    Science.gov (United States)

    Witas, Karel; Hejduk, Stanislav; Vasinek, Vladimir; Vitasek, Jan; Latal, Jan

    2013-05-01

    A high sensitive optical receiver design for the mobile free space optical (FSO) networks is presented. There is an array of photo-detectors and preamplifiers working into same load. It is the second stage sum amplifier getting all signals together. This topology creates a parallel amplifier with an excellent signal to noise ratio (SNR). An automatic gain control (AGC) feature is included also. As a result, the effective noise suppression at the receiver side increases optical signal coverage even with the transmitter power being constant. The design has been verified on the model car which was able to respond beyond the line of sight (LOS).

  10. Features of the compost received by use of dairy whey

    Directory of Open Access Journals (Sweden)

    V. V. Smolnikova

    2010-01-01

    Full Text Available In the article features cjmposting of organic materials are considered at use of a traditional way and fermenting additives. Indicators of quality of the composts received with the use of dairy whey and a bacterial preparation as the fermenting additive are investigated. Comparison of the received samples of composts on such indicators of quality as is spent: humidity, acidity, the maintenance of organic substance in recalculation on dry weight, quantity of the general and fmmonium nitrogen.

  11. Detailed noise statistics for an optically preamplified direct detection receiver

    DEFF Research Database (Denmark)

    Danielsen, Søren Lykke; Mikkelsen, Benny; Durhuus, Terji

    1995-01-01

    We describe the exact statistics of an optically preamplified direct detection receiver by means of the moment generating function. The theory allows an arbitrary shaped electrical filter in the receiver circuit. The moment generating function (MGF) allows for a precise calculation of the error...... rate by using the inverse Fast Fourier transform (FFT). The exact results are compared with the usual Gaussian approximation (GA), the saddlepoint approximation (SAP) and the modified Chernoff bound (MCB). This comparison shows that the noise is not Gaussian distributed for all values of the optical...... and calculate the sensitivity degradation due to inter symbol interference (ISI)...

  12. High Temperature Falling Particle Receiver (2012 - 2016) - Final DOE Report

    Energy Technology Data Exchange (ETDEWEB)

    Ho, Clifford K. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2016-04-15

    The objective of this work was to advance falling particle receiver designs for concentrating solar power applications that will enable higher temperatures (>700 °C) and greater power-cycle efficiencies (≥50% thermal-to-electric). Modeling, design, and testing of components in Phases 1 and 2 led to the successful on-sun demonstration in Phase 3 of the world’s first continuously recirculating high-temperature 1 MWt falling particle receiver that achieved >700 °C particle outlet temperatures at mass flow rates ranging from 1 – 7 kg/s.

  13. Dicty_cDB: VHF408 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available MTYF9_FA... 33 7.5 CP000568_3082( CP000568 |pid:none) Clostridium thermocellum ATCC 2... 33 9.8 AY698035_1(... AY698035 |pid:none) Desmognathus marmoratus isolate 69... 33 9.8 protein update 2009. 3. 3 PSORT psg: 0.69

  14. Characteristics of ionospheric irregularities causing scintillations at VHF/UHF

    International Nuclear Information System (INIS)

    Vats, H.O.; Deshpande, M.R.; Rastogi, R.G.

    1978-01-01

    Some properties of ionization irregularities using amplitude scintillation records of radio beacons from ATS-6 (phase II) at Ootacamund, India have been investigated. For the estimation of scale-size and strength of the irregularities a simple diffraction model has been used which explains only weak and moderate equatorial scintillation observations. It was found that the scale sizes of day time E-region irregularities are smaller than those in the F-region during night time in addition, irregularities are generated initially at large scale sizes which later break up into smaller scale sizes

  15. Lightning initiation: Strong pulses of VHF radiation accompany preliminary breakdown

    Czech Academy of Sciences Publication Activity Database

    Kolmašová, Ivana; Santolík, Ondřej; Defer, E.; Rison, W.; Coquillat, S.; Pedeboy, S.; Lán, Radek; Uhlíř, Luděk; Lambert, D.; Pinty, J.P.; Prieur, S.; Pont, V.

    2018-01-01

    Roč. 8, č. 1 (2018), č. článku 3650. ISSN 2045-2322 R&D Projects: GA ČR GA17-07027S Grant - others:AV ČR(CZ) AP1401 Program:Akademická prémie - Praemium Academiae Institutional support: RVO:68378289 Keywords : controlled study * article * electromagnetic radiation * magnetic field * waveform * lightning * mapping array * discharges * ionosphere * luminosity * flashes * leaders * system Subject RIV: BL - Plasma and Gas Discharge Physics OBOR OECD: Fluids and plasma physics (including surface physics ) Impact factor: 4.259, year: 2016 https://www.nature.com/articles/s41598-018-21972-z

  16. VHF radar observations of gravity waves at a low latitude

    Directory of Open Access Journals (Sweden)

    G. Dutta

    1999-08-01

    Full Text Available Wind observations made at Gadanki (13.5°N by using Indian MST Radar for few days in September, October, December 1995 and January, 1996 have been analyzed to study gravity wave activity in the troposphere and lower stratosphere. Horizontal wind variances have been computed for gravity waves of period (2-6 h from the power spectral density (PSD spectrum. Exponential curves of the form eZ/H have been fitted by least squares technique to these variance values to obtain height variations of the irregular winds upto the height of about 15 km, where Z is the height in kilometers. The value of H, the scale height, as determined from curve fitting is found to be less than the theoretical value of scale height of neutral atmosphere in this region, implying that the waves are gaining energy during their passage in the troposphere. In other words, it indicates that the sources of gravity waves are present in the troposphere. The energy densities of gravity wave fluctuations have been computed. Polynomial fits to the observed values show that wave energy density increases in the troposphere, its source region, and then decreases in the lower stratosphere.Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; turbulence; waves and tides

  17. Dicty_cDB: VHF127 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ce. 72 3e-12 2 EL476245 |EL476245.1 CHUL4181.b1_J14.ab1 CHU(LMS) puzzle sunflower... Helianthus paradoxus cDNA clone CHUL4181, mRNA sequence. 72 3e-12 2 EL513430 |EL513430.1 CHUX465.b1_A21.ab1 CHU(XYZ) puzzle

  18. Dicty_cDB: VHF491 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ents: (bits) Value BC142916_1( BC142916 |pid:none) Danio rerio hypothetical LOC555303... 97 6e-19 (Q9NZJ4) RecName: Full=Sacsi...n; &AL157766_4( AL157766 |pid:none) 97 9e-19 BC171956_1( BC171956 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 96 1e-18 BC138482_1( BC138482 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 96 2e-18 (Q9JLC8) RecName: Full=Sacsin; 96 2e-18 CP001577_292( CP001577 |pid:none) Mi

  19. VHF spectrum monitoring using Meraka cognitive radio platform

    CSIR Research Space (South Africa)

    Aderonmu, AI

    2012-11-01

    Full Text Available discuss the Meraka Cognitive Radio Platform (MCRP) developed using the second version of the Universal Serial Radio Peripheral (USRP2) hardware and the GNU Radio software. We also discussed how the spectrum monitoring system is being implemented...

  20. Simply folded band chaos in a VHF microstrip oscillator

    Energy Technology Data Exchange (ETDEWEB)

    Blakely, Jonathan N. [US Army Research, Development, and Engineering Command, AMSRD-AMR-WS-ST, Redstone Arsenal, AL 35898 (United States)]. E-mail: jonathan.blakely@us.army.mil; Holder, J. Darryl [US Army Research, Development, and Engineering Command, AMSRD-AMR-WS-ST, Redstone Arsenal, AL 35898 (United States); Corron, Ned J. [US Army Research, Development, and Engineering Command, AMSRD-AMR-WS-ST, Redstone Arsenal, AL 35898 (United States); Pethel, Shawn D. [US Army Research, Development, and Engineering Command, AMSRD-AMR-WS-ST, Redstone Arsenal, AL 35898 (United States)

    2005-10-10

    We present experimental observations of a microstrip circuit that produces Roessler-like chaos with center frequency of 175 MHz. A simply folded band chaotic attractor is created through a period doubling route. The circuit provides an experimental realization of a chaotic neutral delay differential equation, a largely unexplored type of nonlinear dynamical system.

  1. Dicty_cDB: VHF631 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available C114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 6e-13 AY892312_1( AY892312 |pid:none...ing fra... 74 2e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid

  2. Dicty_cDB: VHF111 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available id:none) Homo sapiens L-pipecolic acid oxid... 76 2e-12 AX882278_1( AX882278 |pid:none) Sequence 17183 from ...Patent EP10746... 76 2e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic

  3. VHF/UHF filters and multicouplers application of air resonators

    CERN Document Server

    Piette, Bernard

    2013-01-01

    This book describes the various devices used in radio communication and broadcasting to achieve high selectivity filtering and coupling. After providing a background in the basics of microwave theory and more detailed material - including a special chapter on precision and errors in measurement - the reader will find detailed descriptions, manufacturing processes, and, for the most useful instances, a number of worked-through formulas, which will allow engineers and technicians to design circuits or components for filtering or coupling applications. Content is covered in this format across a b

  4. VHF NEMS-CMOS piezoresistive resonators for advanced sensing applications

    Science.gov (United States)

    Arcamone, Julien; Dupré, Cécilia; Arndt, Grégory; Colinet, Eric; Hentz, Sébastien; Ollier, Eric; Duraffourg, Laurent

    2014-10-01

    This work reports on top-down nanoelectromechanical resonators, which are among the smallest resonators listed in the literature. To overcome the fact that their electromechanical transduction is intrinsically very challenging due to their very high frequency (100 MHz) and ultimate size (each resonator is a 1.2 μm long, 100 nm wide, 20 nm thick silicon beam with 100 nm long and 30 nm wide piezoresistive lateral nanowire gauges), they have been monolithically integrated with an advanced fully depleted SOI CMOS technology. By advantageously combining the unique benefits of nanomechanics and nanoelectronics, this hybrid NEMS-CMOS device paves the way for novel breakthrough applications, such as NEMS-based mass spectrometry or hybrid NEMS/CMOS logic, which cannot be fully implemented without this association.

  5. Dicty_cDB: VHF289 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d sequence lvdpasshmlvskikpcmskykflydetadgslqq**tnrlsgftfwitavnrg*yiqam gdwqrklsdy*hstnafgfwvipnniadrgfifdks...siqagkkkrddianinrkasa Translated Amino Acid sequence (All Frames) Frame A: lvdpasshmlvskikpcmskykflydetadgsl

  6. Dicty_cDB: VHF123 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 03667.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP1...nsertion targeting and chromosome engineering clone MHPP186g09. 50 0.17 1 CR034434 |CR034434.1 Forward stran...d read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP47e19. 50 0.17 1 CR023...465 |CR023465.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering...3'HPRT insertion targeting and chromosome engineering clone MHPP47e19. 50 0.17 1 BX990136 |BX990136.1 Forwar

  7. Baseload Nitrate Salt Central Receiver Power Plant Design Final Report

    Energy Technology Data Exchange (ETDEWEB)

    Tilley, Drake [Abengoa Solar LLC, Lakewood, CO (United States); Kelly, Bruce [Abengoa Solar LLC, Lakewood, CO (United States); Burkholder, Frank [Abengoa Solar LLC, Lakewood, CO (United States)

    2014-12-12

    The objectives of the work were to demonstrate that a 100 MWe central receiver plant, using nitrate salt as the receiver coolant, thermal storage medium, and heat transport fluid in the steam generator, can 1) operate, at full load, for 6,400 hours each year using only solar energy, and 2) satisfy the DOE levelized energy cost goal of $0.09/kWhe (real 2009 $). To achieve these objectives the work incorporated a large range of tasks relating to many different aspects of a molten salt tower plant. The first Phase of the project focused on developing a baseline design for a Molten Salt Tower and validating areas for improvement. Tasks included a market study, receiver design, heat exchanger design, preliminary heliostat design, solar field optimization, baseline system design including PFDs and P&IDs and detailed cost estimate. The baseline plant met the initial goal of less than $0.14/kWhe, and reinforced the need to reduce costs in several key areas to reach the overall $0.09/kWhe goal. The major improvements identified from Phase I were: 1) higher temperature salt to improve cycle efficiency and reduce storage requirements, 2) an improved receiver coating to increase the efficiency of the receiver, 3) a large receiver design to maximize storage and meet the baseload hours objective, and 4) lower cost heliostat field. The second Phase of the project looked at advancing the baseline tower with the identified improvements and included key prototypes. To validate increasing the standard solar salt temperature to 600 °C a dynamic test was conducted at Sandia. The results ultimately proved the hypothesis incorrect and showed high oxide production and corrosion rates. The results lead to further testing of systems to mitigate the oxide production to be able to increase the salt temperature for a commercial plant. Foster Wheeler worked on the receiver design in both Phase I and Phase II looking at both design and lowering costs utilizing commercial fossil boiler

  8. Solar central receiver reformer system for ammonia plants

    Science.gov (United States)

    1980-07-01

    Details of the conceptual design, economic analysis, and development plan for a solar central receiver system for retrofitting the Valley Nitrogen Producers, Inc., El Centro, California 600 ST/SD Ammonia Plant are presented. The retrofit system consists of a solar central receiver reformer (SCRR) operating in parallel with the existing fossil fired reformer. Steam and hydrocarbon react in the catalyst filled tubes of the inner cavity receiver to form a hydrogen rich mixture which is the syngas feed for the ammonia production. The SCRR system displaces natural gas presently used in the fossil reformer combustion chamber. The solar reformer retrofit system characteristics and its interface with the existing plant are simple, incorporating state of the art components with proven technology. A northfield composed of one thousand forty second generation heliostats provides solar energy to the receiver which is positioned on top of a 90 meter high steel tower. The overall economics of this system can provide over 20% discount cash flow rate of return with proper investment and market conditions.

  9. 49 CFR 389.23 - Consideration of comments received.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Consideration of comments received. 389.23 Section 389.23 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL MOTOR CARRIER... PROCEDURES-FEDERAL MOTOR CARRIER SAFETY REGULATIONS Procedures for Adoption of Rules § 389.23 Consideration...

  10. 49 CFR 190.323 - Consideration of comments received.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Consideration of comments received. 190.323 Section 190.323 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND... SAFETY PROGRAMS AND RULEMAKING PROCEDURES Procedures for Adoption of Rules § 190.323 Consideration of...

  11. Associated Factors and Quality of Care Received among Maternal ...

    African Journals Online (AJOL)

    USER

    discussions with health staff to assess care received and factors leading to death. A total of 43 maternal deaths ... department with bed capacity of 105, one ..... evidence for emergency obstetric care. ... Planning; 15(2): 170-176. 13. Ray S ...

  12. Heterodyne Receiver for Laboratory Spectrosocpy of Molecules of Astrophysical Importance

    Science.gov (United States)

    Wehres, Nadine; Lewen, Frank; Endres, Christian; Hermanns, Marius; Schlemmer, Stephan

    2016-06-01

    We present first results of a heterodyne receiver built for high-resolution emission laboratory spectroscopy of molecules of astrophysical interest. The room-temperature receiver operates at frequencies between 80 and 110 GHz, consistent with ALMA band 3. Many molecules have been identified in the interstellar and circumstellar medium at exactly these frequencies by comparing emission spectra obtained from telescopes to high-resolution laboratory absorption spectra. Taking advantage of the recent progresses in the field of mm/submm technology in the astronomy community, we have built a room-temperature emission spectrometer making use of heterodyne receiver technology at an instantaneous bandwidth of currently 2.5 GHz. The system performance, in particular the noise temperature and systematic errors, is presented. The proof-of-concept is demonstrated by comparing the emission spectrum of methyl cyanide to respective absorption spectra and to the literature. Future prospects as well as limitations of the new laboratory receiver for the spectroscopy of complex organic molecules or transient species in discharges will be discussed.

  13. Analysis on geometry-aware received signal strength based ...

    African Journals Online (AJOL)

    These handle different scenarios such as environment, adaptation, hybridization and the choice of context is dependent on user requirements. This paper present geometry-aware received signal strength (RSS) based positioning techniques where the influences of the geometries of the BSs (where location estimation ...

  14. Optocoupled line receiver input discriminates against narrow noise pulses

    CERN Document Server

    Napier, T M

    1977-01-01

    Describes a simple optocoupled interface which connects a data line to the receiving end of a data link that features pulse length discrimination to enhance noise pulse rejection. A rugged red LED, D /sub 1/, can bypass any reasonable fault currents to protect the relatively fragile optocoupler input diode. (0 refs).

  15. receive signal strength prediction in the gsm band using wavelet

    African Journals Online (AJOL)

    user

    strength was measured on a Mobile Equipment (ME). One-dimensional ... used to predict the fading phenomenon of the GSM receive signal strength measured. Wavelet ... radio wavelength. The prediction is ... realized by reusing frequency in a dense or complex .... NETWORK SIGNAL PRO software, down loaded from.

  16. A heat receiver design for solar dynamic space power systems

    Science.gov (United States)

    Baker, Karl W.; Dustin, Miles O.; Crane, Roger

    1990-01-01

    An advanced heat pipe receiver designed for a solar dynamic space power system is described. The power system consists of a solar concentrator, solar heat receiver, Stirling heat engine, linear alternator and waste heat radiator. The solar concentrator focuses the sun's energy into a heat receiver. The engine and alternator convert a portion of this energy to electric power and the remaining heat is rejected by a waste heat radiator. Primary liquid metal heat pipes transport heat energy to the Stirling engine. Thermal energy storage allows this power system to operate during the shade portion of an orbit. Lithium fluoride/calcium fluoride eutectic is the thermal energy storage material. Thermal energy storage canisters are attached to the midsection of each heat pipe. The primary heat pipes pass through a secondary vapor cavity heat pipe near the engine and receiver interface. The secondary vapor cavity heat pipe serves three important functions. First, it smooths out hot spots in the solar cavity and provides even distribution of heat to the engine. Second, the event of a heat pipe failure, the secondary heat pipe cavity can efficiently transfer heat from other operating primary heat pipes to the engine heat exchanger of the defunct heat pipe. Third, the secondary heat pipe vapor cavity reduces temperature drops caused by heat flow into the engine. This unique design provides a high level of reliability and performance.

  17. Accounting Issues: An Essay Series. Part II--Accounts Receivable

    Science.gov (United States)

    Laux, Judith A.

    2007-01-01

    This is the second in a series of articles designed to help academics refocus the introductory accounting course on the theoretical underpinnings of accounting. Intended as a supplement for the principles course, this article connects the asset Accounts Receivable to the essential theoretical constructs, discusses the inherent tradeoffs and…

  18. Mark 4A DSN receiver-exciter and transmitter subsystems

    Science.gov (United States)

    Wick, M. R.

    1986-01-01

    The present configuration of the Mark 4A DSN Receiver-Exciter and Transmitter Subsystems is described. Functional requirements and key characteristics are given to show the differences in the capabilities required by the Networks Consolidation task for combined High Earth Orbiter and Deep Space Network tracking support.

  19. A note on dynamic programming in accounts receivable management

    NARCIS (Netherlands)

    Dirickx, Y.M.I.; Kistner, K.-P.

    1982-01-01

    The paper considers a dynamic programming formulation of the accounts receivable problem for single outstanding amounts. An optimal collection policy can be computed efficiently by invoking a “planning horizon” result that determines a time period beyond which the decision process cannot extend. The

  20. HANDBOOK FOR CONSTRUCTED WETLANDS RECEIVING ACID MINE DRAINAGE

    Science.gov (United States)

    In the summer of 1987, a pilot constructed wetland was built at the Big Five Tunnel in Idaho Springs, Colorado. This report details the theory, design and construction of wetlands receiving acid mine drainages, based on the second and third year of operation of this wetland, whic...