WorldWideScience

Sample records for vhf radiotelephone installation

  1. 47 CFR 80.1007 - Bridge-to-bridge radiotelephone installation.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Bridge-to-bridge radiotelephone installation. 80.1007 Section 80.1007 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND... Bridge-to-Bridge Act § 80.1007 Bridge-to-bridge radiotelephone installation. Use of the bridge-to-bridge...

  2. 47 CFR 80.268 - Technical requirements for radiotelephone installation.

    Science.gov (United States)

    2010-10-01

    ... SPECIAL RADIO SERVICES STATIONS IN THE MARITIME SERVICES Equipment Authorization for Compulsory Ships § 80... radio ground waves over seawater. The installation and construction of the required antenna must ensure... between masts or other supports subject to whipping, a safety link must be installed which under heavy...

  3. 47 CFR 80.911 - VHF transmitter.

    Science.gov (United States)

    2010-10-01

    ... MARITIME SERVICES Compulsory Radiotelephone Installations for Small Passenger Boats § 80.911 VHF..., measured at the power input terminals to the transmitter, and the output power of the transmitter, terminated in a matching artificial load, must be measured at the end of 10 minutes of continuous operation...

  4. 46 CFR 169.669 - Radiotelephone equipment.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Radiotelephone equipment. 169.669 Section 169.669 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS SAILING SCHOOL VESSELS... of Less Than 100 Gross Tons § 169.669 Radiotelephone equipment. A separate circuit from the...

  5. Forming and detection of digital watermarks in the System for Automatic Identification of VHF Transmissions

    Directory of Open Access Journals (Sweden)

    О. В. Шишкін

    2013-07-01

    Full Text Available Forming and detection algorithms for digital watermarks are designed for automatic identification of VHF radiotelephone transmissions in the maritime and aeronautical mobile services. An audible insensitivity and interference resistance of embedded digital data are provided by means of OFDM technology jointly with normalized distortions distribution and data packet detection by the hash-function. Experiments were carried out on the base of ship’s radio station RT-2048 Sailor and USB ADC-DAC module of type Е14-140M L-CARD in the off-line processing regime in Matlab medium

  6. Dicty_cDB: VHF264 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF264 (Link to dictyBase) - - - Contig-U16260-1 VHF264P (Link to Original site) VHF...264F 606 VHF264Z 693 VHF264P 1279 - - Show VHF264 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-C/VHF264Q.Seq.d/ Representative seq. ID VHF...264P (Link to Original site) Representative DNA sequence >VHF264 (VHF264Q) /CSM/VH/VHF2-C/VHF...DRRKNIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHFEMPKEDKLPAGCTS

  7. Dicty_cDB: VHF181 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF181 (Link to dictyBase) - - - Contig-U16260-1 VHF181P (Link to Original site) VHF...181F 610 VHF181Z 416 VHF181P 1006 - - Show VHF181 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-D/VHF181Q.Seq.d/ Representative seq. ID VHF...181P (Link to Original site) Representative DNA sequence >VHF181 (VHF181Q) /CSM/VH/VHF1-D/VHF...VKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKVSG DMRYMSCRADEQERGITIKSSSVSLHF

  8. Dicty_cDB: VHF777 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF777 (Link to dictyBase) - - - Contig-U16283-1 VHF777P (Link to Original site) VHF...777F 474 VHF777Z 669 VHF777P 1123 - - Show VHF777 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-D/VHF777Q.Seq.d/ Representative seq. ID VHF...777P (Link to Original site) Representative DNA sequence >VHF777 (VHF777Q) /CSM/VH/VHF7-D/VHF...PNIIGVEHYKVATDVQKILXRI*itsryychfryg*fi *rpksncipcs*dstflittirscprxhqygr*ir*tlrlyq

  9. Dicty_cDB: VHF354 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF354 (Link to dictyBase) - - - Contig-U16260-1 VHF354P (Link to Original site) VHF...354F 617 VHF354Z 721 VHF354P 1318 - - Show VHF354 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-C/VHF354Q.Seq.d/ Representative seq. ID VHF...354P (Link to Original site) Representative DNA sequence >VHF354 (VHF354Q) /CSM/VH/VHF3-C/VHF...no Acid sequence LSSAKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGD

  10. Dicty_cDB: VHF590 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF590 (Link to dictyBase) - - - Contig-U16306-1 VHF590P (Link to Original site) VHF...590F 115 VHF590Z 603 VHF590P 698 - - Show VHF590 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-D/VHF590Q.Seq.d/ Representative seq. ID VHF...590P (Link to Original site) Representative DNA sequence >VHF590 (VHF590Q) /CSM/VH/VHF5-D/VHF5...qlphvlrqlk*sqnfhkkylkkvqeqqq--- ---rwifhrwccfqsthdamyflyqxfgslsw*snlxrpkist*xfyhifghfw*rls*l ss*ipi*lqkwysyv

  11. Dicty_cDB: VHF536 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF536 (Link to dictyBase) - - - Contig-U16531-1 VHF536P (Link to Original site) VHF...536F 255 VHF536Z 685 VHF536P 920 - - Show VHF536 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-B/VHF536Q.Seq.d/ Representative seq. ID VHF...536P (Link to Original site) Representative DNA sequence >VHF536 (VHF536Q) /CSM/VH/VHF5-B/VHF5...ti*mlhliskvmtvh*mslslfyggyfl*lsi*llwnysig qvvvcliksikxerllkstmt--- ---*erlcl*ilxlvsichf

  12. Dicty_cDB: VHF730 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF730 (Link to dictyBase) - - - Contig-U15767-1 VHF730P (Link to Original site) VHF...730F 569 VHF730Z 718 VHF730P 1267 - - Show VHF730 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-B/VHF730Q.Seq.d/ Representative seq. ID VHF...730P (Link to Original site) Representative DNA sequence >VHF730 (VHF730Q) /CSM/VH/VHF7-B/VHF...QEKRIPVLNSMDANDSINKKA RISWPDGFKYFFVDNQAGDSESAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQXFN DVSYPV--- ---lhvvvvkxvhtlpvnvnqivhf

  13. Dicty_cDB: VHF649 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF649 (Link to dictyBase) - - - Contig-U11031-1 VHF649P (Link to Original site) VHF...649F 562 VHF649Z 671 VHF649P 1213 - - Show VHF649 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF6-C/VHF649Q.Seq.d/ Representative seq. ID VHF...649P (Link to Original site) Representative DNA sequence >VHF649 (VHF649Q) /CSM/VH/VHF6-C/VHF...PNTPPTIKIELPSQSILKPSGQLKK*x* Translated Amino Acid sequence (All Frames) Frame A: i*qlvchlsivlfhhqviyphvlklekhf

  14. Dicty_cDB: VHF527 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF527 (Link to dictyBase) - - - Contig-U16260-1 VHF527P (Link to Original site) VHF...527F 571 VHF527Z 456 VHF527P 1007 - - Show VHF527 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-B/VHF527Q.Seq.d/ Representative seq. ID VHF...527P (Link to Original site) Representative DNA sequence >VHF527 (VHF527Q) /CSM/VH/VHF5-B/VHF...AKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQXRGITIKSSSVSLHF

  15. Dicty_cDB: VHF294 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF294 (Link to dictyBase) - - - Contig-U16441-1 VHF294P (Link to Original site) VHF...294F 573 VHF294Z 215 VHF294P 768 - - Show VHF294 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-D/VHF294Q.Seq.d/ Representative seq. ID VHF...294P (Link to Original site) Representative DNA sequence >VHF294 (VHF294Q) /CSM/VH/VHF2-D/VHF2...ssfst*scisfttfry*gfsdctfr*fhfn**RFWFNMEQCII QWVMFYS--- ---DCHVSIKKFFKWWQRLDRWCCXXXSCXXXSWWFWFPTFLRIQISNXXY*k

  16. Dicty_cDB: VHF690 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF690 (Link to dictyBase) - - - Contig-U11064-1 VHF690P (Link to Original site) VHF...690F 199 VHF690Z 419 VHF690P 598 - - Show VHF690 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF6-D/VHF690Q.Seq.d/ Representative seq. ID VHF...690P (Link to Original site) Representative DNA sequence >VHF690 (VHF690Q) /CSM/VH/VHF6-D/VHF6...vllksqsknqyl*hlikslidfinif*hgmhqiyhqrkkn*nq *k--- ---rrwfpr*rernhhfqlc*sts*rgcryw

  17. Dicty_cDB: VHF273 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF273 (Link to dictyBase) - - - Contig-U11514-1 VHF273P (Link to Original site) VHF...273F 644 VHF273Z 678 VHF273P 1302 - - Show VHF273 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-D/VHF273Q.Seq.d/ Representative seq. ID VHF...273P (Link to Original site) Representative DNA sequence >VHF273 (VHF273Q) /CSM/VH/VHF2-D/VHF...ctr*ccnvkdwchyssrl*syrs*ts*nrsifidr*iftsh*kdw**s llwfsnetr*skmcchcnwckhflwscckfstrnrrtwssssys*kywslly*fhrhlg

  18. Dicty_cDB: VHF243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF243 (Link to dictyBase) - - - Contig-U16423-1 VHF243P (Link to Original site) VHF...243F 580 VHF243Z 334 VHF243P 894 - - Show VHF243 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-B/VHF243Q.Seq.d/ Representative seq. ID VHF...243P (Link to Original site) Representative DNA sequence >VHF243 (VHF243Q) /CSM/VH/VHF2-B/VHF2...AATCNAGATATTCCAGATTGGTTTGAAAAGATGG TACA sequence update 2002.10.25 Translated Amino Acid sequence ifihadkff*RISHF

  19. Dicty_cDB: VHF134 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF134 (Link to dictyBase) - - - Contig-U16260-1 VHF134P (Link to Original site) VHF...134F 533 VHF134Z 404 VHF134P 917 - - Show VHF134 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-B/VHF134Q.Seq.d/ Representative seq. ID VHF...134P (Link to Original site) Representative DNA sequence >VHF134 (VHF134Q) /CSM/VH/VHF1-B/VHF1...cid sequence LSSAKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHFEMPKE

  20. Dicty_cDB: VHF892 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF892 (Link to dictyBase) - - - Contig-U16260-1 VHF892P (Link to Original site) VHF...892F 140 VHF892Z 417 VHF892P 537 - - Show VHF892 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF8-D/VHF892Q.Seq.d/ Representative seq. ID VHF...892P (Link to Original site) Representative DNA sequence >VHF892 (VHF892Q) /CSM/VH/VHF8-D/VHF8... Translated Amino Acid sequence TIKSSSVSLHFEMPXEDKLPAGCTSHEFLINLIDSPSHVDFS--- ---ELTASPNILEPIYLVEITAPENAIGGI

  1. Dicty_cDB: VHF479 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF479 (Link to dictyBase) - - - Contig-U11426-1 VHF479P (Link to Original site) VHF...479F 629 VHF479Z 691 VHF479P 1300 - - Show VHF479 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF4-D/VHF479Q.Seq.d/ Representative seq. ID VHF...479P (Link to Original site) Representative DNA sequence >VHF479 (VHF479Q) /CSM/VH/VHF4-D/VHF...EKNPQEWRWSGGFFVDSISDYVVKSRNTERPDHDSLLF HVNIKEKQGTHFIRIPLSSKESPPYIIQNDTQFKISFFQRDSPENIDYIEPKEKLCYGWD EPSAEYVL

  2. Dicty_cDB: VHF754 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF754 (Link to dictyBase) - - - Contig-U16531-1 VHF754P (Link to Original site) VHF...754F 526 VHF754Z 624 VHF754P 1130 - - Show VHF754 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-C/VHF754Q.Seq.d/ Representative seq. ID VHF...754P (Link to Original site) Representative DNA sequence >VHF754 (VHF754Q) /CSM/VH/VHF7-C/VHF...ixnkmqwlkmlqvk*killk*ekvvslgiiftipf--- ---flvsichfnchc*itfccsrwnnlxllxfldsryllqw*

  3. Dicty_cDB: VHF461 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF461 (Link to dictyBase) - - - Contig-U11551-1 VHF461P (Link to Original site) VHF...461F 646 VHF461Z 261 VHF461P 887 - - Show VHF461 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF4-C/VHF461Q.Seq.d/ Representative seq. ID VHF...461P (Link to Original site) Representative DNA sequence >VHF461 (VHF461Q) /CSM/VH/VHF4-C/VHF4...TTAAATTATTAAAAATAGTAAATAAAAAAAA sequence update 2002.10.25 Translated Amino Acid sequence fyfifenfkthfhiiffl

  4. Dicty_cDB: VHF781 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF781 (Link to dictyBase) - - - Contig-U16440-1 VHF781P (Link to Original site) VHF...781F 452 VHF781Z 680 VHF781P 1112 - - Show VHF781 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-D/VHF781Q.Seq.d/ Representative seq. ID VHF...781P (Link to Original site) Representative DNA sequence >VHF781 (VHF781Q) /CSM/VH/VHF7-D/VHF...vlkmmmlkf*xixftr*r Frame C: glldinkleeiik*rfhlfylfl*rlllayhfhkilfqlisktaligsnfnhyiqikmim y*l*iqdqrmf*kdqqmvv

  5. Dicty_cDB: VHF435 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF435 (Link to dictyBase) - - - Contig-U16260-1 VHF435P (Link to Original site) VHF...435F 616 VHF435Z 703 VHF435P 1299 - - Show VHF435 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF4-B/VHF435Q.Seq.d/ Representative seq. ID VHF...435P (Link to Original site) Representative DNA sequence >VHF435 (VHF435Q) /CSM/VH/VHF4-B/VHF...AKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHF

  6. Dicty_cDB: VHF553 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF553 (Link to dictyBase) - - - Contig-U16433-1 VHF553P (Link to Original site) VHF...553F 122 VHF553Z 533 VHF553P 635 - - Show VHF553 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-C/VHF553Q.Seq.d/ Representative seq. ID VHF...553P (Link to Original site) Representative DNA sequence >VHF553 (VHF553Q) /CSM/VH/VHF5-C/VHF5...ed Amino Acid sequence syhfylfiy*IIIYLLNYYLLSCVNYLPINFNILYIY--- ---YVINLTLDGDNVNGFPKTVTVKPAPSXEQXYAEGEGLVKVF

  7. Dicty_cDB: VHF163 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF163 (Link to dictyBase) - - - Contig-U11129-1 VHF163P (Link to Original site) VHF1...63F 611 VHF163Z 654 VHF163P 1245 - - Show VHF163 Library VH (Link to library) Clone ID VHF1...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-C/VHF163Q.Seq.d/ Representative seq. ID VHF1...63P (Link to Original site) Representative DNA sequence >VHF163 (VHF163Q) /CSM/VH/VHF1-C/VHF1...nt alignments: (bits) Value VHF163 (VHF163Q) /CSM/VH/VHF1-C/VHF163Q.Seq.d/ 2357 0.0 VHM584 (VHM584Q) /CSM/VH

  8. Dicty_cDB: VHF444 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (Link to library) VHF444 (Link to dictyBase) - G20601 DDB0204337 Contig-U12392-1 VHF444P (Link to Original...site) VHF444F 579 VHF444Z 213 VHF444P 772 - - Show VHF444 Library VH (Link to library) Clone ID VHF444 (Link...tsukuba.ac.jp/CSM/VH/VHF4-B/VHF444Q.Seq.d/ Representative seq. ID VHF444P (Link to Original site) Representative...Representative DNA sequence >VHF444 (VHF444Q) /CSM/VH/VHF4-B/VHF444Q.Seq.d/ CAAAAGAAATAAATAATTATGCCATCA...significant alignments: (bits) Value VHF444 (VHF444Q) /CSM/VH/VHF4-B/VHF444Q.Seq.d/ 1479 0.0 VHA836 (VHA836Q)

  9. Dicty_cDB: VHF338 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF338 (Link to dictyBase) - - - Contig-U14303-1 VHF338P (Link to Original site) VHF3...38F 208 VHF338Z 685 VHF338P 873 - - Show VHF338 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF338Q.Seq.d/ Representative seq. ID VHF3...38P (Link to Original site) Representative DNA sequence >VHF338 (VHF338Q) /CSM/VH/VHF3-B/VHF3...significant alignments: (bits) Value VHF338 (VHF338Q) /CSM/VH/VHF3-B/VHF338Q.Seq.d/ 1296 0.0 VHK267 (VHK267Q

  10. Dicty_cDB: VHF394 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF394 (Link to dictyBase) - - - Contig-U16260-1 VHF394P (Link to Original site) VHF3...94F 563 VHF394Z 417 VHF394P 960 - - Show VHF394 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-D/VHF394Q.Seq.d/ Representative seq. ID VHF3...94P (Link to Original site) Representative DNA sequence >VHF394 (VHF394Q) /CSM/VH/VHF3-D/VHF3...nt alignments: (bits) Value VHF394 (VHF394Q) /CSM/VH/VHF3-D/VHF394Q.Seq.d/ 1776 0

  11. Dicty_cDB: VHF340 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF340 (Link to dictyBase) - - - Contig-U11939-1 VHF340P (Link to Original site) VHF3...40F 113 VHF340Z 506 VHF340P 599 - - Show VHF340 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF340Q.Seq.d/ Representative seq. ID VHF3...40P (Link to Original site) Representative DNA sequence >VHF340 (VHF340Q) /CSM/VH/VHF3-B/VHF3...Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF340 (VHF340Q) /CSM/VH/VHF3-B/VHF3

  12. Dicty_cDB: VHF329 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF329 (Link to dictyBase) - - - Contig-U16260-1 VHF329P (Link to Original site) VHF3...29F 618 VHF329Z 633 VHF329P 1231 - - Show VHF329 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF329Q.Seq.d/ Representative seq. ID VHF3...29P (Link to Original site) Representative DNA sequence >VHF329 (VHF329Q) /CSM/VH/VHF3-B/VHF3...s CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF329 (VHF329Q) /CSM/VH/VHF3

  13. Dicty_cDB: VHF187 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF187 (Link to dictyBase) - - - Contig-U16363-1 VHF187P (Link to Original site) VHF1...87F 549 VHF187Z 707 VHF187P 1236 - - Show VHF187 Library VH (Link to library) Clone ID VHF1...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-D/VHF187Q.Seq.d/ Representative seq. ID VHF1...87P (Link to Original site) Representative DNA sequence >VHF187 (VHF187Q) /CSM/VH/VHF1-D/VHF1...* Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF187 (VHF1

  14. Dicty_cDB: VHF368 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF368 (Link to dictyBase) - - - Contig-U12673-1 VHF368P (Link to Original site) VHF3...68F 597 VHF368Z 746 VHF368P 1323 - - Show VHF368 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-C/VHF368Q.Seq.d/ Representative seq. ID VHF3...68P (Link to Original site) Representative DNA sequence >VHF368 (VHF368Q) /CSM/VH/VHF3-C/VHF3...ikfpknkii*nki k*nkiky Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF368 (VHF3

  15. Dicty_cDB: VHF348 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF348 (Link to dictyBase) - - - Contig-U13926-1 VHF348P (Link to Original site) VHF3...48F 539 VHF348Z 473 VHF348P 992 - - Show VHF348 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF348Q.Seq.d/ Representative seq. ID VHF3...48P (Link to Original site) Representative DNA sequence >VHF348 (VHF348Q) /CSM/VH/VHF3-B/VHF3...ksxvlmliltck Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF3

  16. Dicty_cDB: VHF312 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF312 (Link to dictyBase) - - - Contig-U15897-1 VHF312P (Link to Original site) VHF3...12F 543 VHF312Z 483 VHF312P 1006 - - Show VHF312 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF312Q.Seq.d/ Representative seq. ID VHF3...12P (Link to Original site) Representative DNA sequence >VHF312 (VHF312Q) /CSM/VH/VHF3-A/VHF3... 4.0 %: extracellular, including cell wall 4.0 %: plasma membrane 4.0 %: peroxisomal >> prediction for VHF31

  17. Dicty_cDB: VHF375 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF375 (Link to dictyBase) - - - Contig-U16260-1 VHF375P (Link to Original site) VHF3...75F 432 VHF375Z 670 VHF375P 1082 - - Show VHF375 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-D/VHF375Q.Seq.d/ Representative seq. ID VHF3...75P (Link to Original site) Representative DNA sequence >VHF375 (VHF375Q) /CSM/VH/VHF3-D/VHF3...pperekv*pqksqiltnstknskqfkshxsfqr*xsnlkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF3

  18. Dicty_cDB: VHF190 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available F0-ATPase putative regulatory protein IF1 (if1) mRNA, complete cds; nuclear gene for mitochondrial produc...VH (Link to library) VHF190 (Link to dictyBase) - - - Contig-U12594-1 - (Link to Original site) VHF1...90F 581 - - - - - - Show VHF190 Library VH (Link to library) Clone ID VHF190 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF1-D/VHF190Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF190 (VHF190Q) /CSM/VH/VHF1-D/VHF190Q.Seq.d/ ATTTTTCATTTTAAAAA

  19. Dicty_cDB: VHF331 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF331 (Link to dictyBase) - - - - - (Link to Original site) VHF3...31F 609 - - - - - - Show VHF331 Library VH (Link to library) Clone ID VHF331 (Link to dictyBase) Atlas ID... - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF3...31Q.Seq.d/ Representative seq. ID - (Link to Original site) Representative DNA sequence >VHF3...31 (VHF331Q) /CSM/VH/VHF3-B/VHF331Q.Seq.d/ AACTCTCGAGTGCAAAAAAAGTAAAGTACAAAATGGTTAATTTCA

  20. Dicty_cDB: VHF709 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF709 (Link to dictyBase) - - - Contig-U15897-1 - (Link to Original site) - - VHF...709Z 602 - - - - Show VHF709 Library VH (Link to library) Clone ID VHF709 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF7-A/VHF709Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF709 (VHF709Q) /CSM/VH/VHF7-A/VHF709Q.Seq.d/ XXXXXXXXXXCGTCCAA...vestir Frame B: ---sknfttrsrlqlccsfnglxpr**rw*tnrqhyhg*cksiwsssfnlsryyw*yrcs ilpqiq*kwchhsnlpiw*wsflyhf

  1. Dicty_cDB: VHF236 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF236 (Link to dictyBase) - - - Contig-U14303-1 - (Link to Original site) - - VHF...236Z 611 - - - - Show VHF236 Library VH (Link to library) Clone ID VHF236 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF2-B/VHF236Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF236 (VHF236Q) /CSM/VH/VHF2-B/VHF236Q.Seq.d/ XXXXXXXXXXTGCCATT...VQKISQELKHLT*tfvsylvlk Frame B: ---plvicc*ninvlhfveilsxhglay*xhcfplvlv*fqilsrmiqs

  2. Dicty_cDB: VHF140 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF140 (Link to dictyBase) - - - Contig-U15309-1 - (Link to Original site) - - VHF...140Z 518 - - - - Show VHF140 Library VH (Link to library) Clone ID VHF140 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF1-B/VHF140Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF140 (VHF140Q) /CSM/VH/VHF1-B/VHF140Q.Seq.d/ XXXXXXXXXXCCGATAA...EDYINMQIKQLENSENSQELIQKLNEHLSEYKASVEEIKHNVQNN Frame C: ---iixvtlmlflqngilhfigviil

  3. Dicty_cDB: VHF507 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF507 (Link to dictyBase) - - - Contig-U11594-1 - (Link to Original site) - - VHF...507Z 541 - - - - Show VHF507 Library VH (Link to library) Clone ID VHF507 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF5-A/VHF507Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF507 (VHF507Q) /CSM/VH/VHF5-A/VHF507Q.Seq.d/ XXXXXXXXXXTACCAAT...nvhsmiwihvglxlvigx*sncfvttsfikst mmvllcstftmllkpsixwivvsmkkyf*clemnxhfw*sviki*knv

  4. Dicty_cDB: VHF321 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF321 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) VHF...321F 617 - - - - - - Show VHF321 Library VH (Link to library) Clone ID VHF321 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF321Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF321 (VHF321Q) /CSM/VH/VHF3-A/VHF321Q.Seq.d/ AACTCTCGAGTGCAAAA...VIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHFEMPKEDKLPAGCTSHEFLINLIDSPGHVDFS SEVTAALRVTDGALVVIDC

  5. Dicty_cDB: VHF866 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF866 (Link to dictyBase) - - - Contig-U16600-1 - (Link to Original site) - - VHF...866Z 388 - - - - Show VHF866 Library VH (Link to library) Clone ID VHF866 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF8-C/VHF866Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF866 (VHF866Q) /CSM/VH/VHF8-C/VHF866Q.Seq.d/ XXXXXXXXXXAAGCAGC...Frame C: ---qhnnifklafptiknftgvpmxfvmtnegdnlgnftvkthfakffstyyscgeaghh yfdsccn*y*qkqgckfhs*h*xkssrr*lcfxqnwfi

  6. Dicty_cDB: VHF155 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF155 (Link to dictyBase) - - - - VHF155P (Link to Original site) VHF155F 587 VHF1...55Z 643 VHF155P 1210 - - Show VHF155 Library VH (Link to library) Clone ID VHF155 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1...-C/VHF155Q.Seq.d/ Representative seq. ID VHF155P (Link to... Original site) Representative DNA sequence >VHF155 (VHF155Q) /CSM/VH/VHF1-C/VHF155Q.Seq.d/ ATTCTCGATACTGGAA

  7. Dicty_cDB: VHF392 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF392 (Link to dictyBase) - - - - VHF392P (Link to Original site) VHF392F 568 VHF3...92Z 375 VHF392P 923 - - Show VHF392 Library VH (Link to library) Clone ID VHF392 (Link ...to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3...-D/VHF392Q.Seq.d/ Representative seq. ID VHF392P (Link to ...Original site) Representative DNA sequence >VHF392 (VHF392Q) /CSM/VH/VHF3-D/VHF392Q.Seq.d/ AACTCTCGAGTGCAAAA

  8. Dicty_cDB: VHF366 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF366 (Link to dictyBase) - - - Contig-U12131-1 | Contig-U13633-1 VHF3...66P (Link to Original site) VHF366F 590 VHF366Z 544 VHF366P 1114 - - Show VHF366 Library VH (Link to library) Clone ID VHF3...131-1 | Contig-U13633-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-C/VHF3...66Q.Seq.d/ Representative seq. ID VHF366P (Link to Original site) Representative DNA sequence >VHF366 (VHF3...66Q) /CSM/VH/VHF3-C/VHF366Q.Seq.d/ AATAATTTATTATTATTATTAATAAGTAATAGAAATAAAAGATGGAACCAATTCCAGATA

  9. Dicty_cDB: VHF310 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF310 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) - - VHF3...10Z 625 - - - - Show VHF310 Library VH (Link to library) Clone ID VHF310 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF310Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF310 (VHF310Q) /CSM/VH/VHF3-A/VHF310Q.Seq.d/ XXXXXXXXXXTCGTCAA...omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF310 (VHF310Q) /CSM/VH/VHF3-A/VHF3

  10. Dicty_cDB: VHF315 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF315 (Link to dictyBase) - G20600 DDB0169270 Contig-U12450-1 VHF3...15P (Link to Original site) VHF315F 216 VHF315Z 353 VHF315P 549 - - Show VHF315 Library VH (Link to library) Clone ID VHF3...ontig-U12450-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF3...15Q.Seq.d/ Representative seq. ID VHF315P (Link to Original site) Representative DNA sequence >VHF315 (VHF315Q) /CSM/VH/VHF3...-A/VHF315Q.Seq.d/ ATTAAAAAACTTCTTACTTGGACACCCCTTTTATATATATAAATAAAAACTTCTAAATAT AAATCCCA

  11. Dicty_cDB: VHF381 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF381 (Link to dictyBase) - - - Contig-U16508-1 - (Link to Original site) - - VHF3...81Z 645 - - - - Show VHF381 Library VH (Link to library) Clone ID VHF381 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF3-D/VHF381Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF381 (VHF381Q) /CSM/VH/VHF3-D/VHF381Q.Seq.d/ XXXXXXXXXXCAACCAA...ignments: (bits) Value VHF381 (VHF381Q) /CSM/VH/VHF3-D/VHF381Q.Seq.d/ 1223 0.0 VHP767 (VHP767Q) /CSM/VH/VHP7

  12. Dicty_cDB: VHF210 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF210 (Link to dictyBase) - - - Contig-U12400-1 | Contig-U16431-1 VHF...210P (Link to Original site) VHF210F 613 VHF210Z 636 VHF210P 1229 - - Show VHF210 Library VH (Link to library) Clone ID VHF...400-1 | Contig-U16431-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-A/VHF...210Q.Seq.d/ Representative seq. ID VHF210P (Link to Original site) Representative DNA sequence >VHF210 (VHF...210Q) /CSM/VH/VHF2-A/VHF210Q.Seq.d/ AATAAAATGATAAGATCATCAATAAAAAATAAAATAACAACAACAAAAAGTTTATCATGT

  13. Dicty_cDB: VHF575 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF575 (Link to dictyBase) - - - Contig-U15481-1 | Contig-U15981-1 VHF...575P (Link to Original site) VHF575F 586 VHF575Z 397 VHF575P 963 - - Show VHF575 Library VH (Link to library) Clone ID VHF...81-1 | Contig-U15981-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-D/VHF...575Q.Seq.d/ Representative seq. ID VHF575P (Link to Original site) Representative DNA sequence >VHF575 (VHF...575Q) /CSM/VH/VHF5-D/VHF575Q.Seq.d/ ATAATAATACAAAGAAGAAATGAAAAATATAAATAATAAAATTTTAAAGATTTTTATTCT

  14. Dicty_cDB: VHF296 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF296 (Link to dictyBase) - G23392 DDB0187414 Contig-U12449-1 VHF...296P (Link to Original site) VHF296F 241 VHF296Z 482 VHF296P 703 - - Show VHF296 Library VH (Link to library) Clone ID VHF...ontig-U12449-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-D/VHF...296Q.Seq.d/ Representative seq. ID VHF296P (Link to Original site) Representative DNA sequence >VHF296 (VHF296Q) /CSM/VH/VHF...2-D/VHF296Q.Seq.d/ GATTATCAGAAAGATTACATTATGAAATTATACCAGATTGTATTAAAATTATTGAAAGCT CAAAACAA

  15. Dicty_cDB: VHF436 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF436 (Link to dictyBase) - - - - VHF436P (Link to Original site) VHF436F 618 VHF...436Z 699 VHF436P 1297 - - Show VHF436 Library VH (Link to library) Clone ID VHF436 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF...4-B/VHF436Q.Seq.d/ Representative seq. ID VHF436P (Link to... Original site) Representative DNA sequence >VHF436 (VHF436Q) /CSM/VH/VHF4-B/VHF436Q.Seq.d/ AACTCTCGAGTGCAAA

  16. Dicty_cDB: VHF158 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF158 (Link to dictyBase) - - - - VHF158P (Link to Original site) VHF158F 608 VHF...158Z 693 VHF158P 1281 - - Show VHF158 Library VH (Link to library) Clone ID VHF158 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF...1-C/VHF158Q.Seq.d/ Representative seq. ID VHF158P (Link to... Original site) Representative DNA sequence >VHF158 (VHF158Q) /CSM/VH/VHF1-C/VHF158Q.Seq.d/ AACTCTCGAGTGCAAA

  17. Dicty_cDB: VHF847 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF847 (Link to dictyBase) - - - Contig-U15351-1 | Contig-U16514-1 VHF...847P (Link to Original site) VHF847F 478 VHF847Z 709 VHF847P 1167 - - Show VHF847 Library VH (Link to library) Clone ID VHF...351-1 | Contig-U16514-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF8-B/VHF...847Q.Seq.d/ Representative seq. ID VHF847P (Link to Original site) Representative DNA sequence >VHF847 (VHF...847Q) /CSM/VH/VHF8-B/VHF847Q.Seq.d/ TATGATGTTCCACTTATAATTCAAACGGTTGCCAATAATAAATCAACAAAACTCANTCTT

  18. Dicty_cDB: VHF272 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF272 (Link to dictyBase) - - - Contig-U15754-1 VHF272P (Link to Original site) VHF...272F 515 VHF272Z 603 VHF272P 1098 - - Show VHF272 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-C/VHF272Q.Seq.d/ Representative seq. ID VHF...272P (Link to Original site) Representative DNA sequence >VHF272 (VHF272Q) /CSM/VH/VHF2-C/VHF...id sequence (All Frames) Frame A: ixfssq**wnkkd*mihy*eiligrigvpm*vidngqlfvkimvvnhgptfhtimldhvh idgqrivlvdfvidfkifv*v*hf

  19. Dicty_cDB: VHF476 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uences producing significant alignments: (bits) Value VHF476 (VHF476Q) /CSM/VH/VHF4-D/VHF476Q.Seq.d/ 198 2e-...46 own update 2003.10.17 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value...e 2008.10.29 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value (Q54AX5) R

  20. 47 CFR 22.719 - Additional channel policy for rural radiotelephone stations.

    Science.gov (United States)

    2010-10-01

    ... applied for or been granted an authorization for other rural radiotelephone channel pairs in the same area... grade of service (blocking probability), and the applicant demonstrates that there will still be...

  1. Dicty_cDB: VHF729 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ences producing significant alignments: (bits) Value VHF729 (VHF729Q) /CSM/VH/VHF...4-A/CHC421Q.Seq.d/ 139 9e-33 own update 2002.12.27 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value... 139 2e-29 1 dna update 2008.10.31 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value

  2. From ultrafast spectroscopy to bidirectional molecular switches: DHA/VHF

    Science.gov (United States)

    Schmidhammer, U.; De Waele, V.; Buntinx, G.; Riedle, E.

    The photoconversion from dihydroazulene (DHA) to vinylheptafulvene (VHF) is governed by two mechanisms: The ring opening proceeds on the excited energy surface on the picosecond time scale. It is followed by an intemal conversion to the VHF ground state that is accelerated by the presence of a conical intersection in the case of cyclopenta-DHA. This conical intersection hinders the photoinduced back reaction from the final VHF products. However, we successfully photoconverted the cyanophenyl-VHF-cis back to the DHA with a second delayed pulse. This opens the route to the development of bistable DHAs.

  3. Comparison study of Lightning VHF interferometric and LF time-of-arival maps

    Science.gov (United States)

    Kudo, A.; Stock, M.; Kawasaki, Z.; Ushio, T.

    2016-12-01

    Lightning discharges radiate broad band frequency electromagnetic waves from ULF to UHF. Using sensors which detect this radiation is an effective technique to detect lightning flashes, even if they are in a cloud. If multiple sensors are present, a lightning flash can be located using various techniques. At low frequencies, the power radiated by lightning is very high, but because the wavelengths are long, the location resolution is somewhat low. At very high frequencies, the wavelengths are much shorter allowing for much better location resolution, but the power radiation is also much lower, making it more difficult to detect. The VHF band is a good compromise between good location resolution, and good detection efficiency. One technique to locate VHF signals from lightning is interferometry. Using this technique, the signals arriving at three or more VHF broadband antennas are coherently combined to produce an image of the lightning flash. The current generation broadband lightning interferometer being developed in Japan by RAIRAN and the University of Osaka called Lightning Interferometer via VHF Emission (LIVE). Currently, LIVE is installed in Kaizuka, a city to the south of Osaka, near Osaka Bay to observe Japanese summer lightning. In the current study, we are comparing the high detail, 2-dimensional lightning maps produced by LIVE to the lower detail, 3-dimensional maps produced by a low frequency time-of-arrival system called the Broadband Observation network for Lightning and Thunderstorms (BOLT). In order to better compare the data, a new GPS timing device is being developed for LIVE to allow high absolute timing accuracy without sacrificing one of the 4 high speed digitizer channels. The objectives of the study are to better understand Japanese summer lightning, and to prepare for a future campaign as part of the GLM validation study.

  4. Dicty_cDB: VHF823 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uences producing significant alignments: (bits) Value VHF823 (VHF823Q) /CSM/VH/VH...186Q.Seq.d/ 86 1e-16 own update 2009. 4. 4 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value...-13 1 dna update 2008.10.31 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value

  5. 47 CFR 22.727 - Power limits for conventional rural radiotelephone transmitters.

    Science.gov (United States)

    2010-10-01

    ... radiotelephone transmitters. 22.727 Section 22.727 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED... this section. (a) Maximum ERP. The effective radiated power (ERP) of central office and rural... circumstances. Frequency range (MHz) Maximum ERP (watts) 152-153 1400 157-159 150 454-455 3500 459-460 150 (b...

  6. Dicty_cDB: VHF145 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF145 (Link to dictyBase) - - - Contig-U15430-1 VHF145E (Link...) Clone ID VHF145 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15430-1 Ori...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116984 |AC116984.2 Dictyos... theta DNA for complete sequence of nucleomorph chromosome 2. 48 2e-07 2 ES451909 | PREDICTED: similar to PI...al 16.0 %: nuclear 8.0 %: vacuolar 8.0 %: endoplasmic reticulum 4.0 %: cytoskeletal >> prediction for VHF145

  7. Broadband Grounded Vertical Antennas for 30-180 MHZ (VHF)

    Science.gov (United States)

    2013-10-18

    antennas are well known for their broadband gain (monocone, bicone ) but are never combined with a monopole. An eccentric combination of broadband...DATES COVERED 00-00-2014 to 00-00-2014 4. TITLE AND SUBTITLE Broadband Grounded Vertical Antennas For 30-180 MZH (VHF) 5a. CONTRACT NUMBER 5b...18 Attorney Docket No. 102536 1 of 17 BROADBAND GROUNDED VERTICAL ANTENNAS FOR 30-180 MHZ (VHF) STATEMENT OF GOVERNMENT INTEREST

  8. Anechoic chamber for VHF and UHF bands

    Science.gov (United States)

    Morikawa, Takao; Sugiura, Akira; Harima, Katsushige; Masuzawa, Hiroshi

    1995-06-01

    Built in 1969, the anechoic chamber of CRL has been used to the fullest by researchers in many fields such as EMI, EMC, antenna design, standard of electric field intensity, and type approval testing. In particular, in the early days of space development in Japan, many satellite-born antennas were developed in this anechoic chamber. However, a quarter of a century has passed since its construction and deteriorated performance due to superannuation sometimes caused difficulties in experiments conducted in the chamber. In 1993, CRL constructed a Measuring Facility for Radio Research (MFRR) and the anechoic chamber for VHF-UHF bands was remodeled as one of the sub-facilities of MFRR. The remodeling work included full replacement of the electromagnetic shielding, absorbers and measurement system. Since the remodeled anechoic chamber is being used not only for EMI tests but also for other purposes, a full-anechoic chamber has been adopted. In addition the chamber has been designed for the frequency range between 30 MHz and 10 GHz. After the remodeling work, the performance of the chamber is greatly improved. The average shielding factor is better than 85 dB for all frequency ranges and the unwanted reflection characteristic is -30 dB for frequencies above 1 GHZ. This paper summarizes the remodeling work, and the specifications and performance of the remodeled anechoic chamber.

  9. Ultimate VHF Broadband Interferometer Zen KAWASAKI and Manabu AKITA

    Science.gov (United States)

    Kawasaki, Z.; Akita, M.

    2013-12-01

    Lightning Research Group of Osaka University (LRGOU) has been developing an interferometer for thunderstorm monitoring during these two decades. When LRGOU initiated this project, many related scientists claimed that LRGOU's system was a time of arrival and it must be a sophisticated TOA system. However the key technology of the system were broad band and digital data processing, and it is named the VHF broad band digital interferometer (BDITF), because the phase difference of Fourier components played the very important role. Then the BDITF finally has been realized as a quasi-real time lightning monitoring system, and LRGOU has been operating their BDITFs around Osaka area. Since the BDITF captures the VHF impulses associated with lightning discharges by amplitude triggering, it occasionally misses one of the bi-directional leader progressions because of relatively small amplitude VHF impulses mainly emitted by positive leader tips. All of high density of VHF pulses associated with recoil leaders may not be recorded. Then the ordinary BDITF is able to be accepted as the practical operational system, but from the aspect of science it has been sioriously expected to be improved its performance. To overcome the difficulty New Mexico Institute of Mining and Technology (NMIMT) and LRGOU have started the joint project, and a continuous recording system for digital signals is adopted [M. Stock et al, and M Akita et al,]. The field campaigns have been conducting in New Mexico and in Japan, and successful observations are accomplished. The algorithm to identify individual VHF pulses associated with lightning discharges from back ground noise and/or artificial noise, the dispersion of phase differences for all Fourier components is examined. In case by of small dispersion it is concluded that analyzed VHF pulse has high possibility to be emitted by lightning discharges. This interpretation means that the recorded VHF pulse shape might maintain without deformation during

  10. VHF signal power suppression in stratiform and convective precipitation

    Directory of Open Access Journals (Sweden)

    A. J. McDonald

    2006-03-01

    Full Text Available Previous studies have indicated that VHF clear-air radar return strengths are reduced during periods of precipitation. This study aims to examine whether the type of precipitation, stratiform and convective precipitation types are identified, has any impact on the relationships previously observed and to examine the possible mechanisms which produce this phenomenon. This study uses a combination of UHF and VHF wind-profiler data to define periods associated with stratiform and convective precipitation. This identification is achieved using an algorithm which examines the range squared corrected signal to noise ratio of the UHF returns for a bright band signature for stratiform precipitation. Regions associated with convective rainfall have been defined by identifying regions of enhanced range corrected signal to noise ratio that do not display a bright band structure and that are relatively uniform until a region above the melting layer.

    This study uses a total of 68 days, which incorporated significant periods of surface rainfall, between 31 August 2000 and 28 February 2002 inclusive from Aberystwyth (52.4° N, 4.1° W. Examination suggests that both precipitation types produce similar magnitude reductions in VHF signal power on average. However, the frequency of occurrence of statistically significant reductions in VHF signal power are very different. In the altitude range 2-4 km stratiform precipitation is related to VHF signal suppression approximately 50% of the time while in convective precipitation suppression is observed only 27% of the time. This statistical result suggests that evaporation, which occurs more often in stratiform precipitation, is important in reducing the small-scale irregularities in humidity and thereby the radio refractive index. A detailed case study presented also suggests that evaporation reducing small-scale irregularities in humidity may contribute to the observed VHF signal

  11. VHF signal power suppression in stratiform and convective precipitation

    Directory of Open Access Journals (Sweden)

    A. J. McDonald

    2006-03-01

    Full Text Available Previous studies have indicated that VHF clear-air radar return strengths are reduced during periods of precipitation. This study aims to examine whether the type of precipitation, stratiform and convective precipitation types are identified, has any impact on the relationships previously observed and to examine the possible mechanisms which produce this phenomenon. This study uses a combination of UHF and VHF wind-profiler data to define periods associated with stratiform and convective precipitation. This identification is achieved using an algorithm which examines the range squared corrected signal to noise ratio of the UHF returns for a bright band signature for stratiform precipitation. Regions associated with convective rainfall have been defined by identifying regions of enhanced range corrected signal to noise ratio that do not display a bright band structure and that are relatively uniform until a region above the melting layer. This study uses a total of 68 days, which incorporated significant periods of surface rainfall, between 31 August 2000 and 28 February 2002 inclusive from Aberystwyth (52.4° N, 4.1° W. Examination suggests that both precipitation types produce similar magnitude reductions in VHF signal power on average. However, the frequency of occurrence of statistically significant reductions in VHF signal power are very different. In the altitude range 2-4 km stratiform precipitation is related to VHF signal suppression approximately 50% of the time while in convective precipitation suppression is observed only 27% of the time. This statistical result suggests that evaporation, which occurs more often in stratiform precipitation, is important in reducing the small-scale irregularities in humidity and thereby the radio refractive index. A detailed case study presented also suggests that evaporation reducing small-scale irregularities in humidity may contribute to the observed VHF signal suppression.

  12. From VHF to UHF CMOS-MEMS Monolithically Integrated Resonators

    DEFF Research Database (Denmark)

    Teva, Jordi; Berini, Abadal Gabriel; Uranga, A.

    2008-01-01

    This paper presents the design, fabrication and characterization of microresonators exhibiting resonance frequencies in the VHF and UHF bands, fabricated using the available layers of the standard and commercial CMOS technology, AMS-0.35mum. The resonators are released in a post-CMOS process cons...

  13. Wind profiler installed in Antarctica

    Science.gov (United States)

    Balsley, B. B.; Carey, J.; Woodman, R. F.; Sarango, M.; Urbina, J.; Rodriguez, R.; Ragaini, E.

    A VHF (50 MHz) wind profiler was installed in Antarctica at the Peruvian Base “Machu Picchu” on King George Island from January 21 to 26. The wind profiler will provide a first look at atmospheric dynamics over the region.The profiler—the first of its kind in Antarctica—is a National Science Foundationsponsored cooperative project of the University of Colorado, the Geophysical Institute of Peru, the University of Piura (Peru), and the Peruvian Navy. This venture was also greatly facilitated by Peru's Comision Nacional de Asuntos Antartidos and Consejo Nacional de Ciencias y Tecnologia, with additional logis tics support provided by the Argentinean Navy and the Uruguayan Air Force.

  14. Installation Art

    DEFF Research Database (Denmark)

    Petersen, Anne Ring

    . In Installation Art: Between Image and Stage, Anne Ring Petersen aims to change that. She begins by exploring how installation art developed into an interdisciplinary genre in the 1960s, and how its intertwining of the visual and the performative has acted as a catalyst for the generation of new artistic...... trajectory of the book is directed by a movement aimed at addressing a series of basic questions that get at the heart of what installation art is and how it is defined: How does installation structure time, space and representation? How does it address and engage its viewers? And how does it draw...

  15. Phase and coherence analysis of VHF scintillation over Christmas Island

    Directory of Open Access Journals (Sweden)

    E. B. Shume

    2014-03-01

    Full Text Available This short paper presents phase and coherence data from the cross-wavelet transform applied on longitudinally separated very high frequency (VHF equatorial ionospheric scintillation observations over Christmas Island. The phase and coherence analyses were employed on a pair of scintillation observations, namely, the east-looking and west-looking VHF scintillation monitors at Christmas Island. Our analysis includes 3 years of peak season scintillation data from 2008, 2009 (low solar activity, and 2011 (moderate solar activity. In statistically significant and high spectral coherence regions of the cross-wavelet transform, scintillation observations from the east-looking monitor lead those from the west-looking monitor by about 20 to 60 (40 ± 20 min (most frequent lead times. Using several years (seasons and solar cycle of lead (or lag and coherence information of the cross-wavelet transform, we envisage construction of a probability model for forecasting scintillation in the nighttime equatorial ionosphere.

  16. Installing Omeka

    Directory of Open Access Journals (Sweden)

    Jonathan Reeve

    2016-07-01

    Full Text Available Omeka.net is a useful service for Omeka beginners, but there are a few reasons why you might want to install your own copy of Omeka. Reasons include: * Upgrades. By installing Omeka yourself, you can use the latest versions of Omeka as soon as they’re released, without having to wait for Omeka.net to upgrade their system. * Plugins and themes. You can install any plugin or theme you want, without being restricted to those provided by Omeka.net. * Customizations. You can buy a custom domain name, and customize your code to achieve your desired functionality. * Control. You have control over your own backups, and you can update the server yourself so that its security is always up-to-date. * Price. There are many low-cost Virtual Private Servers (VPSs now, some of which cost only $5 per month. * Storage. Many shared hosting providers now offer unlimited storage. This is useful if you have a large media library. In this tutorial, we’ll be entering a few commands on the command line. This tutorial assumes no prior knowledge of the command line, but if you want a concise primer, consult the Programming Historian introduction to BASH. There are other ways of installing Omeka, of course, some using exclusively GUI tools. Some hosting providers even offer “one-click installs” via their control panels. Many of those methods, however, will install older versions of Omeka which are then harder to upgrade and maintain. The method outlined below may not be the easiest way to install Omeka, but it will give you some good practice with using the command line, which is a skill that will be useful if you want to manually upgrade your install, or manually install other web frameworks. (For example, this installation method is very similar to WordPress’s “Five-Minute Install”. There are four steps to this process, and it should take about an hour.

  17. PMSE Observations With the Tri-Static EISCAT VHF Radars

    Science.gov (United States)

    Mann, I.; Tjulin, A.; Häggström, I.

    2013-12-01

    The polar mesospheric summer echoes (PMSE) are generated in the ionosphere at roughly 80 to 90 altitude by electron irregularities in the presence of charged solid particles and PMSE are most likely observed when ice particles form onto nanodust. PMSE formation is an important part in understanding mesospheric processes, but is also an interesting example for dusty plasma phenomena occurring in space. To investigate the phenomena that lead to formation of PMSE it is helpful to study the radar reflectivity of the mesosphere at different angles. PMSE were previously studied at different aspect angles in order to better understand the scattering process. Another way is observing PMSE from multiple sites simultaneously. During this summer the EISCAT radars that are located in Northern Scandinavia could for the first time be used for tri-static observations in the VHF band and we carried out observations during three subsequent days in June 2013. The radar signal was transmitted in zenith direction with the EISCAT VHF antenna near Tromsø (69.59 deg N, 19.23 deg E) and the scattered signal was measured from Tromsø, Kiruna (67.86 deg N, 20.44 deg E) and Sodankylä (67.36 deg N, 26.63 deg E). Zenith observations were simultaneously carried out with the Tromsø UHF radar (933 MHz). Other groups have previously reported the observations of PMSE simultaneously with the EISCAT VHF and UHF radars, but with a much lower occurrence rate for the UHF. UHF observations made during this campaign are dominated by incoherent scatter. The VHF system in Tromsø detected PMSE for a large fraction of the observation time. The VHF receivers in Kiruna and Sodankylä were pointed at typical PMSE heights above the Tromsø transmitter and detected radar reflections at the same time and altitude as the Tromsø radar. These observations are among the first tri-static observations of PMSE. Preliminary results from the campaign will be presented and discussed.

  18. Installation Art

    DEFF Research Database (Denmark)

    Petersen, Anne Ring

    . In Installation Art: Between Image and Stage, Anne Ring Petersen aims to change that. She begins by exploring how installation art developed into an interdisciplinary genre in the 1960s, and how its intertwining of the visual and the performative has acted as a catalyst for the generation of new artistic...... trajectory of the book is directed by a movement aimed at addressing a series of basic questions that get at the heart of what installation art is and how it is defined: How does installation structure time, space and representation? How does it address and engage its viewers? And how does it draw...... in the surrounding world to become part of the work? Featuring the work of such well-known artists as Bruce Nauman, Pipilotti Rist, Ilya Kabakov and many others, this book breaks crucial new ground in understanding the conceptual underpinnings of this multifarious art form....

  19. The first operation and results of the Chung-Li VHF radar

    Science.gov (United States)

    Chao, J. K.; Kuo, F. S.; Chu, Y. S.; Fu, I. J.; Rottger, J.; Liu, C. H.

    1986-01-01

    The Chung-Li Very High Frequency (VHF) radar is used in the dual-mode operations, applying Doppler beam-swinging as well as the spaced-antenna-drift method. The design of the VHF radar is examined. Results of performance tests are discussed.

  20. Installation Art

    DEFF Research Database (Denmark)

    Petersen, Anne Ring

    Despite its large and growing popularity – to say nothing of its near-ubiquity in the world’s art scenes and international exhibitions of contemporary art –installation art remains a form whose artistic vocabulary and conceptual basis have rarely been subjected to thorough critical examination....... In Installation Art: Between Image and Stage, Anne Ring Petersen aims to change that. She begins by exploring how installation art developed into an interdisciplinary genre in the 1960s, and how its intertwining of the visual and the performative has acted as a catalyst for the generation of new artistic...... phenomena. It investigates how it became one of today’s most widely used art forms, increasingly expanding into consumer, popular and urban cultures, where installation’s often spectacular appearance ensures that it meets contemporary demands for sense-provoking and immersive cultural experiences. The main...

  1. Installation Art

    DEFF Research Database (Denmark)

    Petersen, Anne Ring

    . In Installation Art: Between Image and Stage, Anne Ring Petersen aims to change that. She begins by exploring how installation art developed into an interdisciplinary genre in the 1960s, and how its intertwining of the visual and the performative has acted as a catalyst for the generation of new artistic......Despite its large and growing popularity – to say nothing of its near-ubiquity in the world’s art scenes and international exhibitions of contemporary art –installation art remains a form whose artistic vocabulary and conceptual basis have rarely been subjected to thorough critical examination...... phenomena. It investigates how it became one of today’s most widely used art forms, increasingly expanding into consumer, popular and urban cultures, where installation’s often spectacular appearance ensures that it meets contemporary demands for sense-provoking and immersive cultural experiences. The main...

  2. Very Compact and Broadband Active Antenna for VHF Band Applications

    Directory of Open Access Journals (Sweden)

    Y. Taachouche

    2012-01-01

    Full Text Available An active receiving antenna with small size consisting of a monopole loaded with a transistor bipolar is presented in this paper. A transistor is used in order to miniaturize the receiving active antenna size in VHF band. The vertical size of the structure is equal to λ/175, where λ is the wavelength at the lower frequency of the bandwidth. Despite the very small size of the antenna, the frequency bandwidth is very wide and the gain is suitable for FM application with sensitive receivers.

  3. Installation Art

    DEFF Research Database (Denmark)

    Petersen, Anne Ring

    Despite its large and growing popularity – to say nothing of its near-ubiquity in the world’s art scenes and international exhibitions of contemporary art –installation art remains a form whose artistic vocabulary and conceptual basis have rarely been subjected to thorough critical examination. I...... in the surrounding world to become part of the work? Featuring the work of such well-known artists as Bruce Nauman, Pipilotti Rist, Ilya Kabakov and many others, this book breaks crucial new ground in understanding the conceptual underpinnings of this multifarious art form.......Despite its large and growing popularity – to say nothing of its near-ubiquity in the world’s art scenes and international exhibitions of contemporary art –installation art remains a form whose artistic vocabulary and conceptual basis have rarely been subjected to thorough critical examination....... In Installation Art: Between Image and Stage, Anne Ring Petersen aims to change that. She begins by exploring how installation art developed into an interdisciplinary genre in the 1960s, and how its intertwining of the visual and the performative has acted as a catalyst for the generation of new artistic...

  4. First results from an iron lidar and a VHF radar at Davis, Antarctica

    Science.gov (United States)

    Luebken, F.; Morris, R. J.; Hoeffner, J.; Kaifler, B.; Viehl, T.

    2012-12-01

    We present temperature measurements at Davis, Antarctica (69°S, 78°E), and compare with simultaneous and co-located radar measurements of polar mesosphere summer echoes (PMSE). The mobile scanning iron lidar of the IAP in Kuehlungsborn was installed at Davis in December 2010. It measures iron densities, vertical winds, and temperatures in the iron layer, i. e. from approximately 80 to 100 km. It is based on probing the Doppler broadened resonance line of iron atoms at 386 nm and can operate under daylight conditions. Typical values for temperature uncertainty, altitude and time resolution are 3-5 K, 1 km, and 1 hour, respectively. The lidar also measures neutral air densities and temperatures in the stratosphere and lower mesosphere. At Davis the lidar has up to now achieved approximately 2700 hours of data which is presumably the largest nearly continuous data set in Antarctica. The mesopause altitude changes throughout the summer season by several kilometers, significantly different from the northern hemisphere summer. Depending on altitude, temperatures can be warmer or colder compared to the NH summer. Temperatures at Davis near 86 km are rather similar to the NH, but they are much colder at higher altitudes. The thermal structure around the mesopause at Davis is closely related to the general circulation in the stratosphere, namely to the transition from winter to summer conditions. Different from expectations we sometimes find the mesopause significantly higher and colder(!) compared to the NH. Furthermore, we find large thermal tides in the summer months with amplitudes of up to 6-7~K, which is much larger than expected from models. The Australien Antarctic Division operates a 55 MHz VHF radar at Davis since February 2003. We report first simultaneous measurements of PMSE and temperatures by the Fe lidar. PMSE are strong radar echoes related to ice particles and therefore require atmospheric temperatures being lower than the frost point temperature

  5. Miniaturization for ultrathin metamaterial perfect absorber in the VHF band

    Science.gov (United States)

    Khuyen, Bui Xuan; Tung, Bui Son; Yoo, Young Joon; Kim, Young Ju; Kim, Ki Won; Chen, Liang-Yao; Lam, Vu Dinh; Lee, Youngpak

    2017-03-01

    An efficient resolution for ultrathin metamaterial perfect absorber (MPA) is proposed and demonstrated in the VHF radio band (30-300 MHz). By adjusting the lumped capacitors and the through vertical interconnects, the absorber is miniaturized to be only λ/816 and λ/84 for its thickness and periodicity with respect to the operating wavelength (at 102 MHz), respectively. The detailed simulation and calculation show that the MPA can maintain an absorption rate over 90% in a certain range of incident angle and with a wide variation of capacitance. Additionally, we utilized the advantages of the initial single-band structure to realize a nearly perfect dual-band absorber in the same range. The results were confirmed by both simulation and experiment at oblique incidence angles up to 50°. Our work is expected to contribute to the actualization of future metamaterial-based devices working at radio frequency.

  6. Extraction of forest stand parameters from CARABAS VHF SAR images

    Energy Technology Data Exchange (ETDEWEB)

    Walter, Fredrik [Swedish Univ. of Agricultural Sciences, Uppsala (Sweden). Centre for Image Analysis

    1999-10-01

    Methods for extracting stand-wise forest parameters from CARABAS VHF SAR images have been developed and evaluated. CARABAS is a unique airborne synthetic aperture radar (SAR), developed by the Swedish Defence Research Establishment. It differs a lot from ordinary microwave radars by using wavelengths between 3.3 and 15 m, making the image intensity highly correlated to stem volume. Furthermore, by providing its own illumination source, the sensor operates independently of daylight and weather conditions. Empirical regression models have been developed for relating backscattering amplitude to stem volume, stem diameter, and tree height. To make comparison between CARABAS image data and forest parameters effective, a fully automatic geo-coding algorithm was developed. Image texture features have also been investigated. By using the variogram as a discriminating feature, CARABAS images and aerial images were segmented into homogeneous regions. Furthermore, a method for discriminating recently clear felled areas from forested areas, combining information from Almaz-1 SAR images and SPOT panchromatic data has also been developed, serving as a comparison to the main work of this thesis. For forest stands at near-horizontal ground, the results for estimating stem volume, stem diameter, and tree height from CARABAS image data are very satisfactory. The root mean square errors for the estimates are comparable to subjective ground-based inventories for dense forest stands. The methods and algorithms described in this thesis have been developed towards an operational remote sensing tool. Altogether, significant potential for mapping of forest characteristics exists using the CARABAS VHF SAR sensor 57 refs, 14 figs, 7 tabs

  7. Letter to the Editor: Complete maps of the aspect sensitivity of VHF atmospheric radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    1999-08-01

    Full Text Available Using the MU radar at Shigaraki, Japan (34.85°N, 136.10°E, we measure the power distribution pattern of VHF radar echoes from the mid-troposphere. The large number of radar beam-pointing directions (320 allows the mapping of echo power from 0° to 40° from zenith, and also the dependence on azimuth, which has not been achieved before at VHF wavelengths. The results show how vertical shear of the horizontal wind is associated with a definite skewing of the VHF echo power distribution, for beam angles as far as 30° or more from zenith, so that aspect sensitivity cannot be assumed negligible at any beam-pointing angle that most existing VHF radars are able to use. Consequently, the use of VHF echo power to calculate intensity of atmospheric turbulence, which assumes only isotropic backscatter at large beam zenith angles, will sometimes not be valid.Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; turbulence; instruments and techniques

  8. Design and Development of VHF Antennas for Space Borne Signal of Opportunity Receivers for Cubesat Platforms

    Science.gov (United States)

    Deshpande, Manohar; Piepmeier, Jeffrey

    2015-01-01

    Design and Development of VHF Antennas for Space Borne Signal of Opportunity Receivers for Cubesat Platforms. Space borne microwave remote sensors at VHF/UHF frequencies are important instruments to observe reflective properties of land surfaces through thick and heavy forestation on a global scale. One of the most cost effective ways of measuring land reflectivity at VHF/UHF frequencies is to use signals transmitted by existing communication satellites (operating at VHF/UHF band) as a signal of opportunity (SoOp) signal and passive receivers integrated with airborne/space borne platforms operating in the Low Earth Orbit (LEO). One of the critical components of the passive receiver is two antennas (one to receive only direct signal and other to receive only reflected signal) which need to have ideally high (>30dB) isolation. However, because of small size of host platforms and broad beam width of dipole antennas, achieving adequate isolation between two channels is a challenging problem and need to be solved for successful implementation of space borne SoOp technology for remote sensing. In this presentation a novel enabling VHF antenna technology for Cubesat platforms is presented to receive direct as well as reflected signal with needed isolation. The novel scheme also allows enhancing the gain of individual channels by factor of 2 without use of reflecting ground plane

  9. PENUMBUHAN LAPISAN TIPIS SILIKON MIKROKRISTAL TERHIDROGENASI DENGAN TEKNIK HWC-VHF-PECVD

    Directory of Open Access Journals (Sweden)

    Ida Usman

    2012-02-01

    Full Text Available Telah dikembangkan teknik HWC-VHF-PECVD (Hot Wire Cell Very High Frequency Plasma Enhanced Chemical Vapor Deposition untuk menumbuhkan lapisan tipis silikon mikrokristal terhidrogenasi (mc-Si:H. Dari hasil penumbuhan lapisan tipis yang dilakukan, teknik HWC-VHF-PECVD memperlihatkan laju deposisi yang lebih tinggi dibandingkan laju deposisi lapisan tipis yang diperoleh dari teknik PECVD maupun teknik VHF-PECVD konvensional. Berdasarkan hasil pengukuran XRD dan SEM, lapisan yang diperoleh pada temperatur filamen yang rendah masih berstruktur amorf. Indikasi yang mengarah pada pembentukan lapisan tipis berstruktur mikrokristalin mulai terlihat pada temperatur filamen ≥ 500oC, dimana puncak-puncak di fraksi spektrum XRD untuk orientasi kristalin tertentu mulai terbentu, sejalan dengan pembentukan butiran-butiran kristalin dari hasil foto SEM permukaan lapisan-lapisan tersebut.

  10. Design VHF Antennas for Space Borne Receivers for SmallSats

    Science.gov (United States)

    Deshpande, Manohar

    2017-01-01

    Space borne microwave remote sensors at VHF/UHF frequencies are important instruments to observe reflective properties of land surfaces through thick and heavy forestation on a global scale. One of the most cost effective ways of measuring land reflectivity at VHF/UHF frequencies is to use signals transmitted by existing communication satellites (operating at VHF/UHF band) as a signal of opportunity (SoOp) signal and passive receivers integrated with airborne/space borne platforms operating in the Low Earth Orbit (LEO). One of the critical components of the passive receiver is two antennas (one to receive only direct signal and other to receive only reflected signal) which need to have ideally high (>30dB) isolation. However, because of small size of host platforms and broad beam width of dipole antennas, achieving adequate isolation between two channels is a challenging problem and need to be solved for successful implementation of space borne SoOp technology for remote sensing. In this presentation a novel enabling VHF antenna technology for Cubesat platforms is presented to receive direct as well as reflected signal with needed isolation. The novel scheme also allows enhancing the gain of individual channels by factor of 2 without use of reflecting ground plane.

  11. A VHF Class E DC-DC Converter with Self-Oscillating Gate Driver

    DEFF Research Database (Denmark)

    Andersen, Toke Meyer; Christensen, Søren K.; Knott, Arnold

    2011-01-01

    This paper describes the analysis and design of a DC-DC converter topology which is operational at frequencies in the Very High Frequency (VHF) band ranging from 30 MHz − 300 MHz. The presented topology, which consists of a class E inverter, class E rectifier, and self-oscillating gate driver, is...

  12. First wind shear observation in PMSE with the tristatic EISCAT VHF radar

    Science.gov (United States)

    Mann, I.; Häggström, I.; Tjulin, A.; Rostami, S.; Anyairo, C. C.; Dalin, P.

    2016-11-01

    The Polar Summer Mesosphere has the lowest temperatures that occur in the entire Earth system. Water ice particles below the optically observable size range participate there in the formation of strong radar echoes (Polar Mesospheric Summer Echoes, PMSE). To study PMSE we carried out observations with the European Incoherent Scatter (EISCAT) VHF and EISCAT UHF radar simultaneously from a site near Tromsø (69.58°N, 19.2272°E) and observed VHF backscattering also with the EISCAT receivers in Kiruna (67.86°N, 20.44°E) and Sodankylä (67.36°N, 26.63°E). This is one of the first tristatic measurements with EISCAT VHF, and we therefore describe the observations and geometry in detail. We present observations made on 26 June 2013 from 7:00 to 13:00 h UT where we found similar PMSE patterns with all three VHF receivers and found signs of wind shear in PMSE. The observations suggest that the PMSE contains sublayers that move in different directions horizontally, and this points to Kelvin-Helmholtz instability possibly playing a role in PMSE formation. We find no signs of PMSE in the UHF data. The electron densities that we derive from observed incoherent scatter at UHF are at PMSE altitudes close to the noise level but possibly indicate reduced electron densities directly above the PMSE.

  13. Testing VHF/GPS collar design and safety in the study of free-roaming horses.

    Directory of Open Access Journals (Sweden)

    Gail H Collins

    Full Text Available Effective and safe monitoring techniques are needed by U.S. land managers to understand free-roaming horse behavior and habitat use and to aid in making informed management decisions. Global positioning system (GPS and very high frequency (VHF radio collars can be used to provide high spatial and temporal resolution information for detecting free-roaming horse movement. GPS and VHF collars are a common tool used in wildlife management, but have rarely been used for free-roaming horse research and monitoring in the United States. The purpose of this study was to evaluate the design, safety, and detachment device on GPS/VHF collars used to collect free-roaming horse location and movement data. Between 2009 and 2010, 28 domestic and feral horses were marked with commercial and custom designed VHF/GPS collars. Individual horses were evaluated for damage caused by the collar placement, and following initial observations, collar design was modified to reduce the potential for injury. After collar modifications, which included the addition of collar length adjustments to both sides of the collar allowing for better alignment of collar and neck shapes, adding foam padding to the custom collars to replicate the commercial collar foam padding, and repositioning the detachment device to reduce wear along the jowl, we observed little to no evidence of collar wear on horses. Neither custom-built nor commercial collars caused injury to study horses, however, most of the custom-built collars failed to collect data. During the evaluation of collar detachment devices, we had an 89% success rate of collar devices detaching correctly. This study showed that free-roaming horses can be safely marked with GPS and/or VHF collars with minimal risk of injury, and that these collars can be a useful tool for monitoring horses without creating a risk to horse health and wellness.

  14. An analysis on the mid-latitude scintillation and coherence frequency bandwidth using transionospheric VHF signals

    Energy Technology Data Exchange (ETDEWEB)

    Juang, Zhen [Los Alamos National Laboratory; Roussel-dupre, Robert [Los Alamos National Laboratory

    2008-01-01

    An analysis was perfonned on the mid-latitude scintillation and coherence frequency bandwidth (Fcoh) using transionospheric VHF signal data. The data include 1062 events spanning from November 1997 to June 2002. Each event records FORTE satellite received VHF signals from LAPP located at Los Alamos, New Mexico. Fcohs were derived to study scintillation characteristics on diurnal and seasonal variations, as well as changes due to solar and geomagnetic activities. Comparisons to the VHFIUHF coherence frequency bandwidth studies previously reported at equatorial and mid-latitude regions are made using a 4th power frequency dependence relationship. Furthennore, a wideband ionospheric scintillation model, WBMOD, was used to estimate Fcohs and compared with our VHF Fcoh values. Our analysis indicates mid-latitude scintillation characteristics that are not previously revealed. At the VHF bottom frequency range (3035 MHz), distinguished smaller Fcohs are found in time period from sunset to midnight, in wann season from May to August, and in low solar activity years. The effects of geomagnetic storm activity on Fcoh are characterized by a sudden transition at a Kp index of 50-60. Comparisons with median Fcohs estimated from other studies validated our VHF Fcohs for daytime while an order of magnitude larger Fcohs are found for nighttime, implying a time-dependent issue in applying the 4th order power relationship. Furthermore, comparisons with WBMOD-estimated Fcohs indicated generally matched median scintillation level estimates while differences do exist for those events undergoing high geomagnetic stonn activity which may imply underestimates of scintillation level by the WBMOD in the mid-latitude regions.

  15. Molecular Switching in Confined Spaces: Effects of Encapsulating the DHA/VHF Photo-Switch in Cucurbiturils

    DEFF Research Database (Denmark)

    Petersen, Michael Å.; Rasmussen, Brian; Andersen, Nicolaj N.

    2017-01-01

    complexes, the kinetics of the thermal VHF-to-DHA back-reaction is accelerated, while in CB8 inclusion complexes, the kinetics is slowed down as compared to the free photo-switch. The effect of the CB encapsulation of the photo-switch can be effectively canceled by introducing a guest that binds the CB more...... strongly. According to DFT calculations, a stabilization of the reactive s-cis VHF conformer relative to the s-trans VHF appears to be a contributing factor responsible for the accelerated back-reaction when encapsulated in CB7....

  16. Installation report - Lidar

    DEFF Research Database (Denmark)

    Georgieva Yankova, Ginka; Villanueva, Héctor

    The report describes the installation, configuration and data transfer for the ground-based lidar. The unit is provided by a customer but is installed and operated by DTU while in this project.......The report describes the installation, configuration and data transfer for the ground-based lidar. The unit is provided by a customer but is installed and operated by DTU while in this project....

  17. A system for mapping sources of VHF and electric field pulses from in-cloud lightning at KSC

    Science.gov (United States)

    Thomson, Ewen M.; Medelius, Pedro J.

    1991-01-01

    The literature concerning VHF radiation and wideband electric fields from in-cloud lightning is reviewed. VHF location systems give impressive radio images of lightning in clouds with high spatial and temporal resolution. Using systems based on long and short baseline time-or-arrival and interferometry, workers have detected VHF sources that move at speeds of 10(exp 5) to 10(exp 8) m/s. The more slowly moving sources appear to be associated with channel formation but the physical basis for the higher speeds is not clear. In contrast, wideband electric fields are directly related to physical parameters such as current and tortuosity. A long baseline system is described to measure simultaneously VHF radiation and wideband electric fields at five stations at Kennedy Space Center. All signals are detected over remote, isolated ground planes with fiber optics for data transmission. The modification of this system to map rapidly varying dE/dt pulses is discussed.

  18. Investigation into the Effects of VHF and UHF Band Radiation on Hewlett-Packard (HP) Cesium Beam Frequency Standards

    National Research Council Canada - National Science Library

    Dickens, Andrew

    1994-01-01

    This paper documents an investigation into reports which have indicated that exposure to VHF and UHF band radiation has adverse effects on the frequency stability of HP cesium beam frequency standards...

  19. Investigation into the effects of VHF and UHF band radiation on Hewlett-Packard (HP) Cesium Beam Frequency Standards

    Science.gov (United States)

    Dickens, Andrew

    1995-01-01

    This paper documents an investigation into reports which have indicated that exposure to VHF and UHF band radiation has adverse effects on the frequency stability of HP cesium beam frequency standards. Tests carried out on the basis of these reports show that sources of VHF and UHF radiation such as two-way hand held police communications devices do cause reproducible adverse effects. This investigation examines reproducible effects and explores possible causes.

  20. Broadband VHF observations for lightning impulses from a small satellite SOHLA-1 (Maido 1)

    Science.gov (United States)

    Morimoto, T.; Kikuchi, H.; Ushio, T.; Kawasaki, Z.; Hidekazu, H.; Aoki, T.

    2009-12-01

    Lightning Research Group of Osaka University (LRG-OU) has been developing VHF Broadband Digital Interferometer (DITF) to image precise lightning channels and monitor lightning activity widely. The feature of broadband DITF is its ultrawide bandwidth (from 25MHz to 100MHz) and implicit redundancy for estimating VHF source location. LRG-OU considers an application of the broadband DITF to the spaceborne measurement system and joins the SOHLA (Space Oriented Higashi-Osaka Leading Associate) satellite project. The SOHLA satellite project represents a technology transfer program to expand the range of the space development community in Japan. The objective is to get SMEs (Small and Medium sized manufacturing Enterprises) involved in small space projects and new space technologies. Under the cooperative agreement, JAXA (Japan Aerospace Exploration Agency) intends to contribute to socio-economic development by returning its R&D results to society, and SOHLA tries to revitalize the local economy through the commercialization of versatile small satellites. According to the agreement, JAXA provides SOHLA its technical information on small satellites and other technical assistance for the development of the small satellites, SOHLA-1. The prime objective of the SOHLA-1 program is to realize low-cost and short term development of a microsatellite which utilizes the components and bus technologies of JAXA’s MicroLabSat. SOHLA-1 is a spin-stabilized microsatellite of MicroLabSat heritage (about 50 kg). The spin axis is fixed to inertial reference frame. The spin axis (z-axis) lies in the plane containing the solar direction and the normal to the orbital plane. LRG-OU takes responsibility for a science mission of SOHLA-1. To examine the feasibility of the DITF receiving VHF lightning impulses in space, LRG-OU proposes the BMW (Broadband Measurement of Waveform for VHF Lightning Impulses). BMW consists of a single pair of an antenna, a band-pass filter, an amplifier, and an

  1. Bias-Voltage Stabilizer for HVHF Amplifiers in VHF Pulse-Echo Measurement Systems

    Directory of Open Access Journals (Sweden)

    Hojong Choi

    2017-10-01

    Full Text Available The impact of high-voltage–high-frequency (HVHF amplifiers on echo-signal quality is greater with very-high-frequency (VHF, ≥100 MHz ultrasound transducers than with low-frequency (LF, ≤15 MHz ultrasound transducers. Hence, the bias voltage of an HVHF amplifier must be stabilized to ensure stable echo-signal amplitudes. We propose a bias-voltage stabilizer circuit to maintain stable DC voltages over a wide input range, thus reducing the harmonic-distortion components of the echo signals in VHF pulse-echo measurement systems. To confirm the feasibility of the bias-voltage stabilizer, we measured and compared the deviations in the gain of the HVHF amplifier with and without a bias-voltage stabilizer. Between −13 and 26 dBm, the measured gain deviations of a HVHF amplifier with a bias-voltage stabilizer are less than that of an amplifier without a bias-voltage stabilizer. In order to confirm the feasibility of the bias-voltage stabilizer, we compared the pulse-echo responses of the amplifiers, which are typically used for the evaluation of transducers or electronic components used in pulse-echo measurement systems. From the responses, we observed that the amplitudes of the echo signals of a VHF transducer triggered by the HVHF amplifier with a bias-voltage stabilizer were higher than those of the transducer triggered by the HVHF amplifier alone. The second, third, and fourth harmonic-distortion components of the HVHF amplifier with the bias-voltage stabilizer were also lower than those of the HVHF amplifier alone. Hence, the proposed scheme is a promising method for stabilizing the bias voltage of an HVHF amplifier, and improving the echo-signal quality of VHF transducers.

  2. First wind shear observation in PMSE with the tristatic EISCAT VHF radar

    OpenAIRE

    Mann, Ingrid; Häggström, I.; Tjulin, A; Rostami, S; Anyairo, CC; Dalin, P

    2016-01-01

    (c) American Geophysical Union, reprinted with permission. Article also available at source: https://doi.org/10.1002/2016JA023080 The Polar Summer Mesosphere has the lowest temperatures that occur in the entire Earth system. Water ice particles below the optically observable size range participate there in the formation of strong radar echoes (Polar Mesospheric Summer Echoes, PMSE). To study PMSE we carried out observations with the European Incoherent Scatter (EISCAT) VHF and EIS...

  3. Bias-Voltage Stabilizer for HVHF Amplifiers in VHF Pulse-Echo Measurement Systems.

    Science.gov (United States)

    Choi, Hojong; Park, Chulwoo; Kim, Jungsuk; Jung, Hayong

    2017-10-23

    The impact of high-voltage-high-frequency (HVHF) amplifiers on echo-signal quality is greater with very-high-frequency (VHF, ≥100 MHz) ultrasound transducers than with low-frequency (LF, ≤15 MHz) ultrasound transducers. Hence, the bias voltage of an HVHF amplifier must be stabilized to ensure stable echo-signal amplitudes. We propose a bias-voltage stabilizer circuit to maintain stable DC voltages over a wide input range, thus reducing the harmonic-distortion components of the echo signals in VHF pulse-echo measurement systems. To confirm the feasibility of the bias-voltage stabilizer, we measured and compared the deviations in the gain of the HVHF amplifier with and without a bias-voltage stabilizer. Between -13 and 26 dBm, the measured gain deviations of a HVHF amplifier with a bias-voltage stabilizer are less than that of an amplifier without a bias-voltage stabilizer. In order to confirm the feasibility of the bias-voltage stabilizer, we compared the pulse-echo responses of the amplifiers, which are typically used for the evaluation of transducers or electronic components used in pulse-echo measurement systems. From the responses, we observed that the amplitudes of the echo signals of a VHF transducer triggered by the HVHF amplifier with a bias-voltage stabilizer were higher than those of the transducer triggered by the HVHF amplifier alone. The second, third, and fourth harmonic-distortion components of the HVHF amplifier with the bias-voltage stabilizer were also lower than those of the HVHF amplifier alone. Hence, the proposed scheme is a promising method for stabilizing the bias voltage of an HVHF amplifier, and improving the echo-signal quality of VHF transducers.

  4. 2-D inner-shelf current observations from a single VHF WEllen RAdar (WERA) station

    Science.gov (United States)

    Voulgaris, G.; Kumar, N.; Gurgel, K.-W.; Warner, J.C.; List, J.H.

    2011-01-01

    The majority of High Frequency (HF) radars used worldwide operate at medium to high frequencies (8 to 30 MHz) providing spatial resolutions ranging from 3 to 1.5 km and ranges from 150 to 50 km. This paper presents results from the deployment of a single Very High Frequency (VHF, 48 MHz) WEllen RAdar (WERA) radar with spatial resolution of 150 m and range 10-15 km, used in the nearshore off Cape Hatteras, NC, USA. It consisted of a linear array of 12 antennas operating in beam forming mode. Radial velocities were estimated from radar backscatter for a variety of wind and nearshore wave conditions. A methodology similar to that used for converting acoustically derived beam velocities to an orthogonal system is presented for obtaining 2-D current fields from a single station. The accuracy of the VHF radar-derived radial velocities is examined using a new statistical technique that evaluates the system over the range of measured velocities. The VHF radar velocities showed a bias of 3 to 7 cm/s over the experimental period explainable by the differences in radar penetration and in-situ measurement height. The 2-D current field shows good agreement with the in-situ measurements. Deviations and inaccuracies are well explained by the geometric dilution analysis. ?? 2011 IEEE.

  5. Electrical installations and regulations

    CERN Document Server

    Whitfield, J F

    1966-01-01

    Electrical Installations and Regulations focuses on the regulations that apply to electrical installations and the reasons for them. Topics covered range from electrical science to alternating and direct current supplies, as well as equipment for providing protection against excess current. Cables, wiring systems, and final subcircuits are also considered, along with earthing, discharge lighting, and testing and inspection.Comprised of 12 chapters, this book begins with an overview of electrical installation work, traits of a good electrician, and the regulations governing installations. The r

  6. Electrical installation calculations advanced

    CERN Document Server

    Kitcher, Christopher

    2013-01-01

    All the essential calculations required for advanced electrical installation workThe Electrical Installation Calculations series has proved an invaluable reference for over forty years, for both apprentices and professional electrical installation engineers alike. The book provides a step-by-step guide to the successful application of electrical installation calculations required in day-to-day electrical engineering practiceA step-by-step guide to everyday calculations used on the job An essential aid to the City & Guilds certificates at Levels 2 and 3For apprentices and electrical installatio

  7. Electrical installation calculations basic

    CERN Document Server

    Kitcher, Christopher

    2013-01-01

    All the essential calculations required for basic electrical installation workThe Electrical Installation Calculations series has proved an invaluable reference for over forty years, for both apprentices and professional electrical installation engineers alike. The book provides a step-by-step guide to the successful application of electrical installation calculations required in day-to-day electrical engineering practice. A step-by-step guide to everyday calculations used on the job An essential aid to the City & Guilds certificates at Levels 2 and 3Fo

  8. Structure, optical properties and thermal stability of HfErO films deposited by simultaneous RF and VHF magnetron sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, H.Y. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Nanjing University of Posts and Telecommunications, School of Tongda, Nanjing (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); He, H.J.; Zhang, Z.; Jin, C.G.; Yang, Y.; Wang, Y.Y.; Ye, C. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Zhuge, L.J. [Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Soochow University, Analysis and Testing Center, Suzhou (China); Wu, X.M. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Chinese Academy of Sciences, State Key Laboratory of Functional Materials for Informatics, Shanghai Institute of Microsystem and Information Technology, Shanghai (China)

    2015-01-23

    HfErO films are deposited on Si substrates by simultaneous radio frequency (RF) and very high frequency (VHF) magnetron sputtering technique. The content of the doped ingredient of Er and the body composition of HfO{sub x} are, respectively, controlled through the VHF and RF powers. Low content of Er doping in the HfErO films can be achieved, because the VHF source of 27.12 MHz has higher ion energy and lower ion flux than the RF source resulting in low sputtering rate in the magnetron sputtering system. The structure, optical properties and thermal stability of the HfErO films are investigated in this work. Results show that the doped content of Er is independently controlled by the VHF power. The oxygen vacancies are created by the Er incorporation. The hafnium in the HfErO films forms mixed valence of Hf{sup 2+} and Hf{sup 4+}. The HfErO films are composed with the structures of HfO{sub 2}, HfO and ErO{sub x}, which can be optimized through the VHF power. At high VHF power, the Hf-Er-O bonds are formed, which demonstrates that the Er atoms are doped into the lattice of HfO{sub 2} in the HfErO films. The HfErO films have bad thermal stability as the crystallization temperature decreases from 900 to 800 C. After thermal annealing, cubic phase of HfO{sub 2} are stabilized, which is ascribed to the oxygen vacancies creation by the Er incorporation. The optical properties such as the refractive index and the optical band gap of the HfErO films are optimized by the VHF power. (orig.)

  9. Measurements methodology for evaluation of Digital TV operation in VHF high-band

    Science.gov (United States)

    Pudwell Chaves de Almeida, M.; Vladimir Gonzalez Castellanos, P.; Alfredo Cal Braz, J.; Pereira David, R.; Saboia Lima de Souza, R.; Pereira da Soledade, A.; Rodrigues Nascimento Junior, J.; Ferreira Lima, F.

    2016-07-01

    This paper describes the experimental setup of field measurements carried out for evaluating the operation of the ISDB-TB (Integrated Services Digital Broadcasting, Terrestrial, Brazilian version) standard digital TV in the VHF-highband. Measurements were performed in urban and suburban areas in a medium-sized Brazilian city. Besides the direct measurements of received power and environmental noise, a measurement procedure involving the injection of Gaussian additive noise was employed to achieve the signal to noise ratio threshold at each measurement site. The analysis includes results of static reception measurements for evaluating the received field strength and the signal to noise ratio thresholds for correct signal decoding.

  10. Luminous phenomena and electromagnetic VHF wave emission originated from earthquake-related radon exhalation

    Science.gov (United States)

    Seki, A.; Tobo, I.; Omori, Y.; Muto, J.; Nagahama, H.

    2013-12-01

    Anomalous luminous phenomena and electromagnetic wave emission before or during earthquakes have been reported (e.g., the 1965 Matsushiro earthquake swarm). However, their mechanism is still unsolved, in spite of many models for these phenomena. Here, we propose a new model about luminous phenomena and electromagnetic wave emission during earthquake by focusing on atmospheric radon (Rn-222) and its daughter nuclides (Po-218 and Po-214). Rn-222, Po-218 and Po-214 are alpha emitters, and these alpha particles ionize atmospheric molecules. A light emission phenomenon, called 'the air luminescence', is caused by de-excitation of the ionized molecules of atmospheric nitrogen due to electron impact ionization from alpha particles. The de-excitation is from the second positive system of neutral nitrogen molecules and the first negative system of nitrogen molecule ion. Wavelengths of lights by these transitions include the visible light wavelength. So based on this mechanism, we proposed a new luminous phenomenon model before or during earthquake: 1. The concentration of atmospheric radon and its daughter nuclides increase anomalously before or during earthquakes, 2. Nitrogen molecules and their ions are excited by alpha particles emitted from Rn-222, Po-218 and Po-214, and air luminescence is generated by their de-excitation. Similarly, electromagnetic VHF wave emission can be explained by ionizing effect of radon and its daughter nuclides. Boyarchuk et al. (2005) proposed a model that electromagnetic VHF wave emission is originated when excited state of neutral clusters changes. Radon gas ionizes atmosphere and forms positively and negatively charged heavy particles. The process of ion hydration in ordinary air can be determined by the formation of complex chemically active structures of the various types of ion radicals. As a result of the association of such hydration radical ions, a neutral cluster, which is dipole quasi-molecules, is formed. A neutral cluster

  11. Observations of Mesospheric Turbulence by Rocket Probe and VHF Radar, Part 2.4A

    Science.gov (United States)

    Royrvik, O.; Smith, L. G.

    1984-01-01

    Data from the Jicamarca VHF radar and from a Languir probe fine-structure on a Nike Orion rocket launched from Punto Lobos, Peru, have been compared. A single mesospheric scattering layer was observed by the radar. The Langmuir probe detected irregularities in the electron-density profile in a narrow region between 85.2 and 86.6 km. It appears from a comparison between these two data sets that turbulence in the neutral atmosphere is the mechanism generating the refractive index irregularities.

  12. Conveyor installation tools

    National Research Council Canada - National Science Library

    1984-01-01

    The USBM in order to reduce accidents associated with transporting, installing or maintaining belt conveyors developed 3 devices for use in moving and positioning conveyor components (the saucer skid...

  13. 3D Projection Installations

    DEFF Research Database (Denmark)

    Halskov, Kim; Johansen, Stine Liv; Bach Mikkelsen, Michelle

    2014-01-01

    Three-dimensional projection installations are particular kinds of augmented spaces in which a digital 3-D model is projected onto a physical three-dimensional object, thereby fusing the digital content and the physical object. Based on interaction design research and media studies, this article...... contributes to the understanding of the distinctive characteristics of such a new medium, and identifies three strategies for designing 3-D projection installations: establishing space; interplay between the digital and the physical; and transformation of materiality. The principal empirical case, From...... Fingerplan to Loop City, is a 3-D projection installation presenting the history and future of city planning for the Copenhagen area in Denmark. The installation was presented as part of the 12th Architecture Biennale in Venice in 2010....

  14. Biggest semiconductor installed

    CERN Multimedia

    2008-01-01

    Scientists and technicians at the European Laboratory for Particle Physics, commonly known by its French acronym CERN (Centre Europen pour la Recherche Nuclaire), have completed the installation of the largest semiconductor silicon detector.

  15. Leadership for Sustainable Installations

    Science.gov (United States)

    2011-04-01

    able_installations/. Accessed 15 April 2011) Leadership for Sustainable Installations By COL Charles Allen (Ret), U.S. Army War College The...number. 1. REPORT DATE APR 2011 2. REPORT TYPE 3. DATES COVERED 00-00-2011 to 00-00-2011 4. TITLE AND SUBTITLE Leadership for Sustainable...of the Army civilian workforce. During that decade, we followed the mandate of A-76 Commercial Sourcing and focused on developing the Most Efficient

  16. Installation af opvaskemaskine

    DEFF Research Database (Denmark)

    Christiansen, J.; Skibstrup Eriksen, S.; Nielsen, F.

    Denne SBI-anvisning er et led i en serie om modernisering af installationerne i den ældre boligmasse. Den henvender sig til både beboere, husejere, VVS-installatører og andre interesserede. Anvisningen indeholder almene afsnit om valg og placering af opvaskemaskine, sagsforløb ved installation......, forhold til myndigheder, priser, finansieringsmuligheder m.m. Anvisningen indeholder endvidere tekniske afsnit om vandinstallation, afløb og elinstallation i forbindelse med installation af opvaskemaskine....

  17. An HF and lower VHF spectrum assessment system exploiting instantaneously wideband capture

    Science.gov (United States)

    Barnes, Rod I.; Singh, Malkiat; Earl, Fred

    2017-09-01

    We report on a spectral environment evaluation and recording (SEER) system, for instantaneously wideband spectral capture and characterization in the HF and lower VHF band, utilizing a direct digital receiver coupled to a data recorder. The system is designed to contend with a wide variety of electromagnetic environments and to provide accurately calibrated spectral characterization and display from very short (ms) to synoptic scales. The system incorporates a novel RF front end involving automated gain and equalization filter selection which provides an analogue frequency-dependent gain characteristic that mitigates the high dynamic range found across the HF and lower VHF spectrum. The system accurately calibrates its own internal noise and automatically subtracts this from low variance, external spectral estimates, further extending the dynamic range over which robust characterization is possible. Laboratory and field experiments demonstrate that the implementation of these concepts has been effective. Sensitivity to varying antenna load impedance of the internal noise reduction process has been examined. Examples of software algorithms to provide extraction and visualization of spectral behavior over narrowband, wideband, short, and synoptic scales are provided. Application in HF noise spectral density monitoring, spectral signal strength assessment, and electromagnetic interference detection is possible with examples provided. The instantaneously full bandwidth collection provides some innovative applications, and this is demonstrated by the collection of discrete lightning emissions, which form fast ionograms called "flashagrams" in power-delay-frequency plots.

  18. Measurements and simulation of ionospheric scattering on VHF and UHF radar signals: Channel scattering function

    Science.gov (United States)

    Rogers, Neil C.; Cannon, Paul S.; Groves, Keith M.

    2009-02-01

    The design and operation of transionospheric VHF and UHF radars requires knowledge of amplitude and phase scintillation due to ionospheric scattering. Phase coherence is of particular importance where long coherent integration periods and large bandwidths are required. A thin phase screen, parabolic equation based, Trans-Ionospheric Radio Propagation Simulator (TIRPS) is described. Modeled channel scattering functions (CSFs) are compared to experimental VHF and UHF data derived from the Advanced Research Projects Agency Long-range Tracking and Instrumentation Radar on Kwajalein Island (9.4°N, 166.8°E). TIRPS quantitatively reproduces the experimental results, including the quasi-parabolic profile observed in the measured CSFs under strong turbulence conditions. Variations in the simulated CSF with ionospheric phase screen parameters are also presented. Under conditions of high integrated strength of turbulence (CkL), a low phase spectral index (p = 1), indicating relatively dense small-scale irregularities, produces pronounced range spreading. Conversely, when the spectral index is high (p = 4), indicative of strong focusing/defocusing by large-scale irregularities, there is increased Doppler spreading and, when the outer scale of irregularities is large, a greater likelihood of asymmetry of the CSF about the zero Doppler axis.

  19. PMSE strength during enhanced D region electron densities: Faraday rotation and absorption effects at VHF frequencies

    Science.gov (United States)

    Chau, Jorge L.; Röttger, Jürgen; Rapp, Markus

    2014-10-01

    In this paper we study the effects of absorption and Faraday rotation on measurements of polar mesosphere summer echoes (PMSE). We found that such effects can produce significant reduction of signal-to-noise ratio (SNR) when the D region electron densities (Ne) are enhanced, and VHF radar systems with linearly polarized antennas are used. In particular we study the expected effects during the strong solar proton event (SPE) of July 2000, also known as the Bastille day flare event. During this event, a strong anti-correlation between the PMSE SNR and the D-region Ne was found over three VHF radar sites at high latitudes: Andøya, Kiruna, and Svalbard. This anti-correlation has been explained (a) in terms of transport effects due to strong electric fields associated to the SPE and (b) due to a limited amount of aerosol particles as compared to the amount of D-region electrons. Our calculations using the Ne profiles used by previous researchers explain most, if not all, of the observed SNR reduction in both time (around the SPE peak) and altitude. This systematic effect, particularly the Faraday rotation, should be recognized and tested, and possibly avoided (e.g., using circular polarization), in future observations during the incoming solar maximum period, to contribute to the understanding of PMSE during enhanced D region Ne.

  20. VHF/UHF radar observations of tropical mesoscale convective systems over southern India

    Directory of Open Access Journals (Sweden)

    K. Kishore Kumar

    2005-07-01

    Full Text Available Several campaigns have been carried out to study the convective systems over Gadanki (13.5° N, 79.2° E, a tropical station in India, using VHF and UHF radars. The height-time sections of several convective systems are investigated in detail to study reflectivity, turbulence and vertical velocity structure. Structure and dynamics of the convective systems are the main objectives of these campaigns. The observed systems are classified into single- and multi-cell systems. It has been observed that most of the convective systems at this latitude are multi-cellular in nature. Simultaneous VHF and UHF radar observations are used to classify the observed precipitating systems as convective, intermediary and stratiform regions. Composite height profiles of vertical velocities in these regions were obtained and the same were compared with the profiles obtained at other geographical locations. These composite profiles of vertical velocity in the convective regions have shown their peaks in the mid troposphere, indicating that the maximum latent heat is being released at those heights. These profiles are very important for numerical simulations of the convective systems, which vary significantly from one geographical location to the other. Keywords. Meteorology and atmospheric dynamics (Mesoscale meteorology; Convective processes – Radio science (Remote sensing

  1. Capping off installation

    CERN Multimedia

    2006-01-01

    Installation of the cathode strip chambers for the muon system on the CMS positive endcap has been completed. Technicians install one of the last muon system cathode strip chambers on the CMS positive endcap. Like successfully putting together the pieces of a giant puzzle, installation of the muon system cathode strip chambers on one of the CMS endcaps has been completed. Total installation of the cathode strip chambers (CSC) is now 91 percent complete; only one ring of chambers needs to be mounted on the remaining endcap to finish installation of the entire system. To guarantee a good fit for the 468 total endcap muon system CSCs, physicists and engineers from the collaboration spent about 10 years carefully planning the design. The endcap muon system's cables, boxes, pipes and other parts were designed and integrated using a 3D computerized model. 'It took a long time to do all the computer modelling, but in the long run it saved us an enormous amount of time because it meant that everything fit together,...

  2. Python Introduction and Installation

    Directory of Open Access Journals (Sweden)

    William J. Turkel

    2012-07-01

    Full Text Available This first lesson in our section on dealing with Online Sources is designed to get you and your computer set up to start programming. We will focus on installing the relevant software – all free and reputable – and finally we will help you to get your toes wet with some simple programming that provides immediate results. In this opening module you will install the Python programming language, the Beautiful Soup HTML/XML parser, and a text editor. Screencaps provided here come from Komodo Edit, but you can use any text editor capable of working with Python. Here’s a list of other options: Python Editors. Once everything is installed, you will write your first programs, “Hello World” in Python and HTML.

  3. Electrical installations technology

    CERN Document Server

    Whitfield, J F

    1968-01-01

    Electrical Installations Technology covers the syllabus of the City and Guilds of London Institute course No. 51, the "Electricians B Certificate”. This book is composed of 15 chapters that deal with basic electrical science and electrical installations. The introductory chapters discuss the fundamentals and basic electrical principles, including the concept of mechanics, heat, magnetic fields, electric currents, power, and energy. These chapters also explore the atomic theory of electric current and the electric circuit, conductors, and insulators. The subsequent chapter focuses on the chemis

  4. Molecular Switching in Confined Spaces: Effects of Encapsulating the DHA/VHF Photo-Switch in Cucurbiturils.

    Science.gov (United States)

    Petersen, Michael Å; Rasmussen, Brian; Andersen, Nicolaj N; Sauer, Stephan P A; Nielsen, Mogens Brøndsted; Beeren, Sophie R; Pittelkow, Michael

    2017-09-18

    Confinement of reactive chemical species uniquely affects chemical reactivity by restricting the physical space available and by restricting access to interactions with the solvent. In Nature, for example, confined protein binding pockets govern processes following photoisomerization reactions and the isomerizations themselves. Here we describe the first example of a dihydroazulene/vinylheptafulvene (DHA/VHF) photo-switch functioning in water, and we show how its switching behavior is strongly influenced by supramolecular interactions with a series of cucurbit[n]uril (CB) host molecules. In CB7 inclusion complexes, the kinetics of the thermal VHF-to-DHA back-reaction is accelerated, while in CB8 inclusion complexes, the kinetics is slowed down as compared to the free photo-switch. The effect of the CB encapsulation of the photo-switch can be effectively canceled by introducing a guest that binds the CB more strongly. According to DFT calculations, a stabilization of the reactive s-cis VHF conformer relative to the s-trans VHF appears to be a contributing factor responsible for the accelerated back-reaction when encapsulated in CB7. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  5. Complementary code and digital filtering for detection of weak VHF radar signals from the mesoscale. [SOUSY-VHF radar, Harz Mountains, Germany

    Science.gov (United States)

    Schmidt, G.; Ruster, R.; Czechowsky, P.

    1983-01-01

    The SOUSY-VHF-Radar operates at a frequency of 53.5 MHz in a valley in the Harz mountains, Germany, 90 km from Hanover. The radar controller, which is programmed by a 16-bit computer holds 1024 program steps in core and controls, via 8 channels, the whole radar system: in particular the master oscillator, the transmitter, the transmit-receive-switch, the receiver, the analog to digital converter, and the hardware adder. The high-sensitivity receiver has a dynamic range of 70 dB and a video bandwidth of 1 MHz. Phase coding schemes are applied, in particular for investigations at mesospheric heights, in order to carry out measurements with the maximum duty cycle and the maximum height resolution. The computer takes the data from the adder to store it in magnetic tape or disc. The radar controller is programmed by the computer using simple FORTRAN IV statements. After the program has been loaded and the computer has started the radar controller, it runs automatically, stopping at the program end. In case of errors or failures occurring during the radar operation, the radar controller is shut off caused either by a safety circuit or by a power failure circuit or by a parity check system.

  6. Frequency Reuse, Cell Separation, and Capacity Analysis of VHF Digital Link Mode 3 TDMA

    Science.gov (United States)

    Shamma, Mohammed A.; Nguyen, Thanh C.; Apaza, Rafael D.

    2003-01-01

    The most recent studies by the Federal Aviation Administration (FAA) and the aviation industry have indicated that it has become increasingly difficult to make new VHF frequency or channel assignments to meet the aviation needs for air-ground communications. FAA has planned for several aggressive improvement measures to the existing systems, but these measures would not meet the projected voice communications needs beyond 2009. FAA found that since 1974 there has been, on the average, a 4 percent annual increase in the number of channel assignments needed to satisfy the air-ground communication traffic (approximately 300 new channel assignments per year). With the planned improvement measures, the channel assignments are expected to reach a maximum number of 16615 channels by about 2010. Hence, the FAA proposed the use of VDL Mode 3 as a new integrated digital voice and data communications systems to meet the future air traffic demand. This paper presents analytical results of frequency reuse; cell separation and capacity estimation of VDL Mode 3 TDMA systems that FAA has planned to implement the future VHF air-ground communications system by the year 2010. For TDMA, it is well understood that the frequency reuse factor is a crucial parameter for capacity estimation. Formulation of this frequency reuse factor is shown, taking into account the limitation imposed by the requirement to have a sufficient Signal to Co-Channel Interference Ratio. Several different values for the Signal to Co-Channel Interference Ratio were utilized corresponding to the current analog VHF DSB-AM systems, and the future digital VDL Mode 3. The required separation of Co-Channel cells is computed for most of the Frequency Protected Service Volumes (FPSV's) currently in use by the FAA. Additionally, the ideal cell capacity for each FPSV is presented. Also, using actual traffic for the Detroit air space, a FPSV traffic distribution model is used to generate a typical cell for channel capacity

  7. Layered Polar Mesospheric Summer Echoes Observed with the Tri-Static Eiscat VHF

    Science.gov (United States)

    Mann, I.; Anyairo, C.; Häggström, I.; Tjulin, A.

    2014-12-01

    Polar mesospheric summer echoes (PMSE) are strong radar echoes that are typically observed at 50 to 500 MHz. They are often discussed in the context of dusty plasma studies and linked to e.g. the existence of charged ice particles, neutral atmospheric turbulence and atmospheric stratification. The PMSE are observed at mesospheric temperature minimum when ice particles form, though the exact path of formation is still a topic for research. Mesospheric smoke particles that are assumed to form after or during the meteor ablation process possibly contribute to the formation of the ice particles. For understanding the formation of the radar echoes their variation with scattering angle is an important parameter. We analyze PMSE observations with the tri-static EISCAT VHF radar (224 MHz) during one day in June when PMSE were observed almost continuously from 7:00 to 13:00 UT. The radar signal was transmitted and received in zenith direction with the EISCAT VHF antenna near Tromsø. The receivers in Kiruna and Sodankylä were pointed at typical PMSE heights above the Tromsø transmitter and detected radar reflections at the same time and altitude as the Tromsø radar. The altitude of the PMSE changed with time and the extension of the echoes in altitude was smaller toward the end of the observation. These observations are among the first tri-static observations of PMSE. The observations suggest that the scattering process underlying the PMSE occurs over a broad range of scattering angles. Based on the observations we will show that the spectral width of the received echoes is most likely determined by the variations within the observed volume rather than by the scattering process. The observed frequency shifts suggest a layer structure and horizontal motions that vary with altitude. UHF (933 MHz) radar observations were carried out in parallel, they display predominantly incoherent scatter and an electron density typical for the altitude. Some other studies, have in

  8. Disturbance-induced responses of VHF and satellite tagged harbour seals

    DEFF Research Database (Denmark)

    Andersen, Signe May; Teilmann, Jonas; Dietz, Rune

    2014-01-01

    ABSTRACT 1. The response of individual harbour seals (Phoca vitulina) to controlled and sporadic disturbances when hauled out in the Anholt seal reserve, Denmark, was studied. Sporadic disturbances from pedestrians, boats, low-flying aeroplanes and grey seals (Halichoerus grypus) were observed...... in or near the reserve. VHF and satellite transmitters were attached to eight harbour seals to determine post-disturbance and undisturbed behaviour during the pre-breeding period (25 April to 21 May 2008). 2. Both disturbed and undisturbed seals mostly returned to the haul-out site from dusk and throughout...... within 40 km from the haul-out site. The maximum extent of post-disturbance trips, however, varied among individuals and disturbance types, and was strongly correlated with the duration of trips. 3. Disturbed and undisturbed seals used the same areas, suggesting that these areas represent normal foraging...

  9. Graphene-based tunable non-foster circuit for VHF applications

    Directory of Open Access Journals (Sweden)

    Jing Tian

    2016-06-01

    Full Text Available This paper presents a negative impedance converter (NIC based on graphene field effect transistors (GFETs for VHF applications. The NIC is designed following Linvill’s open circuit stable (OCS topology. The DC modelling parameters of GFET are extracted from a device measured by Meric et al. [IEEE Electron Devices Meeting, 23.2.1 (2010] Estimated parasitics are also taken into account. Simulation results from Keysight Advanced Design System (ADS show good NIC performance up to 200 MHz and the value of negative capacitance is directly proportional to the capacitive load. In addition, it has been shown that by varying the supply voltage the value of negative capacitance can also be tuned. The NIC stability has been tested up to 2 GHz (10 times the maximum operation frequency using Nyquist stability criterion to ensure there are no oscillation issues.

  10. Final environmental assessment for vegetation control at VHF stations, microwave stations, electrical substations, and pole yards

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-10-13

    Southwestern Power Adm. operates very high frequency (VHF) and microwave radio stations, electrical substations, and pole yards for electric power transmission throughout AR, MO, and OK. Vegetation growth at the stations must be suppressed for safety of operation and personnel. Southwestern has been using a combination of mechanical/manual and herbicide control for this purpose; Federally- mandated reductions in staff and budgetary resources require Southwestern to evaluate all potentially efficient methods for vegetation control. Three alternatives were examined: no action, mechanical/manual control, and (proposed) a combination of mechanical/manual and herbicide control. Environmental impacts on air and water quality, wetlands, wildlife, endangered species, archaeological and other resources, farmland, human health, transportation, etc. were evaluated.

  11. Simultaneous observation of sporadic E with a rapid-run ionosonde and VHF coherent backscatter radar

    Directory of Open Access Journals (Sweden)

    T. Maruyama

    2006-03-01

    Full Text Available During the SEEK 2 rocket campaign, ionograms were recorded every minute at the Yamagawa Radio Observatory at about 90km west of the region monitored by a VHF (very high frequency coherent backscatter radar. Sporadic E-layer parameters, which include the critical (foEs and blanketing (fbEs frequencies, the layer height (h'Es, and the width of the range spread of sporadic E-traces, were compared with RTI (range-time-intensity plots of VHF quasi-periodic (QP and continuous coherent backscatter echoes. A close relationship was found between the appearance of QP echoes in the RTI plots and the level of spatial inhomogeneity in sporadic E plasma, signified here by the difference between foEs and fbEs. During QP echo events, foEs increased while fbEs decreased, so that the difference foEs-fbEs was enhanced, indicating the development of strong spatial structuring in electron density within a sporadic E-layer. On the other hand, increases in sporadic E range spreading also correlated with the occurrence of QP echoes but the degree of correlation varied from event to event. Continuous radar echoes were observed in association with low altitude sporadic E-layers, located well below 100 km and at times as low as 90 km. During the continuous echo events, both foEs and fbEs were less variable, and the difference foEs-fbEs was small and not as dynamic as in the QP echoes. On the other hand, the Es-layer spread intensified during continuous echoes, which means that some patchiness or corrugation in those low altitude layers is also necessary for the continuous backscatter echoes to take place.

  12. Simultaneous observation of sporadic E with a rapid-run ionosonde and VHF coherent backscatter radar

    Directory of Open Access Journals (Sweden)

    T. Maruyama

    2006-03-01

    Full Text Available During the SEEK 2 rocket campaign, ionograms were recorded every minute at the Yamagawa Radio Observatory at about 90km west of the region monitored by a VHF (very high frequency coherent backscatter radar. Sporadic E-layer parameters, which include the critical (foEs and blanketing (fbEs frequencies, the layer height (h'Es, and the width of the range spread of sporadic E-traces, were compared with RTI (range-time-intensity plots of VHF quasi-periodic (QP and continuous coherent backscatter echoes. A close relationship was found between the appearance of QP echoes in the RTI plots and the level of spatial inhomogeneity in sporadic E plasma, signified here by the difference between foEs and fbEs. During QP echo events, foEs increased while fbEs decreased, so that the difference foEs-fbEs was enhanced, indicating the development of strong spatial structuring in electron density within a sporadic E-layer. On the other hand, increases in sporadic E range spreading also correlated with the occurrence of QP echoes but the degree of correlation varied from event to event. Continuous radar echoes were observed in association with low altitude sporadic E-layers, located well below 100 km and at times as low as 90 km. During the continuous echo events, both foEs and fbEs were less variable, and the difference foEs-fbEs was small and not as dynamic as in the QP echoes. On the other hand, the Es-layer spread intensified during continuous echoes, which means that some patchiness or corrugation in those low altitude layers is also necessary for the continuous backscatter echoes to take place.

  13. Recent Comparisons of VHF Lightning Mapping Using Interferometry and Time-of-Arrival Techniques

    Science.gov (United States)

    Lojou, J.; Cummins, K. L.

    2005-12-01

    As part of Vaisala's technology and applications test bed in the Dallas-Fort Worth area in Texas, we have been operating two overlapping Total Lightning detection networks. One network employs VHF Interferometry (both 2- and 3-timensional instrumentation) and the other employs VHF 3-dimensional Time-Of-Arrival (TOA) techniques. For the first time, these two technologies can be compared and contrasted in a common region where they both exhibit good performance. The aim of the work presented is to evaluate the spatial and temporal "description" of lightning flashes provided by these two techniques, and to compare and contrast the relative strengths of these two approaches for Total Lightning mapping. This study employs data acquired during the summer of 2005. The analysis set includes data obtained by these two networks, as well as cloud-to-ground location data from the U.S. National Lightning Detection Network (NLDN). The spatial extent and vertical profile of sources from individual in-cloud and cloud-to-ground flashes are compared for various storm conditions, with both technologies clearly contributing supplemental information not provided by the other. Leader propagation velocities show a substantially unimodal distribution centered at about 105 m/s for TOA-derived sources, whereas the velocity distribution for sources detected using interferometry exhibit a bimodal distribution with the second mode at about 107 m/s. The most-probable interval-between-sources for TOA-derived sources seems to be a few milliseconds, whereas interferometry produces large populations with intervals near 100 microseconds and 100 milliseconds.

  14. Installing the ALICE detector

    CERN Multimedia

    Maximilien Brice

    2006-01-01

    The huge iron yoke in the cavern at Point 2 in the LHC tunnel is prepared for the installation of the ALICE experiment. The yoke is being reused from the previous L3 experiment that was located at the same point during the LEP project from 1989 to 2000. ALICE will be inserted piece by piece into the cradle where it will be used to study collisions between two beams of lead ions.

  15. Installation Strategic Planning Guidebook

    Science.gov (United States)

    2012-05-01

    project plan, probably in the form of a Gantt chart so that the planning team members can reference as needed. Organization schedule of events: If...Koehler Publishing, 1994 7. Strategy Safari – A Guided Tour Through the Wilds of Strategic Management by Henry Mintzberg, Bruce Ahlstrand, and... Gantt chart - Resource the pre-work - Recap - Follow-up actions Installation Strategic Planning Guidebook 94 Appendix H

  16. First ALICE detectors installed!

    CERN Multimedia

    2006-01-01

    Detectors to track down penetrating muon particles are the first to be placed in their final position in the ALICE cavern. The Alice muon spectrometer: in the foreground the trigger chamber is positioned in front of the muon wall, with the dipole magnet in the background. After the impressive transport of its dipole magnet, ALICE has begun to fill the spectrometer with detectors. In mid-July, the ALICE muon spectrometer team achieved important milestones with the installation of the trigger and the tracking chambers of the muon spectrometer. They are the first detectors to be installed in their final position in the cavern. All of the eight half planes of the RPCs (resistive plate chambers) have been installed in their final position behind the muon filter. The role of the trigger detector is to select events containing a muon pair coming, for instance, from the decay of J/ or Y resonances. The selection is made on the transverse momentum of the two individual muons. The internal parts of the RPCs, made o...

  17. Microminiature thermocouple monitors own installation

    Science.gov (United States)

    Garrett, A. J.; Sellers, J. P., Jr.

    1966-01-01

    Microminiature thermocouple makes precision gas sidewall temperature readings inside large thrust chambers. It is installed by a technique whereby the sensor monitors its own installation to insure against thermal damage to the thermocouple and ensure minimum disturbance to chamber surfaces.

  18. Humanizing the Installation of Microcomputers.

    Science.gov (United States)

    Ansfield, Paul J.

    1982-01-01

    This discussion of the installation of microcomputing tools in organizations and institutions describes the effects of change, precautions for management, procedures to support inexperienced employees, and directives for microcomputer installation. Nine references are listed. (EJS)

  19. Performance of buried pipe installation.

    Science.gov (United States)

    2010-05-01

    The purpose of this study is to determine the effects of geometric and mechanical parameters : characterizing the soil structure interaction developed in a buried pipe installation located under : roads/highways. The drainage pipes or culverts instal...

  20. Samus Toroid Installation Fixture

    Energy Technology Data Exchange (ETDEWEB)

    Stredde, H.; /Fermilab

    1990-06-27

    The SAMUS (Small Angle Muon System) toroids have been designed and fabricated in the USSR and delivered to D0 ready for installation into the D0 detector. These toroids will be installed into the aperture of the EF's (End Toroids). The aperture in the EF's is 72-inch vertically and 66-inch horizontally. The Samus toroid is 70-inch vertically by 64-inch horizontally by 66-inch long and weighs approximately 38 tons. The Samus toroid has a 20-inch by 20-inch aperture in the center and it is through this aperture that the lift fixture must fit. The toroid must be 'threaded' through the EF aperture. Further, the Samus toroid coils are wound about the vertical portion of the aperture and thus limit the area where a lift fixture can make contact and not damage the coils. The fixture is designed to lift along a surface adjacent to the coils, but with clearance to the coil and with contact to the upper steel block of the toroid. The lift and installation will be done with the 50 ton crane at DO. The fixture was tested by lifting the Samus Toroid 2-inch off the floor and holding the weight for 10 minutes. Deflection was as predicted by the design calculations. Enclosed are sketches of the fixture and it relation to both Toroids (Samus and EF), along with hand calculations and an Finite Element Analysis. The PEA work was done by Kay Weber of the Accelerator Engineering Department.

  1. VHF volume-imaging radar observation of aspect-sensitive scatterers tilted in mountain waves above a convective boundary layer

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    2005-06-01

    Full Text Available Thin stable atmospheric layers cause VHF radars to receive increased echo power from near zenith. Layers can be tilted from horizontal, for instance by gravity waves, and the direction of VHF "glinting" is measurable by spatial domain interferometry or many-beam Doppler beam swinging (DBS. This paper uses the Middle and Upper atmosphere (MU radar, Shigaraki, Japan as a volume-imaging radar with 64-beam DBS, to show tilting of layers and air flow in mountain waves. Tilt of aspect-sensitive echo power from horizontal is nearly parallel to air flow, as assumed in earlier measurements of mountain-wave alignment. Vertical-wind measurements are self-consistent from different beam zenith angles, despite the combined effects of aspect sensitivity and horizontal-wind gradients.

  2. Analysis of the VHF-UHF electromagnetic radiation of lightning: Application to a model of the negative stepped leader propagation

    Science.gov (United States)

    Taudiere, Isabelle

    1991-03-01

    The space and time characteristics of the VHF-UHF radiation from lightning are analyzed on the bases of 300 MHz emission sources, localized in three dimensions by interferometric measurements. The main phases that contribute to the development of intracloud lightning are examined in detail, also using electric field measurements at the lower frequency. This research is complemented by an experimental and theoretical analysis of long discharge (8m) radio emissions generated with both polarities in the laboratory. These investigations revealed that the VHF radiation is associated with the channel reillumination phase accompanying each step in the negative spark. The outcome of this work is the creation of a simple model for the propagation of the negative leader. The current and the radiated field during this phase of the discharge are computed from an equivalent electric circuit using the physical laws governing the variation of resistance. The extrapolation of these results to the case of the stepped leader of natural lightning is discussed.

  3. CNGS Reflector installed

    CERN Multimedia

    2006-01-01

    A major component that will help target the CNGS neutrino beam for its 732km journey through the earth's crust, from CERN to the Gran Sasso laboratory in Italy, has been installed in its final position. The transport of the huge magnetic horn reflector through the CNGS access gallery. A team from CNGS and TS/IC, and the contractors DBS, transported the magnetic horn reflector on 5th December, in a carefully conducted operation that took just under two hours. The reflector is 7m long, 1.6m in diameter and 1.6 tonnes in weight. With only a matter of centimetres to spare on either side, the reflector was transported through the CNGS access gallery, before being installed in the experiment's target chamber. The larger of two magnetic horns, the reflector will help refocus sprays of high energy pions and kaons emitted after a 0.5MW stream of protons from the Super Proton Synchrotron (SPS) strikes nucleons in a graphite target. The horns are toroidal magnetic lenses and work with high pulsed currents: 150 kA f...

  4. Meteor head echo altitude distributions and the height cutoff effect studied with the EISCAT HPLA UHF and VHF radars

    Directory of Open Access Journals (Sweden)

    A. Westman

    2004-04-01

    Full Text Available Meteor head echo altitude distributions have been derived from data collected with the EISCAT VHF (224MHz and UHF (930MHz high-power, large-aperture (HPLA radars. At the high-altitude end, the distributions cut off abruptly in a manner reminiscent of the trail echo height ceiling effect observed with classical meteor radars. The target dimensions are shown to be much smaller than both the VHF and the UHF probing wavelengths, but the cutoff heights for the two systems are still clearly different, the VHF cutoff being located several km above the UHF one. A single-collision meteor-atmosphere interaction model is used to demonstrate that meteors in the (1.3–7.2µg mass range will ionise such that critical electron density at 224MHz is first reached at or around the VHF cutoff altitude and critical density at 930MHz will be reached at the UHF cutoff altitude. The observed seasonal variation in the cutoff altitudes is shown to be a function of the seasonal variation of atmospheric density with altitude. Assuming that the electron density required for detection is in the order of the critical density, the abrupt altitude cutoffs can be explained as a consequence of the micrometeoroid joint size-speed distribution dropping off so fast at the large-mass, high-velocity end that above a certain altitude the number of detectable events becomes vanishingly small. Conversely, meteors at the low-mass end of the distribution will be gradually retarded such that the ionisation they generate never reaches critical density. These particles will remain unobservable.Key words. Radio science (instruments and techniques – Interplatery physics (interplanetary dust – General or miscellaneous (new fields

  5. VHF digital ultrasound three-dimensional scanning in the diagnosis of myopic regression after corneal refractive surgery.

    Science.gov (United States)

    Reinstein, Dan Z; Ameline, Barbara; Puech, Michel; Montefiore, Guy; Laroche, Laurent

    2005-01-01

    To perform VHF digital ultrasound scanning and analysis of a case of high-myopic undercorrection in an eye that had undergone multiple surgical interventions for the correction of an initial refraction of -12.00 diopters (D). A 49-year-old woman was evaluated after undergoing three surgical interventions for correction of an initial refraction of -12.00 D in the left eye. Automated lamellar keratoplasty (ALK) was followed by arcuate keratotomy (for induced astigmatism) and surface photorefractive keratectomy (PRK). The residual ametropia on presentation was -6.75 -3.50 x 95 degrees. VHF digital ultrasound scanning and analysis was performed. On ultrasound, the ALK interface was clearly visible. Residual stromal thickness beneath the cap was at least 275 microm. The absence of Bowman's layer indicated the region of PRK. New stroma and nascent stromal layers were differentiated within the flap. Neo stromal deposition and central epithelial hyperplasia were determined to be responsible for the myopic shift, as opposed to biomechanical changes. In this case, refraction, slit-lamp examination, and topography were unable to provide a diagnosis for regression following multiple corneal refractive procedures. By providing layered anatomical mapping, VHF digital ultrasound scanning was able to exclude a diagnosis of ectasia and provide anatomical diagnostic information to explain the clinical observations.

  6. Disturbances in VHF/UHF telemetry links as a possible effect of the 2003 Hokkaido Tokachi-oki earthquake

    Directory of Open Access Journals (Sweden)

    H. Nagamoto

    2008-08-01

    Full Text Available The data on radio telemetry links (for water information at VHF/UHF in Hokkaido are used to investigate the rate of disturbances on radio links (or connection failure and its association with a huge earthquake, Tokachi-oki earthquake on 26 September 2003. Especially, the telemetry links at the Tokachi region closest to the earthquake epicenter, showed a significant increase in disturbances on radio links two weeks to a few days before the earthquake on the basis of analysis during a long interval from 1 June 2002 to 3 November 2007 (over 5 years. We suggest that these severe disturbances in VHF/UHF telemetry links are attributed to the generation of seismogenic VHF/UHF radio noises (emissions. Based on this idea, we have estimated that the intensity of these seismogenic emissions is on the order of 10–19 dB μV/m. Finally, the present result was compared with other physical parameters already obtained for this earthquake.

  7. Decommissioning of offshore installations

    Energy Technology Data Exchange (ETDEWEB)

    Oeen, Sigrun; Iversen, Per Erik; Stokke, Reidunn; Nielsen, Frantz; Henriksen, Thor; Natvig, Henning; Dretvik, Oeystein; Martinsen, Finn; Bakke, Gunnstein

    2010-07-01

    New legislation on the handling and storage of radioactive substances came into force 1 January 2011. This version of the report is updated to reflect this new regulation and will therefore in some chapters differ from the Norwegian version (see NEI-NO--1660). The Ministry of the Environment commissioned the Climate and Pollution Agency to examine the environmental impacts associated with the decommissioning of offshore installations (demolition and recycling). This has involved an assessment of the volumes and types of waste material and of decommissioning capacity in Norway now and in the future. This report also presents proposals for measures and instruments to address environmental and other concerns that arise in connection with the decommissioning of offshore installations. At present, Norway has four decommissioning facilities for offshore installations, three of which are currently involved in decommissioning projects. Waste treatment plants of this kind are required to hold permits under the Pollution Control Act. The permit system allows the pollution control authority to tailor the requirements in a specific permit by evaluating conditions and limits for releases of pollutants on a case-to-case basis, and the Act also provides for requirements to be tightened up in line with the development of best available techniques (BAT). The environmental risks posed by decommissioning facilities are much the same as those from process industries and other waste treatment plants that are regulated by means of individual permits. Strict requirements are intended to ensure that environmental and health concerns are taken into account. The review of the four Norwegian decommissioning facilities in connection with this report shows that the degree to which requirements need to be tightened up varies from one facility to another. The permit for the Vats yard is newest and contains the strictest conditions. The Climate and Pollution Agency recommends a number of measures

  8. Long-period unstable gravity-waves and associated VHF radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    Full Text Available VHF atmospheric radar is used to measure the wind velocity and radar echo power related to long-period wind perturbations, including gravity waves, which are observed commonly in the lower stratosphere and tropopause region, and sometimes in the troposphere. These wind structures have been identified previously as either inertia-gravity waves, often associated with jet streams, or mountain waves. At heights of peak wind shear, imbalances are found between the echo powers of a symmetric pair of radar beams, which are expected to be equal. The largest of these power differences are found for conditions of simultaneous high wind shear and high aspect sensitivity. It is suggested that the effect might arise from tilted specular reflectors or anisotropic turbulent scatterers, a result of, for example, Kelvin-Helmholtz instabilities generated by the strong wind shears. This radar power-difference effect could offer information about the onset of saturation in long-period waves, and the formation of thin layers of turbulence.

  9. Anisotropy of Doppler spectral parameters in the VHF radar observations at MU and White Sands

    Directory of Open Access Journals (Sweden)

    G. D. Nastrom

    2001-08-01

    Full Text Available Significant differences are found between the mean spectral widths from beams in the meridional plane and in the zonal plane at both the MU and the White Sands VHF radars. The spectral width in the beam directed perpendicular to the prevailing wind is greater than that in the beam parallel to the wind. The magnitudes of the differences in spectral width show a linear relationship with wind speed, with the greatest differences at the greatest wind speeds. The differences in spectral width show a positive correlation with the differences in backscattered power. The anisotropy in backscattered power is well-known and is usually attributed to aspect sensitivity effects. However, the anisotropy in spectral width does not appear to be due to the same mechanism, and while several hypotheses to account for this are considered, including finite range-volume effects, effects from the tilting of isentropic layers, and anisotropic turbulence effects, it is seen that each of these suggestions has its shortcomings.Key words. Meteorology and atmospheric dynamics (turbulence; instruments and techniques

  10. Anisotropy of Doppler spectral parameters in the VHF radar observations at MU and White Sands

    Directory of Open Access Journals (Sweden)

    G. D. Nastrom

    Full Text Available Significant differences are found between the mean spectral widths from beams in the meridional plane and in the zonal plane at both the MU and the White Sands VHF radars. The spectral width in the beam directed perpendicular to the prevailing wind is greater than that in the beam parallel to the wind. The magnitudes of the differences in spectral width show a linear relationship with wind speed, with the greatest differences at the greatest wind speeds. The differences in spectral width show a positive correlation with the differences in backscattered power. The anisotropy in backscattered power is well-known and is usually attributed to aspect sensitivity effects. However, the anisotropy in spectral width does not appear to be due to the same mechanism, and while several hypotheses to account for this are considered, including finite range-volume effects, effects from the tilting of isentropic layers, and anisotropic turbulence effects, it is seen that each of these suggestions has its shortcomings.

    Key words. Meteorology and atmospheric dynamics (turbulence; instruments and techniques

  11. Range imaging observations of PMSE using the EISCAT VHF radar: Phase calibration and first results

    Directory of Open Access Journals (Sweden)

    J. R. Fernandez

    2005-01-01

    Full Text Available A novel phase calibration technique for use with the multiple-frequency Range IMaging (RIM technique is introduced based on genetic algorithms. The method is used on data collected with the European Incoherent SCATter (EISCAT VHF radar during a 2002 experiment with the goal of characterizing the vertical structure of Polar Mesosphere Summer Echoes (PMSE over northern Norway. For typical Doppler measurements, the initial phases of the transmitter and receiver are not required to be the same. The EISCAT receiver systems exploit this fact, allowing a multi-static configuration. However, the RIM method relies on the small phase differences between closely spaced frequencies. As a result, the high-resolution images produced by the RIM method can be significantly degraded if not properly calibrated. Using an enhanced numerical radar simulator, in which data from multiple sampling volumes are simultaneously generated, the proposed calibration method is validated. Subsequently, the method is applied to preliminary data from the EISCAT radar, providing first results of RIM images of PMSE. Data using conventional analysis techniques, and confirmed by RIM, reveal an often-observed double-layer structure with higher stability in the lower layer. Moreover, vertical velocity oscillations exhibit a clear correlation with the apparent motion of the layers shown in the echo power plots.

  12. Frequency domain interferometry mode observations of PMSE using the EISCAT VHF radar

    Directory of Open Access Journals (Sweden)

    P. B. Chilson

    2000-12-01

    Full Text Available During the summer of 1997 investigations into the nature of polar mesosphere summer echoes (PMSE were conducted using the European incoherent scatter (EISCAT VHF radar in Norway. The radar was operated in a frequency domain interferometry (FDI mode over a period of two weeks to study the frequency coherence of the returned radar signals. The operating frequencies of the radar were 224.0 and 224.6 MHz. We present the first results from the experiment by discussing two 4-h intervals of data collected over two consecutive nights. During the first of the two days an enhancement of the FDI coherence, which indicates the presence of distinct scattering layers, was found to follow the lower boundary of the PMSE. Indeed, it is not unusual to observe that the coherence values are peaked around the heights corresponding to both the lower- and upper-most boundaries of the PMSE layer and sublayers. A Kelvin-Helmholtz mechanism is offered as one possible explanation for the layering structure. Additionally, our analysis using range-time-pseudocolor plots of signal-to-noise ratios, spectrograms of Doppler velocity, and estimates of the positions of individual scattering layers is shown to be consistent with the proposition that upwardly propagating gravity waves can become steepened near the mesopause.Key words: Ionosphere (polar ionosphere · Meteorology and Atmospheric Dynamics (middle atmosphere dynamics · Radio Science (Interferometry

  13. Frequency domain interferometry mode observations of PMSE using the EISCAT VHF radar

    Directory of Open Access Journals (Sweden)

    P. B. Chilson

    Full Text Available During the summer of 1997 investigations into the nature of polar mesosphere summer echoes (PMSE were conducted using the European incoherent scatter (EISCAT VHF radar in Norway. The radar was operated in a frequency domain interferometry (FDI mode over a period of two weeks to study the frequency coherence of the returned radar signals. The operating frequencies of the radar were 224.0 and 224.6 MHz. We present the first results from the experiment by discussing two 4-h intervals of data collected over two consecutive nights. During the first of the two days an enhancement of the FDI coherence, which indicates the presence of distinct scattering layers, was found to follow the lower boundary of the PMSE. Indeed, it is not unusual to observe that the coherence values are peaked around the heights corresponding to both the lower- and upper-most boundaries of the PMSE layer and sublayers. A Kelvin-Helmholtz mechanism is offered as one possible explanation for the layering structure. Additionally, our analysis using range-time-pseudocolor plots of signal-to-noise ratios, spectrograms of Doppler velocity, and estimates of the positions of individual scattering layers is shown to be consistent with the proposition that upwardly propagating gravity waves can become steepened near the mesopause.

    Key words: Ionosphere (polar ionosphere · Meteorology and Atmospheric Dynamics (middle atmosphere dynamics · Radio Science (Interferometry

  14. Study of CNT growth using nanocatalyst Ag precursor by HWC-VHF-PECVD

    Energy Technology Data Exchange (ETDEWEB)

    Eliyana, Ajeng; Rosikin, Ahmad; Winata, Toto, E-mail: toto@fi.itb.ac.id [Physics of Electronics Material Research Division, Physics Programme, Faculty of Mathematics and Natural Sciences, Institut Teknologi Bandung, Jl. Ganesha 10, Bandung 40132, West Java (Indonesia)

    2015-04-16

    The study of CNT growth has been done by using silver (Ag) nanocatalyst as a guide precursor on corning glass 7059 substrate. The silver catalyst was prepared by the evaporation method by varying deposition time for 50, 25, and 14 seconds. The silver films were then annealed at temperature of 400°C for 4 hours. From Scanning Electron Microscope (SEM) and Energy Dispersive X-ray Spectroscopy (EDX) results the grain sizes are 65 nm, 57 nm, and 33 nm, and also the atomic compositions are 6,06%, 4,52%, and 3,73% for 14, 25 and 50 seconds samples, respectively. The 33 nm samples were then used for CNT growth by using Hot Wire Cell (HWC) – Very High Frequency (VHF) – Plasma Enhanced Chemical Vapor Deposition (PECVD) at 275 ° C deposition temperature and pressure of 300 mTorr. The rf power was varied from 8 to 20 watts, with deposition time for 60 minutes. The methane (CH4) 99.999% was used as Carbon sources. Hydrogen gas (H2) was used to etch the oxide layer formed during the pre-deposition process. The diameter and length for the CNT are 125 nm and 1.650 to 2.989 nm respectively.

  15. On the VHF source retrieval errors associated with Lightning Mapping Arrays (LMAs)

    Science.gov (United States)

    Koshak, W. J.

    2016-12-01

    A common method for retrieving the lightning Very High Frequency (VHF) radio source (x, y, z, t) emission is to minimize a (reduced) chi-squared function that indicates how well the model arrival times associated with the model source represent the arrival time measurements at each Lightning Mapping Array (LMA) site. The Levenberg-Marquardt (LM) algorithm is usually employed to find the minimum of the chi-squared function, and the model source producing this minimum is considered to be the optimal source solution. Because the chi-squared mathematical surface is nonlinear, it is important to feed the LM algorithm an accurate initial guess (xo, yo, zo, to) in parameter space to avoid parameter searches that terminate at a relative minima of the chi-squared surface. Source initialization is commonly performed using a linear retrieval algorithm first introduced in Koshak and Solakiewicz (1996), and further applied in Koshak et al. (2004). Monte Carlo simulations and theoretical inferences both show that source retrieval errors (particularly source altitude errors) increase with horizontal source range. In the present study, the effect of modifying certain elements of the retrieval (i. e., the LMA site locations, the number of sites employed, and the retrieval algorithm characteristics) are examined to assess and quantify associated improvements in retrieval results.

  16. Signal processing techniques for phase-coded HF-VHF radars

    Directory of Open Access Journals (Sweden)

    J. A. Baskaradas

    2003-06-01

    Full Text Available HF-VHF radar techniques are easy to employ and commonly used in geophysical applications. They include deep radio soundings, used for probing the ionosphere, stratosphere-mesosphere measurement, weather forecast and radio-glaciology. Fast algorithms and powerful processors facilitate the development of several kinds of low power radars, but the reduction of the transmitted power has to be compensated by on-line processing of an encoded signal to maintain a favorable signal-to-noise ratio suitable for detection. Moreover, radars have to reconstruct return echoes with different travel times due to various origins (multi-path, adjacent objects, etc.. Such needs can be accomplished by means of signal phase coding and one of the most attractive is the reversal phase code. The composite echo signal must be processed to extract the physical information useful for the measurement considered. In this paper some algorithms used for on-line processing of phase-coded signals will be described, both in time and frequency domain.

  17. Installing Piezometers in Deepwater Sediments

    Science.gov (United States)

    Lee, David R.; Harvey, F. Edwin

    1996-04-01

    A new method has been developed for installing piezometers in the sediments of deep harbors and lakes, where it has been difficult to measure hydrogeological parameters and collect pore waters for geochemical analyses. Using an underwater hammer operated from the surface, piezometers have been installed as much as 12 m below the water-sediment interface. The piezometer screen is held in place by barbs on the drive head and is connected to the water surface via flexible tubing. These piezometers have been installed from boats and from ice cover in water up to 30 m deep. However, installation in water more than 100 m deep should be possible.

  18. ROS Installation and Commissioning

    CERN Multimedia

    Gorini, B

    The ATLAS Readout group (a sub-group of TDAQ) has now completed the installation and commissioning of all of the Readout System (ROS) units. Event data from ATLAS is initially handled by detector specific hardware and software, but following a Level 1 Accept the data passes from the detector specific Readout Drivers (RODs) to the ROS, the first stage of the central ATLAS DAQ. Within the final ATLAS TDAQ system the ROS stores the data and on request makes it available to the Level 2 Trigger (L2) processors and to the Event Builder (EB) as required. The ROS is implemented as a large number of PCs housing custom built cards (ROBINs) and running custom multi-threaded software. Each ROBIN card (shown below) contains buffer memories to store the data, plus a field programmable gate array ( FPGA ) and an embedded PowerPC processor for management of the memories and data requests, and is implemented as a 64-bit 66 MHz PCI card. Both the software and the ROBIN cards have been designed and developed by the Readout g...

  19. Arctic and Antarctic polar mesosphere summer echoes observed with oblique incidence HF radars: analysis using simultaneous MF and VHF radar data

    Directory of Open Access Journals (Sweden)

    T. Ogawa

    2004-12-01

    Full Text Available Polar mesosphere summer echoes (PMSEs have been well studied using vertical incidence VHF radars at northern high-latitudes. In this paper, two PMSE events detected with the oblique incidence SuperDARN HF radars at Hankasalmi, Finland (62.3° N and Syowa Station, Antarctica (69.0° S, are analyzed, together with simultaneous VHF and medium-frequency (MF radar data. Altitude resolutions of the HF radars in the mesosphere and the lower thermosphere are too poor to know exact PMSE altitudes. However, a comparison of Doppler velocity from the HF radar and neutral wind velocity from the MF radar shows that PMSEs at the HF band appeared at altitudes within 80-90km, which are consistent with those from previous vertical incidence HF-VHF radar results. The HF-VHF PMSE occurrences exhibit a semidiurnal behavior, as observed by other researchers. It is found that in one event, PMSEs occurred when westward semidiurnal winds with large amplitude at 85-88km altitudes attained a maximum. When the HF-VHF PMSEs were observed at distances beyond 180km from MF radar sites, the MF radars detected no appreciable signatures of echo enhancement. Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; thermospheric dynamics; waves and tides

  20. Arctic and Antarctic polar mesosphere summer echoes observed with oblique incidence HF radars: analysis using simultaneous MF and VHF radar data

    Directory of Open Access Journals (Sweden)

    T. Ogawa

    2004-12-01

    Full Text Available Polar mesosphere summer echoes (PMSEs have been well studied using vertical incidence VHF radars at northern high-latitudes. In this paper, two PMSE events detected with the oblique incidence SuperDARN HF radars at Hankasalmi, Finland (62.3° N and Syowa Station, Antarctica (69.0° S, are analyzed, together with simultaneous VHF and medium-frequency (MF radar data. Altitude resolutions of the HF radars in the mesosphere and the lower thermosphere are too poor to know exact PMSE altitudes. However, a comparison of Doppler velocity from the HF radar and neutral wind velocity from the MF radar shows that PMSEs at the HF band appeared at altitudes within 80-90km, which are consistent with those from previous vertical incidence HF-VHF radar results. The HF-VHF PMSE occurrences exhibit a semidiurnal behavior, as observed by other researchers. It is found that in one event, PMSEs occurred when westward semidiurnal winds with large amplitude at 85-88km altitudes attained a maximum. When the HF-VHF PMSEs were observed at distances beyond 180km from MF radar sites, the MF radars detected no appreciable signatures of echo enhancement.

    Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; thermospheric dynamics; waves and tides

  1. Effect of solar and magnetic activity on VHF scintillations near the equatorial anomaly crest

    Directory of Open Access Journals (Sweden)

    R. P. Singh

    2004-09-01

    Full Text Available The VHF amplitude scintillation recorded during the period January 1991 to December 1993 in the declining phase of a solar cycle and April 1998 to December 1999 in the ascending phase of the next solar cycle at Varanasi (geogr. lat.=25.3°, long.=83.0°, dip=37°N have been analyzed to study the behavior of ionospheric irregularities during active solar periods and magnetic storms. It is shown that irregularities occur at arbitrary times and may last for <30min. A rise in solar activity increases scintillations during winter (November-February and near equinoxes (March-April; September-October, whereas it depresses the scintillations during the summer (May-July. In general, the role of magnetic activity is to suppress scintillations in the pre-midnight period and to increase it in the post-midnight period during equinox and winter seasons, whilst during summer months the effect is reversed. The pre-midnight scintillation is sometimes observed when the main phase of Dst corresponds to the pre-midnight period. The annual variation shows suppression of scintillations on disturbed days, both during pre-midnight and post-midnight period, which becomes more effective during years of high solar activity. It is observed that for magnetic storms for which the recovery phase starts post-midnight, the probability of occurrence of irregularities is enhanced during this time. If the magnetic storm occurred during daytime, then the probability of occurrence of scintillations during the night hours is decreased. The penetration of magnetospheric electric fields to the magnetic equator affects the evolution of low-latitude irregularities. A delayed disturbance dynamo electric field also affects the development of irregularities.

  2. Simulation of Controller Pilot Data Link Communications over VHF Digital Link Mode 3

    Science.gov (United States)

    Bretmersky, Steven C.; Murawski, Robert; Nguyen, Thanh C.; Raghavan, Rajesh S.

    2004-01-01

    The Federal Aviation Administration (FAA) has established an operational plan for the future Air Traffic Management (ATM) system, in which the Controller Pilot Data Link Communications (CPDLC) is envisioned to evolve into digital messaging that will take on an ever increasing role in controller to pilot communications, significantly changing the way the National Airspace System (NAS) is operating. According to FAA, CPDLC represents the first phase of the transition from the current analog voice system to an International Civil Aviation Organization (ICAO) compliant system in which digital communication becomes the alternate and perhaps primary method of routine communication. The CPDLC application is an Air Traffic Service (ATS) application in which pilots and controllers exchange messages via an addressed data link. CPDLC includes a set of clearance, information, and request message elements that correspond to existing phraseology employed by current Air Traffic Control (ATC) procedures. These message elements encompass altitude assignments, crossing constraints, lateral deviations, route changes and clearances, speed assignments, radio frequency assignments, and various requests for information. The pilot is provided with the capability to respond to messages, to request clearances and information, to report information, and to declare/rescind an emergency. A 'free text' capability is also provided to exchange information not conforming to defined formats. This paper presents simulated results of the aeronautical telecommunication application Controller Pilot Data Link Communications over VHF Digital Link Mode 3 (VDL Mode 3). The objective of this simulation study was to determine the impact of CPDLC traffic loads, in terms of timely message delivery and capacity of the VDL Mode 3 subnetwork. The traffic model is based on and is used for generating air/ground messages with different priorities. Communication is modeled for the en route domain of the Cleveland

  3. Seasonal and diurnal changes in wind variability from Flatland VHF profiler observations

    Energy Technology Data Exchange (ETDEWEB)

    Nastrom, G.D. [Saint Cloud State Univ., MN (United States). Dept. of Earth Sci.; Clark, W.L. [National Oceanic and Atmospheric Administration, Boulder, CO (United States). Aeronomy Lab.; Zandt, T.E. van [National Oceanic and Atmospheric Administration, Boulder, CO (United States). Aeronomy Lab.; Warnock, J.M. [National Oceanic and Atmospheric Administration, Boulder, CO (United States). Aeronomy Lab.

    1996-02-01

    Climatological results are presented on the hourly variance of the wind observed in the mid-troposphere (3 to 9 km MSL). This quantity roughly indicates the energy in the atmospheric wind field for variations with periods roughly less than 1 hour. Observations are from the Flatland VHF research wind profiler, located near Champaign/Urbana, Illinois, well away from significant orographic features. The period of record covers two years, September 1990 through August 1992. The values of the variance of the winds along vertical and oblique (15 degrees from zenith in the cardinal directions) beams are presented versus height, season, time-of-day, and beam pointing direction. It is found that the hourly variance values have approximately lognormal frequency distribution. The mean hourly variance is significantly larger for the oblique wind observations than for the vertical. Mean wind variances also tend to be larger in the east/west steering plane than in the north/south plane. The mean variance generally increases with height, but faster than would be expected if it were due solely to the decrease in atmospheric density, implying the presence of local source/sinks of wind energy. The rate of change with height is noticeably different for the vertical and oblique beams, being much less for the vertical beam, in some seasons even decreasing with height. With respect to season, the mean hourly variance is smallest in the summer and largest in the winter. With respect to diurnal changes, the variance is maximum during the afternoon for spring, summer, and autumn, with the maximum up to a factor of two larger than the minimum. In winter, the diurnal change is much smaller, with little indication of an afternoon maximum. (orig.)

  4. VHF radar observations of turbulent structures in the polar mesopause region

    Directory of Open Access Journals (Sweden)

    P. Czechowsky

    Full Text Available The mobile SOUSY VHF Radar was operated in the summer of 1987 during the MAC/SINE campaign in northern Norway to study the polar mesosphere summer echoes (PMSE. Measurements of the spectral width indicate that two types of structures occur. In general mesospheric layers are bifurcated exhibiting a narrow spectral width and a well-defined aspect sensitivity. However, for about 10% of the observation time cells of enhanced turbulence characterized by extremely broad spectral widths appear predominantly in the upper sublayer above 86 km. Identification and separation of beam and shear broadening allows a determination of the turbulence-induced component of the spectral width. This case study reveals that during several events these cloud-like structures of enhanced turbulence move with an apparent velocity of several tens of meters per second which is almost identical with the phase trace velocity of simultaneously observed waves. Since, at that time, the Richardson number was less than a quarter, it was concluded that these turbulent cells were generated by a Kelvin-Helmholtz mechanism. The horizontal extent of these structures was calculated to be less than 40 km. A general relation between spectral width and echo power was not detected. The turbulent component of the spectral width was used to calculate typical values of the energy dissipation rate at times where narrow spectral width dominates and during periods of enhanced turbulence. In addition, the outer scale of the inertial subrange (buoyancy scale was estimated. For the first time the occurrence and motion of this type of structures of enhanced spectral width is analyzed and discussed in detail.

  5. VHF radar observations of turbulent structures in the polar mesopause region

    Directory of Open Access Journals (Sweden)

    P. Czechowsky

    1997-08-01

    Full Text Available The mobile SOUSY VHF Radar was operated in the summer of 1987 during the MAC/SINE campaign in northern Norway to study the polar mesosphere summer echoes (PMSE. Measurements of the spectral width indicate that two types of structures occur. In general mesospheric layers are bifurcated exhibiting a narrow spectral width and a well-defined aspect sensitivity. However, for about 10% of the observation time cells of enhanced turbulence characterized by extremely broad spectral widths appear predominantly in the upper sublayer above 86 km. Identification and separation of beam and shear broadening allows a determination of the turbulence-induced component of the spectral width. This case study reveals that during several events these cloud-like structures of enhanced turbulence move with an apparent velocity of several tens of meters per second which is almost identical with the phase trace velocity of simultaneously observed waves. Since, at that time, the Richardson number was less than a quarter, it was concluded that these turbulent cells were generated by a Kelvin-Helmholtz mechanism. The horizontal extent of these structures was calculated to be less than 40 km. A general relation between spectral width and echo power was not detected. The turbulent component of the spectral width was used to calculate typical values of the energy dissipation rate at times where narrow spectral width dominates and during periods of enhanced turbulence. In addition, the outer scale of the inertial subrange (buoyancy scale was estimated. For the first time the occurrence and motion of this type of structures of enhanced spectral width is analyzed and discussed in detail.

  6. The relationship between VHF radar auroral backscatter amplitude and Doppler velocity: a statistical study

    Directory of Open Access Journals (Sweden)

    B. A. Shand

    1996-08-01

    Full Text Available A statistical investigation of the relationship between VHF radar auroral backscatter intensity and Doppler velocity has been undertaken with data collected from 8 years operation of the Wick site of the Sweden And Britain Radar-auroral Experiment (SABRE. The results indicate three different regimes within the statistical data set; firstly, for Doppler velocities <200 m s–1, the backscatter intensity (measured in decibels remains relatively constant. Secondly, a linear relationship is observed between the backscatter intensity (in decibels and Doppler velocity for velocities between 200 m s–1 and 700 m s–1. At velocities greater than 700 m s–1 the backscatter intensity saturates at a maximum value as the Doppler velocity increases. There are three possible geophysical mechanisms for the saturation in the backscatter intensity at high phase speeds: a saturation in the irregularity turbulence level, a maximisation of the scattering volume, and a modification of the local ambient electron density. There is also a difference in the dependence of the backscatter intensity on Doppler velocity for the flow towards and away from the radar. The results for flow towards the radar exhibit a consistent relationship between backscatter intensity and measured velocities throughout the solar cycle. For flow away from the radar, however, the relationship between backscatter intensity and Doppler velocity varies during the solar cycle. The geometry of the SABRE system ensures that flow towards the radar is predominantly associated with the eastward electrojet, and flow away is associated with the westward electrojet. The difference in the backscatter intensity variation as a function of Doppler velocity is attributed to asymmetries between the eastward and westward electrojets and the geophysical parameters controlling the backscatter amplitude.

  7. Statistics of 150-km echoes over Jicamarca based on low-power VHF observations

    Directory of Open Access Journals (Sweden)

    J. L. Chau

    2006-07-01

    Full Text Available In this work we summarize the statistics of the so-called 150-km echoes obtained with a low-power VHF radar operation at the Jicamarca Radio Observatory (11.97 S, 76.87 W, and 1.3 dip angle at 150-km altitude in Peru. Our results are based on almost four years of observations between August 2001 and July 2005 (approximately 150 days per year. The majority of the observations have been conducted between 08:00 and 17:00 LT. We present the statistics of occurrence of the echoes for each of the four seasons as a function of time of day and altitude. The occurrence frequency of the echoes is ~75% around noon and start decreasing after 15:00 LT and disappear after 17:00 LT in all seasons. As shown in previous campaign observations, the 150-echoes appear at a higher altitude (>150 km in narrow layers in the morning, reaching lower altitudes (~135 km around noon, and disappear at higher altitudes (>150 km after 17:00 LT. We show that although 150-km echoes are observed all year long, they exhibit a clear seasonal variability on altitudinal coverage and the percentage of occurrence around noon and early in the morning. We also show that there is a strong day-to-day variability, and no correlation with magnetic activity. Although our results do not solve the 150-km riddle, they should be taken into account when a reasonable theory is proposed.

  8. The relationship between VHF radar auroral backscatter amplitude and Doppler velocity: a statistical study

    Directory of Open Access Journals (Sweden)

    B. A. Shand

    Full Text Available A statistical investigation of the relationship between VHF radar auroral backscatter intensity and Doppler velocity has been undertaken with data collected from 8 years operation of the Wick site of the Sweden And Britain Radar-auroral Experiment (SABRE. The results indicate three different regimes within the statistical data set; firstly, for Doppler velocities <200 m s–1, the backscatter intensity (measured in decibels remains relatively constant. Secondly, a linear relationship is observed between the backscatter intensity (in decibels and Doppler velocity for velocities between 200 m s–1 and 700 m s–1. At velocities greater than 700 m s–1 the backscatter intensity saturates at a maximum value as the Doppler velocity increases. There are three possible geophysical mechanisms for the saturation in the backscatter intensity at high phase speeds: a saturation in the irregularity turbulence level, a maximisation of the scattering volume, and a modification of the local ambient electron density. There is also a difference in the dependence of the backscatter intensity on Doppler velocity for the flow towards and away from the radar. The results for flow towards the radar exhibit a consistent relationship between backscatter intensity and measured velocities throughout the solar cycle. For flow away from the radar, however, the relationship between backscatter intensity and Doppler velocity varies during the solar cycle. The geometry of the SABRE system ensures that flow towards the radar is predominantly associated with the eastward electrojet, and flow away is associated with the westward electrojet. The difference in the backscatter intensity variation as a function of Doppler velocity is attributed to asymmetries between the eastward and westward electrojets and the geophysical parameters controlling the backscatter amplitude.

  9. Cut-off low monitoring by the French VHF-ST-radar network during the ESTIME campaign

    Science.gov (United States)

    Caccia, J.-L.; Bertin, F.; Campistron, B.; Klaus, V.; Pointin, Y.; van Baelen, J.; Wilson, R.

    2000-05-01

    In order to investigate mesoscale strato-tropospheric exchanges, the field campaign `Echanges Stratosphère-Troposphère: Investigations à Moyenne Echelle' was conducted in France from late 1993 to mid 1995 and focused on cut-off low events. It involved the French research network of five VHF (Very High Frequency) ST (Strato-Tropospheric) radars deployed in southern France. Observations corresponding to three Intensive Observing Periods are reported here. The radar data analyzed and discussed are time-height diagrams of the aspect ratio (AR), that is, the vertical to oblique beam-returned power ratio, used for monitoring three cut-off low events. In order to discuss the validity of the method, 506 h of radar AR data were compared with time-height diagrams of the static stability and the humidity obtained from synoptic European Center for Medium-range Weather Forecasts model analyses. A dataset corresponding to 297 h of observations is analyzed and discussed here. It is concluded that the AR is a good tracer to document cut-off low events, including tropopause folding identification and the detection of tropospheric air masses of enhanced stability, in dry or weakly humid cases. On the other hand, although the effects of the specific humidity and its gradients on VHF radar echo power could not be extensively investigated, our results suggest that the same parameter cannot be used at mid- and lower-tropospheric levels when the effects of specific humidity significantly reinforce the moist static stability. It is important to take into account these insights in the context of future observing campaigns in which a network of VHF-ST-radars will be involved, and where their role will be to observe and to document the evolution of upper-level features or potential vorticity streamers, or more generally stratospheric-tropospheric exchanges.

  10. The Houston Lightning Mapping Array: Installation, Operation, and Preliminary Results

    Science.gov (United States)

    Orville, R. E.; Cullen, M. R.; Rodeheffer, D.; Krehbiel, P. R.; Rison, W.

    2012-12-01

    The Houston Lightning Mapping Array (LMA) was established in April 2012 and is a network of twelve time-of-arrival lightning sensors operating in the VHF around Houston, Texas. The network sensors are built by New Mexico Institute of Mining and Technology. Built stand-alone units, these LMA sensors use solar panels and cellular data modems for Internet connectivity. This enables the units to be placed in strategic locations at sites to minimize noise and interference by reducing dependence on wired power or communications lines. Twelve sensors are distributed around the Houston and provide total lightning data for the fourth most populated American city. The primary research goals of the network are to investigate the structure of total lightning within thunderstorm development and to examine any potential impact of the urban environment on lightning characteristics. Furthermore, the proximity to the coast and the Gulf of Mexico presents the opportunity to examine the total lightning structure within tropical cyclones that impact the Texas coastline. The availability of real-time LMA data provides a decision support tool for advanced warning of thunderstorm development. We present efforts with the Houston/Galveston Weather Forecast Office and the Spaceflight Meteorology Group at Johnson Space Center to integrate the real-time LMA data into operational display software. The network of 12 sensors has been operating continuously since installation in mid-April with 10 sensors surrounding the Houston area plus one in College Station and one in Galveston. Analysis of recent data will investigate three-dimensional thunderstorm activity.

  11. Offshore structure and installation method

    Energy Technology Data Exchange (ETDEWEB)

    Waddell, J.W.

    1992-12-23

    An offshore structure particularly for use in arctic environments, and a method for installing this structure comprises a shield portion which rests on a seabed and primarily resists environmental loads, such as from ice, and a separate support portion which comprises a plurality of piles driven into the seabed to support a deck payload. The method for installing the structure comprises moving a shield portion of the structure to its intended location with piles pre-installed therein; setting the structure on the seabed; driving the piles into the seabed; and then severing any connection between the piles and the shield portion. (Author)

  12. DAQ INSTALLATION IN USC COMPLETED

    CERN Multimedia

    A. Racz

    After one year of work at P5 in the underground control rooms (USC55-S1&S2), the DAQ installation in USC55 is completed. The first half of 2006 was dedicated to the DAQ infrastructures installation (private cable trays, rack equipment for a very dense cabling, connection to services i.e. water, power, network). The second half has been spent to install the custom made electronics (FRLs and FMMs) and place all the inter-rack cables/fibers connecting all sub-systems to central DAQ (more details are given in the internal pages). The installation has been carried out by DAQ group members, coming from the hardware and software side as well. The pictures show the very nice team spirit !

  13. Solar Installation Labor Market Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Friedman, B.; Jordan, P.; Carrese, J.

    2011-12-01

    The potential economic benefits of the growing renewable energy sector have led to increased federal, state, and local investments in solar industries, including federal grants for expanded workforce training for U.S. solar installers. However, there remain gaps in the data required to understand the size and composition of the workforce needed to meet the demand for solar power. Through primary research on the U.S. solar installation employer base, this report seeks to address that gap, improving policymakers and other solar stakeholders understanding of both the evolving needs of these employers and the economic opportunity associated with solar market development. Included are labor market data covering current U.S. employment, expected industry growth, and employer skill preferences for solar installation-related occupations. This study offers an in-depth look at the solar installation sectors. A study published by the Solar Foundation in October 2011 provides a census of labor data across the entire solar value chain.

  14. Installation of the Gbar LINAC

    CERN Multimedia

    Maximilien, Brice

    2017-01-01

    Installation of the GBAR linac in its shielding bunker. The electrons accelerated to 10 MeV toward a target will produce the positrons that are necessary to form anti hydrogen with the antiprotons coming from the ELENA decelerator.

  15. Suitcase to Audit Solar Installations

    Energy Technology Data Exchange (ETDEWEB)

    Alberdi, J.; Barcala, J. M.; Blas, J. de; Molinero, A.; Navarrete, J. J.; Yuste, C.

    2001-07-01

    The audit suitcase was proposed by BESEL to introduce in the solar energy market a new tool which can make an evaluation of solar installation efficiency. Non-invasive sensors and low power components permit both easy installation of the devices and data storage for a period as long as ten days. This project was funded by the contract JOR3-CT98-7030 of the European Union JOULE III program. (Author)

  16. Installment options close to expiry

    Directory of Open Access Journals (Sweden)

    G. Alobaidi

    2006-01-01

    Full Text Available We use an asymptotic expansion to study the behavior of installment options close to expiry. Installment options are contracts where the price is paid over the life of the option rather than as a lump sum at the time of purchase, and where the contract can be allowed to lapse at any time. Series solutions are obtained for the location of the free boundary and the price of the option.

  17. The Offshore Bucket Trail Installation

    DEFF Research Database (Denmark)

    Nielsen, Søren Andreas; Ibsen, Lars Bo

    The Bucket Trail Installation project has gathered a substantial amount of date in a unique soil database which enable update of the used standards for penetration prediction. This update will lead to less conservative design of bucket foundations and is vital for the aim of cost reduction...... in the offshore wind business. Furthermore is serial offshore operation with the bucket concept was demonstrated with achieving full installation depth and inclination within given tolerance....

  18. Lightning VHF radiation location system based on short-baseline TDOA technique — Validation in rocket-triggered lightning

    Science.gov (United States)

    Sun, Zhuling; Qie, Xiushu; Liu, Mingyuan; Cao, Dongjie; Wang, Dongfang

    2013-07-01

    A lightning VHF radiation location system based on short-baseline time-difference of arrival (TDOA) technology is newly developed. Based on the orthogonal 10 m-baseline antenna array with four identical broadband flat plane antennas, this system receives the lightning broadband VHF radiation signals and calculates TDOA between antennas in order to determine the location of lightning radiation sources in two dimensions (elevation and azimuth). To reduce noise and improve estimation accuracy of time delay, a general correlation time delay estimation algorithm based on direct correlation method and wavelet transform is proposed. Moreover, parabolic interpolation algorithm is used in the fractional delay estimation to improve the time resolution of the positioning system. In this paper, a rocket-triggered lightning discharge and a cloud lightning discharge are analyzed respectively, combining with simultaneous observations of high-speed camera and fast/slow electric field changes. The results indicate that the TDOA location system could effectively map the lightning radiation sources in 2 dimensions and are in a good agreement with the high-speed video camera images.

  19. Radar efficiency and the calculation of decade-long PMSE backscatter cross-section for the Resolute Bay VHF radar

    Directory of Open Access Journals (Sweden)

    N. Swarnalingam

    2009-04-01

    Full Text Available The Resolute Bay VHF radar, located in Nunavut, Canada (75.0° N, 95.0° W and operating at 51.5 MHz, has been used to investigate Polar Mesosphere Summer Echoes (PMSE since 1997. PMSE are a unique form of strong coherent radar echoes, and their understanding has been a challenge to the scientific community since their discovery more than three decades ago. While other high latitude radars have recorded strong levels of PMSE activities, the Resolute Bay radar has observed relatively lower levels of PMSE strengths. In order to derive absolute measurements of PMSE strength at this site, a technique is developed to determine the radar efficiency using cosmic (sky noise variations along with the help of a calibrated noise source. VHF radars are only rarely calibrated, but determination of efficiency is even less common. Here we emphasize the importance of efficiency for determination of cross-section measurements. The significant advantage of this method is that it can be directly applied to any MST radar system anywhere in the world as long as the sky noise variations are known. The radar efficiencies for two on-site radars at Resolute Bay are determined. PMSE backscatter cross-section is estimated, and decade-long PMSE strength variations at this location are investigated. It was noticed that the median of the backscatter cross-section distribution remains relatively unchanged, but over the years a great level of variability occurs in the high power tail of the distribution.

  20. Meteoroid Fragmentation as Revealed in Head- and Trail-Echoes Observed with the Arecibo UHF and VHF Radars

    Science.gov (United States)

    Mathews, J. D.; Malhorta, A.

    2011-01-01

    We report recent 46.8/430 MHz (VHF/UHF) radar meteor observations at Arecibo Observatory (AO) that reveal many previously unreported features in the radar meteor return - including flare-trails at both UHF and VHF - that are consistent with meteoroid fragmentation. Signature features of fragmentation include strong intra-pulse and pulse-to-pulse fading as the result of interference between or among multiple meteor head-echo returns and between head-echo and impulsive flare or "point" trail-echoes. That strong interference fading occurs implies that these scatterers exhibit well defined phase centers and are thus small compared with the wavelength. These results are consistent with and offer advances beyond a long history of optical and radar meteoroid fragmentation studies. Further, at AO, fragmenting and flare events are found to be a large fraction of the total events even though these meteoroids are likely the smallest observed by the major radars. Fragmentation is found to be a major though not dominate component of the meteors observed at other HPLA radars that are sensitive to larger meteoroids.

  1. Displacement pile installation effects in sand

    NARCIS (Netherlands)

    Beijer-Lundberg, A.

    2015-01-01

    Installation effects govern the post-installation behaviour of displacement piles in sand. These effects are currently not completely understood. Suitable experimental techniques to model these installation effects include field, laboratory and experimental models. In the current thesis a

  2. High-Rate Fabrication of a-Si-Based Thin-Film Solar Cells Using Large-Area VHF PECVD Processes

    Energy Technology Data Exchange (ETDEWEB)

    Deng, Xunming [University of Toledo; Fan, Qi Hua

    2011-12-31

    The University of Toledo (UT), working in concert with it’s a-Si-based PV industry partner Xunlight Corporation (Xunlight), has conducted a comprehensive study to develop a large-area (3ft x 3ft) VHF PECVD system for high rate uniform fabrication of silicon absorber layers, and the large-area VHF PECVD processes to achieve high performance a-Si/a-SiGe or a-Si/nc-Si tandem junction solar cells during the period of July 1, 2008 to Dec. 31, 2011, under DOE Award No. DE-FG36-08GO18073. The project had two primary goals: (i) to develop and improve a large area (3 ft × 3 ft) VHF PECVD system for high rate fabrication of > = 8 Å/s a-Si and >= 20 Å/s nc-Si or 4 Å/s a-SiGe absorber layers with high uniformity in film thicknesses and in material structures. (ii) to develop and optimize the large-area VHF PECVD processes to achieve high-performance a-Si/nc-Si or a-Si/a-SiGe tandem-junction solar cells with >= 10% stable efficiency. Our work has met the goals and is summarized in “Accomplishments versus goals and objectives”.

  3. YB0 SERVICES INSTALLATION COMPLETED

    CERN Multimedia

    The beauty of the completed YB0 was briefly visible at P5 as preparations continue for Tracker installation. A tremendous effort, lasting 7 months and involving more than 100 workers on the busiest days, resulted in 5700 electrical cables, 780 optical cables with 65k fibre channels, and 550 pipes laid on YB0 for HB, EB and Tracker.

  4. Horn installed in CNGS tunnel

    CERN Multimedia

    Maximilien Brice

    2005-01-01

    The horn is installed for the CERN Neutrinos to Gran Sasso (CNGS) project. Protons collide with a graphite target producing charged particles that are focussed by the magnetic field in the horn. These particles will then pass into a decay tube where they decay into neutrinos, which travel towards a detector at Gran Sasso 732 km away in Italy.

  5. SUB-SLAB PROBE INSTALLATION

    Science.gov (United States)

    Sub-slab sampling has become an integral part of vapor intrusion investigations. It is now recommended in guidance documents developed by EPA and most states. A method for sub-slab probe installation was devised in 2002, presented at conferences through 2005, and finally docume...

  6. Temperature rise of installed FCC

    Science.gov (United States)

    Hankins, J. D.

    1976-01-01

    Report discusses temperature profiles of installed FCC for wood and tile surfaces. Three-conductor FCC was tested at twice nominal current-carrying capacity over bare floor and under carpet, with result indicating that temperature rise is not a linear function of current with FCC at this level.

  7. installation

    Directory of Open Access Journals (Sweden)

    Kaczmarczyk Michał

    2017-01-01

    Full Text Available The basic source of information for determining the temperature distribution in the rock mass and thus the potential for thermal energy contained in geothermal water conversion to electricity, are: temperature measurements in stable geothermic conditions, temperature measurements in unstable conditions, measurements of maximum temperatures at the bottom of the well. Incorrect temperature estimation can lead to errors during thermodynamic parameters calculation and consequently economic viability of the project. The analysis was performed for the geothermal water temperature range of 86–100°C, for dry working fluid R245fa. As a result of the calculations, the data indicate an increase in geothermal power as the geothermal water temperature increases. At 86°C, the potential power is 817.48 kW, increases to 912.20 kW at 88°C and consequently to 1 493.34 kW at 100°C. These results are not surprising, but show a scale of error in assessing the potential that can result improper interpretation of the rock mass and geothermal waters temperature.

  8. Engineering report for simulated riser installation

    Energy Technology Data Exchange (ETDEWEB)

    Brevick, C.H., Westinghouse Hanford

    1996-05-09

    The simulated riser installation field tests demonstrated that new access ports (risers) can be installed safely, quickly, and economically in the concrete domes of existing underground single- shell waste storage tanks by utilizing proven rotary drilling equipment and vacuum excavation techniques. The new riser installation will seal against water intrusion, provide as table riser anchored to the tank dome, and be installed in accordance with ALARA principles. The information contained in the report will apply to actual riser installation activity in the future.

  9. The dismantling of nuclear installations; Le demantelement des installations nucleaires

    Energy Technology Data Exchange (ETDEWEB)

    Lacoste, A.C.; Duthe, M.; Mignon, H. [Ministere de l`Industrie, des Postes et Telecommunications et du Commerce Exterieur, 75-Paris (France). Direction de la Surete des Installations Nucleaires; Charles, Th. [CEA Centre d`Etudes de Fontenay-aux-Roses, 92 (France). Inst. de Protection et de Surete Nucleaire; Michon, D. [Electricite de France (EDF), 75 - Paris (France); Lambert, F. [Unite de demantelement des installations nucleaires (UDIN), CEA (France); Pradel, Ph. [Compagnie Generale de Matieres Nucleaires (COGEMA), 30 - Bagnols-sur-Ceze (France). Etablissement de Marcoule; Vergne, C. [CODEM Groupement d`interet economique (France); Hillewaere, J.P.; Dupre la Tour, St. [DRIRE Nord-Pas-de-Calais (France); Mandil, C. [Ministere de l`Economie, des Finances et de l`Industrie (France); Weil, L.; Eickelpasch, N.; Finsterwalder, L. [Office Federal de radioprotection, (Germany)

    1997-10-01

    for nuclear installations, the dismantling is an important part of their exploitation. The technology of dismantling is existing and to get a benefit from the radioactive decay, it seems more easy for operating company such E.D.F. to wait for fifty years before dismantling. But in order to get the knowledge of this operation, the Safety Authority wanted to devote this issue of `Controle`to the dismantling method. This issue includes: the legal aspects, the risks assessment, the dismantling policy at E.D.F., the site of Brennilis (first French experience of dismantling), the dismantling techniques, the first dismantling of a fuel reprocessing plant, comparison with classical installations, economic aspect, some German experiences, the cleansing of the american site of Handford. (N.C.)

  10. Low head hydroelectric installation. Installation hydroelectrique de basse chute

    Energy Technology Data Exchange (ETDEWEB)

    Megnint, L.

    1987-08-04

    A low head hydroelectric installation, in particular for tidal power plant use, is intended to function at variable head heights which can descend to near-zero values. While the head height is lower than a determined value, inferior to at least half the nominal head, the turbomachinery is made to turn at a speed lower than the synchronizing speed and bringing its output near the middle of the output curve. A frequency converter is inserted between the electric generator and the power network, said converter being constructed for a power in any case inferior to at least half of the nominal power. The invention also concerns a process for obtaining at the outlet of a hydraulic turbine an optimal output under a defined, nominal head or output, corresponding to a nominal power of a low head hydroelectric installation and for a rotation speed corresponding to the speed of synchronization with the frequency of a power network.

  11. Mounting clips for panel installation

    Energy Technology Data Exchange (ETDEWEB)

    Cavieres, Andres; Al-Haddad, Tristan; Goodman, Joseph

    2017-07-11

    A photovoltaic panel mounting clip comprising a base, central indexing tabs, flanges, lateral indexing tabs, and vertical indexing tabs. The mounting clip removably attaches one or more panels to a beam or the like structure, both mechanically and electrically. It provides secure locking of the panels in all directions, while providing guidance in all directions for accurate installation of the panels to the beam or the like structure.

  12. Installation of LHC experimental areas

    CERN Document Server

    Butin, F; Lacarrère, D; Osborne, J; CERN. Geneva. TS Department

    2005-01-01

    Following handover by the civil engineering contractors, the new LHC experimental areas are being fitted-out with appropriate infrastructure and technical services. In parallel, and in order to make up for the short time available, the installation of the detectors has already started in the experimental caverns. In addition, the LHC machine installation now has a non-negligible impact on the experimental area activities. Four Experimental Area Teams have been set up in order to coordinate all this work, organize the logistic resources and ensure the proper safety of personnel and material. This paper will focus on the status of installation in all areas and define the technical challenges coming in the next months. Illustrations from the new areas at Point 1 and Point 5 will be presented and compared to those from existing areas at Point 2 and Point 8, custom built for and inherited from LEP. The successes and difficulties encountered so far will be reviewed and the conclusions that have been drawn from this...

  13. The Epi Info Viral Hemorrhagic Fever (VHF) Application: A Resource for Outbreak Data Management and Contact Tracing in the 2014-2016 West Africa Ebola Epidemic.

    Science.gov (United States)

    Schafer, Ilana J; Knudsen, Erik; McNamara, Lucy A; Agnihotri, Sachin; Rollin, Pierre E; Islam, Asad

    2016-10-15

    The Epi Info Viral Hemorrhagic Fever application (Epi Info VHF) was developed in response to challenges managing outbreak data during four 2012 filovirus outbreaks. Development goals included combining case and contact data in a relational database, facilitating data-driven contact tracing, and improving outbreak data consistency and use. The application was first deployed in Guinea, when the West Africa Ebola epidemic was detected, in March 2014, and has been used in 7 African countries and 2 US states. Epi Info VHF enabled reporting of compatible data from multiple countries, contributing to international Ebola knowledge. However, challenges were encountered in accommodating the epidemic's unexpectedly large magnitude, addressing country-specific needs within 1 software product, and using the application in settings with limited Internet access and information technology support. Use of Epi Info VHF in the West Africa Ebola epidemic highlighted the fundamental importance of good data management for effective outbreak response, regardless of the software used. Published by Oxford University Press for the Infectious Diseases Society of America 2016. This work is written by (a) US Government employee(s) and is in the public domain in the US.

  14. Performance evaluation of buried pipe installation.

    Science.gov (United States)

    2010-05-01

    The purpose of this study is to determine the effects of geometric and mechanical parameters characterizing the soil structure interaction developed in a buried pipe installation located under roads/highways. The drainage pipes or culverts installed ...

  15. Multifunctional Heat Pump Installation for Dairy Plants

    Directory of Open Access Journals (Sweden)

    Sit M.L.

    2015-08-01

    Full Text Available The article presents the installation based on the approach using the integration of the carbon dioxide heat pump in pasteurization and cooling installation for milk and in installations for preparing of hot and "icy" water. The scheme differs from the prototype by the use of additional heat exchangers and of their connection to the main elements of the installation. A proposed technique of elements connection in the heat pump installation permits to compensate the effect of temperature of cold water supply source, which is low-grade heat source for the heat pump, on the quality the work of the installation. The design of the installation enables to compensate the impact of seasonal variation of water temperature. The installation ensures the COP = 5.3.

  16. Automated solar collector installation design

    Science.gov (United States)

    Wayne, Gary; Frumkin, Alexander; Zaydman, Michael; Lehman, Scott; Brenner, Jules

    2014-08-26

    Embodiments may include systems and methods to create and edit a representation of a worksite, to create various data objects, to classify such objects as various types of pre-defined "features" with attendant properties and layout constraints. As part of or in addition to classification, an embodiment may include systems and methods to create, associate, and edit intrinsic and extrinsic properties to these objects. A design engine may apply of design rules to the features described above to generate one or more solar collectors installation design alternatives, including generation of on-screen and/or paper representations of the physical layout or arrangement of the one or more design alternatives.

  17. Helium transfer line installation details.

    CERN Multimedia

    G. Perinic

    2007-01-01

    A particularity of the 32 m long four in one helium transfer line in between the cold box in USC55 and the cavern UX5 is the fact that the transfer line passes through a hole in the crane rail support beam. In order to ensure the alignment of the suspension rail in the interconnecting tunnel with the hole in the rail support as well as the connection points at both ends required precise measurements of the given geometries as well as the installation of a temporary target for the verification of the theoretical predictions.

  18. Statistical characteristics of low-latitude ionospheric field-aligned irregularities obtained with the Piura VHF radar

    Directory of Open Access Journals (Sweden)

    J. L. Chau

    2002-08-01

    Full Text Available We present a summary of the statistical characteristics of echoes from ionospheric (E- and F-region field-aligned irregularities obtained with the Piura VHF radar. This radar is located at ~ 7.0° dip latitude, just outside the equatorial electrojet (EEJ region. Our results are based on (1 intermittent observations made between 1991 and 1999 just few days a year, and (2 continuous observations made between January 2000 and June 2001. During most of the intermittent observations, simultaneous measurements of EEJ and equatorial spread F (ESF irregularities were performed with the Jicamarca VHF radar. From the continuous measurements, we have obtained the diurnal and seasonal characteristics of a variety of parameters (percentage of occurrence, signal-to-noise ratio and/or Doppler velocities from the lower and upper E-region irregularities and also from F-region irregularities over Piura. For example, we have found that (1 the E-region echoes are stronger and occur more frequently during local summer (i.e. between December and March; (2 between May and June, the E-region echoes are weaker and occur less frequently; moreover, during these months, a semidiurnal wave with large amplitudes is observed in the meridional wind (> 100 ms- 1; (3 there is vertical wavelength of about 20 km in the Doppler velocity, particularly after midnight; (4 the lower (upper E-region Doppler velocities are influenced mainly by meridional winds (equatorial F-region vertical drifts. In addition, we have observed that the seasonal and daily occurrences of Piura F-region irregularities are similar to the occurrence of topside ESF irregularities over Jicamarca. The likelihood of occurrence of F-region irregularities over Piura and, therefore, topside ESF over Jicamarca is greater when there are no E-region irregularities over Piura. On the other hand, there is more probability of observing bottomtype/bottomside ESF irregularities over Jicamarca when E-region irregularities

  19. PMSE observations with the EISCAT VHF- and UHF-radars: Ice particles and their effect on ambient electron densities

    Science.gov (United States)

    Li, Qiang; Rapp, Markus

    2013-11-01

    It is now well understood that the occurrence of PMSE is closely connected to the presence of ice particles. These ice particles modify the ambient electron density by electron attachment which occasionally leads to large electron density depletions which have also been called ‘biteouts’. There has been some debate in the literature regarding the relative depth of such depletions which is usually expressed by the parameter Λ=|ZA|NA/ne. Here, |ZA|NA is the charge number density of ice particles and ne is the electron density. In this paper, we present, for the first time, the statistical distribution of Λ using measurements with the EISCAT VHF- and UHF-radars. Based on 25 h of simultaneous observations, we derived a total of 757 Λ values based on 15 min of data each. In each of these cases, PMSE were observed with the EISCAT VHF-radar but not with the UHF-radar and the UHF-measurement were hence used to determine the electron density profile. From these 757 cases, there are 699 cases with Λ⪡1, and only 33 cases with Λ>0.5 (21 cases with Λ>1). A correlation analysis of Λ versus PMSE volume reflectivities further reveals that there is no strong dependence between the two parameters. This is in accordance with current PMSE-theory based on turbulence in combination with a large Schmidt-number. The maxima of Λ from each profile show a negative relationship with the undisturbed electron densities deduced at the same altitudes. This reveals that the variability of Λ mainly depends on the variability of the electron densities. In addition, variations of aerosol number densities may also play a role. Although part of the observations were conducted during the HF heating experiments, the so-called overshoot effects did not significantly bias our statistical results. In order to avoid missing biteouts because of a superposition of coherent and incoherent scatter in the UHF-data, we finally calculated spectral parameters n by applying a simple fit to auto

  20. VHF SoOp (Signal of Opportunity) Technology Demonstration for Soil Moisture Measurement Using Microwave Hydraulic Boom Truck Platform

    Science.gov (United States)

    Joseph, Alicia; Deshpande, Manohar; O'Neill, Peggy; Miles, Lynn

    2017-04-01

    A goal of this research is to test deployable VHF antennas for 6U Cubesat platforms to enable validation of root zone soil moisture (RZSM) estimation algorithms for signal of opportunity (SoOp) remote sensing over the 240-270 MHz frequency band. The proposed work provides a strong foundation for establishing a technology development path for maturing a global direct surface soil moisture (SM) and RZSM measurement system over a variety of land covers. Knowledge of RZSM up to a depth of 1 meter and surface SM up to a depth of 0.05 meter on a global scale, at a spatial resolution of 1-10 km through moderate-to-heavy vegetation, is critical to understanding global water resources and the vertical moisture gradient in the Earth's surface layer which controls moisture interactions between the soil, vegetation, and atmosphere. Current observations of surface SM from space by L-band radiometers (1.4 GHz) and radars (1.26 GHz) are limited to measurements of surface SM up to a depth of 0.05 meter through moderate amounts of vegetation. This limitation is mainly due to the inability of L-band signals to penetrate through dense vegetation and deep into the soil column. Satellite observations of the surface moisture conditions are coupled to sophisticated models which extrapolate the surface SM into the root zone, thus providing an indirect estimate rather than a direct measurement of RZSM. To overcome this limitation, low-frequency airborne radars operating at 435 MHz and 118 MHz have been investigated, since these lower frequencies should penetrate denser vegetation and respond to conditions deeper in the soil. This presentation describes a new and less expensive technique for SM as well as RZSM direct measurement using Signal of Opportunity transmitters. Being less expensive and needing only passive simple RF receiver, the SoOp concept has the potential for being used for space borne applications, thus providing global SM and RZSM measurements. This study will describe

  1. Sprinkler System Installer. Occupational Analyses Series.

    Science.gov (United States)

    Chinien, Chris; Boutin, France

    This analysis covers tasks performed by a sprinkler system installer, an occupational title some provinces and territories of Canada have also identified as pipefitter--fire protection mechanic specialty; sprinkler and fire protection installer; sprinkler and fire protection systems installer; and sprinkler fitter. A guide to analysis discusses…

  2. Comparison of wind measurements in the troposphere and mesosphere by VHF/MF radars and in-situ techniques

    Directory of Open Access Journals (Sweden)

    N. Engler

    2008-11-01

    Full Text Available Radar wind observations at frequencies between 1.98 and 53.5 MHz obtained at polar latitudes were compared to in-situ wind measurements by radiosondes at tropospheric altitudes and to winds from falling spheres at mesospheric altitudes. Comparisons are shown for several campaigns of radiosonde and falling sphere observations. The radar wind directions agree well to the radiosonde and falling sphere observations and are highly correlated. The winds estimated from radar measurements are less than the radiosonde data by about 15% for spaced antenna observations and by about 10% for the Doppler beam swinging experiment. At mesospheric altitudes the spaced antenna winds obtained from the wide-beam Andenes MF radar are underestimated in the order of 35% and winds from the narrow-beam Saura MF radar are underestimated by about 20% compared to falling sphere winds at altitudes between 70 and 80 km. Furthermore, the relation between wind measurements using narrow-beam and wide-beam antenna arrangements for the MF radars is discussed and VHF radar observations are compared to the wide-beam MF radar.

  3. Comparison of wind measurements in the troposphere and mesosphere by VHF/MF radars and in-situ techniques

    Science.gov (United States)

    Engler, N.; Singer, W.; Latteck, R.; Strelnikov, B.

    2008-11-01

    Radar wind observations at frequencies between 1.98 and 53.5 MHz obtained at polar latitudes were compared to in-situ wind measurements by radiosondes at tropospheric altitudes and to winds from falling spheres at mesospheric altitudes. Comparisons are shown for several campaigns of radiosonde and falling sphere observations. The radar wind directions agree well to the radiosonde and falling sphere observations and are highly correlated. The winds estimated from radar measurements are less than the radiosonde data by about 15% for spaced antenna observations and by about 10% for the Doppler beam swinging experiment. At mesospheric altitudes the spaced antenna winds obtained from the wide-beam Andenes MF radar are underestimated in the order of 35% and winds from the narrow-beam Saura MF radar are underestimated by about 20% compared to falling sphere winds at altitudes between 70 and 80 km. Furthermore, the relation between wind measurements using narrow-beam and wide-beam antenna arrangements for the MF radars is discussed and VHF radar observations are compared to the wide-beam MF radar.

  4. Observation of polar mesosphere summer echoes with calibrated VHF radars at 69° in the Northern and Southern hemispheres

    Science.gov (United States)

    Latteck, R.; Singer, W.; Morris, R. J.; Holdsworth, D. A.; Murphy, D. J.

    2007-07-01

    Polar Mesosphere Summer Echoes (PMSE) observed in the northern and southern hemisphere were studied using continuous measurements obtained by calibrated VHF radars located at Andenes (69.3°N) and Davis (68.6°S) during the boreal summer 2004 and the austral summer 2004/2005. The PMSE observed at Davis have a lower peak volume reflectivity of approximately 4 . 10-11 m-1 compared with their counterparts (7 . 10-10 m-1) observed at Andenes. The duration of the PMSE season is correlated with the dynamical and thermal state of the mesopause region supported by recent studies using meridional winds and temperatures. PMSE occurred less frequently but with greater variability above Davis. The diurnal variation of PMSE occurrence has a maximum around 11-16 LT in both hemispheres, and a minimum occurs during late evening with a longer duration in the southern hemisphere. The mean PMSE season at both sites started around 34 days before solstice, but the duration of the Davis PMSE season is about 9 days shorter than at Andenes. The maximum occurrence height of PMSE at Davis is 86 km which is about 1 km higher than at Andenes.

  5. Comparison of wind measurements in the troposphere and mesosphere by VHF/MF radars and in-situ techniques

    Energy Technology Data Exchange (ETDEWEB)

    Engler, N.; Singer, W.; Latteck, R.; Strelnikov, B. [Rostock Univ., Kuehlungsborn (Germany). Leibniz Inst. of Atmospheric Physics

    2008-07-01

    Radar wind observations at frequencies between 1.98 and 53.5 MHz obtained at polar latitudes were compared to in-situ wind measurements by radiosondes at tropospheric altitudes and to winds from falling spheres at mesospheric altitudes. Comparisons are shown for several campaigns of radiosonde and falling sphere observations. The radar wind directions agree well to the radiosonde and falling sphere observations and are highly correlated. The winds estimated from radar measurements are less than the radiosonde data by about 15% for spaced antenna observations and by about 10% for the Doppler beam swinging experiment. At mesospheric altitudes the spaced antenna winds obtained from the wide-beam Andenes MF radar are underestimated in the order of 35% and winds from the narrow-beam Saura MF radar are underestimated by about 20% compared to falling sphere winds at altitudes between 70 and 80 km. Furthermore, the relation between wind measurements using narrow-beam and wide-beam antenna arrangements for the MF radars is discussed and VHF radar observations are compared to the wide-beam MF radar. (orig.)

  6. Calculating the azimuth of mountain waves, using the effect of tilted fine-scale stable layers on VHF radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    1999-02-01

    Full Text Available A simple method is described, based on standard VHF wind-profiler data, where imbalances of echo power between four off-vertical radar beams, caused by mountain waves, can be used to calculate the orientation of the wave pattern. It is shown that the mountain wave azimuth (direction of the horizontal component of the wavevector, is given by the vector [ W (PE - P W ,W (PN - P S ]; PN, PS, PE, PW are radar echo powers, measured in dB, in beams pointed away from vertical by the same angle towards north, south, east and west respectively, and W is the vertical wind velocity. The method is applied to Aberystwyth MST radar data, and the calculated wave vector usually, but not always, points into the low-level wind direction. The mean vertical wind at Aberystwyth, which may also be affected by tilted aspect-sensitive layers, is investigated briefly using the entire radar output 1990-1997. The mean vertical-wind profile is inconsistent with existing theories, but a new mountain-wave interpretation is proposed.Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; waves and tides; instruments and techniques.

  7. Effect of power on growth of nanocrystalline silicon films deposited by VHF PECVD technique for solar cell applications

    Science.gov (United States)

    Juneja, Sucheta; Verma, Payal; Savelyev, Dmitry A.; Khonina, Svetlana N.; Sudhakar, S.; Kumar, Sushil

    2016-04-01

    An investigation of the effect of power on the deposition of nanocrystalline silicon thin films were carried out using a gaseous mixture of silane and hydrogen in the 60MHz assisted VHF plasma enhanced chemical vapor deposition (PECVD) technique. The power was varied from 10 to 50 watt maintaining all other parameters constant. Corresponding layer properties w.r.t. material microstructure, optical, hydrogen content and electrical transport are studied in detail. The structural properties have been studied by Raman spectroscopy and x-ray diffraction (XRD). The presence of nano-sized crystals and their morphology have been investigated using atomic force microscopy (AFM). The role of bonded hydrogen content in the films have been studied from the results of Fourier transform infrared spectroscopy. It was observed from the results that with increase in power, crystalline volume fraction increases and crystallite size changes from 4 to 9 nm. The optical band gap varies from 1.7 to 2.1eV due to quantum confinement effect and which further can be explained with reduced hydrogen content. These striking features of nc-Si films can be used to fabricate stable thin film solar cells.

  8. Case study of stratospheric gravity waves of convective origin over Arctic Scandinavia. VHF radar observations and numerical modelling

    Energy Technology Data Exchange (ETDEWEB)

    Rechou, A. [La Reunion Univ., St. Denis Messag, Ile de La Reunion (France). Lab. de l' Atmosphere et des Cyclones; Arnault, J.; Dalin, P.; Kirkwood, S. [Swedish Institute of Space Physics, Kiruna (Sweden)

    2013-03-01

    Orography is a well-known source of gravity and inertia-gravity waves in the atmosphere. Other sources, such as convection, are also known to be potentially important but the large amplitude of orographic waves over Scandinavia has generally precluded the possibility to study such other sources experimentally in this region. In order to better understand the origin of stratospheric gravity waves observed by the VHF radar ESRAD (Esrange MST radar) over Kiruna, in Arctic Sweden (67.88 N, 21.10 E), observations have been compared to simulations made using the Weather Research and Forecasting model (WRF) with and without the effects of orography and clouds. This case study concerns gravity waves observed from 00:00 UTC on 18 February to 12:00 UTC on 20 February 2007. We focus on the wave signatures in the static stability field and vertical wind deduced from the simulations and from the observations as these are the parameters which are provided by the observations with the best height coverage. As is common at this site, orographic gravity waves were produced over the Scandinavian mountains and observed by the radar. However, at the same time, southward propagation of fronts in the Barents Sea created short-period waves which propagated into the stratosphere and were transported, embedded in the cyclonic winds, over the radar site. (orig.)

  9. Development of a Coherent Bistatic Vegetation Model for Signal of Opportunity Applications at VHF UHF-Bands

    Science.gov (United States)

    Kurum, Mehmet; Deshpande, Manohar; Joseph, Alicia T.; O'Neill, Peggy E.; Lang, Roger H.; Eroglu, Orhan

    2017-01-01

    A coherent bistatic vegetation scattering model, based on a Monte Carlo simulation, is being developed to simulate polarimetric bi-static reflectometry at VHF/UHF-bands (240-270 MHz). The model is aimed to assess the value of geostationary satellite signals of opportunity to enable estimation of the Earth's biomass and root-zone soil moisture. An expression for bistatic scattering from a vegetation canopy is derived for the practical case of a ground-based/low altitude platforms with passive receivers overlooking vegetation. Using analytical wave theory in conjunction with distorted Born approximation (DBA), the transmit and receive antennas effects (i.e., polarization, orientation, height, etc.) are explicitly accounted for. Both the coherency nature of the model (joint phase and amplitude information) and the explicit account of system parameters (antenna, altitude, polarization, etc) enable one to perform various beamforming techniques to evaluate realistic deployment configurations. In this paper, several test scenarios will be presented and the results will be evaluated for feasibility for future biomass and root-zone soil moisture application using geostationary communication satellite signals of opportunity at low frequencies.

  10. Device for installing rocket engines

    Science.gov (United States)

    George, T. R., Jr. (Inventor)

    1976-01-01

    A device for installing rocket engines is reported that is supported at a cant relative to vertical by an axially extensible, tiltable pedestal. A lifting platform supports the rocket engine at its thrust chamber exit, including a mount having a concentric base characterized by a concave bearing surface, a plurality of uniformly spaced legs extended radially from the base, and an annular receiver coaxially aligned with the base and affixed to the distal ends of said legs for receiving the thrust chamber exit. The lifting platform rests on a seat concentrically related to the pedestal and affixed to an extended end portion thereof having a convex bearing surface mated in sliding engagement with the concave bearing surface of the annular base for accommodating a rocking motion of the platform.

  11. Comparative environmental assessment of unconventional power installations

    Science.gov (United States)

    Sosnina, E. N.; Masleeva, O. V.; Kryukov, E. V.

    2015-08-01

    Procedure of the strategic environmental assessment of the power installations operating on the basis of renewable energy sources (RES) was developed and described. This procedure takes into account not only the operational process of the power installation but also the whole life cycles: from the production and distribution of power resources for manufacturing of the power installations to the process of their recovery. Such an approach gives an opportunity to make a more comprehensive assessment of the influence of the power installations on environments and may be used during adaptation of the current regulations and development of new regulations for application of different types of unconventional power installations with due account of the ecological factor. Application of the procedure of the integrated environmental assessment in the context of mini-HPP (Hydro Power Plant); wind, solar, and biogas power installations; and traditional power installation operating natural gas was considered. Comparison of environmental influence revealed advantages of new energy technologies compared to traditional ones. It is shown that solar energy installations hardly pollute the environment during operation, but the negative influence of the mining operations and manufacturing and utilization of the materials used for solar modules is maximum. Biogas power installations are on the second place as concerns the impact on the environment due to the considerable mass of the biogas installation and gas reciprocating engine. The minimum impact on the environment is exerted by the mini-HPP. Consumption of material and energy resources for the production of the traditional power installation is less compared to power installations on RES; however, this factor incomparably increases when taking into account the fuel extraction and transfer. The greatest impact on the environment is exerted by the operational process of the traditional power installations.

  12. Anticipating Climate Change Impacts on Army Installations

    Science.gov (United States)

    2011-10-01

    ER D C SR -1 1- 1 Anticipating Climate Change Impacts on Army Installations Co ns tr uc tio n En gi ne er in g R es ea rc h La bo...distribution is unlimited. ERDC SR-11-1 October 2011 Anticipating Climate Change Impacts on Army Installations Robert C. Lozar, Matthew D...Abstract Military installations must be maintained and managed to provide appropriate training and testing opportunities. As climate changes

  13. Modern electrical installation for craft students

    CERN Document Server

    Scaddan, Brian

    2013-01-01

    Modern Electrical Installation for Craft Students, Volume 2, Third Edition discusses several topics concerning electrical installations. The book is comprised of eight chapters that deal with craft theory, associated subjects, and electrical industries. Chapter 1 covers inductors and inductance, while Chapter 2 tackles capacitors and capacitance. Chapter 3 deals with inductance and capacitance in installation work. The book also discusses cells, batteries, and transformers. The electrical industries, control and earthing, and testing are also dealt with. The last chapter discusses the basic el

  14. Automated identification of installed malicious Android applications

    National Research Council Canada - National Science Library

    Guido, Mark; Ondricek, Jared; Grover, Justin; Wilburn, David; Nguyen, Thanh; Hunt, Andrew

    2013-01-01

    Increasingly, Android smartphones are becoming more pervasive within the government and industry, despite the limited ways to detect malicious applications installed to these phones' operating systems...

  15. ALARA in European nuclear installations

    Energy Technology Data Exchange (ETDEWEB)

    Lefaure, C. [CEPN, Fontenay-Aux-Roses (France); Croft, J. [NRPB, Chilton, Didcot (United Kingdom); Pfeffer, W. [GRS, Koeln (Germany); Zeevaert, T. [SCK/CEN, Mol (Belgium)

    1995-03-01

    For over a decade the Commission of the European Community has sponsored research projects on the development and practical implementation of the Optimization principle, or as it is often referred to, ALARA. These projects have given rise to a series of successful international Optimization training courses and have provided a significant input to the periodic European Seminars on Optimization, the last one of which took place in April 1993. This paper reviews the approaches to Optimization that have development within Europe and describes the areas of work in the current project. The on-going CEC research project addresses the problem of ALARA and internal exposures, and tries to define procedures for ALARA implementation, taking account of the perception of the hazard as well as the levels of probability of exposure. The relationships between ALARA and work management, and ALARA and decommissioning of installations appear to be other fruitful research areas. Finally, this paper introduces some software for using ALARA decision aiding techniques and databases containing feed back experience developed in Europe.

  16. ID Barrel installed in cryostat

    CERN Multimedia

    Apsimon, R.; Romaniouk, A.

    Wednesday 23rd August was a memorable day for the Inner Detector community as they witnessed the transport and installation of the central part of the inner detector (ID-barrel) into the ATLAS detector. Many members of the collaboration gathered to witness this moment at Point 1. After years of design, construction and commissioning, the outer two detectors (TRT and SCT) of the ID barrel were moved from the SR1 cleanroom to the ATLAS cavern. The barrel was moved across the car park from building 2175 to SX1. Although only a journey of about 100 metres, this required weeks of planning and some degree of luck as far as the weather was concerned. Accelerometers were fitted to the barrel to provide real-time monitoring and no values greater than 0.1 g were recorded, fully satisfying the transport specification for this extremely precise and fragile detector. Muriel, despite her fear of heights, bravely volunteered to keep a close eye on the detector. Swapping cranes to cross the entire parking lot, while Mur...

  17. VHF radar observation of atmospheric winds, associated shears and C2n at a tropical location: interdependence and seasonal pattern

    Directory of Open Access Journals (Sweden)

    A. R. Jain

    Full Text Available The turbulence refractivity structure constant (C2n is an important parameter of the atmosphere. VHF radars have been used extensively for the measurements of C2n. Presently, most of such observations are from mid and high latitudes and only very limited observations are available for equatorial and tropical latitudes. Indian MST radar is an excellent tool for making high-resolution measurements of atmospheric winds, associated shears and turbulence refractivity structure constant (C2n. This radar is located at Gadanki (13.45° N, 79.18° E, a tropical station in India. The objective of this paper is to bring out the height structure of C2n for different seasons using the long series of data (September 1995 – August 1999 from Indian MST radar. An attempt is also made to understand such changes in the height structure of C2n in relation to background atmospheric parameters such as horizontal winds and associated shears. The height structure of C2n, during the summer monsoon and post-monsoon season, shows specific height features that are found to be related to Tropical Easterly Jet (TEJ winds. It is important to examine the nature of the radar back-scatterers and also to understand the causative mechanism of such scatterers. Aspect sensitivity of the received radar echo is examined for this purpose. It is observed that radar back-scatterers at the upper tropospheric and lower stratospheric heights are more anisotropic, with horizontal correlation length of 10–20 m, as compared to those observed at lower and middle tropospheric heights.Key words. Meteorology and atmospheric dynamics (climatology; tropical meteorology; turbulence

  18. VHF SoOp (Signal of Opportunity) Technology Demonstration for Soil Moisture Measurement Using Microwave Hydraulic Boom Truck Platform

    Science.gov (United States)

    Joseph, A. T.; Deshpande, M.; O'Neill, P. E.; Miles, L.

    2017-01-01

    A goal of this research is to test deployable VHF antennas for 6U Cubesat platforms to enable validation of root zone soil moisture (RZSM) estimation algorithms for signal of opportunity (SoOp) remote sensing over the 240-270 MHz frequency band. The proposed work provides a strong foundation for establishing a technology development path for maturing a global direct surface soil moisture (SM) and RZSM measurement system over a variety of land covers. Knowledge of RZSM up to a depth of 1 meter and surface SM up to a depth of 0.05 meter on a global scale, at a spatial resolution of 1-10 km through moderate-to-heavy vegetation, is critical to understanding global water resources and the vertical moisture gradient in the Earths surface layer which controls moisture interactions between the soil, vegetation, and atmosphere. Current observations of surface SM from space by L-band radiometers (1.4 GHz) and radars (1.26 GHz) are limited to measurements of surface SM up to a depth of 0.05 meter through moderate amounts of vegetation. This limitation is mainly due to the inability of L-band signals to penetrate through dense vegetation and deep into the soil column. Satellite observations of the surface moisture conditions are coupled to sophisticated models which extrapolate the surface SM into the root zone, thus providing an indirect estimate rather than a direct measurement of RZSM. To overcome this limitation, low-frequency airborne radars operating at 435 MHz and 118 MHz have been investigated, since these lower frequencies should penetrate denser vegetation and respond to conditions deeper in the soil.

  19. Spatial variability of the aspect sensitivity of VHF radar echoes in the troposphere and lower stratosphere during jet stream passages

    Directory of Open Access Journals (Sweden)

    J. G. Yoe

    Full Text Available The aspect sensitivity of SOUSY-VHF-radar oblique-beam echoes from the troposphere and lower stratosphere has been examined for a number of jet stream passages during the years 1990 - 1992. When the core of the jet is overhead or nearly so, vertical profiles of the aspect sensitivity display two notable features. First, the distinction between mainly isotropic and strongly aspect-sensitive echoes in the troposphere and the lower stratosphere, respectively, often reported for measurements made during calm conditions, does not necessarily prevail in the vicinity of the jet stream. Second, echoes obtained at altitudes near the height of the horizontal wind maximum are found to be more aspect sensitive for beams directed parallel to the horizontal flow or nearly so, than for other beam directions. It is demonstrated that time-averaged horizontal wind speeds estimated from the radar data, taking into account the reduced effective oblique-beam zenith angle resulting from aspect sensitivity, may exceed uncorrected wind speeds by as much as 10 m s-1 in these circumstances. Implications for wind profiling and for describing the backscattering process are discussed. Doppler spectral widths examined for one jet stream passage are found to be narrower in a beam aligned with the horizontal wind at heights near the wind speed maximum than corresponding widths measured in a beam projected at right angles to the jet. The narrowest spectra thus coincide with the most aspect-sensitive echoes, consistent with the hypothesis that such returns result from specular backscattering processes.

  20. Calculating the azimuth of mountain waves, using the effect of tilted fine-scale stable layers on VHF radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    Full Text Available A simple method is described, based on standard VHF wind-profiler data, where imbalances of echo power between four off-vertical radar beams, caused by mountain waves, can be used to calculate the orientation of the wave pattern. It is shown that the mountain wave azimuth (direction of the horizontal component of the wavevector, is given by the vector [ W (PE - P W ,W (PN - P S ]; PN, PS, PE, PW are radar echo powers, measured in dB, in beams pointed away from vertical by the same angle towards north, south, east and west respectively, and W is the vertical wind velocity. The method is applied to Aberystwyth MST radar data, and the calculated wave vector usually, but not always, points into the low-level wind direction. The mean vertical wind at Aberystwyth, which may also be affected by tilted aspect-sensitive layers, is investigated briefly using the entire radar output 1990-1997. The mean vertical-wind profile is inconsistent with existing theories, but a new mountain-wave interpretation is proposed.

    Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; waves and tides; instruments and techniques.

  1. Benchmarking the Performance of Solar Installers and Rooftop Photovoltaic Installations in California

    National Research Council Canada - National Science Library

    Dadi Wang

    2017-01-01

    Rooftop photovoltaic (PV) systems are rapidly proliferating around the world. Whether the PV systems have been efficiently installed is an issue of utmost importance for both solar installers and policymakers...

  2. ATLAS semiconductor tracker installed into its barrel

    CERN Multimedia

    Maximilien Brice

    2005-01-01

    The ATLAS silicon tracker is installed in the silicon tracker barrel. Absolute precision was required in this operation to ensure that the tracker was inserted without damage through minimal clearance. The installation was performed in a clean room on the CERN site so that no impurities in the air would contaminate the tracker's systems.

  3. A Hadron Radiation Installation and Verification Method

    NARCIS (Netherlands)

    Beekman, F.J.; Bom, V.R.

    2013-01-01

    A hadron radiation installation adapted to subject a target to irradiation by a hadron radiation beam, said installation comprising: - a target support configured to support, preferably immobilize, a target: - a hadron radiation apparatus adapted to emit a hadron radiation beam along a beam axis to

  4. Installation Service - Changes in opening hours

    CERN Multimedia

    GS Department

    2010-01-01

    For organizational matters, please note that, as from 15 March 2010, the Installation Service will have wen opening hours. The new schedule will be from 14:00 to 17:00 (Monday to Friday). Contact persons are: Martine Briant, Karine Robert and Claudia Bruggmann. The office address remains 73-3-014. Installation Service

  5. Installed water resource modelling systems for catchment ...

    African Journals Online (AJOL)

    Following international trends there are a growing number of modelling systems being installed for integrated water resource management, in Southern Africa. Such systems are likely to be installed for operational use in ongoing learning, research, strategic planning and consensus-building amongst stakeholders in the ...

  6. Buckling of Bucket Foundations During Installation

    DEFF Research Database (Denmark)

    Madsen, Søren

    There is a great politically will to expand the green energy market in these times. A proven green technology is wind turbines. Wind turbines have been installed in great numbers on land over the last decades. However, the current development in wind turbine design leads to larger turbine sizes...... in order to reduce the cost of energy. This limits the on land application due to transportation limitations and unwillingness from prospect neighbours. Thus, offshore wind energy started developing over the last couple of years. Although installing the wind turbines offshore resolves the before men tioned...... issues, it brings up the cost of energy mainly due to increased installation and maintenance costs. A very large part—up to 30–50% using current technology—of the installation cost origins from the expenses related to the installation of foundations. A new foundation concept—the bucket foundation...

  7. Observations of mesosphere summer echoes with calibrated VHF radars at latitudes between 54°N and 69°N in summer 2004

    Science.gov (United States)

    Latteck, R.; Singer, W.; Kirkwood, S.; Jönsson, L. O.; Eriksson, Håkan

    2005-08-01

    Mesosphere Summer Echoes (MSE) have been observed with 50-MHz VHF radars at middle (MSE) and polar latitudes (PMSE) for more than 20 years. The occurrence and seasonal variation of these radar echoes as well as their dependence on solar and geomagnetic activity are mostly studied basing on relative signal strength measurements (signal-to-noise ratios). The latitudinal dependence of the appearance and intensity of mesospheric summer echoes is still an open question as the widely used relative signal strength observations are determined by the atmospheric properties as well as by the individual radar characteristics. The use of absolutely calibrated echo powers allows a system in-depended comparison of mesospheric summer echoes observed at different sites by different systems. We present two different radar calibration methods. One applies a noise source to calibrate the receive path of the radar only, a second uses the radar signal itself to calibrate the complete transmitting and receiving path of the radar system. Both techniques and the same calibration hardware have been applied to the ALWIN VHF radar at Andenes/Norway (69°N), the ESRAD radar at Kiruna/Sweden (68deg;N) and OSWIN radar at Kühlungsborn/Germany (54°N). The sensitivity of the different radar systems and the seasonal and diurnal variation of the occurrence of mesospheric summer echoes at different locations are discussed on the basis of radar backscatter cross-sections.

  8. SISTEMA WEB DE GEOLOCALIZACIÓN Y MONITOREO DE LA TORTUGA PODOCNEMIS LEWYANA EN EL RÍO SINÚ, MEDIANTE EL USO DE ANTENAS VHF Y DISPOSITIVOS GPS

    Directory of Open Access Journals (Sweden)

    Mario Macea Anaya

    2016-03-01

    Full Text Available Este trabajo tiene como finalidad el diseño e implementación de una aplicación para el monitoreo de las Tortugas de Río Podocnemis Lewyana, utilizando las tecnologías GPS (Global Positioning System y VHF (Very High Frequency. La aplicación permite apoyar los procesos de conservación y recuperación de la especie en el Departamento de Córdoba, en las poblaciones de Caño Viejo y Cotocá Arriba del municipio Santa Cruz de Lorica, Colombia. El uso de esa herramienta está dirigido a biólogos y personas de las comunidades rurales dedicadas a conservar dicha especie. En el desarrollo del proyecto se utilizaron 18 Tortugas de Río para su monitoreo. El resultado del trabajo es la aplicación Web Podocnemis-Soft. Su funcionamiento se basa en un dispositivo GPS y VHF, ubicado en una o varias de las tortugas Podocnemis Lewyana; los dispositivos envían los datos de la ubicación de la tortuga hasta un servidor para su procesamiento y posterior visualización de la información.

  9. Relationship between propagation direction of gravity waves in OH and OI airglow images and VHF radar echo occurrence during the SEEK-2 campaign

    Directory of Open Access Journals (Sweden)

    F. Onoma

    2005-10-01

    Full Text Available We report simultaneous observations of atmospheric gravity waves (AGW in OI (557.7nm and OH airglow images and VHF radar backscatter from field-aligned irregularities (FAI in the E-region during the SEEK-2 (Sporadic-E Experiment over Kyushu 2 campaign period from 29 July to 9 August 2002. An all-sky imager was operated at Nishino-Omote (30.5 N, 130.1 E, Japan. On 14 nights, 17 AGW events were detected in OI and OH airglow images. AGW propagated mostly toward the northeast or southeast. From comparison with the E-region FAI occurrence, which is detected by a nearby VHF radar (31.57MHz, we found that AGW tended to propagate southeastward during FAI events. This result suggests that the interaction between AGW and E-region plasma plays an important role in generating FAI. Furthermore, polarization electric fields generated directly by AGW may contribute to the FAI generation.

    Keywords. Atmospheric composition and structure (Airglow and aurora, Ionosphere (Ionospheric irregularities, Mid-latitude ionosphere

  10. Offshore Cable Installation - Lillgrund. Lillgrund Pilot Project

    Energy Technology Data Exchange (ETDEWEB)

    Unosson, Oscar (Vattenfall Vindkraft AB, Stockholm (Sweden))

    2009-01-15

    This report describes the installation method and the experiences gained during the installation of the submarine cables for the offshore wind farm at Lillgrund. The wind farm consists of 48 wind turbines and is expected to produce 0.33 TWh annually. Different aspects of the installation, such as techniques, co-operation between the installation teams, weather conditions and regulatory and environmental issues are described in this report. In addition, recommendations and guidelines are provided, which hopefully can be utilised in future offshore wind projects. The trenches, in which the submarine cables were laid, were excavated weeks before the cable laying. This installation technique proved to be successful for the laying of the inter array cables. The export cable, however, was laid into position with difficulty. The main reason why the laying of the export cable proved more challenging was due to practical difficulties connected with the barge entrusted with the cable laying, Nautilus Maxi. The barge ran aground a number of times and it had difficulties with the thrusters, which made it impossible to manoeuvre. When laying the inter array cables, the method specification was closely followed, and the laying of the cables was executed successfully. The knowledge and experience gained from the offshore cable installation in Lillgrund is essential when writing technical specifications for new wind plant projects. It is recommended to avoid offshore cable installation work in winter seasons. That will lower the chances of dealing with bad weather and, in turn, will reduce the risks

  11. A novel method for coiled tubing installation

    Energy Technology Data Exchange (ETDEWEB)

    Simpson, Peter J. [2H Offshore, Houston, TX (United States); Tibbetts, David [Aquactic Engineering and Construction Ltd., Aberdeen (United Kingdom)

    2009-12-19

    Installation of flexible pipe for offshore developments is costly due to the physical cost of the flexible pipe, expensive day rates and the availability of suitable installation vessels. Considering the scarcity of flexible pipe in today's increasingly demanding and busy market, operators are seeking a cost effective solution for installing piping in a range of water depths using vessels which are readily on hand. This paper describes a novel approach to installing reeled coiled tubing, from 1 inch to 5 inch diameter, from the back of a small vessel in water depths from 40 m up to around 1000 m. The uniqueness of the system is the fact that the equipment design is modular and compact. This means that when disassembled, it fits into standard 40 ft shipping containers, and the size allows it to be installed on even relatively small vessels of opportunity, such as anchor handling or installation vessels, from smaller, and cheaper quay side locations. Such an approach is the ideal solution to the problem faced by operators, in that it allows the installation of cheaper, readily available coiled tubing, from cost-effective vessels, which do not need to transit to a pick up the system. (author)

  12. Structural considerations for solar installers : an approach for small, simplified solar installations or retrofits.

    Energy Technology Data Exchange (ETDEWEB)

    Richards, Elizabeth H.; Schindel, Kay (City of Madison, WI); Bosiljevac, Tom; Dwyer, Stephen F.; Lindau, William (Lindau Companies, Inc., Hudson, WI); Harper, Alan (City of Madison, WI)

    2011-12-01

    Structural Considerations for Solar Installers provides a comprehensive outline of structural considerations associated with simplified solar installations and recommends a set of best practices installers can follow when assessing such considerations. Information in the manual comes from engineering and solar experts as well as case studies. The objectives of the manual are to ensure safety and structural durability for rooftop solar installations and to potentially accelerate the permitting process by identifying and remedying structural issues prior to installation. The purpose of this document is to provide tools and guidelines for installers to help ensure that residential photovoltaic (PV) power systems are properly specified and installed with respect to the continuing structural integrity of the building.

  13. Installing and Testing a Server Operating System

    OpenAIRE

    Lorentz JÄNTSCHI

    2003-01-01

    The paper is based on the experience of the author with the FreeBSD server operating system administration on three servers in use under academicdirect.ro domain.The paper describes a set of installation, preparation, and administration aspects of a FreeBSD server.First issue of the paper is the installation procedure of FreeBSD operating system on i386 computer architecture. Discussed problems are boot disks preparation and using, hard disk partitioning and operating system installation usin...

  14. Instability of Bucket Foundations during Installation

    DEFF Research Database (Denmark)

    Madsen, Søren; Andersen, Lars Vabbersgaard; Ibsen, Lars Bo

    The bucket foundation is an upcoming technology for offshore wind turbines. The bucket foundation is a large cylindrical monopod foundation constructed as a thin steel shell structure. A bucket foundation does not require heavy installation equipment since it is installed by suction forces....... The combination of a thin shell structure and suction forces leads to the fact that instability, in form of buckling, becomes a crucial issue during installation. The hydrostatic buckling pressure of the bucket foundation is addressed using three-dimensional, non-linear finite element analysis. The results...

  15. RF accelerating unit installed in the PSB

    CERN Multimedia

    CERN PhotoLab

    1972-01-01

    RF accelerating unit installed in the PSB ring between two bending magnets. Cool air from a heat exchanger is injected into the four cavities from the central feeder and the hot air recirculated via the lateral ducts.

  16. Structural Code Considerations for Solar Rooftop Installations.

    Energy Technology Data Exchange (ETDEWEB)

    Dwyer, Stephen F.; Dwyer, Brian P.; Sanchez, Alfred

    2014-12-01

    Residential rooftop solar panel installations are limited in part by the high cost of structural related code requirements for field installation. Permitting solar installations is difficult because there is a belief among residential permitting authorities that typical residential rooftops may be structurally inadequate to support the additional load associated with a photovoltaic (PV) solar installation. Typical engineering methods utilized to calculate stresses on a roof structure involve simplifying assumptions that render a complex non-linear structure to a basic determinate beam. This method of analysis neglects the composite action of the entire roof structure, yielding a conservative analysis based on a rafter or top chord of a truss. Consequently, the analysis can result in an overly conservative structural analysis. A literature review was conducted to gain a better understanding of the conservative nature of the regulations and codes governing residential construction and the associated structural system calculations.

  17. Design, fabrication and installation of irradiation facilities

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Yong Sung; Lee, C. Y.; Kim, J. Y.; Chi, D. Y.; Kim, S. H.; Ahn, S. H.; Kim, S. J.; Kim, J. K.; Yang, S. H.; Yang, S. Y.; Kim, H. R.; Kim, H.; Lee, K. H.; Lee, B. C.; Park, C.; Lee, C. T.; Cho, S. W.; Kwak, K. K.; Suk, H. C. [and others

    1997-07-01

    The principle contents of this project are to design, fabricate and install the steady-state fuel test loop and non-instrumented capsule in HANARO for nuclear technology development. This project will be completed in 1999, the basic and detail design, safety analysis, and procurement of main equipment for fuel test loop have been performed and also the piping in gallery and the support for IPS piping in reactor pool have been installed in 1994. In the area of non-instrumented capsule for material irradiation test, the fabrication of capsule has been completed. Procurement, fabrication and installation of the fuel test loop will be implemented continuously till 1999. As besides, as these irradiation facilities will be installed in HANARO, review of safety concern, discussion with KINS for licensing and safety analysis report has been submitted to KINS to get a license and review of HANARO interface have been performed respectively. (author). 39 refs., 28 tabs., 21 figs.

  18. Designing Software-Based Interactive Installations

    DEFF Research Database (Denmark)

    Andreasen, Troels; Juul, Niels Christian; Rosendahl, Mads

    2014-01-01

    architecture as well as esthetic experience, artistic expression, and leisure aspects into focus. The approach presented here has this intended purpose. Where. Building on experience from conventional software development and with inspiration from interaction design and creative programming, this chapter......What. This chapter focuses on software engineering principles with specific emphasis on interactive installations providing embodied, tangible, and immersive experiences for the user. Such installations may deliver light, image, sound, and movement through actuators and may provide interaction...... through gesticulation, voice, and sensor signals. Installations are typically driven by specialized software that differs significantly from conventional business software, and in addition may include hardware components customized for the installation. To set the context, we give a range of example...

  19. Installation of the LHC transfer lines begins

    CERN Multimedia

    Patrice Loïez

    2003-01-01

    The first of 700 magnets has been installed in one of the two transfer tunnels built to transfer the SPS beam into the LHC. The start of this first installation phase of the LHC transfer lines provides the opportunity to launch a new and highly original modular system for transporting and installing all kinds of magnets in very narrow tunnels. The system is based on very compact bogies, up to four of which can be coupled together to form a convoy. The wheels are fitted with individual motors enabling them to swivel through an angle of 90° and the convoy to move laterally. In this way the magnet is delivered directly to its installation point, but beneath the beamline. It is then raised into its final position in the beamline using air cushions, which form an integrated part of the transport system. Here we see the transport vehicle alongside the magnet supports. Visible in the background is the first magnet in place.

  20. Notes on LED Installations in Street Illumination

    Directory of Open Access Journals (Sweden)

    Elisabeta Spunei

    2014-09-01

    Full Text Available The paper presents a study made on choosing LED street lighting installations, such that the quality requirements for exterior artificial lighting are fulfilled. We analyze two types of LED street lighting installations from a technical point of view, together with lighting level and brightness values obtained during the measurements. Following on the field measurements, the lighting quality parameters are calculated, and, for the lighting installation with the best performance, optimal mounting suggestions are made. The optimal quality parameters are calculated by simulations using the Dialux software. The same software and the same light sources we also compute an optimal street lighting by determining the size of the installation that provides the best lighting parameter values.

  1. Towards a Framework for Projection Installations

    DEFF Research Database (Denmark)

    Halskov, Kim; Falck, Hans William

    2013-01-01

    Projection installations are part of Spatially Augmented Reality, where the projection medium is used to enrich a fixed, bounded physical space with digital content. Projection technology enables us to turn many kinds of physical objects into displays. In this paper we develop and present...... a conceptual framework that addresses three aspects of a projection installation: the contentassociated with the object, the digital content, and the relation between the two. We conclude the paper with a set of strategies commonly used in projection installations: Enhancing or emphasizing physical aspects......; Transforming materiality; Adding virtual objects; 3D effects; Complex content on simple objects or simple content on complex; Strong versus loose connections between the physical object and the digital content. This paper is based on four cases, two of which concern cultural heritage installations, the others...

  2. REFLEXION - modeshowet som æstetisk installation

    OpenAIRE

    Wæver, Lin Klinke; Hald, Amanda Uetea

    2014-01-01

    In this project, we explore how a fashion show can be re-invented as an installation that potentially can lead the viewer to experience a sense of aesthetic qualities. The fashion industry is criticised for being exclusionary of the general public audience. As a reaction to that, we are working with the perception of the viewer as a participating element in the existence of the installation throughout this project. Based on the encyclopaedia 'Guide to Producing a Fashion Show', we deduce the...

  3. Installation Package -SIMS Prototype System 1A

    Energy Technology Data Exchange (ETDEWEB)

    None

    1976-12-01

    This package consists of details for the installation, operation and maintenance of a prototype heating and hot water system, designed for residential or light commercial applications. International Business Machines, under NASA/MSFC Contract NAS8-32036, developed this system consisting of the following subsystems: air type collectors, pebble bed thermal storage, air handling unit, air to water heat exchanger, hot water preheat tank, auxiliary energy, ducting system. This system is installed at Home Builders Association in Huntsville, Alabama (OTS-04).

  4. Installation of the LHC transfer lines begins

    CERN Multimedia

    Patrice Loïez

    2003-01-01

    The first of 700 magnets has been installed in one of the two transfer tunnels built to transfer the SPS beam into the LHC. The start of this first installation phase of the LHC transfer lines provides the opportunity to launch a new and highly original modular system for transporting and installing all kinds of magnets in very narrow tunnels. The system is based on very compact bogies, up to four of which can be coupled together to form a convoy. The wheels are fitted with individual motors enabling them to swivel through an angle of 90° and the convoy to move laterally. The first installation phase will continue until mid-April. In addition to the magnets, a beam dump facility also has to be installed. The second installation phase will take place later this year and should be completed in 2004, when the TI 8 transfer line is due to be tested. The second transfer line, in tunnel TI 2, should be ready in April 2007, once the LHC magnets have been transported through the downstream section of this tunnel.Pho...

  5. Installation of the LHC transfer lines begins

    CERN Multimedia

    Patrice Loïez

    2003-01-01

    The first of 700 magnets has been installed in one of the two transfer tunnels built to transfer the SPS beam into the LHC. The start of this first installation phase of the LHC transfer lines provides the opportunity to launch a new and highly original modular system for transporting and installing all kinds of magnets in very narrow tunnels. The system is based on very compact bogies, up to four of which can be coupled together to form a convoy. The wheels are fitted with individual motors enabling them to swivel through an angle of 90° and the convoy to move laterally. The first installation phase will continue until mid-April. In addition to the magnets, a beam dump facility also has to be installed. The second installation phase will take place later this year and should be completed in 2004, when the TI 8 transfer line is due to be tested. The second transfer line, in tunnel TI 2, should be ready in April 2007, once the LHC magnets have been transported through the downstream section of this tunnel. We...

  6. Installation of the LHC transfer lines begins

    CERN Multimedia

    Patrice Loïez

    2003-01-01

    The first of 700 magnets has been installed in one of the two transfer tunnels built to transfer the SPS beam into the LHC. The start of this first installation phase of the LHC transfer lines provides the opportunity to launch a new and highly original modular system for transporting and installing all kinds of magnets in very narrow tunnels. The system is based on very compact bogies, up to four of which can be coupled together to form a convoy. The wheels are fitted with individual motors enabling them to swivel through an angle of 90° and the convoy to move laterally. The first installation phase will continue until mid-April. In addition to the magnets, a beam dump facility also has to be installed. The second installation phase will take place later this year and should be completed in 2004, when the TI 8 transfer line is due to be tested. The second transfer line, in tunnel TI 2, should be ready in April 2007, once the LHC magnets have been transported through the downstream section of this tunnel. Th...

  7. Demonstrate Energy Component of the Installation Master Plan Using Net Zero Installation Virtual Testbed

    Science.gov (United States)

    2015-09-01

    selections from the MILP optimization 26 2-25 The cluster optimization analysis page. Here, the District Hot Water alternative is expanded to show...VAV Variable Air Volume VFD Variable Frequency Drive XML Extensible Markup Language XPS Extruded Polystyrene xvi 1 1.0 INTRODUCTION...Installations Directive, which expanded the Net Zero Initiative beyond the pilot installations to all permanent Army installations. The U.S. Navy is

  8. Planning and installing micro-hydro systems a guide for designers, installers and engineers

    CERN Document Server

    Elliott, Chris

    2014-01-01

    An essential addition to the Earthscan Planning & Installing series, Planning and Installing Micro-Hydro Systems provides vital diagrams, pictures and tables detailing the planning and installing of a micro-hydro system, including information on the maintenance and economics once an installation is running. The book covers subjects such as measuring head and flow, ecological impacts, scheme layouts, practical advice, calculations and turbine choice. Archimedes screws are also covered in detail, as well as the main conventional choices relevant to small sites.Micro-hydro refers to hydropower sy

  9. Installing and Testing a Server Operating System

    Directory of Open Access Journals (Sweden)

    Lorentz JÄNTSCHI

    2003-08-01

    Full Text Available The paper is based on the experience of the author with the FreeBSD server operating system administration on three servers in use under academicdirect.ro domain.The paper describes a set of installation, preparation, and administration aspects of a FreeBSD server.First issue of the paper is the installation procedure of FreeBSD operating system on i386 computer architecture. Discussed problems are boot disks preparation and using, hard disk partitioning and operating system installation using a existent network topology and a internet connection.Second issue is the optimization procedure of operating system, server services installation, and configuration. Discussed problems are kernel and services configuration, system and services optimization.The third issue is about client-server applications. Using operating system utilities calls we present an original application, which allows displaying the system information in a friendly web interface. An original program designed for molecular structure analysis was adapted for systems performance comparisons and it serves for a discussion of Pentium, Pentium II and Pentium III processors computation speed.The last issue of the paper discusses the installation and configuration aspects of dial-in service on a UNIX-based operating system. The discussion includes serial ports, ppp and pppd services configuration, ppp and tun devices using.

  10. Installation of the LHC transfer lines begins

    CERN Multimedia

    Patrice Loïez

    2003-01-01

    The first of 700 magnets has been installed in one of the two transfer tunnels built to transfer the SPS beam into the LHC. The start of this first installation phase of the LHC transfer lines provides the opportunity to launch a new and highly original modular system for transporting and installing all kinds of magnets in very narrow tunnels. The system is based on very compact bogies, up to four of which can be coupled together to form a convoy. The wheels are fitted with individual motors enabling them to swivel through an angle of 90° and the convoy to move laterally. In this way the magnet is delivered directly to its installation point, but beneath the beamline. It is then raised into its final position in the beamline using air cushions, which form an integrated part of the transport system.Photos 01, 02: Pictured with the newly installed magnet and transport system in the transfer line tunnel are LHC project leader Lyn Evans (second left, white helmet); Volker Mertens, responsible for the LHC injecti...

  11. Installation of the LHC transfer lines begins

    CERN Multimedia

    Patrice Loïez

    2003-01-01

    The first of 700 magnets has been installed in one of the two transfer tunnels built to transfer the SPS beam into the LHC. The start of this first installation phase of the LHC transfer lines provides the opportunity to launch a new and highly original modular system for transporting and installing all kinds of magnets in very narrow tunnels. The system is based on very compact bogies, up to four of which can be coupled together to form a convoy. The wheels are fitted with individual motors enabling them to swivel through an angle of 90° and the convoy to move laterally. In this way the magnet is delivered directly to its installation point, but beneath the beamline. It is then raised into its final position in the beamline using air cushions, which form an integrated part of the transport system.Photo 01: Pictured with the newly installed magnet and transport system in the transfer line tunnel are (left to right) Volker Mertens, responsible for the LHC injection and transfer lines; personnel involved in tr...

  12. Design and installation of earth energy systems

    Energy Technology Data Exchange (ETDEWEB)

    Loggia, S.; Adragna, M.; Coyle, S.; Foley, C.; Hawryn, S.; Martin, A.; McConnell, J. (eds.)

    2002-07-01

    This first edition of the Canadian Standards Association (CSA) Standard C448 Series, replaces CSA Standards CAN/CSA-C445-M92 entitled Design and Installation of Earth Energy Heat Pump Systems for Residential and Other Small Buildings, as well as C447-94 entitled Design and Installation of Earth Energy Heat Pump Systems for Commercial and Institutional Buildings. This standard document consists of three parts: (C448.1) Design and installation of earth energy systems for commercial and institutional buildings; (C448.2) Design and installation of earth energy systems for residential and small buildings; and, (C448.3) Design and installation of underground thermal energy storage systems for commercial and institutional buildings. In C448.1, the requirements applicable to any system falling within the scope of the C448 series were included. Alternative requirements for houses and small buildings were added in C448.2. It was noted that either standard may be implemented. The standards applicable to the intentional storage of energy in the earth for later use were presented in C448.3. This latter section includes a brief introduction on underground thermal energy storage (UTES). tabs.

  13. Development Of VHF (240-270 MHz) Antennas For SoOp (Signal Of Opportunity) Receiver For 6u Cubesat Platforms

    Science.gov (United States)

    Joseph, A. T.; Deshpande, M.; O'Neill, P. E.; Miles, L.

    2016-01-01

    The main goal of this research is to design, fabricate, and test deployable VHF antennas for 6U Cubesat platforms to enable validation of root zone soil moisture (RZSM) estimation algorithms for signal of opportunity (SoOp) remote sensing over the 240-270 MHz frequency band. The proposed work provides a strong foundation for establishing a technology development path for maturing a truly global direct surface soil moisture (SM) and RZSM measurement system (Figure 1) over a variety of land covers with limited density restrictions. In SoOp methodology, signals transmitted by already existing transmitters (known as transmitters of opportunity, in this case the Military Satellite Communication (MilSatCom) System's UHF Follow-On program) are utilized to measure properties of reflecting targets by recording reflected signals using a simple passive microwave receiver.

  14. An ambiguity-function-based method for analysis of Doppler decompressed radar signals applied to EISCAT measurements of oblique UHF-VHF meteor echoes

    Science.gov (United States)

    Wannberg, G.; Pellinen-Wannberg, A.; Westman, A.

    1996-05-01

    Binary phase modulation using Barker codes as the modulating sequences is often used as a pulse compression technique in incoherent scatter radar measurements of the ionospheric E region. Demodulation of the compressed signal is usually accomplished by matched filtering techniques. If the target has appreciable velocity, the resulting Doppler shift detunes the scattered signal relative to the filter, and the target response spreads over a large range interval. The paper describes the development of a new data analysis method, based on an ambiguity function description of radar total-power measurements, which uses the characteristic Doppler decompression signatures to identify, extract, and analyze high-velocity events from conventional Barker-coded power profile type incoherent scatter (IS) measurements. Data sets recorded with the European Incoherent Scatter UHF (931 MHz) and VHF (224 MHz) radars during the 1990-1991 Geminid and 1993 Perseid showers are shown to contain many events which are associated with individual meteors crossing the radar beams over a wide range of aspect angles, including a few near-radial cases. Line-of-sight velocities and effective cross sections are derived for some of the best dual radar events. The cross sections are very small and increase with decreasing wavelength, something not observed before. It is suggested that this is indicative of a scattering mechanism different from the one operating at near-normal incidence at VHF, and Rayleigh scatter from compact "balls" of plasma contained within the meteor coma is proposed as a possible candidate, in qualitative agreement with the observations. Finally, some signal-processing related aspects of the method are discussed. It is shown that most IS radars should be able to apply it to their existing programs with very little effort and without having to compromise the performance in normal E region applications. The method could therefore become a powerful tool for studies of meteor

  15. High-resolution observation of field-aligned irregularities in the ionosphere using multi-frequency range imaging of VHF atmospheric radar

    Science.gov (United States)

    Chen, Jenn-Shyong; Furumoto, Jun-ichi; Su, Ching-Lun; Chu, Yen-Hsyang

    Field-aligned irregularity (FAI) in the ionosphere is a topic of interest to atmospheric radar community. In addition to the field-aligned characteristic, quasi-periodic (QP) appearance of FAI echoes has been observed frequently by very-high-frequency (VHF) atmospheric radar. The occurrence range of QP FAI echoes changes with time, and the slope of range versus time can be positive or negative, depending on occurrence time of the echoes. Several mechanisms responsible for the QP FAI echoes have been proposed, e.g., modulation in altitude by a passing atmospheric gravity wave, semidiurnal neutral-wind variation, and so on. Owing to the finite pulse length of radar in observation, the range resolution of measurement is limited within hundreds of meters. In view of this, the range imaging (RIM) using multiple frequencies has been employed to improve the range resolution of measurement. The multi-frequency technique transmits a set of slightly different frequencies sequentially during each radar pulse, and the radar returns at different transmitting frequencies are received, respectively. With adaptive retrieval algorithms for these radar returns, it is capable of resolving the echo structures at meter scale in the range direction. RIM has been employed in the lower atmosphere successfully. In this study, the performance of RIM for FAI was first carried out with the Middle and Upper atmosphere Radar (46 MHz; 34.85(°) N, 136.10(°) N; Japan) and the Chung-Li VHF radar (52 MHz; 24.9(°) N, 121.1(°) E; Taiwan). Some initial results of high-resolution FAI echoes within the range gate will be shown.

  16. VHF and L-band scintillation characteristics over an Indian low latitude station, Waltair (17.7° N, 83.3° E

    Directory of Open Access Journals (Sweden)

    P. V. S. Rama Rao

    2005-10-01

    Full Text Available Characteristics of simultaneous VHF (244 MHz and L-band (1.5 GHz scintillations recorded at a low-latitude station, Waltair (17.7° N, 83.3° E, during the low sunspot activity year of March 2004 to March 2005, suggest that the occurrence of scintillations is mainly due to two types, namely the Plasma Bubble Induced (PBI, which maximizes during the post sunset hours of winter and equinoctial months, and the Bottom Side Sinusoidal (BSS type, which maximizes during the post-midnight hours of the summer solstice months. A detailed study on the spectral characteristics of the scintillations at both the frequencies show that the post-sunset scintillations are strong with fast fading (≈40 fad/min and are multiple in nature in scattering, giving rise to steep spectral slopes, whereas the post-midnight scintillations, which occur mostly on the VHF signal with low fading rate (≈4 fad/min, are of the BSS type, often showing typical Fresnel oscillations with reduced roll off spectral slopes, indicating that the type of irregularity resembles a thin screen structure giving rise to weak scattering. Using the onset times of several similar scintillation patches across the two satellite (FLEETSAT 73° E, INMARSAT 65° E ray paths (sub-ionospheric points are separated by 82 km, the East ward movement of the irregularity patches is found to vary from 150 to 250 m/s during the post sunset hours and decrease slowly during the post midnight hours. Further, the east-west extent of the PBI type of irregularities is found to vary from 100 to 500 km, while that of the BSS type extend up to a few thousand kilometers. Keywords. Ionosphere (Ionospheric irregularities; Auroral ionosphere; Electric fields and currents

  17. Installation Strategy for the LHC Main Dipoles

    CERN Multimedia

    Fartoukh, Stephane David

    2004-01-01

    All positions in the LHC machine are not equivalent in terms of beam requirements on the geometry and the field quality of the main dipoles. In the presence of slightly or strongly out-of tolerance magnets, a well-defined installation strategy will therefore contribute to preserve or even optimize the performance of the machine. Based on the present status of the production, we have anticipated a list of potential issues (geometry, transfer function, field direction and random b3) which, combined by order of priority, have been taken into account to define a simple but efficient installation algorithm for the LHC main dipoles. Its output is a prescription for installing the available dipoles in sequence while reducing to an absolute minimum the number of holes required by geometry or FQ issues.

  18. VERA 3.5 Installation Guide

    Energy Technology Data Exchange (ETDEWEB)

    Bartlett, Roscoe A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Baird, Mark L. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Berrill, Mark A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Kulesza, Joel A. [Univ. of Michigan, Ann Arbor, MI (United States); Mervin, Brenden T. [Electric Power Research Inst. (EPRI), Charlotte, NC (United States)

    2016-08-16

    This guide describes the structure and setup of the standard VERA development environment (VERA Dev Env) and standard VERA Third Party Libraries (TPLs) that need to be in place before installing many of the VERA simulation components. It describes everything from the initial setup on a new machine to the final build, testing, and installation of VERA components. The goal of this document is to describe how to create the directories and contents outlined in Standard VERA Dev Env Directory Structure and then obtain the remaining VERA source and build, test, and install any of the necessary VERA components on a given system. This document describes the process both for a development version of VERA and for a released tarball of the VERA sources.

  19. Installation, operation, and maintenance for the pyramidal optics solar system installed at Yacht Cove, Columbia, SC

    Energy Technology Data Exchange (ETDEWEB)

    1980-09-01

    Information is presented concerning the installation, operation, and maintenance of the pyramidal Solar System for space heating and domestic hot water. Included are such items as principles of operation, sequence of installation, and procedures for the operation and maintenance of each subsystem making up the solar system. Also included are trouble-shooting charts and maintenance schedules.

  20. Design, fabrication and installation of irradiation facilities

    Energy Technology Data Exchange (ETDEWEB)

    Sim, Bong Shick; Kim, Y. S.; Lee, C. Y. and others

    1999-03-01

    The principal contents of this project are to design, fabricate and install the steady-state fuel test loop in HANARO for nuclear technology development. Procurement and fabrication of main equipment, licensing and technical review for fuel test loop have been performed during 2 years(1997, 1998) for this project. Following contents are described in the report. - Procurement and fabrication of the equipment, piping for OPS - IPS manufacture - License - Technical review and evaluation of the FTL facility. As besides, as these irradiation facilities will be installed in HANARO, review of safety concern, discussion with KINS for licensing and review ofHANARO interface have been performed respectively. (author)

  1. High voltage electricity installations a planning perspective

    CERN Document Server

    Jay, Stephen Andrew

    2006-01-01

    The presence of high voltage power lines has provoked widespread concern for many years. High Voltage Electricity Installations presents an in-depth study of policy surrounding the planning of high voltage installations, discussing the manner in which they are percieved by the public, and the associated environmental issues. An analysis of these concerns, along with the geographical, environmental and political influences that shape their expression, is presented. Investigates local planning policy in an area of the energy sector that is of highly topical environmental and public concern Cover

  2. Tolley's industrial and commercial gas installation practice

    CERN Document Server

    Hazlehurst, John

    2010-01-01

    This is the third of three essential reference volumes for those concerned with the installation and servicing of domestic and industrial gas equipment. This volume explains the basic principles underlying the practical and theoretical aspects of installing and servicing gas appliances and associated equipment, from the basics of combustion, to burners, pressure and flow, transfer of heat, controls, as well as materials and processes, electrical aspects, and metering and measuring devices. Covering both Natural Gas and Liquefied Petroleum Gas, the many illustrations and worked examples include

  3. The role of installers for thermo-technical installations when buying gas boilers

    Directory of Open Access Journals (Sweden)

    Jovičić Dragoljub

    2013-01-01

    Full Text Available This study presents the research of role installers for thermo-technical installations when buying gas boilers in the Serbian market. Considering the fact that installers are significantly different, they are grouped by specific, relevant characteristics. The research is focused on the evaluation of marketing mix instruments by nine identified segments of installers. Moreover, research has been explored deeper through conclusion installers about the most important and most credible sources of information on gas boilers. During the research were used secondary and primary data sources. Besides the research at the table, field research has been also done by unstructured personal communication. All collected data were analyzed in details and both hypothesis were tested, where one of them is partially confirmed, and another one fully confirm. Given results can be useful for marketers and their anticipation of demand. Also these results can be used for creating optimal marketing strategy in the Serbian market of gas boilers.

  4. 14 CFR 25.1703 - Function and installation: EWIS.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Function and installation: EWIS. 25.1703... (EWIS) § 25.1703 Function and installation: EWIS. (a) Each EWIS component installed in any area of the aircraft must: (1) Be of a kind and design appropriate to its intended function. (2) Be installed according...

  5. 46 CFR 58.10-10 - Diesel engine installations.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Diesel engine installations. 58.10-10 Section 58.10-10... MACHINERY AND RELATED SYSTEMS Internal Combustion Engine Installations § 58.10-10 Diesel engine installations. (a) The requirements of § 58.10-5 (a), (c), and (d) shall apply to diesel engine installations...

  6. Installation of the LHC transfer lines begins

    CERN Multimedia

    2003-01-01

    On 19 February, the very first magnet was installed in one of the two tunnels that will house the transfer lines leading to the LHC. This magnet, recycled from a previous facility, was transported and positioned using a novel system designed for conveying large objects through narrow tunnels.

  7. Installation of the ALICE dipole magnet

    CERN Multimedia

    Maximilien Brice

    2005-01-01

    The large dipole magnet is installed on the ALICE detector at CERN. This magnet, which is cooled by demineralised water, will bend the path of muons that leave the huge rectangular solenoid (in the background). These muons are heavy electrons that interact less with matter, allowing them to traverse the main section of the detector.

  8. First detector installed inside the ALICE solenoid...

    CERN Multimedia

    2006-01-01

    ALICE's emblematic red magnet welcomed its first detector on 23 September, when the array of seven Cherenkov detectors, named HMPID, was successfully installed. ALICE team members standing in front of the completed HMPID detector.The red magnet, viewed from its front opening. The HMPID unit, seen from the back (top right corner of photo) is placed on a frame and lifted onto a platform during the installation. After the installation of the ACORDE scintillator array and the muon trigger and tracking chambers, the ALICE collaboration fitted the first detector inside the solenoid. The HMPID, for High Momentum Particle Identification, was installed at the 2 o'clock position in the central and most external region of the space frame, just below the solenoid yoke. It will be used to extend the hadron identification capability of the ALICE experiment up to 5 GeV/c, thus complementing the reach of the other particle identification systems (ITS, TPC and TOF). The HMPID is a Ring Imaging Cherenkov (RICH) detector in a...

  9. Installations solaires photovoltaïques

    CERN Document Server

    2014-01-01

    Cet ouvrage présente les règles de conception et de mise en œuvre des installations photovoltaïques raccordées au réseau public de distribution à basse tension. Il s’applique aux bâtiments neufs et existants et concerne non seulement les petites installations résidentielles, d’une puissance de l’ordre de quelques kWc, mais aussi celles des bâtiments collectifs, tertiaires ou agricoles. Il traite successivement : - des fondamentaux de l'énergie solaire photovoltaïque (gisement solaire, principe de la conversion, composants d'une installation...) ; - du dimensionnement de l'installation (choix des matériels, règles de conception, estimation de l'énergie récupérable...) ; - de sa mise en oeuvre (travail en hauteur, habilitation électrique, mise en service, maintenance...) ; - des démarches administratives nécessaires (aides financières, accès au réseau de distribution, vente de l'électricité produite...).

  10. Safety and Inspection Planning of Older Installations

    DEFF Research Database (Denmark)

    Sørensen, John Dalsgaard; Ersdal, G.

    2008-01-01

    (and coalescence of small cracks) and increased crack growth. This should imply shorter inspection time intervals for ageing structures. Different approaches for updating inspection plans for older installations are proposed. The most promisingmethod consists of increasing the rate of crack initiations...

  11. Safety and Inspection Planning of Older Installations

    DEFF Research Database (Denmark)

    Sørensen, John Dalsgaard; Ersdal, G.

    2007-01-01

    time intervals for ageing structures. Different approaches for updating inspection plans for older installations are proposed.The most promising method consists in increasing the rate of crack initiations at the end of the expected lifetime - corresponding to a bath-tube hazard rate effect.The approach...

  12. Installation in Outdoor Advertising Designs: Engagement with ...

    African Journals Online (AJOL)

    Conventional outdoor platform came into existence in Nigeria since 1929, but from 1980s, optional site specifics were located in vintage positions in form of Installations. The 3D sculptural art form as a reminder medium, positions popular brands such as Star lager beer, Guinness and Milo beverage. Dictates of globalization ...

  13. 46 CFR 132.220 - Installation.

    Science.gov (United States)

    2010-10-01

    ... Portable and Semiportable Fire Extinguishers § 132.220 Installation. (a) Each portable fire extinguisher approved under subpart 162.028 of this chapter and each semiportable fire extinguisher approved under... placement of each extinguisher must satisfy the cognizant OCMI, who may also deem added extinguishers...

  14. On the Modelling of Pile Installation

    NARCIS (Netherlands)

    Dijkstra, J.

    2009-01-01

    This thesis introduces two different types of physical model tests to investigate the stress and density change in the soil during installation of a jacked pile as well as two numerical modelling approaches to model the same process in a finite element code capable of large deformations.

  15. Solar Energy Installers Curriculum Guides. Final Report.

    Science.gov (United States)

    Walker, Gene C.

    A project was conducted to develop solar energy installers curriculum guides for use in high school vocational centers and community colleges. Project activities included researching job competencies for the heating, ventilation, and air conditioning industry and determining through interviews and manufacturers' literature what additional…

  16. Thermocouple installation in thin-walled tubes

    Science.gov (United States)

    Curren, A. N.; Wycoff, K. C.

    1970-01-01

    Brazing process attaches thermocouples to slot in type-347 stainless steel tube flush around its circumference. Electrolytic flashing with gold enhances brazing process. This installation procedure does not significantly change calibration of thermocouples used and does not cause major wear spots in the thin-walled devices.

  17. The Swiss nuclear installations. Annual report 1994

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-06-01

    Surveillance of the Swiss nuclear installations with regard to nuclear safety, including radiation protection, is among the tasks of the Swiss Federal Nuclear Safety Inspectorate (HSK). Five nuclear power plants are operational in Switzerland: the three units Beznau I and II and Muehleberg with electrical capacities in the range of 300 to 400 MWe, and the two units Goesgen and Leibstadt with capacities between 900 and 1200 MWe. These are light water reactors; at Beznau and Goesgen of the PWR type, and at Muehleberg and Leibstadt of the BWR type. Research reactors of thermal capacities below 10 MWth are operational at the Paul Scherrer Institute (PSI), at the Swiss Federal Institute of Technology Lausanne and at the University of Basel. Further subject to HSK`s supervision are all activities at PSI involving nuclear fuel or ionizing radiation, the shut-down experimental reactor of Lucens, the exploration, in Switzerland, of final disposal facilities for radwaste and the interim radwaste storage facilities. The report first deals with the nuclear power and covers, in individual sections, the aspects of installation safety, radiation protection as well as personnel and organization, and the resulting overall impression from the point of view of HSK. In chapter 5, the corresponding information is given for research installations. Chapter 6, on radwaste disposal, is dedicated to the treatment of waste, waste from reprocessing, interim storage and exploration by NAGRA. In chapter 7, the status of emergency planning in the nuclear power plants` proximity is reported. Certificates issued for the transport of radioactive materials are dealt with in chapter 8. Finally chapter 9 goes into general questions relating to the safety of nuclear installations. All in all, the safety of operation of the Swiss nuclear installations, in the period of 1994, is judged as good by HSK. (author) 11 figs., 13 tabs.

  18. Installation Capacity Assessment of Damaged Deepwater Pipelines

    Directory of Open Access Journals (Sweden)

    Ramasamy R.

    2014-07-01

    Full Text Available The worldwide exploration and development of subsea and deepwater reservoirs has laid down some new and old engineering challenges to the offshore pipeline industry. This requires large D/t pipelines to be installed at water depths in the vicinity of up to 2700m. The deepwater collapse and buckle propagation event is almost unavoidable as the pipe wall thickness cannot be always determined from the codes and standards due to the limit state criteria. These codes also do not consider any fabrication imperfections and sustained damages emanating from transportation and handling. The objective of this paper is to present the Finite Element Analysis (FEA of dented pipes with D/t ratio more than 45, which is outside the applicability of current design codes, and to investigate the effects on installation capacity of these various damage sizes in terms of collapse and buckle propagation.

  19. Software safety analysis practice in installation phase

    Energy Technology Data Exchange (ETDEWEB)

    Huang, H. W.; Chen, M. H.; Shyu, S. S., E-mail: hwhwang@iner.gov.t [Institute of Nuclear Energy Research, No. 1000 Wenhua Road, Chiaan Village, Longtan Township, 32546 Taoyuan County, Taiwan (China)

    2010-10-15

    This work performed a software safety analysis in the installation phase of the Lung men nuclear power plant in Taiwan, under the cooperation of Institute of Nuclear Energy Research and Tpc. The US Nuclear Regulatory Commission requests licensee to perform software safety analysis and software verification and validation in each phase of software development life cycle with Branch Technical Position 7-14. In this work, 37 safety grade digital instrumentation and control systems were analyzed by failure mode and effects analysis, which is suggested by IEEE standard 7-4.3.2-2003. During the installation phase, skew tests for safety grade network and point to point tests were performed. The failure mode and effects analysis showed all the single failure modes can be resolved by the redundant means. Most of the common mode failures can be resolved by operator manual actions. (Author)

  20. Integrated installation for offshore wind turbines

    Energy Technology Data Exchange (ETDEWEB)

    Way, J.; Bowerman, H.

    2003-07-01

    A project to investigate the feasibility of integrating the offshore installation of foundation, turbine and tower for offshore wind turbines into one operation is described. Three separate objectives are listed. They are: (1) Telescopic tower study - reversible process incorporating lift and lock mechanisms; (2) Transportation study - technical and economic feasibility of transporting and installing a wind turbine unit via a standard barge with minimal conversion and (3) Self-burial system study - to demonstrate the feasibility of self burial of a slab foundation via controlled jetting beneath the slab. The background to the study and the proposed concepts are discussed. The work carried out to date and the costs are reported together with the findings. Recommendations for future work are listed. The work was carried out by Corus UK Ltd and is managed by Future Energy Solutions for the DTI.

  1. Installation for producing sealed radioactive sources; Installation de fabrication de sources radioactives scellees

    Energy Technology Data Exchange (ETDEWEB)

    Fradin, J.; Hayoun, C. [Commissariat a l' Energie Atomique, 91 - Saclay (France). Centre d' Etudes Nucleaires

    1969-07-01

    This installation has been designed and built for producing sealed sources of fission elements: caesium 137, strontium 90, promethium 147, ruthenium 106 and cerium 144 in particular. The installation consists of sealed and protected cells, each being assigned to a particular production. The safety and the operational reliability of the equipment are the principal considerations which have governed this work. The report describes the installation and, in particular, the apparatus used as well as the various control devices. In conclusion, a review as presented of six years operation. (authors) [French] Cette installation a ete concue et realisee pour effectuer des fabrications de sources scellees d'elements de fission: caesium 137 - strontium 90 - promethium 147 - ruthenium 106 - cerium 144 en particulier. L'installation est composee de cellules etanches et protegees, chacune d'elles etant affectee a une fabrication particuliere. La securite et la surete de fonctionnement de l'ensemble sont parmi les elements principaux qui ont guide l'etude. Le rapport decrit l'installation et plus particulierement l'appareillage utilise ainsi que les divers controles et commandes. Le bilan de fonctionnement apres 6 ans d'exploitation sert de conclusion. (auteurs)

  2. Installation of superconducting gravimeter in the Antarctica

    Energy Technology Data Exchange (ETDEWEB)

    Ikeda, H. [Research Facility Center for Science and Technology Cryogenics Division, University of Tsukuba, Tsukuba, Ibaraki 305-8577 (Japan)]. E-mail: ikeda@bk.tsukuba.ac.jp; Doi, K. [National Institute of Polar Research, Tokyo, Itabashi-ku 1-9-10, Kaga 173-8515 (Japan); Fukuda, Y. [Department of Geophysics, Graduate School of Science, Kyoto University, Sakyo-ku, Kyoto 606-8502 (Japan); Shibuya, K. [National Institute of Polar Research, Tokyo, Itabashi-ku 1-9-10, Kaga 173-8515 (Japan); Yoshizaki, R. [Research Facility Center for Science and Technology Cryogenics Division, University of Tsukuba, Tsukuba, Ibaraki 305-8577 (Japan)

    2005-10-01

    In February 2003 to January 2004, a new superconducting gravimeter with a cryocooler was installed to replace the former one in Syowa Station on the Antarctica. It has a high sensitivity of one nano-Gal to survey inside the earth in the Global Geodynamics Project (GGP network). A new type of diaphragm was confirmed to well isolate the vibration from refrigerator cold-head and to prevent the solid air contamination perfectly. Real time remote monitoring system from Japan is also established.

  3. CASTOR Calorimeter Installation Review at CMS

    CERN Multimedia

    CERN Video Productions

    2011-01-01

    This test is a part of CASTOR EDR process. The CASTOR phys-tech review held on 14 Jan 2011 and the subsequent EDR held on 17 Jun 2011, the CMS Management Board has endorsed a strategy in which CASTOR is removed during the 2011 Year-End Technical Stop, but is then refurbished, replacing a substantial fraction of the phototubes, so that it is ready for re-installation in the Technical Stop just before 2012 heavy-ion operation.

  4. AUTONOMOUS WIND POWER INSTALLATIONS AND SYSTEMS

    OpenAIRE

    Kvitko A. V.; Semenov Y. A.; Otmakhov G. S.

    2015-01-01

    The article shows the main advantages and disadvantages of renewable energy sources. It is shown, that in general, the use of renewable energy in the world has acquired real momentum and stable growth trend. An interesting fact is that the greatest application was currently the most mutable and unstable form of energy - wind. The total global installed capacity of large wind turbines, according to various estimates, is approximately 20 GW. This is because the specific investment in wind power...

  5. Installation of a Roof Mounted Photovoltaic System

    Science.gov (United States)

    Lam, M.

    2015-12-01

    In order to create a safe and comfortable environment for students to learn, a lot of electricity, which is generated from coal fired power plants, is used. Therefore, ISF Academy, a school in Hong Kong with approximately 1,500 students, will be installing a rooftop photovoltaic (PV) system with 302 solar panels. Not only will these panels be used to power a classroom, they will also serve as an educational opportunity for students to learn about the importance of renewable energy technology and its uses. There were four different options for the installation of the solar panels, and the final choice was made based on the loading capacity of the roof, considering the fact that overstressing the roof could prove to be a safety hazard. Moreover, due to consideration of the risk of typhoons in Hong Kong, the solar panel PV system will include concrete plinths as counterweights - but not so much that the roof would be severely overstressed. During and after the installation of the PV system, students involved would be able to do multiple calculations, such as determining the reduction of the school's carbon footprint. This can allow students to learn about the impact renewable energy can have on the environment. Another project students can participate in includes measuring the efficiency of the solar panels and how much power can be produced per year, which in turn can help with calculate the amount of money saved per year and when we will achieve economic parity. In short, the installation of the roof mounted PV system will not only be able to help save money for the school but also provide learning opportunities for students studying at the ISF Academy.

  6. Installation of electric generators on turbine engines

    Science.gov (United States)

    Demel, H. F.

    1983-01-01

    The installation of generators on turbine aircraft is discussed. Emphasis is placed on the use of the samarium cobalt generator. Potential advantages of an electric secondary power system at the engine level are listed. The integrated generator and the externally mounted generator are discussed. It is concluded that the integrated generator is best used in turbojet and low bypass ratio engines where there is no easy way of placing generators externally without influencing frontal areas.

  7. Filter Protection of Consumers’ Electrical Installations

    Directory of Open Access Journals (Sweden)

    M. I. Polouyanov

    2008-01-01

    Full Text Available The paper justifies necessity to use current filters of symmetric components, in particular, combined filters of positive and negative phase-sequences for protection of three-phase receivers.Results pertaining to calculation of currents of various phase-sequences for emergency cases with small current are presented in the paper. The paper reveals that protective devices designed on the basis of current filters of symmetric components efficiently improve protection of consumers’ electrical installations and increase their operational safety.

  8. Improving Energy Security for Air Force Installations

    Science.gov (United States)

    2015-09-01

    air energy, and flow batteries are better suited to deliver energy to users for durations in units of minutes or longer. One can see a natural...closely watching. The site has a landfill gas project, solar energy, and a zinc bromide flow battery based energy storage system. Raytheon, though its...of Defense Instruction 4170.11, “Installation Energy Management,” 11 December 2009. Department of Defense, “ Zinc Bromide Flow Battery

  9. Analysis of Installation-Level Planning Requirements

    Science.gov (United States)

    2004-05-01

    the Master Planning Instruction (MPI) document is internally inconsistent in that land use planning and integrated environmental decision-making are...Master Planning contains citations found in the ARs and guidance documents referring to master planning and land use planning . The relationship of other...Instruction, page 3- 1 Land use planning is a mapping and planned allocation of the use of all installation lands based on established land use categories and

  10. AWAKE starts the equipment installation phase

    CERN Multimedia

    Antonella Del Rosso

    2015-01-01

    AWAKE is the proof-of-principle experiment whose aim is to use protons to generate powerful wakefields to accelerate an electron beam. With accelerator gradients hundreds of times higher than those used in current systems, this technique could revolutionise the field of particle acceleration. Installed in the tunnel previously used by the CNGS facility, AWAKE is completing the service installation phase and will receive the plasma cell in the coming months.   The AWAKE proton line with all the magnets installed. (Image: AWAKE collaboration.) AWAKE is the world’s first proton-driven plasma wakefield acceleration experiment. In AWAKE, a beam of protons from the SPS will be travelling through a plasma cell and this will generate a wakefield that, in turn, will accelerate an electron beam. A laser will ionise the gas in the plasma cell and seed the self-modulation instability that will trigger the wakefield in the plasma. The project aims to prove that the plasma wakefield can be driv...

  11. Numerical simulation of installation of skirt foundations

    Energy Technology Data Exchange (ETDEWEB)

    Vangelsten, Bjoern Vidar

    1997-12-31

    Skirt foundation has been increasingly used for permanent offshore oil installations and anchors for drilling ships. Suction is commonly used in skirt foundation installing. If a large amount of suction is applied, the soil around the foundation may fail and the foundation become useless. This thesis studies failure due to high seepage gradients, aiming to provide a basis for reducing the risk of such failures. Skirt penetration model testing has shown that to solve the problem one must understand what is going on at the skirt tip during suction installation. A numerical model based on micro mechanics was developed as continuum hypothesis was seen to be unsuitable to describe the processes in the critical phases of the failure. The numerical model combines two-dimensional elliptical particles with the finite difference method for flow to model water flow in a granular material. The key idea is to formulate the permeability as a function of the porosity of the grain assembly and so obtain an interaction between the finite difference method on flow and the particle movement. A computer program, DYNELL, was developed and used to simulate: (1) weight penetration of a skirt wall, (2) combined suction and weight penetration of a skirt wall, and (3) critical gradient tests around a skirt wall to study failure mechanisms. The model calculations agree well with laboratory experiments. 16 refs., 124 figs., 21 tabs.

  12. Does drywall installers' innovative idea reduce the ergonomic exposures of ceiling installation: A field case study.

    Science.gov (United States)

    Dasgupta, Priyadarshini Sengupta; Punnett, Laura; Moir, Susan; Kuhn, Sarah; Buchholz, Bryan

    2016-07-01

    The study was conducted to assess an intervention suggested by the workers to reduce the physical or ergonomic exposures of the drywall installation task. The drywall installers were asked to brainstorm on innovative ideas that could reduce their ergonomic exposures during the drywall installation work. The workers proposed the idea of using a 'deadman' (narrow panel piece) to hold the panels to the ceiling while installing them. The researcher collected quantitative exposure data (PATH, 3DSSPP) at the baseline and intervention phases and compared the phases to find out any change in the exposure while using the 'deadman'. Results showed that ergonomic exposures (such as overhead arm and awkward trunk postures and heavy load handling) were reduced at the intervention phase while using the 'deadman' with an electrically operated lift. The concept of the 'deadman', which was shown to help reduce musculoskeletal exposures during ceiling installation, can be used to fabricate a permanent ergonomic tool to support the ceiling drywall panel. Copyright © 2016 Elsevier Ltd and The Ergonomics Society. All rights reserved.

  13. LHC: installation du plus grand trajectographe au silicium du monde

    CERN Multimedia

    2008-01-01

    The installation of the largest silicon trajectograph of the world was concluded at CERN. Thursday December 13 at dawn, the silicon trajectograph with ribbons of CMS (*) began its trip from the principal site of CERN to its installation of experimentation.

  14. Design and installation package for a solar powered pump

    Energy Technology Data Exchange (ETDEWEB)

    1978-07-01

    Information is presented to evaluate the design and installation procedures of a solar powered pump developed by Calmac Manufacturing Company. Included is information about subsystem installation, operation and maintenance requirements, subsystem performance specifications, and detailed design drawings.

  15. The variability of the occurrence of the Field Aligned Irregularities in the middle-latitude F region using the VHF radar observation at Daejon, South Korea.

    Science.gov (United States)

    Oh, S. J.; Kil, H.; Tae-yong, Y.; Kwak, Y. S.; Lee, W. K.

    2016-12-01

    The VHF radar observations at Daejeon in South Korea reveal the highly variable nature of the field-aligned irregularities (FAIs) in the middle-latitude F-region. Medium-scale travelling ionospheric disturbances (MSTIDs) are suggested as the source of FAIs, however, the occurrence climatology of the FAIs cannot be fully explained by the existence of the MSTIDs. Moreover, the occurrence climatology of the FAIs with respect to local time (pre-midnight and post-midnight) likely to have separate onset mechanisms. We investigate the role of the ionospheric disturbances(MSTIDs, Equatorial Plasma Bubbles(EPBs)) in the creation of the FAIs using the radar data at Daejon , the total electron content maps over Japan acquired during 2010-2015. and the measurements of the ion density by Swarm (2014,2015). We assess the causal linkage of the occurrence of the FAIs by examining the correlative occurrence of MSTIDs in middle latitude F-region and EPB in low latitude F-region.

  16. Observations of VHF emissions from 50-mA electron beam injections in the ionosphere that are associated with beam-induced discharges

    Science.gov (United States)

    Goerke, R. T.; Kellogg, P. J.; Monson, S. J.; Franz, R. C.; Nemzek, R. J.; Anderson, H. R.; Potter, D. W.; Denig, W. F.; Szuszczewicz, E. P.; Earle, G. D.

    1992-01-01

    Results are presented of observations of strong VHF plasma waves with amplitudes in excess of 0.1 mV/m (Hz)1/2 associated with 50 mA electron beam injections in the ionosphere. Data from three swept-frequency receivers carried on two daughter payloads are analyzed to determine the emission spectra of the electron beam for various energies and currents. These results were obtained from the rocket-borne experiment SCEX 3, NASA flight 39.002 UE, launched February 1, 1990. The accelerator payload also carried photometers, which measured luminosity at wavelengths of 391.4 and 380.5 nm. Several times during electron gun activity the measured luminosity increased much faster than proportional to the beam current. This nonlinear increase is evidence that a discharge is occurring in the vicinity of the accelerator payload. It is inferred from the uniform distribution of the luminosity around the accelerator payload that the observed discharge extends significantly outside the beam cylinder.

  17. RF installation for the grain disinfestation

    CERN Document Server

    Zajtzev, B V; Kobetz, A F; Rudiak, B I

    2001-01-01

    The ecologically pure method of grain product disinfestations through the grain treatment with the RF electric field is described. The experimental data obtained showed that with strengths of the electrical RF field of E=5 kV/cm and frequency of 80 MHz the relative death rate is 100%.The time of the grain treatment it this case is 1 sec. The pulses with a duration of 600 mu s and repetition rate of 2 Hz were used, the duration of the front was 10 mu s. The schematic layout of installation with a productivity of 50 tones/h and power of 10 kW is given.

  18. Basic electrical installation work level 2

    CERN Document Server

    Linsley, Trevor

    2015-01-01

    Everything needed to pass the first part of the City & Guilds 2365 Diploma in Electrical InstallationsUpdated in line with the 3rd Amendment of the 17th Edition IET Wiring Regulations, this new edition covers the City & Guilds 2365-02 course. Written in an accessible style with a chapter dedicated to each unit of the syllabus, this book helps you to master each topic before moving on to the next. End of chapter revision questions enable learners to check their understanding and consolidate key concepts learnt in each chapter. With a companion website containing videos, animations, worksheets a

  19. Water Sustainability Assessment for Ten Army Installations

    Science.gov (United States)

    2011-03-26

    the severity of this scarcity varies by scenario. It seems that natural condi- tions play a bigger part in water availability for the region than does...question lies with: (1) a picture of how short-term water scarcity might play out across the region, which is outside of the scope of this study, and...ER D C/ CE RL T R- 11 -5 Water Sustainability Assessment for Ten Army Installations Co ns tr uc tio n En gi ne er in g R es

  20. Recommended lighting maintenance practices for Army installations

    Energy Technology Data Exchange (ETDEWEB)

    Kedl, R.J.

    1987-08-01

    A well-maintained lighting system contributes to workforce efficiency and safety. This report recommends routine lighting maintenance practices (primarily relamping and fixture cleaning) for Army installations. The recommendations are derived from consideration of a comparative economic analysis, current maintenance practices in the military and nonmilitary sectors, and information obtained from industry trade and professional associations. Most common sources of interior and exterior illumination are considered: fluorescent, incandescent, and high-intensity discharge. Recommendations concerning window cleaning and wall and ceiling paint are included.

  1. Small wind planning and building successful installations

    CERN Document Server

    Clark, Nolan

    2013-01-01

    This book provides a cohesive guide to achieving successful small wind installations. It is a comprehensive information resource from one of the world's most experienced small wind professionals, covering all the key issues for small wind system development, from site and machine selection to international standards compliance. Engineers who are tasked with planning and developing these small wind systems, from choosing the best site and accurately estimating likely power output to obtaining proper permitting and troubleshooting operational inefficiencies, will find this book an ess

  2. Planning and installing photovoltaic systems a guide for installers, architects and engineers

    CERN Document Server

    Deutsche Gesellschaft für Sonnenenergie (DGS)

    2013-01-01

    New third edition of the bestselling manual from the German Solar Energy Society (DGS), showing you the essential steps to plan and install a solar photovoltaic system. With a global focus, it has been updated to include sections on new technology and concepts, new legislation and the current PV market.Updates cover:new developments in inverter and module technologymarket situation worldwide and outlookintegration to the grid (voltage stabilization, frequency, remote control)new legal requirements for installation and planningoperational costs for dismantling and recyclingfeed-in managementnew requirements for fire protectionnew requirements in Europe for electric waste (Waste Electrical and Electronic Equipment, WEEE) and the restriction of the use of certain hazardous substances (RoHS).Also providing information on current developments in system design, economic analysis, operation and maintenance of PV systems, as well as new software tools, hybrid and tracking systems.An essential manual for installers, e...

  3. General installation of pressurized water reactors; Installation generale des reacteurs a eau sous pression

    Energy Technology Data Exchange (ETDEWEB)

    Kaercher, M. [Electricite de France (EDF), 75 - Paris (France)

    2002-07-01

    This article describes the criteria considered for the installation of PWR reactors according to the most recent French standard: the N4 - 1450 MWe plant series which benefits of the experience feedback of the previous 900 and 1300 MWe series: 1 - functional organization: nuclear island, classical island; 2 - general principles of installation: safety, functional and operation requirements, grouping of equipments inside buildings, criteria of equipments separation; 3 - location of the main equipments, plot plan: specific site constraints, sitting of facilities, leveling; 4 - general installation of buildings: reactor building, fuel building, electrical and auxiliaries building, nuclear auxiliaries building, machines room, pumping station, standby generators building, water storage tank and pool building, effluents processing building; 5 - the EPR european concept: 4 sub-series concept, prevention of serious accidents, annual collective dose. (J.S.)

  4. 49 CFR 192.321 - Installation of plastic pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Installation of plastic pipe. 192.321 Section 192... Transmission Lines and Mains § 192.321 Installation of plastic pipe. (a) Plastic pipe must be installed below ground level except as provided by paragraphs (g) and (h) of this section. (b) Plastic pipe that is...

  5. 49 CFR 192.193 - Valve installation in plastic pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Valve installation in plastic pipe. 192.193... Components § 192.193 Valve installation in plastic pipe. Each valve installed in plastic pipe must be designed so as to protect the plastic material against excessive torsional or shearing loads when the valve...

  6. Canberra Alpha Sentry Installation Functional Design Criteria (FDC)

    Energy Technology Data Exchange (ETDEWEB)

    WHITE, W.F.

    1999-12-16

    This document provides the functional design criteria for the installation of the Canberra Alpha Sentry System at selected locations within the Plutonium Finishing Plant (PFP). The equipment being installed is identified by part number in Section 3 and the locations are given in Section 5. The design, procurement and installation are assigned to Fluor Federal Services.

  7. 14 CFR 31.71 - Function and installation.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Function and installation. 31.71 Section 31... AIRWORTHINESS STANDARDS: MANNED FREE BALLOONS Equipment § 31.71 Function and installation. (a) Each item of installed equipment must— (1) Be of a kind and design appropriate to its intended function; (2) Be...

  8. Installing fonts in LaTeX a user's experience

    NARCIS (Netherlands)

    Hanssen, F.T.Y.

    2003-01-01

    This paper presents a user's experience with installing fonts for use in LaTeX. It will be shown that it is not hard to make a standard Type 1 font work, if you use modern font installation software for LaTeX. All the steps necessary to install the example fonts will be shown. The example fonts used

  9. GAS FLOW IN UNDERWATER BREATHING INSTALLATIONS

    Directory of Open Access Journals (Sweden)

    Anca CONSTANTIN

    2017-11-01

    Full Text Available The open circuit underwater breathing apparatus can be a one or two-stage regulator used in scuba diving or a two-stage regulator used in surface supplied installations. These installations are proper in underwater sites at small depth. The pneumatic circuit of a two-stage regulator is composed mainly of a first stage regulator mounted on the air cylinders and a second stage carried by the diver in his mouth. The two regulators are linked together by a medium pressure hose. The circuit opens when the depression created by the diver’s inhalation, in the second stage body, reaches a certain value. The second stage opening causes a transient movement, namely an expansion wave that propagates through the medium pressure hose to the first stage regulator. The first stage regulator opens and the air in the cylinders is allowed to flow to the diver. The longer the hose, the greater the duration of the expansion wave propagation. Investigations on the wave propagation offer data on the inspiration unsteady motion duration which influences the respiratory effort of the diver.

  10. LHC Installation Scenarios and Dynamic Aperture

    CERN Document Server

    Fartoukh, Stéphane David

    2000-01-01

    The nominal installation strategy of the LHC assumes that each of the 8 arcs of the ring will be equipped with dipoles coming from the same production line. One of the main arguments used to justify this option was the possibility to compensate most of the non-linearities induced by the dipole field errors via a single corrector circuit per arc and per multipole. Indeed, assuming small variations from magnet to magnet within a given production line, the multipolar components of the main dipoles appear as a systematic per arc in this scenario, which, de facto, guarantees their correctability even with a small number of corrector families. All the tracking studies done so far have used this installation scheme to model the field imperfections of the main LHC magnets. According to latest error tables, with the improvement of the dipole field quality, the uncertainty on the systematic field errors per production line has been strongly reduced and becomes quite comparable or even lower than the random multipolar c...

  11. Assembling and Installing LRUs for NIF

    Energy Technology Data Exchange (ETDEWEB)

    Bonanno, R E

    2003-12-31

    Within the 192 National Ignition Facility (NIF) beamlines, there are over 7000 large (40 x 40 cm) optical components, including laser glass, mirrors, lenses, and polarizers. These optics are held in large opto-mechanical assemblies called line-replaceable units (LRUs). Each LRU has strict specifications with respect to cleanliness, alignment, and wavefront so that once activated, each NIF beamline will meet its performance requirements. NIF LRUs are assembled, tested, and refurbished in on-site cleanroom facilities. The assembled LRUs weigh up to 1800 kilograms, and are about the size of a phone booth. They are transported in portable clean canisters and inserted into the NIF beampath using robotic transporters. This plug and play design allows LRUs to be easily removed from the beampath for maintenance or upgrades. Commissioning of the first NIF quad, an activity known as NIF Early Light (NEL), has validated LRU designs and architecture, as well as demonstrated that LRUs can be assembled and installed as designed. Furthermore, it has served to develop key processes and tools forming the foundation for NIF s long-term LRU production and maintenance strategy. As we look forward to building out the rest of NIF, the challenge lies in scaling up the production rate while maintaining quality, implementing process improvements, and fully leveraging the learning and experience gained from NEL. This paper provides an overview of the facilities, equipment and processes used to assemble and install LRUs in NIF.

  12. Selecting parameters of air heating installations

    Energy Technology Data Exchange (ETDEWEB)

    Nazarevich, V.V.; Cherdantsev, N.V.; Bakhtin, G.M. (Kuzbasskii Politekhnicheskii Institut (Russian Federation))

    1993-04-01

    Evaluates types and output of air heating installations used in selected coal basins of the Russian Federation (Kuzbass and Pechora) and Kazakhstan (Karaganda). Types and capacity of mine blowers (VTs, VTsD and VOD), air supply rates and parameters of the air heating installations are comparatively evaluated. Mine shafts used for ventilation in 3 basins are comparatively evaluated considering their air flow rate: 6.4% of shafts with a flow rate to 65 m[sup 3]/s, 12.8% with a flow rate of 65-100 m[sup 3], 20.5% with a flow rate of 101-150, 21.8% with a flow rate of 151-200, 30.8% with a flow rate of 201-300, 6.4% with a flow rate of 301-400 and 1.3% with a flow rate greater than 400 m[sup 3]/s. Recommendations are made for the capacity of air heating systems for individual classes of ventilation shafts.

  13. District heating substations - design and installation

    Energy Technology Data Exchange (ETDEWEB)

    2004-12-15

    These technical regulations for district heating substations are sector-wide regulations for the Swedish district heating sector, describing the design, installation, use and maintenance of substations. If a district heating substation is to operate in the best possible way, the building's space heating and domestic hot water systems must comply with the requirements in these regulations and with those issued by public authorities. These regulations also describe aspects that must be considered when substations need to be replaced. The use then of correct values for the building energy requirements ensures that the new substation will be properly matched to its duties. These regulations are intended for use by: - those responsible for contacts between the district heating supplier and the customer. - those who own, operate and/or administer a building or facility that is heated by district heating. - those who design, manufacture, purchase, test or install substations. It is recommended that enquiries should refer to the Swedish District Heating Association's technical regulations when specifying requirements. The procurement criteria described in these regulations should be applied when evaluating tenders

  14. Performance of Installed Cooking Exhaust Devices

    Energy Technology Data Exchange (ETDEWEB)

    Singer, Brett C.; Delp, William W.; Apte, Michael G.; Price, Philip N.

    2011-11-01

    The performance metrics of airflow, sound, and combustion product capture efficiency (CE) were measured for a convenience sample of fifteen cooking exhaust devices, as installed in residences. Results were analyzed to quantify the impact of various device- and installation-dependent parameters on CE. Measured maximum airflows were 70% or lower than values noted on product literature for 10 of the devices. Above-the-cooktop devices with flat bottom surfaces (no capture hood) – including exhaust fan/microwave combination appliances – were found to have much lower CE at similar flow rates, compared to devices with capture hoods. For almost all exhaust devices and especially for rear-mounted downdraft exhaust and microwaves, CE was substantially higher for back compared with front burner use. Flow rate, and the extent to which the exhaust device extends over the burners that are in use, also had a large effect on CE. A flow rate of 95 liters per second (200 cubic feet per minute) was necessary, but not sufficient, to attain capture efficiency in excess of 75% for the front burners. A-weighted sound levels in kitchens exceeded 57 dB when operating at the highest fan setting for all 14 devices evaluated for sound performance.

  15. SPRAYER INSTALLATION ATTACHED TO THE AGRICULTURAL TRACTOR

    Directory of Open Access Journals (Sweden)

    ȘCHEAUA Fănel

    2015-06-01

    Full Text Available A continually development of the global market economy has in foreground a strong increase in consumer goods demand and offer. The agricultural products have a significant share of total transactions performed on the market. Therefore, it is important that on the cultivated field areas to be obtained optimum harvests that ensure a continuous farms development based on higher crop yields. Today there are many solutions to make the agriculture more efficient regarding crops yield obtained. The use of herbicides aims to maintain the farm lands clean of weeds that may have harmful effects on crops. They can be administered mechanized on large areas using herbicides autonomous installations or attached to the tractor. The agricultural tractor is the machine that performs most of the mechanized works in farmlands using attached auxiliary equipment. The agricultural auxiliary equipments have undergone a continuous development over time. This paper performs a functional description for the sprayer installation assembly that can be attached to the agricultural tractor.

  16. Emotion in Painting and Art Installations.

    Science.gov (United States)

    Konečni, Vladimir J

    2015-01-01

    Paintings are static 2-dimensional images with limited narrative means. On the basis of a critical analysis of the relevant laboratory scaling studies, museum studies, and neuroaesthetic work, the article reaches a negative conclusion about most paintings' ability to engage sufficiently with general viewers' associative-memory systems, so as to lead to identification and empathy, and induce fundamental psychobiological emotions. In contrast, designers of art installations can draw on subtle combinations of several classes of stimulus properties with psychological significance subsumable under the classical concept of the sublime (physical grandeur, rarity, an association with beauty and with biologically significant outcomes), so that some installations may induce the peak aesthetic emotional response, aesthetic awe--as defined in Aesthetic Trinity Theory (Konečni, 2005, 2011), along with the states of being moved and physiological thrills. The approach also involves an analytical skepticism about emotivism, defined as a culturological proclivity for unnecessary insertion of emotion into accounts of mental life and behavior, especially in the arts. Implications for the role of emotion theory in empirical aesthetics are examined.

  17. Case studies of six high priority DOD installations

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1994-11-01

    This is a supplement to the report entitled Environmental Cleanup: Too Many High Priority Sites Impede DOD`s Program. It provides six installation case studies addressing issues including the status of the restoration program, the cost of cleanup to date and projected costs, the cleanup options considered, the option selected, expected completion, and the applicable cleanup standards. The case studies also provide installation specific information on reasons installation was listed on the NPL, the regulatory process, cooperation between the installation and the regulatory agencies, staffing at the installations and the regulatory agencies, and the process for funding the cleanup.

  18. Experience in float over integrated deck -- Design and installation

    Energy Technology Data Exchange (ETDEWEB)

    Sigrist, J.H.; Naudin, J.C.

    1996-12-31

    Since early 1980, Technip-Geoproduction (TPG), as designer or as installation contractor, has been using with success the float over system UNIDECK-TPG for the transportation and installation of integrated decks for offshore platforms. The concept offers the advantages of significant savings in transportation and installation cost by minimizing the installation time and offshore hook-up and eliminating the need for a heavy lift derrick barge. The paper describes the technology used for the installation, the required engineering studies, the consequences of using such a concept on platform design and the selection of an appropriate barge size to be used.

  19. Buffer protection in the installation phase

    Energy Technology Data Exchange (ETDEWEB)

    Wimelius, Hans (Swedish Nuclear Fuel and Waste Management Co., Stockholm (Sweden)); Pusch, Roland (Geodevelopment International AB, Lund (Sweden))

    2008-12-15

    The research and development of the design and construction of the SKB's repository for final disposal of spent reactor fuel is conducted along several paths ('lines'). Issues concerning the bedrock are dealt with in the 'rock line' and those related to buffer and backfill in deposition holes and tunnels are considered in the 'buffer line' and 'backfill line', respectively. These lines also deal with sub-activities that are coupled to several other lines. One of them includes development of techniques for protecting buffer blocks from moisture and water in the installation phase. Techniques and methods for placement and removal of the 'buffer protection sheet' are dealt with in the 'buffer line'. The removal is, however, considered as being part of the backfilling sequence. Since the performance of the sheet is of fundamental importance to the placement and function of the buffer it deserves particular attention. Thus, the removal of the rubber sheet that serves to protect the buffer blocks in the installation phase may be difficult and can cause significant problems that may require retrieval of already placed canister, buffer and backfill. These matters are in focus in the present report. Arrangements for protecting already placed buffer blocks from moist air and water have been tested in earlier large-scale experiments, i.e. the Prototype Repository project at Aespoe but the experience from them has called for more effective protection of the clay blocks as described in the present report. Focus is on the construction of foundation components at the bottom of the deposition holes required for establishing a tight seal between rock and buffer blocks, and on the protection sheet and arrangements for limiting water pressure on it. Special attention is paid to the drainage of the space between rock and protection sheet that is necessary for avoiding failure of the sheet and to systems for achieving

  20. Designing performativity for mixed reality installations

    Directory of Open Access Journals (Sweden)

    Andrew Morrison

    2010-07-01

    Full Text Available This article takes up the concept of performativity prevalent in the humanities and applies it to the design of installation arts in mixed reality mode. Based on the design, development and public access to two specific works, the concept is related to a form of research by design. We argue that the concept of performativity may be further usefully employed in investigations (design and research, artistic and public into digital arts where complex intersections between concepts, technologies, dramaturgy, media and participant actions are in flux and together constitute the emergence and experience of a work. Theories of performativity are related to these two works in an argument that further suggests there is room in research by design to also include ‘performative design’. The article is the result of a wide-ranging interdisciplinary collaboration and aims to convey some sense of that in its reporting style, content and analysis.

  1. vhfRNAi: a web-platform for analysis of host genes involved in viral infections discovered by genome wide RNAi screens.

    Science.gov (United States)

    Thakur, Anamika; Qureshi, Abid; Kumar, Manoj

    2017-06-27

    Knockdown of host genes using high-throughput genome-wide RNA interference screens has identified numerous host factors that affect viral infections, which would be helpful in understanding host-virus interactions. We have developed a vhfRNAi web resource based on genome-wide RNAi experiments for viruses. It contains experimental details of 12 249 entries (host factors + restriction factors) for 18 viruses. Simultaneously, this resource encompasses analysis of overlapping genes, genome wide association studies, gene ontology (GO), pathogen interacting proteins, interaction networks and pathway enrichment. Using overlap analysis, it was found that Influenza A virus shared overlapping host genes with the majority of viruses including Hepatitis C virus and Dengue virus 2. In the genome wide association studies analysis, 429 diseases/traits were mapped, of which obesity-related traits were the most common. GO analysis revealed that the major categories belonged to metabolic processes, molecule transport, signal transduction, proteolysis, etc. In the pathogen interacting protein analysis, protein interaction data from different resources can be explored for further understanding of host-virus biology. By pathway enrichment analysis, a total of 8955 genes were mapped on 303 pathways with most of the hits coming from metabolic pathways. We have found 491 genes that are not essential for the host but essential for the virus and can be targeted to inhibit the virus. These may be explored as potential candidates for drug targets. The resource is freely accessible at and will be useful in understanding host-virus biology as well as identification of targets for the development of antiviral therapeutics.

  2. WHU VHF radar observations of the diurnal tide and its variability in the lower atmosphere over Chongyang (114.14° E, 29.53° N, China

    Directory of Open Access Journals (Sweden)

    C. Huang

    2015-07-01

    Full Text Available The diurnal tide (DT and its variability in the lower atmosphere over Chongyang (114.14° E, 29.53° N were studied based on the newly established Wuhan University (WHU VHF radar observations with the height intervals of 0.145 km (below 9 km and 0.58 km (above 9 km in the whole year of 2012. We find that the DT was the dominant tidal component and showed remarkable height and season variations. A prominent seasonally dependent height variability characteristic is that maximum DT amplitude usually occurs around 6 km in the winter and spring months, which might be due to the tidal wave energy concentration arising from the reflections from the strong eastward tropospheric jet around 13 km and the ground surface. Our results suggest that the background wind is a crucial cause for height variability and seasonal variability of DT. In April 2012, a notable strengthening of DT is observed. Meanwhile, the significant higher harmonics of tides, i.e., the semidiurnal, terdiurnal, and even quarterdiurnal tides, can also be observed, which has seldom been reported. Interestingly, these four tidal components displayed consistent short-term variability, implying that they were excited by the same dramatically varying tidal source. In addition, we identified two symptoms of the coupling of DT and planetary waves (PWs, which can also lead to the short-term DT variability. One is the sum and difference interactions between DT and PWs, causing the tidal amplitude short-term variability as a consequence of the energy exchange among the interacting waves. The other one is the modulation of DT by PWs, leading to that the amplitude of DT varies with the periods of the PWs.

  3. Heat flux and thermal conduction in O+ and H+ ion flows deduced from EISCAT-VHF radar observations in the high-latitude topside ionosphere

    Science.gov (United States)

    Wu, Jian; Taieb, Charley

    1994-06-01

    With two periods of EISCAT-VHF radar observations, magnetically quiet and moderately disturbed, we have calculated the H+ and O+ heat fluxes in using formulae of Wu and Taieb (1993), accounting not only for temperature gradients but also for pressure gradients, velocity gradients, and diffusion-thermal effects. They correspond to different physical processes that are calculated and compared between them. Then, the general features of the H+ and O+ ion thermal conductions are studied during the two periods of observation in the high-latitude topside ionosphere. The analysis of the two periods of measurements revealed the following trends, to be confirmed by further observations: (1) During the two periods the H+ heat flux Q2 is always upward in the altitude range from 600 km up to about 1000 km. It is larger during the quiet period than during the disturbed period. (2) The most important dominant mechanism for H+ heat flux is the diffusion-thermal effect due to the H+-O+ collision, with a correcting term due to the H+ temperature gradient. (3) The O+ heat flux is always downward in the same altitude range during the two periods of observations. The absolute value during the disturbed period is slightly larger than that during the quiet period. (4) The dominant mechanism for O+ heat flux is its temperature gradient, corrected by the coupling with the H+ ion. (5) The O+ thermal conduction is less important during the quiet period than during the disturbed period, while for the H+ thermal conduction it is the contrary. (6) The H+ thermal conduction increases with altitude below about 1000 km.

  4. Effects of child restraint system features on installation errors.

    Science.gov (United States)

    Klinich, Kathleen D; Manary, Miriam A; Flannagan, Carol A C; Ebert, Sheila M; Malik, Laura A; Green, Paul A; Reed, Matthew P

    2014-03-01

    This study examined how child restraint system (CRS) features contribute to CRS installation errors. Sixteen convertible CRS, selected to include a wide range of features, were used in volunteer testing with 32 subjects. Subjects were recruited based on their education level (high or low) and experience with installing CRS (none or experienced). Each subject was asked to perform four child restraint installations in the right-rear passenger seat of a 2006 Pontiac G6 sedan using a crash dummy as a child surrogate. Each subject installed two CRS forward-facing (FF), one with LATCH and one with the vehicle seatbelt, and two CRS rear-facing (RF), one with LATCH and one with the seatbelt. After each installation, the experimenter evaluated 42 factors for each installation, such as choice of belt routing path, tightness of installation, and harness snugness. Analyses used linear mixed models to identify CRS installation outcomes associated with CRS features. LATCH connector type, LATCH strap adjustor type, and the presence of belt lockoffs were associated with the tightness of the CRS installation. The type of harness shoulder height adjuster was associated with the rate of achieving a snug harness. Correct tether use was associated with the tether storage method. In general, subject assessments of the ease-of-use of CRS features were not highly correlated with the quality of their installation, suggesting a need for feedback with incorrect installations. The data from this study provide quantitative assessments of some CRS features that were associated with reductions in CRS installation errors. These results provide child restraint designers with design guidelines for developing easier-to-use products. Research on providing effective feedback during the child restraint installation process is recommended. Copyright © 2013 Elsevier Ltd and The Ergonomics Society. All rights reserved.

  5. Preventive medicine oversight of splash pads on military installations.

    Science.gov (United States)

    Hardcastle, Lisa Raysby; Perry, Matthew; Browne, Ashley

    2015-01-01

    Over the past several years, an increasing number of military installations have installed splash pads that provide fun, recreational water entertainment for Soldiers and their families. The addition of splash pads brings added responsibilities for medical treatment facility preventive medicine oversight and installation facilities maintenance to ensure a safe and healthy environment. Currently, there are no consistent standards or detailed guidance for military installations to follow when installing and maintaining splash pads. The central issues associated with splash pads on military installations are water quality and risk for waterborne illnesses, responsibility for safety and health oversight, and federal energy and water sustainability mandates. This article examines the importance of implementing a standard for design and oversight to ensure the health and safety of Soldiers and their families.

  6. Advanced Measuring (Instrumentation Methods for Nuclear Installations: A Review

    Directory of Open Access Journals (Sweden)

    Wang Qiu-kuan

    2012-01-01

    Full Text Available The nuclear technology has been widely used in the world. The research of measurement in nuclear installations involves many aspects, such as nuclear reactors, nuclear fuel cycle, safety and security, nuclear accident, after action, analysis, and environmental applications. In last decades, many advanced measuring devices and techniques have been widely applied in nuclear installations. This paper mainly introduces the development of the measuring (instrumentation methods for nuclear installations and the applications of these instruments and methods.

  7. Installation package for a Sunspot Cascade Solar Water Heating System

    Energy Technology Data Exchange (ETDEWEB)

    None

    1980-09-01

    Elcam, Incorporated of Santa Barbara, California, has developed two solar water heating systems. The systems have been installed at Tempe, Arizona and San Diego, California. The systems consist of the following: collector, collector-tank water loop, solar tank, conventional tank and controls. General guidelines are provided which may be utilized in development of detailed instalation plans and specifications. In addition, it provides instruction on operation, maintenance and installation of solar hot water systems.

  8. Integrating Environmental Impact Assessment with Master Planning at Army Installations

    Science.gov (United States)

    2002-05-01

    background on both the benefits and problems of NEPA integration into early agency planning. Army land use planning , the subject of this paper, focuses on...making. Rather, this research focuses on the land use planning associated with on-going activities at the installation level. This installation master...installation master plan within the past five years. Thus, other recent cases of NEPA documents for Army land use planning were also pursued. These

  9. Installing and Scaling out Ubuntu Enterprise Cloud in Virtual Environment

    DEFF Research Database (Denmark)

    Pantić, Zoran; Ali Babar, Muhammad

    This document contains the supplemental material to the book “Guidelines for Building a Private Cloud Infrastructure”. This document provides guidance on how to install Ubuntu Enterprise Cloud in virtual environment, and afterwards how to scale out when needed. The purpose of this supplemental book...... is to provide a practical, step-by-step, detailed guide on how to dimension and install the machines and network. Some initial steps of configuring the cloud are also covered. The installation is performed in a virtual environment based on Windows 7 and VMware Workstation 7. The cloud installation is performed...... cloud, both using the command line tools, and GUI based tool HybridFox....

  10. 24 CFR 3286.203 - Installation license required.

    Science.gov (United States)

    2010-04-01

    ... home manufacturer under warranty or other obligations or service agreements; (6) Installations performed by authorized representatives of the Federal Emergency Management Agency in order to provide...

  11. Ship and Installation Program: Optimal Stationing of Naval Ships

    National Research Council Canada - National Science Library

    Colgary, Katherine A; Willett, Devon K

    2006-01-01

    .... Using constraints that maintain adequate pier capacity and unique capability installation, Configuration Analysis seeks to maximize a measure of military value while penalizing excess capacity...

  12. Tilecal towards the Installation at Cruise Speed

    CERN Multimedia

    Miralles, Ll

    Over the last month the Tile Calorimeter has made a major step in its way towards its assembly in ATLAS. Late February the final EndCap supports were installed and the load (200 Tn) transferred from the assembly cradle to the supports. By mid-March, 32 Endcap modules, 50% of the total with a weight of 350 Tn were pre-assembled in bldg. 185 at CERN. At this stage the assembly is inside its geometrical envelope and the tooling and procedures have been developed. The ATLAS Tile Calorimeter is composed of 3 cylinders ("barrels") of steel, scintillating tiles and optical fibers, altogether about 12 m long, with an outer diameter of 8.4 m, inner diameter of 4.5 m and weighing about 2800 tons. The central cavity will contain the Liquid Argon cryostats, and the whole calorimetry system will measure the direction and energy of jets produced at the LHC, as well as the missing transverse energy, which - as everyone knows - is one of the telltale signals of new and exciting physics. Each of the three cylinders is divid...

  13. Minimal Technologies Application Project: Planning and installation

    Energy Technology Data Exchange (ETDEWEB)

    Zellmer, S.D.; Hinchman, R.R.; Severinghaus, W.D.; Johnson, D.O.; Brent, J.J.

    1989-03-01

    Intensive and continuous tactical training during the last 35 years at the Hohenfels Training Area in West Germany has caused the loss of vegetative ground cover and has accelerated soil erosion rates, resulting in extensive environmental damage, safety hazards, and unrealistic training habitats. The objectives of this project are to develop and evaluate revegetation procedures for establishing adequate vegetative cover to control erosion at minimal costs and disruption to training activities. This project involved the development and installation of 12 revegetation procedures that combined four seedbed preparation methods and seeding options with three site-closure periods. In March 1987, the four seedbed preparation/seeding options and closure periods were selected, a study site design and location chosen, and specifications for the revegetation procedures developed. A German rehabilitation contractor attempted the specified seedbed preparation and seeding on the 13.5-ha site in June, but abnormally high rainfall, usually wet site conditions, and lack of adequate equipment prevented the contractor from completing six of the 12 planned procedures. Planning and execution of the project has nonetheless provided valuable information on the importance and use of soil analytical results, seed availability and cost data, contractor equipment requirements, and time required for planning future revegetation efforts. Continued monitoring of vegetative ground cover at the site for the next two years, combined with cost information, will provide necessary data to determine which of the six revegetation procedures is the most effective. These data will be used in planning future rehabilitation efforts on tactical training areas.

  14. Production Facility Prototype Blower Installation Report

    Energy Technology Data Exchange (ETDEWEB)

    Woloshun, Keith Albert [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Dale, Gregory E. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Dalmas, Dale Allen [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Romero, Frank Patrick [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-07-28

    The roots blower in use at ANL for in-beam experiments and also at LANL for flow tests was sized for 12 mm diameter disks and significantly less beam heating.  Currently, the disks are 29 mm in diameter, with a 12 mm FWHM Gaussian beam spot at 42 MeV and 2.86 μA on each side of the target, 5.72 μA total. The target design itself is reported elsewhere.  With the increased beam heating, the helium flow requirement increased so that a larger blower was need for a mass flow rate of 400 g/s at 2.76 MPa (400 psig).  An Aerzen GM 12.4 blower was selected, and is currently being installed at the LANL facility for target and component flow testing.  This report describes this blower/motor/ppressure vessel package and the status of the facility preparations.

  15. Solid targetry at the TESLA Accelerator Installation

    CERN Document Server

    Comor, J J; Rajcevic, M; Kosutic, D; Spasic, M; Vidovic, A; Duricic, J; Nedeljkovic, N

    2002-01-01

    According to the concept of the TESLA Accelerator Installation, the channel for production of radioisotopes has to routinely produce sup 2 sup 0 sup 1 Tl, sup 1 sup 1 sup 1 In, sup 6 sup 7 Ga, sup 1 sup 2 sup 3 I and sup 1 sup 8 F, and a number of other radionuclides for experimental purposes. The production of sup 1 sup 2 sup 3 I and sup 1 sup 8 F will be performed in dedicated, commercial target stations, while a versatile solid target irradiation system is designed for the routine and experimental production of all other radioisotopes. The solid target station is designed to accept targets for both the 7 deg. and 90 deg. irradiation geometry. The targets used for the routine production will be prepared by electroplating on a silver substrate. They can be irradiated with a 1.5 kW beam using the 7 deg. geometry. The cooling of these targets is enhanced by fins on the back of the silver substrate designed so that the highest temperature on the surface of the target does not exceed 110 deg. C. The irradiation ...

  16. IPPC installations in France and limit values of emission; Installations IPPC en France et valeurs limites d'emission

    Energy Technology Data Exchange (ETDEWEB)

    Soleille, S

    2004-07-15

    The IPPC directive of the 24 September 1996 asked for the main european industrial installations an authorization. This authorization fixes limit values for pollutant emissions. In France, the main industrial installations are controlled since many years in the framework of the regulation on classified installations for the environment protection (ICPE). This report compares the limit values of emissions for the national and prefectorial orders and for the IPPC directive. (A.L.B.)

  17. Level-Oriented Diagnosis for Indoor Climate Installations

    NARCIS (Netherlands)

    Yu, B.

    2003-01-01

    Indoor climate installations are widely used in modern office buildings. Statistical data show that the energy consumption in buildings has grown quickly in the past decades. A considerable part is due to inefficient and improper operations of installations. Therefore, Fault Detection and Diagnosis

  18. 30 CFR 75.340 - Underground electrical installations.

    Science.gov (United States)

    2010-07-01

    ... electrical installations. (a) Underground transformer stations, battery charging stations, substations... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Underground electrical installations. 75.340 Section 75.340 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR COAL MINE...

  19. Installation, care, and maintenance of wood shake and shingle siding

    Science.gov (United States)

    Jack Dwyer; Tony Bonura; Arnie Nebelsick; Sam Williams; Christopher G. Hunt

    2011-01-01

    This article gives general guidelines for selection, installation, finishing, and maintenance of wood shakes and shingles. The authors gathered information from a variety of sources: research publications on wood finishing, technical data sheets from paint manufacturers, installation instructions for shake and shingle siding, and interviews with experts having...

  20. Forecasting Climate-Induced Ecosystem Changes on Military Installations

    Science.gov (United States)

    James D. Westervelt; William W. Hargrove

    2011-01-01

    Military installation training lands must be managed to support species at risk as well as to be effective training environments for soldiers. Forecasts from various global climate change models suggest that the habitats associated with some military training installations will face pressures that induce biome-shifts, invasive species, loss of habitat, and changes in...

  1. You're a What? Solar Photovoltaic Installer

    Science.gov (United States)

    Torpey, Elka Maria

    2009-01-01

    This article talks about solar photovoltaic (PV) installer and features Rebekah Hren, a solar PV installer who puts solar panels on roofs and in other sunny places to turn the sun's power into electricity. Hren enjoys promoting renewable energy, in part because it's an emerging field. In solar PV systems, solar cells--devices that convert sunlight…

  2. Solution for Improve the Efficiency of Solar Photovoltaic Installation

    OpenAIRE

    Petru Chioncel; Cristian Paul Chioncel; Nicoleta Gillich

    2013-01-01

    This paper present a solution for improving efficiency of solar photovoltaic installation, realized with fixed solar photovoltaic modules, placed in solar parks or individual installations. The proposed solution to increase the radiation on the solar photovoltaic panels is to use some thin plates covered with a reflective blanket, mounted in front of the solar photovoltaic modules, with the possibility of their adjustment.

  3. 49 CFR 192.359 - Customer meter installations: Operating pressure.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Customer meter installations: Operating pressure... SAFETY TRANSPORTATION OF NATURAL AND OTHER GAS BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Customer Meters, Service Regulators, and Service Lines § 192.359 Customer meter installations: Operating pressure...

  4. 49 CFR 192.357 - Customer meters and regulators: Installation.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Customer meters and regulators: Installation. 192... SAFETY TRANSPORTATION OF NATURAL AND OTHER GAS BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Customer Meters, Service Regulators, and Service Lines § 192.357 Customer meters and regulators: Installation. (a...

  5. 46 CFR 58.10-5 - Gasoline engine installations.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Gasoline engine installations. 58.10-5 Section 58.10-5... MACHINERY AND RELATED SYSTEMS Internal Combustion Engine Installations § 58.10-5 Gasoline engine... drained by a device for automatic return of all drip to engine air intakes. (2) All gasoline engines must...

  6. Design and installation package for solar hot water system

    Energy Technology Data Exchange (ETDEWEB)

    1978-12-01

    This report contains the design and installation procedure for the Solar Engineering and Manufacturing Company's solar hot water system. Included are the system performance specifications, system design drawings, hazard analysis and other information necessary to evaluate the design and instal the system.

  7. Delta FUSE Fairing Installation at Launch Complex 17A

    Science.gov (United States)

    1999-01-01

    This NASA Kennedy Space Center (KSC) video release presents footage of the June 19, 1999 installation of the fairing around the Far Ultraviolet Spectroscopic Explorer (FUSE) spacecraft. The spacecraft was previously mated to the Boeing Delta II rocket. Installation took place on Pad A of Launch Complex 17.

  8. 30 CFR 75.516-1 - Installed insulators.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Installed insulators. 75.516-1 Section 75.516-1 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR COAL MINE SAFETY AND HEALTH... insulators. Well-insulated insulators is interpreted to mean well-installed insulators. Insulated J-hooks may...

  9. 24 CFR 3285.402 - Ground anchor installations.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Ground anchor installations. 3285....402 Ground anchor installations. (a) Ground anchor certification and testing. Each ground anchor must... registered architect must certify, the ground anchor for use in a classified soil (refer to § 3285.202...

  10. 46 CFR 58.20-15 - Installation of refrigerating machinery.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Installation of refrigerating machinery. 58.20-15 Section 58.20-15 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE ENGINEERING MAIN... refrigerating machinery. (a) Where refrigerating machines are installed in which anhydrous ammonia is used as a...

  11. 30 CFR 75.310 - Installation of main mine fans.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Installation of main mine fans. 75.310 Section 75.310 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR COAL MINE SAFETY AND HEALTH MANDATORY SAFETY STANDARDS-UNDERGROUND COAL MINES Ventilation § 75.310 Installation of main...

  12. Bridging interpersonal installation art with tangible business modeling

    DEFF Research Database (Denmark)

    Mitchell, Robb

    2012-01-01

    This position paper introduces an exploration of what deploying physical artefacts to enliven discussions about business innovation has in common with building room sized mechanical installations to provoke social interaction.......This position paper introduces an exploration of what deploying physical artefacts to enliven discussions about business innovation has in common with building room sized mechanical installations to provoke social interaction....

  13. Progress Report 1 January 1983 - 31 December 1984. Computer Installation

    DEFF Research Database (Denmark)

    Risø National Laboratory, Roskilde

    This report describes selected parts of the activities at the Computer Installation of Risa National Laboratory in 1983 and 1984. Information given may be preliminary.......This report describes selected parts of the activities at the Computer Installation of Risa National Laboratory in 1983 and 1984. Information given may be preliminary....

  14. Progress Report. 1 January 1981 - 31 December 1982. Computer Installation

    DEFF Research Database (Denmark)

    Risø National Laboratory, Roskilde

    This report describes selected parts of the activities at the Computer Installation of Risø National Laboratory in 1981 and 1982. Information given may be preliminary.......This report describes selected parts of the activities at the Computer Installation of Risø National Laboratory in 1981 and 1982. Information given may be preliminary....

  15. Developing Headquarters Guidance for Army Installation Sustainability Plans in 2007

    Science.gov (United States)

    2009-01-01

    leverage off strong installation pollution prevention, energy man- agement, environmental management systems (EMSs) (such as ISO 14001 implemen- tation...Plans in 2007 Fort Campbell, “Sustainable Installation Management System ISO 14001 .” Fort Campbell, KY, 15 January 2006. As of October 19, 2006

  16. The new installation at the Nijmegen High Field Magnet Laboratory

    NARCIS (Netherlands)

    Perenboom, J.A.A.J.; Wiegers, S.A.J.; Christianen, P.C.M.; Zeitler, U.; Maan, J.C.

    2004-01-01

    For research in the highest continuous and pulsed magnetic fields large, complex and powerful installations are needed. A new 20 MW installation has been built at the University of Nijmegen. The ultra-low ripple power converter, delivering 40 kA at up to 500 V, provides the capability to perform

  17. 49 CFR 192.361 - Service lines: Installation.

    Science.gov (United States)

    2010-10-01

    ... millimeters) of cover in streets and roads. However, where an underground structure prevents installation at... drainage. Where condensate in the gas might cause interruption in the gas supply to the customer, the... buildings. Each underground service line installed below grade through the outer foundation wall of a...

  18. Installing Ubuntu Enterprise Cloud in a Physical Environment

    DEFF Research Database (Denmark)

    Pantić, Zoran; Ali Babar, Muhammad

    This document contains the supplemental material to “Guidelines for Building a Private Cloud Infrastructure.” This supplemental material provides guidance on how to install Ubuntu Enterprise Cloud in a physical environment. The purpose of this document is to provide a practical, step......-by-step, detailed guide on how to pre-configure and install the machines and network. For more detailed description of the steps, a reader is advised to refer to another supplemental book named “Installing and Scaling out Ubuntu Enterprise Cloud in Virtual Environment.” There are a few more details, accompanied...... with screenshots. The material included in this supplemental document is based on the installation that was performed in a physical environment based on HP ProLiant DL380 G4 servers, 100 Mbit/s witches, and a firewall/router that isolated the whole solution. The cloud installation was performed using the (for...

  19. Installation and Commissioning Automated Demand Response Systems

    Energy Technology Data Exchange (ETDEWEB)

    Global Energy Partners; Pacific Gas and Electric Company; Kiliccote, Sila; Kiliccote, Sila; Piette, Mary Ann; Wikler, Greg; Prijyanonda, Joe; Chiu, Albert

    2008-04-21

    defined and programmed strategies if convenient to the facility. From 2003 through 2006 Lawrence Berkeley National Laboratory (LBNL) and the Demand Response Research Center (DRRC) developed and tested a series of demand response automation communications technologies known as Automated Demand Response (Auto-DR). In 2007, LBNL worked with three investor-owned utilities to commercialize and implement Auto-DR programs in their territories. This paper summarizes the history of technology development for Auto-DR, and describes the DR technologies and control strategies utilized at many of the facilities. It outlines early experience in commercializing Auto-DR systems within PG&E DR programs, including the steps to configure the automation technology. The paper also describes the DR sheds derived using three different baseline methodologies. Emphasis is given to the lessons learned from installation and commissioning of Auto-DR systems, with a detailed description of the technical coordination roles and responsibilities, and costs.

  20. Installation of Ohio's First Electrolysis-Based Hydrogen Fueling Station

    Science.gov (United States)

    Scheidegger, Brianne T.; Lively, Michael L.

    2012-01-01

    This paper describes progress made towards the installation of a hydrogen fueling station in Northeast Ohio. In collaboration with several entities in the Northeast Ohio area, the NASA Glenn Research Center is installing a hydrogen fueling station that uses electrolysis to generate hydrogen on-site. The installation of this station is scheduled for the spring of 2012 at the Greater Cleveland Regional Transit Authority s Hayden bus garage in East Cleveland. This will be the first electrolysis-based hydrogen fueling station in Ohio.

  1. DoD Installations, Energy and the Environment: An Update

    Science.gov (United States)

    2011-05-10

    DoD Installations, Energy and the Environment : An Update Dorothy Robyn Deputy Under Secretary of Defense Installations & Environment E2S2 Symposium...REPORT DATE 10 MAY 2011 2. REPORT TYPE 3. DATES COVERED 00-00-2011 to 00-00-2011 4. TITLE AND SUBTITLE DoD Installations, Energy and the ... Environment : An Update 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) 5d. PROJECT NUMBER 5e. TASK NUMBER 5f. WORK UNIT

  2. Sistema de adquisición de datos para la medición de parámetros radioeléctricos en antenas lineales en la banda de TV de VHF y UHF System of acquisition of information for measurement of radioelectric parameters in linear antennas in the band of VHF and UHF’s television

    Directory of Open Access Journals (Sweden)

    María del Pilar Celemín

    2007-06-01

    Full Text Available Este proyecto desarrolla un sistema de adquisición y procesamiento de datos para la medición y ajuste de parámetros radioeléctricos de antenas lineales en las bandas de VHF y UHF. Como señal de prueba se utilizan algunas de las señales de televisión que se encuentran en el espectro radioeléctrico, provenientes de los transmisores que radian señales de canales nacionales. El receptor implementado incluye un sintonizador comercial de televisión que toma como muestra la señal portadora de video. Esta señal es amplificada, filtrada, almacenada y acondicionada, para ser leída por el puerto serial de un computador personal y procesada empleando un programa en Visual Basic, con una interfaz gráfica que permite una interacción amigable con el usuario. Desde acá se interactúa con un microcontrolador que controla el mecanismo de posicionamiento de la antena receptora por medio de una estructura electromecánica, que le permite ejecutar movimientos en dos grados de libertad: en azimut y en elevación. Con esto se logra un sistema capaz de determinar automáticamente el apuntamiento óptimo de la antena de acuerdo al máximo nivel de recepción de señal. Así mismo, se determinan parámetros propios de la antena tales como: el patrón de radiación (tanto en el plano horizontal como vertical, la ganancia directiva de la antena, la ganancia en cada uno de los puntos que conforman el plano principal, y otros parámetros de interés para el análisis de las características reales de antenas lineales.This project develops a data acquisition and processing system for measuring and adjusting lineal-antenna radioelectric parameters in VHF and UHF. Television signals are used as test signal. They can be found in radio electric spectrum, as they come from commercial transmitters that broadcast signals of national channels. The achieved receptor includes a television commercial tuner for obtaining video signal. Later, this signal is conditioning to

  3. Preliminary assessment report for Fort Jacob F. Wolters, Installation 48555, Mineral Wells, Texas. Installation Restoration Program

    Energy Technology Data Exchange (ETDEWEB)

    Dennis, C.B.

    1993-08-01

    This report presents the results of the preliminary assessment (PA) conducted by Argonne National Laboratory at the Texas Army National Guard (TXARNG) property near Mineral Wells, Texas. Preliminary assessments of federal facilities are being conducted to compile the information necessary for completing preremedial activities and to provide a basis for establishing corrective actions in response to releases of hazardous substances. The principal objective of the PA is to characterize the site accurately and determine the need for further action by examining site activities, quantities of hazardous substances present, and potential pathways by which contamination could affect public health and the environment. This PA satisfies, for the Fort Wolters property, the requirement of the Department of Defense Installation Restoration Program.

  4. Preliminary assessment report for Camp Swift Military Reservation, Installation 48070, Bastrop County, Texas. Installation Restoration Program

    Energy Technology Data Exchange (ETDEWEB)

    Dennis, C.B.

    1993-08-01

    This report presents the results of the preliminary assessment (PA) conducted by Argonne National Laboratory at the Texas Army National Guard property in Bastrop County, Texas. Preliminary assessments of federal facilities are being conducted to compile the information necessary for completing preremedial activities and to provide a basis for establishing corrective actions in response to releases of hazardous substances. The principal objective of the PA is to characterize the site accurately and determine the need for further action by examining site activities, quantities of hazardous substances present, and potential pathways by which contamination could affect public health and the environment. This PA satisfies, for the Camp Swift property, the requirement of the Department of Defense Installation Restoration Program (IRP). The review of both historical and current practices at the property indicated that the activities at Camp Swift include no operations considered to have an adverse impact to the environment. The recommendation, therefore, is that no further IRP action is necessary at this property.

  5. Preliminary assessment report for Waiawa Gulch, Installation 15080, Pearl City, Oahu, Hawaii. Installation Restoration Program

    Energy Technology Data Exchange (ETDEWEB)

    1993-08-01

    This report presents the results of the preliminary assessment (PA) conducted by Argonne National Laboratory at the Hawaii Army National Guard (HIARNG) property near Pearl City, Oahu, Hawaii. Preliminary assessments of federal facilities are being conducted to compile the information necessary for completing preremedial activities and to provide a basis for establishing corrective actions in response to releases of hazardous substances. The principal objective of the PA is to characterize the site accurately and determine the need for further action by examining site activities, quantities of hazardous substances present, and potential pathways by which contamination could affect public health and the environment. This PA satisfies, for the Waiawa Gulch property, phase I of the Department of Defense Installation Restoration Program (IRP).

  6. Ionospheric plasma by VHF waves

    Indian Academy of Sciences (India)

    ... chart recorder at Varanasi during 1991 to 1999. The amplitude fluctuations having peak to peak variations>1 dB have been con- sidered for the present analysis. At Varanasi scintillations are frequently observed during nighttime, hence only nocturnal variation of irregularities in different months and sea- sons are studied.

  7. Progress of the Electrical Installation Work for LHC

    CERN Document Server

    Pedersen, J

    2001-01-01

    During the year 2000 the ST-EL group has performed a number of electrical installations within the LHC project. The 18 kV substation of zone 18 has been entirely renovated and the installations in the SD, SMA and SHM buildings terminated. In access point 5 the SX, SY, SH and SF buildings are either completed or have seen the installation advance according to schedule. The preparations for the injection tunnels and the buildings BA 4 and BA 7 have continued. The study work for the LHC general service is progressing well, supported by a study office, staffed by contracted personnel. The possibilities for an ST-EL support for the cabling of the experiments is currently being investigated by a joint EST - ST working group. A new activity to be taken over by the group is the optical fibre installation. The specialist team from SL joined the group the first of January 2001 and is presently settling in ST .

  8. INSTALLATION OF THE LHC LONG STRAIGHT SECTIONS (LSS)

    CERN Document Server

    Bartolome-Jimenez, S

    2005-01-01

    The LHC long straight sections (LSS) serve as experimental or utility insertions. There are two high luminosity experimental insertions located at Point 1 and 5 and two more experimental insertions at Point 2 and 8 which also contain the injection systems. The beams only cross at these four locations and are focused by superconducting low-beta triplets. Insertions 3 and 7 each contain two collimation systems. Insertion 4 contains two RF systems. Insertion 6 contains the beam dumping system. The installation of the LSS is a challenge due to the compact layout that characterise these areas and the difficulties related to the underground work mainly in zones of restricted access. Specific devices are required for handling and installing various heavy and voluminous elements. This paper reviews the installation scenarios, describes the sequences presently planned and highlights the potential problem areas. The particular case of sector 7-8 where the LSS elements will be installed in parallel with the cryogenic di...

  9. Installation of the LHC Long Straight Sections (LSS)

    CERN Document Server

    Bartolome-Jimenez, Sonia

    2005-01-01

    The LHC long straight sections (LSS) serve as experimental or utility insertions. There are two high luminosity experimental insertions located at points 1 and 5 and two more experimental insertions at points 2 and 8 which also contain the injection systems. The beams only cross at these four locations and are focused by superconducting low-beta triplets. Insertions 3 and 7 each contain two collimation systems. Insertion 4 contains two RF systems. Insertion 6 contains the beam dumping system. The installation of the LSS is a challenge due to the compact layout that characterises these areas and the difficulties related to the underground work mainly in zones of restricted access. Specific devices are required for handling and installing various heavy and voluminous elements. This paper reviews the installation scenarios, describes the sequences presently planned and highlights the potential problem areas. The particular case of sector 7-8 where the LSS elements will be installed in parallel with the cryogenic...

  10. Development of cryogenic installations for large liquid argon neutrino detectors

    CERN Document Server

    Adamowski, M; Geynisman, M; Hentschel, S; Montanari, D; Nessi, M; Norris, B

    2015-01-01

    A proposal for a very large liquid argon (68,000 kg) based neutrino detector is being studied. To validate the design principles and the detector technology, and to gain experience in the development of the cryostats and the cryogenic systems needed for such large experiments, several smaller scale installations will be developed and implemented, at Fermilab and CERN. The cryogenic systems for these installations will be developed, constructed, installed and commissioned by an international engineering team. These installations shall bring the required cooling power under specific conditions to the experiments for the initial cool-down and the long term operation, and shall also guarantee the correct distribution of the cooling power within the cryostats to ensure a homogeneous temperature distribution within the cryostat itself. The cryogenic systems shall also include gaseous and liquid phase argon purification devices to be used to reach and maintain the very stringent purity requirements needed for these...

  11. 7 CFR 58.314 - General construction, repair and installation.

    Science.gov (United States)

    2010-01-01

    ... Service 1 Equipment and Utensils § 58.314 General construction, repair and installation. All equipment and utensils necessary to the manufacture of butter and related products shall meet the same general...

  12. Siren system installed to alert campus community to emergency events

    OpenAIRE

    Miller, Allan

    2006-01-01

    Virginia Tech is installing a system of warning sirens to alert the campus community to emergency events. The first test of the siren system is scheduled to occur on Wednesday, April 19, at 12:10 p.m.

  13. Ceremony to mark the installation of first magnet at LEP

    CERN Multimedia

    CERN Audiovisual Team

    1987-01-01

    Speech from French Prime Minister Jacques Chirac following the installation of the first magnet at LEP on 4 June 1987. And from Herwig Schopper, CERN Director-General; Swiss President Pierre Aubert and Wolfgang Kummer, President of the CERN Council.

  14. Offshore Wind Energy Cost Modeling Installation and Decommissioning

    CERN Document Server

    Kaiser, Mark J

    2012-01-01

    Offshore wind energy is one of the most promising and fastest growing alternative energy sources in the world. Offshore Wind Energy Cost Modeling provides a methodological framework to assess installation and decommissioning costs, and using examples from the European experience, provides a broad review of existing processes and systems used in the offshore wind industry. Offshore Wind Energy Cost Modeling provides a step-by-step guide to modeling costs over four sections. These sections cover: ·Background and introductory material, ·Installation processes and vessel requirements, ·Installation cost estimation, and ·Decommissioning methods and cost estimation.  This self-contained and detailed treatment of the key principles in offshore wind development is supported throughout by visual aids and data tables. Offshore Wind Energy Cost Modeling is a key resource for anyone interested in the offshore wind industry, particularly those interested in the technical and economic aspects of installation and decom...

  15. Rapid installation of numerical models in multiple parent codes

    Energy Technology Data Exchange (ETDEWEB)

    Brannon, R.M.; Wong, M.K.

    1996-10-01

    A set of``model interface guidelines``, called MIG, is offered as a means to more rapidly install numerical models (such as stress-strain laws) into any parent code (hydrocode, finite element code, etc.) without having to modify the model subroutines. The model developer (who creates the model package in compliance with the guidelines) specifies the model`s input and storage requirements in a standardized way. For portability, database management (such as saving user inputs and field variables) is handled by the parent code. To date, NUG has proved viable in beta installations of several diverse models in vectorized and parallel codes written in different computer languages. A NUG-compliant model can be installed in different codes without modifying the model`s subroutines. By maintaining one model for many codes, MIG facilitates code-to-code comparisons and reduces duplication of effort potentially reducing the cost of installing and sharing models.

  16. Optimal Installation for Electric Vehicle Wireless Charging Lanes

    OpenAIRE

    Ushijima-Mwesigwa, Hayato; Khan, MD Zadid; Chowdhury, Mashrur A; Safro, Ilya

    2017-01-01

    Range anxiety, the persistent worry about not having enough battery power to complete a trip, remains one of the major obstacles to widespread electric-vehicle adoption. As cities look to attract more users to adopt electric vehicles, the emergence of wireless in-motion car charging technology presents itself as a solution to range anxiety. For a limited budget, cities could face the decision problem of where to install these wireless charging units. With a heavy price tag, an installation wi...

  17. Solution for Improve the Efficiency of Solar Photovoltaic Installation

    Directory of Open Access Journals (Sweden)

    Petru Chioncel

    2013-01-01

    Full Text Available This paper present a solution for improving efficiency of solar photovoltaic installation, realized with fixed solar photovoltaic modules, placed in solar parks or individual installations. The proposed solution to increase the radiation on the solar photovoltaic panels is to use some thin plates covered with a reflective blanket, mounted in front of the solar photovoltaic modules, with the possibility of their adjustment.

  18. Solar hot water system installed at Las Vegas, Nevada

    Science.gov (United States)

    1981-01-01

    A solar energy hot water system installed in a motor inn at Las Vegas, Nevada is described. The inn is a three story building with a flat roof for installation of the solar panels. The system consists of 1,200 square feet of liquid flat plate collectors, a 2,500 gallon insulated vertical steel storage tank, two heat exchangers, and pumps and controls. The system was designed to supply approximately 74 percent of the total hot water load.

  19. Insulation coordination in installations for hvdc power transmission

    Energy Technology Data Exchange (ETDEWEB)

    Neise, W.; Povh, D.; Sarbach, E.

    1968-01-01

    Principal considerations on insulation coordination in installations for hvdc power transmission are discussed. Measures which may be taken for the limitation of overvoltages are explained. An arrester for hvdc power transmission is described and its characteristics are indicated. Starting from the protective levels for arresters can be used and which protective levels can be realized. Under consideration of a usual safety margin, the withstand voltages of the components of the installation can thus be indicated.

  20. Design and Installation of Nearshore Ocean Cable Protection Systems,

    Science.gov (United States)

    1979-11-01

    SUPPLEMENTARY NOTATION 17. COSATI CODES 18. SUBJECT TERMS (Continue on reverse if nec.) FIELD GROUP SUB-GROUP Design. Cable installation retrieval & repair...Cable protection 19. ABSTRACT (Continue on reverse if necessary & identify by block number) The U.S. Navy currentlyhas a requirment to install and...2-26 Data Requirements .. ....... ....... .. 2-26 Reporting .. .. ........ ....... .... 2-26 2.4.2 Logistcs

  1. Smoke alarm installation and function in inner London council housing

    Science.gov (United States)

    DiGuiseppi, C.; Roberts, I.; Speirs, N.

    1999-01-01

    AIM—To determine the prevalence of and predictors for installed, functioning smoke alarms in council (public) housing in a low income, multi-ethnic urban area.
DESIGN—Cross sectional study.
SETTING—40 materially deprived electoral wards in two inner London boroughs.
PARTICIPANTS—Occupants of 315 addresses randomly selected from council housing lists, with 75% response rate.
MAIN OUTCOME MEASURES—Installation and function of smoke alarms based on inspection and testing.
RESULTS—39% (95% confidence interval (CI) 33% to 46%) of council tenants owned a smoke alarm, 31% (95% CI 25% to 38%) had an installed alarm (of which 54% were correctly installed), and 16% (95% CI 12% to 22%) had at least one installed, functioning alarm. Alarms most commonly failed because they lacked batteries (72%). In multivariate modelling, having an installed, functioning alarm was most strongly associated with living in a house versus a flat (apartment) (odds ratio (OR) 3.2, 95% CI 1.1 to 10.0), having two resident adults versus one (OR 2.8, 95% CI 1.2 to 6.5), and recognising stills from a Home Office television smoke alarm campaign (OR 2.4, 95% CI 1.1 to 5.5).
CONCLUSIONS—Fires are a leading cause of child injury and death, particularly among those younger than 5 years of age and those in social classes IV and V. Smoke alarms are associated with a significantly reduced risk of death in residential fires, and are more protective in households with young children. Few council properties in a multi-ethnic, materially deprived urban area had any installed, functioning smoke alarms, despite a high risk of residential fires and fire related injuries in such areas. Effective methods to increase the prevalence of installed and functioning alarms must be identified.

 PMID:10519711

  2. Specialized Common Carriers: Long Distance Alternatives for Military Installations.

    Science.gov (United States)

    1984-03-01

    4 s This second method is reasonable since all cf the carriers are tariffed and 44Ancther Air Force installation, Offutt Air Force Base, is "teting...analyze the use of SCC and/c: reseller services at military installations. * An analysis of the econcmic feasibility of the use of dynamic least cost...other states have mcre -:han cne LATA. Message Telecommunications service (MTS) - Long ristarce Message Telecom municat-icns Service (LDATS) - AT&T’s

  3. Fluoridation Status of U. S. Army Conus Installations

    Science.gov (United States)

    1993-09-30

    water source and date the water was analyzed. 3. The process of fluoridating or defluoridating water . a. Are chemicals used in the fluoridation... defluoridated ? Some installations are supplied water which is naturally fluoridated above optimal limits and there is need to remove a portion of the...Seven reported using no chemicals with 4 recording below 0.7 ppm levels of fluoride in the drinking water . Defluoridation was used at two installations

  4. Evaluation of Installation Time for SMASHmount by SMASHsolar

    Energy Technology Data Exchange (ETDEWEB)

    2017-04-05

    The Department of Energy SunShot Incubator program provides early-stage assistance to help startup companies cross technological barriers to commercialization while encouraging private sector investment. The SunShot Incubator program aims to shorten the time it takes for a young business or company to develop an innovative product concept and make it commercially available, which includes product prototyping, deployment, and, potentially, manufacturing. SMASHsolar was selected as an Incubator awardee to develop a simple, snap-together, module-integrated photovoltaic (PV) mounting system in attempts to dramatically reduce the time, effort and skill needed to install rooftop solar. In support of this award, the National Renewable Energy Laboratory worked with SMASHsolar to develop a procedure for evaluating the installation time required for the SMASHmount system vs. widely-available rail systems. Amongst several installations, NREL measured the following installation times, subject to the qualifications and conditions described later in this report. NREL found that the SMASHsolar SMASHmount system was installed between 15% and 37% faster than tested competing systems after one or two installations of the system.

  5. Correlating the experience in the design of catalytic reforming installations

    Energy Technology Data Exchange (ETDEWEB)

    Aspel, N.B.; Ratner, Ye.M.; Vasil' yev, A.V.

    1980-01-01

    Catalytic reforming installations of varying capacity and purpose are being used at all oil refineries which were designed by Lengiproneftekhim on the basis of the studies of the VNIIneftekhim. Experience in the operation of the installations exposed a number of positive and negative aspects. In a number of cases the attachment of the installations was accomplished without consideration of the specifications on the quality of the raw material. A great deviation in the raw material from the projected fractional composition, the presence of leaching and of aqueous washing, the contact of the raw material and air in the industrial fleets made the operation of the equipment difficult and led to partial halts. Violation of the industrial conditions was observed as well as a result of a switch-off of the electric power, a fall in the pressure in the fuel lines. In spite of this, almost all the enterprises reached and even exceeded the design capacity, which attests to the presence of reserves. Modernization and intensification of the installation made it possible to increase productivity by 30% and to raise the octane number of the gasoline to 95 or to increase the output of aromatic fractions. The basic features of the intensification are: the addition of subassemblies for drying the circulationg gas; regeneration of adsorbents; sulfuration, chlorinating and oxychlorinating of the concentrates; the installation of air cooling apparatuses and equipment for redistribution of the thermal loads on the furnace and others. Special attention with regard to the shift to the new Kt (KR) is given to the quality of the raw material. The fractional composition of the raw material is given relative to the obtained final products and the basic process parameters. Enlarged, independent installations are being designed whose introduction will produce a savings of no less than 0.5 million rubles per installation.

  6. Renewable Energy Opportunities at the Kanto Installations, Japan

    Energy Technology Data Exchange (ETDEWEB)

    Solana, Amy E.; Horner, Jacob A.; Russo, Bryan J.; Gorrissen, Willy J.; Kora, Angela R.; Weimar, Mark R.; Hand, James R.; Orrell, Alice C.; Williamson, Jennifer L.

    2010-09-24

    This document provides an overview of renewable resource development potential at the U.S. Army installations in the Kanto region in Japan, which includes Camp Zama, Yokohama North Dock, Sagamihara Family Housing Area (SFHA), Sagami General Depot, and Akasaka Press Center. This effort focuses on grid-connected generation of electricity from renewable energy sources and also on ground source heat pumps for heating and cooling buildings. The effort was funded by the Huntsville Army Corps of Engineers, and includes the development of a methodology for renewable resource assessment at Army installations located on foreign soil. The methodology is documented in Renewable Energy Assessment Methodology for Japanese OCONUS Army Installations. The site visit to the Kanto installations took place on April 5 and 6, 2010. At the current time, there are some renewable technologies that show economic potential. Because of siting restrictions and the small size of these installations, development of most renewable energy technologies will likely be limited to Camp Zama. Project feasibility is based on installation-specific resource availability and energy costs and projections based on accepted life-cycle cost methods. Development of any renewable energy project will be challenging, as it will require investigation into existing contractual obligations, new contracts that could be developed, the legality of certain partnerships, and available financing avenues, which involves the U.S. Forces Japan (USFJ), the Government of Japan (GOJ), and a number of other parties on both sides. The Army will not be able to implement a project without involvement and approval from the other services and multiple levels of Japanese government. However, implementation of renewable energy projects could be an attractive method for GOJ to reduce greenhouse gas emissions and lower annual utility payments to USFJ. This report recommends projects to pursue and offers approaches to use. The most

  7. Preliminary assessment report for Redmond Army National Guard Facility, Installation 53120, Redmond, Washington. Installation Restoration Program

    Energy Technology Data Exchange (ETDEWEB)

    Ketels, P.; Aggarwal, P.

    1993-08-01

    This report presents the results of the preliminary assessment (PA) conducted by Argonne National Laboratory at the Washington Army National Guard (WAARNG) property in Redmond, Washington. Preliminary assessments of federal facilities are being conducted to compile the information necessary for completing preremedial activities and to provide a basis for establishing corrective actions in response to releases of hazardous substances. The principal objective of the PA is to characterize the site accurately and determine the need for further action by examining site activities, quantities of hazardous substances present, and potential pathways by which contamination could affect public health and the environment. This PA satisfies, for the Redmond ARNG property, Phase I of the Department of Defense Installation Restoration Program. The environmentally significant operations (ESOs) associated with the property are (1) supply/storage of hazardous materials, (2) weapons cleaning, (3) the underground storage tanks (USTs), and (4) the use of herbicides. These ESOs are no longer active because of the closure of OMS 10 activities in 1988.

  8. WEBsite of monitoring solar installations; Portal WEB de funcionamiento de instalaciones solares

    Energy Technology Data Exchange (ETDEWEB)

    Lopez, G.; Perez-Solano, M. J.

    2004-07-01

    This article shows an Internet Website of monitoring solar installations. It describes the most interesting characteristics of these installations and includes measures of their working variables. These values are presented in graphics and summarised reports. The solar installations are divided in four groups: Solar Thermal Installations, Domestic Solar Systems, Isolated Photovoltaic Installations and Grid Connected Photovoltaic Installations, however, in this article, the operation and the contents of this Website will be described based on the group of Solar Thermal Installations. This article describes the main page of the website and the necessary procedures to access to an installation, as well as the different screens related to this group. (Author)

  9. Federal Emergency Management Information System (FEMIS) Installation Guide for FEMIS Version 1.5

    Energy Technology Data Exchange (ETDEWEB)

    Burnett, Robert A.(BATTELLE (PACIFIC NW LAB)); Carter, Richard J.(BATTELLE (PACIFIC NW LAB)); Downing, Timothy R.(BATTELLE (PACIFIC NW LAB)); Dunkle, Julie R.(BATTELLE (PACIFIC NW LAB)); Homer, Brian J.(BATTELLE (PACIFIC NW LAB)); Johnson, Daniel M.(BATTELLE (PACIFIC NW LAB)); Johnson, Ranata L.(BATTELLE (PACIFIC NW LAB)); Johnson, Sharon M.(BATTELLE (PACIFIC NW LAB)); Loveall, Robert M.(BATTELLE (PACIFIC NW LAB)); Ramos Jr., Juan (BATTELLE (PACIFIC NW LAB)); Stephan, Alex J.(BATTELLE (PACIFIC NW LAB)); Wood, Blanche M.(BATTELLE (PACIFIC NW LAB))

    2001-12-01

    The Federal Emergency Management System (FEMIS) is an emergency management planning and response tool. The FEMIS Installation Guide provides instructions for installing and configuring the FEMIS software package.

  10. Renewable Energy Assessment Methodology for Japanese OCONUS Army Installations

    Energy Technology Data Exchange (ETDEWEB)

    Solana, Amy E.; Horner, Jacob A.; Russo, Bryan J.; Gorrissen, Willy J.; Kora, Angela R.; Weimar, Mark R.; Hand, James R.; Orrell, Alice C.; Williamson, Jennifer L.

    2010-08-30

    Since 2005, Pacific Northwest National Laboratory (PNNL) has been asked by Installation Management Command (IMCOM) to conduct strategic assessments at selected US Army installations of the potential use of renewable energy resources, including solar, wind, geothermal, biomass, waste, and ground source heat pumps (GSHPs). IMCOM has the same economic, security, and legal drivers to develop alternative, renewable energy resources overseas as it has for installations located in the US. The approach for continental US (CONUS) studies has been to use known, US-based renewable resource characterizations and information sources coupled with local, site-specific sources and interviews. However, the extent to which this sort of data might be available for outside the continental US (OCONUS) sites was unknown. An assessment at Camp Zama, Japan was completed as a trial to test the applicability of the CONUS methodology at OCONUS installations. It was found that, with some help from Camp Zama personnel in translating and locating a few Japanese sources, there was relatively little difficulty in finding sources that should provide a solid basis for conducting an assessment of comparable depth to those conducted for US installations. Project implementation will likely be more of a challenge, but the feasibility analysis will be able to use the same basic steps, with some adjusted inputs, as PNNL’s established renewable resource assessment methodology.

  11. Energy efficiency of lighting installations: Software application and experimental validation

    Directory of Open Access Journals (Sweden)

    J.A. Lobão

    2015-11-01

    Full Text Available The rational use of energy and energy-efficient environmental public street lighting is an important topic. In the design of new public lighting installations, national regulations containing energy-efficient guidelines are already used. Nevertheless, either in new installations or in reconstructions of existing lighting, designers do not generally consider all the available means to save energy. In installations of street lighting, energy consumption can be reduced by reducing the losses in the conductors, associated with the efficiency of the equipment, allowing better use of the available energy. The losses in the conductors must be analysed in conjunction with all the loads that contribute to the current in the sections of the installed street lighting. When opting for more efficient lamps and luminaires or lighting control systems, the current decreases in the sections covered with the most significant power loss due to proportionality with the square of the current. This decrease, often forgotten, is considered in this work in the investment analysis of efficiency and sustainable street lighting via simulation and experimental results. This analysis, combined with the features and operating parameters of the electrical installation, accounts for all the gains that can make a difference in the choice of efficient street lighting.

  12. Financing of Liabilities Beyond the Service Life of Nuclear Installations

    Directory of Open Access Journals (Sweden)

    L. Havlíček

    2006-01-01

    Full Text Available Operation of a nuclear installation is connected with the creation of long-term liabilities for spent fuel management and disposal, and also decommissioning of the installation (power plant, storages. This means that the operator will have to expend considerable amount of financial resources over a long period after the closure of installation. These financial resources will have to be created during operation of the installation. Related costs to be expended in future must be fully included in the price of electricity, in order to ensure fair competition among different operators. Financial resources for future coverage of liabilities must be continuously invested in order to compensate for inflation and to gain some real interest.Any failure by the operator to comply with its liabilities poses an economic and potentially an environmental hazard for operator’s country. Due attention must therefore be paid to assessing connected costs, defining liabilities and ensuring appropriate regulatory oversight. Appropriate measures must be well defined and firmly anchored in the legislation of countries operating nuclear installations. This paper reviews the basic principles that should ensure operator’s compliance their liabilities, and maps the current situation in the Czech Republic. 

  13. Hydrophone localization for the newly installed CTBTO station HA04 using noise from the installation vessel

    Science.gov (United States)

    Nielsen, Peter; Haralabus, Georgios; Stanley, Jerry; Zampolli, Mario; Grenard, Patrick; Brown, David; Le Bras, Ronan; Amir, Menachem; Slava, Bereza; Bittner, Paulina; Gore, Jane; Wang, Haijun

    2017-04-01

    During December 2016, the cabled hydroacoustic station HA04 was installed close to the Crozet Islands, France, in the southern Indian Ocean as part of the Comprehensive Nuclear-Test-Ban Treaty Organization's (CTBTO) International Monitoring System (IMS) designed to detect nuclear explosions worldwide. The HA04 station consists of two triplets of cabled to shore hydrophones deployed north and south of Crozet. Each triplet forms a two kilometre triangular configuration positioned in the Sound Fixing and Ranging channel for optimum performance. The water depth is approximately 1200 m with the hydrophones connected to a riser cable of approximately 700 m in length. The deployment was conducted from a cable vessel utilising high precision global and dynamic positioning system to position the sensors as close as possible to the planned locations. Although high confidence in the sensor locations was achieved during the vessel operation, the locations were verified by independent means in order to refine sensor locations, optimize station performance, and to ensure that the deployment was within the tolerance of the terms of reference for the deployment. The alternative estimate of the individual sensor locations was formulated as a global optimization problem with 10 unknown parameters, i.e., latitude, longitude and depth for each sensor within a station and an effective sound speed value in water. The objective function was defined as a least-mean-square type error function between modelled and measured arrival times between pairs of hydrophones. The arrival times were obtained by cross-correlating radiated noise from the surface vessel deploying the sensors while performing a dedicated known track for the purpose of the hydrophone localization. Results from the hydrophone localization estimation are presented and compared to the planned positions together with uncertainty estimates caused by independent modelling and measurement errors.

  14. Designing, Integrating, and Coordinating the Installation of MedAustron

    CERN Document Server

    Nicquevert, B; Benedikt, M

    2011-01-01

    "Give me a layout good enough and a building to place it, and I will install your accelerator". To paraphrase Archimedes, this is the role attributed to the Integration team in the MedAustron project. Starting with the optics layout and a building sketch, the integration work consists of a series of activities, interlinked in a complex manner. First the design and the integration of accelerator: list all items, define geometrical envelopes with interfaces, put them in position in CAD, identify conflicts and define input for design of items and of infrastructure. Then the various equipment is procured: verify and validate design data, follow-up manufacturing, fiducialize equipment and build supports. Lastly the global installation: check building and infrastructure, define survey framework, install and pre-align equipment on supports, move assemblies to their final location, survey actual position and adjust to theoretical position. The whole chain of operations from the layout to a real beam in MedAustron, i...

  15. PV Systems Installed in Marine Vessels: Technologies and Specifications

    Directory of Open Access Journals (Sweden)

    Ioannis Kobougias

    2013-01-01

    Full Text Available Considerations are held about the specificationin whichthe PV plants have to fulfill so that they can be installed on marine vessels. Initially, a brief description of the typical electrical grid of ships is presented, distinguishing the main parts, reporting the typical electrical magnitudes, and choosing the most preferable installation areas. The technical specifications,in whichthe PV plants have to be compatible with, are fully described. They are determined by the special marine environmental conditions, taking into consideration parameters like wind, humidity, shading, corrosion, and limited installation area. The work is carried out with the presentation of the most popular trends in the field of solar cell types and PV system technologies and their ability to keep up with the aforementioned specifications.

  16. Instability during Installation of Foundations for Offshore Structures

    DEFF Research Database (Denmark)

    Madsen, Søren; Andersen, Lars Vabbersgaard; Ibsen, Lars Bo

    2012-01-01

    caisson”. During installation, suction is applied inside the bucket. The suction creates a pressure differential across the bucket lid, effectively increasing the downward force on the bucket while the water flow reduces the skirt tip resistance. The bucket foundation is constructed as a thin shell......, becomes a crucial issue. Instability is also an issue affecting piles during installation, where imperfections and boulder impacts during pile driving can lead to structural buckling. The failure mechanism can be an “extrusion” mechanism type, where an initial imperfection in the pile geometry increases...... as the pile is penetrating through a soil of high stiffness. This paper deals with structural instability issues related to slender, circular cylindrical offshore foundations during installation. The authors present the previous work done by other authors within this field, highlighting the key issues...

  17. Wind power installations in Switzerland - Checklist for investors in large-scale installations; Eoliennes en Suisse. Liste de controle pour investisseurs de grandes installations

    Energy Technology Data Exchange (ETDEWEB)

    Ott, W.; Kaufmann, Y.; Steiner, P. [Econcept AG, Zuerich (Switzerland); Gilgen, K.; Sartoris, A. [IRAP-HSR, Institut fuer Raumentwicklung an der Hochschule fuer Technik Rapperswil, Rapperswil (Switzerland)

    2008-07-01

    This report published by the Swiss Federal Office of Energy (SFOE) takes a look at a checklist for investors in large-scale wind-power installations. The authors state that the same questions are often posed in the course of the planning and realisation of wind turbine installations. This document presents a checklist that will help achieve the following goals: Tackling the steps involved in the planning and implementation phases, increasing planning security, systematic implementation in order to reduce risks for investors and to shorten time-scales as well as the reduction of costs. Further, participative processes can be optimised by using comprehensively prepared information in order to reduce the risk of objections during project approval. The structure of the check-list is described and discussed.

  18. Impact of sensor installation techniques on seismic network performance

    Science.gov (United States)

    Bainbridge, Geoffrey; Laporte, Michael; Baturan, Dario; Greig, Wesley

    2015-04-01

    The magnitude of completeness (Mc) of a seismic network is determined by a number of factors including station density, self-noise and passband of the sensor used, ambient noise environment and sensor installation method and depth. Sensor installation techniques related to depth are of particular importance due to their impact on overall monitoring network deployment costs. We present a case study which evaluates performance of Trillium Compact Posthole seismometers installed using different methods as well as depths, and evaluate its impact on seismic network operation in terms of the target area of interest average magnitude of completeness in various monitoring applications. We evaluate three sensor installation methods: direct burial in soil at 0.5 m depth, 5 m screwpile and 15 m cemented casing borehole at sites chosen to represent high, medium and low ambient noise environments. In all cases, noise performance improves with depth with noise suppression generally more prominent at higher frequencies but with significant variations from site to site. When extended to overall network performance, the observed noise suppression results in improved (decreased) target area average Mc. However, the extent of the improvement with depth varies significantly, and can be negligible. The increased cost associated with installation at depth uses funds that could be applied to the deployment of additional stations. Using network modelling tools, we compare the improvement in magnitude of completeness and location accuracy associated with increasing installation depth to those associated with increased number of stations. The appropriate strategy is applied on a case-by-case and driven by network-specific performance requirements, deployment constraints and site noise conditions.

  19. Meeting the challenges of installing a mobile robotic system

    Science.gov (United States)

    Decorte, Celeste

    1994-01-01

    The challenges of integrating a mobile robotic system into an application environment are many. Most problems inherent to installing the mobile robotic system fall into one of three categories: (1) the physical environment - location(s) where, and conditions under which, the mobile robotic system will work; (2) the technological environment - external equipment with which the mobile robotic system will interact; and (3) the human environment - personnel who will operate and interact with the mobile robotic system. The successful integration of a mobile robotic system into these three types of application environment requires more than a good pair of pliers. The tools for this job include: careful planning, accurate measurement data (as-built drawings), complete technical data of systems to be interfaced, sufficient time and attention of key personnel for training on how to operate and program the robot, on-site access during installation, and a thorough understanding and appreciation - by all concerned - of the mobile robotic system's role in the security mission at the site, as well as the machine's capabilities and limitations. Patience, luck, and a sense of humor are also useful tools to keep handy during a mobile robotic system installation. This paper will discuss some specific examples of problems in each of three categories, and explore approaches to solving these problems. The discussion will draw from the author's experience with on-site installations of mobile robotic systems in various applications. Most of the information discussed in this paper has come directly from knowledge learned during installations of Cybermotion's SR2 security robots. A large part of the discussion will apply to any vehicle with a drive system, collision avoidance, and navigation sensors, which is, of course, what makes a vehicle autonomous. And it is with these sensors and a drive system that the installer must become familiar in order to foresee potential trouble areas in the

  20. Solar heating system installed at Troy, Ohio. Final report

    Energy Technology Data Exchange (ETDEWEB)

    None

    1980-09-01

    This document is the Final Report of the Solar Energy System located at Troy-Miami County Public Library, Troy, Ohio. The completed system is composed of tree basic subsystems: the collector system consisting of 3264 square feet of Owens Illinois evacuated glass tube collectors; the storage system which includes a 5000-gallon insulated steel tank; and the distribution and control system which includes piping, pumping and control logic for the efficient and safe operation of the entire system. This solar heating system was installed in an existing facility and is, therefore, a retrofit system. This report includes extracts from the site files, specifications, drawings, installation, operation and maintenance instructions.

  1. Photovoltaics for professionals solar electric systems marketing, design and installation

    CERN Document Server

    Falk, Antony; Remmers, Karl-Heinz

    2007-01-01

    For the building industry, the installation of photovoltaic systems has become a new field of activity. Interest in solar energy is growing and future business prospects are excellent. Photovoltaics for Professionals describes the practicalities of marketing, designing and installing photovoltaic systems, both grid-tied and stand-alone. It has been written for electricians, technicians, builders, architects and building engineers who want to get involved in this expanding industry. It answers all the beginner's questions as well as serving as a textbook and work of reference

  2. Deepwater offshore windfarm. Design fabrication and installation study. Final report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-07-01

    This report discusses the plans and benefits of using the Beatrice oil field installation for the development of the offshore Beatrice windfarm in the Moray Firth. The development of an economic support structure for wind turbine generators to allow development of deepwater wind farms was investigated, and the screening of structural designs, and the analysis of fatigue, fabrication and installation considerations is described. Details are given of the recommendation for a further examination of two structural designs as options for the Beatrice windfarm development, the estimated costs, and the results of an environmental review.

  3. Solar system installation at Louisville, Kentucky (final report)

    Energy Technology Data Exchange (ETDEWEB)

    1978-08-07

    A contract was awarded in June 1976 for the installation of a solar space heating and domestic hot water system at 2400 Watteroon Trail, Louisville, Kentucky. The overall philosophy used was to install both a liquid and a hot air system retrofitted to the existing office and combined warehouse building. The 1080 sq ft office space is heated first and excess heat is dumped into the warehouse. The two systems offered a unique opportunity to measure the performance and compare results of both air and liquid at one site. The two systems are described in detail and information on the data acquisition system is included.

  4. Comparison of absorption after inhalation and installation of uranium octoxide

    Energy Technology Data Exchange (ETDEWEB)

    Pellow, P.G.D.; Hodgson, S.A.; Hodgson, A.; Rance, E.; Ellender, M.; Guilmette, R.A.; Stradling, G.N

    2003-07-01

    Values for the absorption parameters were compared after inhalation or intratracheal installation of 1.5 {mu}m mass median aerodynamic diameter (MMAD) {sup 233}U{sub 3}O{sub 8} particles into the lungs of HMT strain rats. The two sets of parameter values were similar, as were the calculated dose coefficients and predicted biokinetics for workers. Hence the inhalation and installation techniques can probably both be used to generate values of the absorption parameters for U{sub 3}O{sub 8}. (author)

  5. Framework for Modelling Multiple Input Complex Aggregations for Interactive Installations

    DEFF Research Database (Denmark)

    Padfield, Nicolas; Andreasen, Troels

    2012-01-01

    We describe a generalized framework as a method and design tool for creating interactive installations with a demand for exploratory meaning creation, not limited to the design stage, but extending into the stage where the installation meets participants and audience. The proposed solution is based...... on fuzzy logic and provides a method for variably balancing interaction and user input with the intention of the artist or director. An experimental design is presented, demonstrating an intuitive interface for parametric modelling of a complex aggregation function. The aggregation function unifies...

  6. Eliciting Audience's Experience to Improve Interactive Art Installation

    DEFF Research Database (Denmark)

    Baharin, Hanif; Morrison, Ann

    2006-01-01

    Designing with the users in mind is one of the widely accepted design practices in the Interaction Design field. On the other hand, it can be said that audience's experience is the heart of an interactive art. Since Interaction Design has shown that user's involvement in the design process can be...... installation using techniques adopted from Interaction Design such as prototyping, observation and contextual interview is described. This paper also presents the result from the contextual interview and the improvement made to the installation....

  7. Installation af vaskemaskine og tørretumbler

    DEFF Research Database (Denmark)

    Christiansen, J.; Skibstrup Eriksen, S.; Nielsen, F.

    Denne SBI-anvisning er et led i en serie om modernisering af installationerne i den ældre boligmasse. Den henvender sig til både beboere, husejere, VVS-installatører og andre interesserede. Anvisningen indeholder almene afsnit om valg og placering af vaskemaskine og tørretumbler, sagsforløb ved i...... installation, forhold til myndigheder, priser, finansieringsuligheder m.m. Anvisningen indeholder endvidere tekniske afsnit om vandinstallation, afløb, ventilation og elinstallation i forbindelse med installation af vaskemaskine og tørretumbler....

  8. Status and perspectives of wind turbine installations in Italy

    Energy Technology Data Exchange (ETDEWEB)

    Barra, L.; Arena, A.; Mizzoni, G.; Pirazzi, L. [ENEA, Rome (Italy). Energy Dept.

    1995-12-31

    The article intends to illustrate the Italian situation in wind sector, giving some elements to explain why some delay is registered with respect to other European countries. Further than the present day situation, from which it can be concluded that the diffusion process is still commencing, being installed only 20 MW, the perspectives are discussed. Projects for plant installations totaling about 430 MW have been submitted to the electric utility. The actual realization of these important initiatives will probably depend on the ability to use wind energy as an occasion to sustain economic development of the involved zones. (author)

  9. Radiation protection in Swiss nuclear installations; Strahlenschutz in Schweizer Kernanlagen

    Energy Technology Data Exchange (ETDEWEB)

    Hammer, J.; Brunell, M. [Eidgenoessisches Nuklearsicherheitsinspektorat ENSI, Brugg (Switzerland)

    2015-07-01

    Well developed measures on operational radiation protection within Swiss nuclear installations will be presented. The focus lays on competent authority actions. Results of the last ten years, including events on radiation issues, will be discussed. Finally a view on challenges for radiation protection personnel with respect to a renewed Swiss radiation protection legislation based on recent ICRP recommendations will be given.

  10. City of Penticton to install adaptive streetlight system

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    2008-09-15

    The City of Penticton in British Columbia will be among the first to install an adaptive street lighting system that will help the municipality reduce its environmental impact, enhance street lighting and reduce maintenance costs. Municipalities in Canada typically spend nearly one third of their energy budget on street lighting. Intelligent streetlight management systems can reduce that amount by up to 50 per cent while promoting a more sustainable community by reducing power consumption and greenhouse gas emission. The city-owned and operated electric utility in Penticton will install the Lumen IQ{sup TM} Streetlight Optimization System. Lamp controllers using wireless technology will be installed into the lamp heads to monitor and control individual streetlights via the Internet. A station communication hub centrally controls all of the lights, which can be turned on or off, or dimmed when needed to reduce light pollution and minimize energy wastage. This also extends the service life of the bulb by 20 per cent. The new lighting system will initially be implemented as a pilot project but could result in tens of thousands of dollars in savings to the city. The city is eligible for a rebate incentive under the FortisBC Power Sense Program. The payback period is estimated to be 4 or 5 years. Cities in British Columbia which have already installed the new street lighting system have netted energy savings of 40 per cent without any detectable changes in lighting quality.

  11. Transformation of Installation Management: An Analysis of Organizational Change

    Science.gov (United States)

    2006-03-15

    This paper analyzes the dynamics of organizational change that led the Department of the Army (DA) to establish the Installation Management Agency...to establish the IMA. Viewed through the lenses of contingency and organizational theory this paper provides answers related to organizational change that are relevant to today’s strategic leaders.

  12. Installation Restoration Program. Phase 2. Confirmation, Edwards AFB, California

    Science.gov (United States)

    1982-09-01

    to divert groundwater movement. IRP. Installation Restoration Program kg. Kilogram Lenticular. Having the shape of a lentil or double convex lense...California. Supervisor, Chemistry- Nutrition Laboratory. Responsible for operation of nutrient analysis facility for major food processing company. Developed...areas. Conducted lab- * oratory investigation of leachate composition and analysis of treatment techniques for application to leachates generated

  13. Mechanical installation for standby power house, Building No. 184-N

    Energy Technology Data Exchange (ETDEWEB)

    1960-09-01

    This specification covers the furnishing of piping, piping accessories, and certain specified mechanical equipment. Further it covers the provision of all labor, supervision, supplies, equipment and tools required for the handling, installation, painting, readying for operating and functional testing of all the equipment and systems described.

  14. 46 CFR 182.430 - Engine exhaust pipe installation.

    Science.gov (United States)

    2010-10-01

    ... installation. (a) The design of all exhaust systems must ensure minimum risk of injury to personnel. Protection... steel or equivalent bulkhead in way of a penetration and a fiberglass wet exhaust pipe may be fiberglassed to a fiberglass reinforced plastic bulkhead if suitable arrangements are provided to relieve the...

  15. Permafrost Ecosystem Warming Prototype: Installation, Operation, and Initial Site Characterization

    Science.gov (United States)

    2013-11-01

    in 3 m diameter plots in a temperate deciduous forest . To further develop the prototype for an arctic climate, a similar test system was installed...silts, which represents relatively low moisture content permafrost. Vegetation is typical of the Alaskan Interior—subarctic taiga forest with white

  16. Analysis of Bright Harvest Remote Analysis for Residential Solar Installations

    Energy Technology Data Exchange (ETDEWEB)

    Nangle, John [National Renewable Energy Lab. (NREL), Golden, CO (United States); Simon, Joseph [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2015-06-17

    Bright Harvest provides remote shading analysis and design products for residential PV system installers. The National Renewable Energy Laboratory (NREL) through the NREL Commercialization Assistance Program, completed comparative assessments between on-site measurements and remotely calculated values to validate the accuracy of Bright Harvest’s remote shading and power generation.

  17. 32 CFR 634.40 - General off installation traffic activities.

    Science.gov (United States)

    2010-07-01

    ... reports received from civil authorities on serious traffic violations, accidents, and intoxicated driving... 32 National Defense 4 2010-07-01 2010-07-01 true General off installation traffic activities. 634... (CONTINUED) LAW ENFORCEMENT AND CRIMINAL INVESTIGATIONS MOTOR VEHICLE TRAFFIC SUPERVISION Traffic Supervision...

  18. Tangible air: An interactive installation for visualising audience engagement

    NARCIS (Netherlands)

    T. Röggla (Tom); C. Wang (Chen); L. Pérez Romero (Lilia); A.J. Jansen (Jack); P.S. Cesar Garcia (Pablo Santiago)

    2017-01-01

    textabstractThis article presents an end-to-end system for capturing physiological sensor data and visualising it on a real-time graphic dashboard and as part of an art installation. More specifically, it describes an event where the level of engagement of the audience was measured by means of

  19. Tangible air : An Interactive Installation for Visualising Audience Engagement

    NARCIS (Netherlands)

    Röggla, Thomas; Wang, Chen; Perez Romero, Lilia; Jansen, Jack; Cesar Garcia, P.S.

    2017-01-01

    This article presents an end-to-end system for capturing physiological sensor data and visualising it on a real-time graphic dashboard and as part of an art installation. More specifically, it describes an event where the level of engagement of the audience was measured by means of Galvanic Skin

  20. Assessment approaches to logistics for offshore wind energy installation

    NARCIS (Netherlands)

    Vis, Iris F.A.; Ursavas, Evrim

    2016-01-01

    Offshore wind farm installation planning is highly complex, due to the high dependency on weather and the oversized components that impose specific constraints in areas such as transportation and lifting. Currently, there is very little transparency vis-à-vis the logistics challenges in the

  1. 30 CFR 77.206 - Ladders; construction; installation and maintenance.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Ladders; construction; installation and maintenance. 77.206 Section 77.206 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF... members of ladders shall not be painted. (c) Steep or vertical ladders which are used regularly at fixed...

  2. ATLAS Tile Calorimeter central barrel assembly and installation.

    CERN Multimedia

    nikolai topilin

    2009-01-01

    These photos belong to the self-published book by Nikolai Topilin "ATLAS Hadron Calorimeter Assembly". The book is a collection of souvenirs from the years of assembly and installation of the Tile Hadron Calorimeter, which extended from November 2002 until May 2006.

  3. 46 CFR 167.40-1 - Electrical installations.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Electrical installations. 167.40-1 Section 167.40-1 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS PUBLIC NAUTICAL SCHOOL... danger of fire, giving particular attention to wiring which is carried through wooden bulkheads...

  4. behavior of acacia plants installed on substrates based on compost ...

    African Journals Online (AJOL)

    Received: 28 December 2012 / Accepted: 29 April 2013 / Published online: 30 June 2013. ABSTRACT. The present study aims principally the evaluation of germination and of plant growth of. Acacia cyanophylla installed, on the one hand, on the gross forestry compost (CSB) in its purest form, produced in a forest nursery in ...

  5. Determination of safety distance for installing GSM mast in ...

    African Journals Online (AJOL)

    Global System for Mobile Communication (GSM) technology is one of the fastest growing technologies and most demanding application all over the world. But the health implication of its equipment used or installed in residential area has become subject debate among Nigerian. This work, made an attempt to determine the ...

  6. 14 CFR 25.1353 - Electrical equipment and installations.

    Science.gov (United States)

    2010-01-01

    .... (b) Storage batteries must be designed and installed as follows: (1) Safe cell temperatures and... in cell temperature may result when the battery is recharged (after previous complete discharge)— (i... most adverse cooling condition likely to occur in service. (2) Compliance with paragraph (b)(1) of this...

  7. 14 CFR 29.1353 - Electrical equipment and installations.

    Science.gov (United States)

    2010-01-01

    ... heavy current-carrying cables. (c) Storage batteries must be designed and installed as follows: (1) Safe... condition. No uncontrolled increase in cell temperature may result when the battery is recharged (after... duration; and (iii) Under the most adverse cooling condition likely in service. (2) Compliance with...

  8. Documenting the Analogue Past in Marijke van Warmerdam's Film Installations

    NARCIS (Netherlands)

    Noordegraaf, J.

    2015-01-01

    Dutch visual artist Marijke van Warmerdam is best known for her film-based installations, which present simple settings or actions, such as a girl performing a handstand, in short, 16mm film loops that are projected in the gallery space. In 2011 van Warmerdam took the decision to digitize most of

  9. Spallation Neutron Source High Power RF Installation and Commissioning Progress

    CERN Document Server

    McCarthy, Michael P; Bradley, Joseph T; Fuja, Ray E; Gurd, Pamela; Hardek, Thomas; Kang, Yoon W; Rees, Daniel; Roybal, William; Young, Karen A

    2005-01-01

    The Spallation Neutron Source (SNS) linac will provide a 1 GeV proton beam for injection into the accumulator ring. In the normal conducting (NC) section of this linac, the Radio Frequency Quadupole (RFQ) and six drift tube linac (DTL) tanks are powered by seven 2.5 MW, 402.5 MHz klystrons and the four coupled cavity linac (CCL) cavities are powered by four 5.0 MW, 805 MHz klystrons. Eighty-one 550 kW, 805 MHz klystrons each drive a single cavity in the superconducting (SC) section of the linac. The high power radio frequency (HPRF) equipment was specified and procured by LANL and tested before delivery to ensure a smooth transition from installation to commissioning. Installation of RF equipment to support klystron operation in the 350-meter long klystron gallery started in June 2002. The final klystron was set in place in September 2004. Presently, all RF stations have been installed and high power testing has been completed. This paper reviews the progression of the installation and testing of the HPRF Sys...

  10. 33 CFR 183.552 - Plastic encased fuel tanks: Installation.

    Science.gov (United States)

    2010-07-01

    ... tank by capillary action. (c) If the plastic is bonded to the surface of a metallic fuel tank, the... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Plastic encased fuel tanks... § 183.552 Plastic encased fuel tanks: Installation. (a) Each fuel tank encased in cellular plastic foam...

  11. Reducing the environmental impact of a gas operated cogeneration installation

    Directory of Open Access Journals (Sweden)

    Irimie Sabin Ioan

    2017-01-01

    The amount of energy saved yearly, the specific fuel consumption and the environmental impact were determined by the comparative study. The diagrams representing the variation of the performance indicators according to the operation period were also created. The usefulness of the paper consists in the creation of the yearly optimum installation operation time chart.

  12. Scheduling the installation of the LHC injection lines

    CERN Document Server

    Lari, L; Mertens, V

    2004-01-01

    The installation of the two Large Hadron Collider (LHC) injection lines has to fit within tight milestones of the LHC project and of CERN's accelerator activity in general. For instance, the transfer line from the Super Proton Synchrotron (SPS) to LHC point 8 (to fill the anti-clockwise LHC ring) should be tested with beam before the end of 2004 since the SPS will not run in 2005. It will first serve during the LHC sector test in 2006. Time constraints are also very strong on the installation of the transfer line from the SPS to LHC point 2 (for the clockwise LHC ring): its tunnel is the sole access for the LHC cryo-magnets and a large part of the beam line can only be installed once practically all LHC cryo-magnets are in place. Of course, the line must be operational when the LHC starts. This paper presents the various constraints and how they are taken into account for the logistics and installation planning of the LHC injection lines.

  13. Streamlining U.S. Army Military Installation Map (MIM) Production

    Science.gov (United States)

    2010-06-01

    Assurance Plans ( QAPs ). Serves as the standardized data structure across all Army training and testing installations. Once populated, this...produced NGA MIMs and supporting documentation. All aspects reflect the layout, fonts, and features which are common to MIMs. Based on SRP QAP (CIP

  14. Behavior of Acacia Plants Installed on Substrates Based on ...

    African Journals Online (AJOL)

    The present study aims principally the evaluation of germination and of plant growth of Acacia cyanophylla installed, on the one hand, on the gross forestry compost (CSB) in its purest form, produced in a forest nursery in Tunisia, on the other hand, on the CSB mixed with poultry methacompost (MCA) refined (solid residue ...

  15. Interactive Installations for Spatial Access to Artistic Sketchbooks

    DEFF Research Database (Denmark)

    Christiansen, Henning; Laursen, Bjørn

    2017-01-01

    A book is a book – or is it? With present-day, aordable technology, we can scale a book to become a spatial object, or even a space in itself, of almost arbitrary size. We describe our design of and experiences with a generic interactive installation, called Viskbook, that provides a convincing...

  16. Contamination of Ground Water Samples from Well Installations

    DEFF Research Database (Denmark)

    Grøn, Christian; Madsen, Jørgen Øgaard; Simonsen, Y.

    1996-01-01

    Leaching of a plasticizer, N-butylbenzenesulfonamide, from ground water multilevel sampling installations in nylon has been demonstrated. The leaching resulted in concentrations of DOC and apparent AOX, both comparable with those observed in landfill contaminated ground waters. It is concluded...

  17. Massive scale production and installation of flexible printed solar cells

    DEFF Research Database (Denmark)

    Hösel, Markus

    Printed solar cells can be prepared on a large scale (kilometers) on relatively small equipment using little material. The performance and lifetime are lower and shorter than many conventional PV technology but manufacturing speed, manufacturing cost, energy pay back time and installation speed can...

  18. Installation and Assembly, Electrical Ground Support Equipment (GSE), Specification for

    Science.gov (United States)

    Denson, Erik C.

    2014-01-01

    This specification covers the general workmanship requirements and procedures for the complete installation and assembly of electrical ground support equipment (EGSE) such as terminal distributors, junction boxes, conduit and fittings, cable trays and accessories, interconnecting cables (including routing requirements), motor-control equipment, and necessary hardware as specified by the applicable contract and drawings.

  19. 33 CFR 159.57 - Installation, operation, and maintenance instructions.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Installation, operation, and maintenance instructions. 159.57 Section 159.57 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... number of persons that the device is capable of serving and the period of time the device is rated to...

  20. Installation of NA62 Large Angle Veto detectors

    CERN Multimedia

    2012-01-01

    In May 2012, the NA62 collaboration has installed the first eight (out of 12) Large Angle Veto detectors for the accurate identification of photons. These subdetectors will re-use 3000 lead glass crystals with attached photomultipliers from the OPAL experiment at LEP – CERN’s former accelerator.

  1. The Use of Geothermal Energy at Military Installations.

    Science.gov (United States)

    1976-10-01

    geothermal resources; and one was a review of the current state-of-the-art of geothermal energy development. As a result of these studies, two target areas...have been identified as prime candiates for development of geothermal energy at military installations. The Coso Hot Springs, on the Naval Weapons

  2. Evaluation of Trenchless Installation Technology for Radioactive Wastewater Piping Applications

    Energy Technology Data Exchange (ETDEWEB)

    Robinson, Sharon M [ORNL; Jubin, Robert Thomas [ORNL; Patton, Bradley D [ORNL; Sullivan, Nicholas M [ORNL; Bugbee, Kathy P [ORNL

    2009-09-01

    The U.S. Department of Energy (DOE) Office of Environmental Management (EM) cleanup mission at Oak Ridge National Laboratory (ORNL) includes dispositioning facilities, contaminated legacy materials/waste, and contamination sources and remediation of soil under facilities, groundwater, and surface water to support final Records of Decision (RODs). The Integrated Facilities Disposition Project (IFDP) is a roughly $15B project for completion of the EM mission at Oak Ridge, with a project duration of up to 35 years. The IFDP Mission Need Statement - Critical Decision-0 (CD-0) - was approved by DOE in July 2007, and the IFDP Alternative Selection and Cost Range - Critical Decision-1 (CD-1) - was approved in November 2008. The IFDP scope includes reconfiguration of waste collection and treatment systems as needed to complete the IFDP remediation and decontamination and decommissioning (D&D) missions in a safe and cost-effective manner while maintaining compliance with all governing regulations and bodies and preserving the support of continuing operations at ORNL. A step in the CD-1 approval process included an external technical review (ETR) of technical approaches proposed in the CD-1 document related to the facility reconfiguration for the ORNL radioactive waste and liquid low-level waste management systems. The ETR team recommended that the IFDP team consider the use of trenchless technologies for installing pipelines underground in and around contaminated sites as part of the alternatives evaluations required in support of the CD-2 process. The team specifically recommended evaluating trenchless technologies for installing new pipes in existing underground pipelines as an alternative to conventional open trench installation methods. Potential benefits could include reduction in project costs, less costly underground piping, fewer disruptions of ongoing and surface activities, and lower risk for workers. While trenchless technologies have been used extensively in the

  3. The performative turn at Inhotim: installation art and Baudelairean modernity

    Directory of Open Access Journals (Sweden)

    Lauren S. Weingarden

    2013-12-01

    Full Text Available This article explores the participatory turn in installation art as part of a trajectory from Baudelairean modernity to twentyfirst-century postmodernity, as represented at Inhotim, the outdoor contemporary art museum and botanical gardens in Brumadinho, MG. In his 1862 essay “The Painter of ModernLife,” Charles Baudelaire defined modernity as fleeting, transitory and fragmentary. Baudelairean modernity initiated a breakdown of boundaries between art and life and between high art aesthetics and popular culture, which continues in the work of installation artists. In the sites of installation art, the spectator is compelled to extend – rather than complete – the work of art in his/her own time, prior experiential encounters and transformative after thoughts.The shift from the isolated work of art to the experiential one notonly complicates how and where works of art are viewed, but also radicalizes the materials that constitute the work of art – whether those materials are extracted from the quotidian sphere or complex technologies, each undergoes a process of defamiliarization and reactivation to produce the transformative aesthetic experience.The individual installations in Inhotim’s “outdoor museum” engage the spectator in a dynamic/participatory experience with spatial,temporal and material relationships that define the very essence of art’s reciprocity, or contrast with the natural and man-madeworlds. It is the rarefied setting of Inhotim’s botanical gardens that makes the participatory and transformative experience central to the aesthetic encounter with installation art.

  4. Comparative Tests Between Shallow Downhole Installation and Classical Seismic Vaults

    Science.gov (United States)

    Charade, Olivier; Vergne, Jérôme; Bonaimé, Sébastien; Bonnin, Mickaël; Louis-Xavier, Thierry; Beucler, Eric; Manhaval, Bertrand; Arnold, Benoît

    2016-04-01

    The French permanent broadband network is engaged in a major evolution with the installation of a hundred of new stations within the forthcoming years. Since most of them will be located in open field environments, we are looking for a standardized installation method able to provide good noise level performance at a reasonable cost. Nowadays, the use of posthole seismometers that can be deployed at the bottom of shallow boreholes appears to be an affordable and alternative solution to more traditional installation methods such as seismic vaults or dedicated underground cellars. Here we present some comparative tests performed at different sites (including two GEOSCOPE stations), spanning various geological conditions. On each site, posthole sensors were deployed for several weeks to months at various depths from 1.5m up to 20m. We compare the seismic noise levels measured in the different boreholes with the one for a reference sensor either directly buried or installed in a tunnel, a cellar or a seismic vault. Apart from the microseism frequency band, seismic noise level in most of the boreholes equals or outperforms the one obtained for the reference sensors. At periods higher than 20s we observe a strong reduction of the seismic noise on the horizontal components in the deepest boreholes compared to near surface installations. This improvement can reach up to 30dB and appears to be mostly due to a reduction in tilt noise induced by wind or local pressure variations. However, the absolute noise level that can be achieved strongly depends on the local geology.

  5. FORSCOM installation characterization and ranking for water efficiency improvement

    Energy Technology Data Exchange (ETDEWEB)

    Fitzpatrick, Q.K.; McMordie, K.L.; Di Massa, F.V. [and others

    1995-05-01

    On March 11, 1994, President Clinton signed Executive Order 12902-Energy Efficiency and Water Conservation at Federal Facilities. Section 302 of the Executive Order calls for energy and water prioritization surveys of federal facilities to be conducted. The surveys will be used to establish priorities for conducting comprehensive facility audits. In response to the requirements of the Executive Order, the U.S. Army Forces Command (FORSCOM) has tasked Pacific Northwest Laboratory (PNL) to initiate a broad study of the water savings potential at each of its major installations. This report provides an assessment of the water, sewer, energy (for hot water production and pumping), and associated cost savings potential at ten of the major FORSCOM installations. This assessment is meant to be a {open_quotes}first pass{close_quotes} estimate of the water savings potential, to assist FORSCOM in prioritizing installations for detailed water audits and potential water efficient retrofits. In addition, the end uses (toilets, sinks, showerheads, irrigation, etc.) with the greatest water savings potential are identified at each installation. This report is organized in the following manner. Following this Introduction, Section 2 provides important background information pertaining to the water analysis. Section 3 describes the methodology employed in the analysis, and Section 4 summarizes the study results. Section 5 prioritizes the installations based on both water/sewer savings and cost associated with water, sewer, and energy savings. Section 6 provides recommendations on where to start detailed water audits, as well as other recommendations. References are listed in Section 7. The appendices provide specific information on the analysis results and methodology, along with a discussion of special issues.

  6. Using Residential Solar PV Quote Data to Analyze the Relationship Between Installer Pricing and Firm Size

    Energy Technology Data Exchange (ETDEWEB)

    O' Shaughnessy, Eric; Margolis, Robert

    2017-05-18

    We use residential solar photovoltaic (PV) quote data to study the role of firm size in PV installer pricing. We find that large installers (those that installed more than 1,000 PV systems in any year from 2013 to 2015) quote higher prices for customer-owned systems, on average, than do other installers. The results suggest that low prices are not the primary value proposition of large installers.

  7. Using Residential Solar PV Quote Data to Analyze the Relationship Between Installer Pricing and Firm Size

    Energy Technology Data Exchange (ETDEWEB)

    O' Shaughnessy, Eric [National Renewable Energy Lab. (NREL), Golden, CO (United States); Margolis, Robert [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2017-05-19

    We use residential solar photovoltaic (PV) quote data to study the role of firm size in PV installer pricing. We find that large installers (those that installed more than 1,000 PV systems in any year from 2013 to 2015) quote higher prices for customer-owned systems, on average, than do other installers. The results suggest that low prices are not the primary value proposition of large installers.

  8. Safety report concerning the reactor Pegase - volume 1 - Description of the installation - volume 2 - Safety of the installations; Rapport de surete du reacteur pegase - tome 1 - Description des installations - tome 2 - Surete des installations

    Energy Technology Data Exchange (ETDEWEB)

    Lacour, J. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires; Legoin, P. [S.E.M. Hispano-Suiza, 92 - Colombes (France)

    1964-07-01

    In the first volume: This report is a description of the reactor Pegase, given with a view to examine the safety of the installations. The Cadarache site at which they are situated is briefly described, in particular because of the consequences on the techniques employed for building Pegase. A description is also given of the original aspects of the reactor. The independent loops which are designed for full-scale testing of fuel elements used in natural uranium-gas-graphite reactor systems are described in this report, together with their operational and control equipment. In the second volume: In the present report are examined the accidents which could cause damage to the Pegase reactor installation. Among possible causes of accidents considered are the seismicity of the region, an excessive power excursion of the reactor and a fracture in the sealing of an independent loop. Although all possible precautions have been taken to offset the effects of such accidents, their ultimate consequences are considered here. The importance is stressed of the security action and regulations which, added to the precautions taken for the construction, ensure the safety of the installations. (authors) [French] Dans le volume 1: Ce rapport est une description du reacteur Pegase, afin d'examiner la surete des installations. Le site de CADARACHE ou elles sont situees, a ete sommairement decrit, en particulier, a cause des consequences sur les techniques mises en oeuvre pour la realisation de Pegase. Nous nous sommes egalement attache a decrire les aspects originaux du reacteur. Les boucles autonomes destinees a tester en vraie grandeur des elements combustibles de la filiere uranium naturel graphite-gaz, ainsi que leurs dispositifs de controle et d'exploitation, figurent egalement dans ce rapport. Dans le volume 2: Dans le present rapport, nous examinons des accidents pouvant endommager des installations du reacteur Pegase. Les origines d'accidents examines

  9. Heritage plaza parking lots improvement project- Solar PV installation

    Energy Technology Data Exchange (ETDEWEB)

    Hooks, Todd [Agua Caliente Indian Reservation, Palm Springs, CA (United States)

    2017-03-31

    The Agua Caliente Band of Cahuilla Indians (ACBCI or the “Tribe”) installed a 79.95 kW solar photovoltaic (PV) system to offset the energy usage costs of the Tribal Education and Family Services offices located at the Tribe's Heritage Plaza office building, 90I Tahquitz Way, Palm Springs, CA, 92262 (the "Project"). The installation of the Solar PV system was part of the larger Heritage Plaza Parking Lot Improvements Project and mounted on the two southern carport shade structures. The solar PV system will offset 99% of the approximately 115,000 kWh in electricity delivered annually by Southern California Edison (SCE) to the Tribal Education and Family Services offices at Heritage Plaza, reducing their annual energy costs from approximately $22,000 annually to approximately $200. The total cost of the proposed solar PV system is $240,000.

  10. Idaho National Engineering Laboratory installation roadmap document. Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    1993-05-30

    The roadmapping process was initiated by the US Department of Energy`s office of Environmental Restoration and Waste Management (EM) to improve its Five-Year Plan and budget allocation process. Roadmap documents will provide the technical baseline for this planning process and help EM develop more effective strategies and program plans for achieving its long-term goals. This document is a composite of roadmap assumptions and issues developed for the Idaho National Engineering Laboratory (INEL) by US Department of Energy Idaho Field Office and subcontractor personnel. The installation roadmap discusses activities, issues, and installation commitments that affect waste management and environmental restoration activities at the INEL. The High-Level Waste, Land Disposal Restriction, and Environmental Restoration Roadmaps are also included.

  11. Design and installation manual for thermal energy storage

    Science.gov (United States)

    Cole, R. L.; Nield, K. J.; Rohde, R. R.; Wolosewicz, R. M.

    1980-01-01

    The design and installation of thermal energy storage in active solar systems is discussed. Both air based and liquid based systems are covered with topics on designing rock beds, tank types, pump and fan selection, installation, costs, and operation and maintenance. Topics relevant to latent heat storage include properties of phase change materials, sizing the storage unit, insulating the storage unit, available systems, and cost. Topics relevant to heating domestic water include safety, single-, and dual-tank systems, domestic water heating with air and liquid based space heating systems, and stand alone domestics hot water systems. Also examined are common problems with storage systems and their solutions, heat transfer fluid properties, economic insulation thickness, heat exchanger sizing, and sample specifications for heat exchangers, wooden rock bins, steel tanks, concrete tanks, and fiberglass reinforced plastic tanks.

  12. Rate-based structural health monitoring using permanently installed sensors.

    Science.gov (United States)

    Corcoran, Joseph

    2017-09-01

    Permanently installed sensors are becoming increasingly ubiquitous, facilitating very frequent in situ measurements and consequently improved monitoring of 'trends' in the observed system behaviour. It is proposed that this newly available data may be used to provide prior warning and forecasting of critical events, particularly system failure. Numerous damage mechanisms are examples of positive feedback; they are 'self-accelerating' with an increasing rate of damage towards failure. The positive feedback leads to a common time-response behaviour which may be described by an empirical relation allowing prediction of the time to criticality. This study focuses on Structural Health Monitoring of engineering components; failure times are projected well in advance of failure for fatigue, creep crack growth and volumetric creep damage experiments. The proposed methodology provides a widely applicable framework for using newly available near-continuous data from permanently installed sensors to predict time until failure in a range of application areas including engineering, geophysics and medicine.

  13. Final Testing of the ATLAS Central Solenoid before Installation

    CERN Document Server

    Haug, F; Haruyama, T; Kawai, M; Kondo, T; Kondo, Y; Makida, Y; Metselaar, J; Passardi, Giorgio; Pavlov, O; Pezzetti, M; Pirotte, O; Ruber, Roger J M Y; Sbrissa, E; ten Kate, H H J; Tyrvainen, H; Yamamoto, A

    2005-01-01

    The central solenoid is part of the superconducting magnet system of the ATLAS experiment at the CERN LHC collider. It provides a 2 tesla axial magnetic field for the inner 24 m3 volume centre particle tracker. Design and construction was done in Japan by KEK and Toshiba in collaboration with CERN. Factory tests were made in Japan with the proximity cryogenics in a geometrical arrangement corresponding to the final installation and, a full magnet test. After shipment to CERN the proximity cryogenics has been installed at a surface hall and recommissioning with load simulations and the instrumentation adapted for radiation hard requirements at the final underground area. The solenoid has recently been integrated in the common cryostat vessel of the liquid argon barrel. Cool down for final surface testing has started. The final control systems architecture and process logics are applied which is tested.

  14. Holistic simulation of geotechnical installation processes numerical and physical modelling

    CERN Document Server

    2015-01-01

    The book provides suitable methods for the simulations of boundary value problems of geotechnical installation processes with reliable prediction for the deformation behavior of structures in static or dynamic interaction with the soil. It summarizes the basic research of a research group from scientists dealing with constitutive relations of soils and their implementations as well as contact element formulations in FE-codes. Numerical and physical experiments are presented providing benchmarks for future developments in this field. Boundary value problems have been formulated and solved with the developed tools in order to show the effectivity of the methods. Parametric studies of geotechnical installation processes in order to identify the governing parameters for the optimization of the process are given in such a way that the findings can be recommended to practice for further use. For many design engineers in practice the assessment of the serviceability of nearby structures due to geotechnical installat...

  15. Holistic simulation of geotechnical installation processes benchmarks and simulations

    CERN Document Server

    2016-01-01

    This book examines in detail the entire process involved in implementing geotechnical projects, from a well-defined initial stress and deformation state, to the completion of the installation process.   The individual chapters provide the fundamental knowledge needed to effectively improve soil-structure interaction models. Further, they present the results of theoretical fundamental research on suitable constitutive models, contact formulations, and efficient numerical implementations and algorithms. Applications of fundamental research on boundary value problems are also considered in order to improve the implementation of the theoretical models developed. Subsequent chapters highlight parametric studies of the respective geotechnical installation process, as well as elementary and large-scale model tests under well-defined conditions, in order to identify the most essential parameters for optimizing the process. The book provides suitable methods for simulating boundary value problems in connection with g...

  16. IMIS: Integrated Marine Installation System for offshore turbines

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2003-07-01

    The report describes a feasibility study on the Integrated Marine Installation System for offshore wind turbines. The aspects covered are (1) Background and why the study is required; (2) Aims and objectives of the project; (3) Summary of methods adopted; (4) Design criteria according to the area for deployment; (5) Conclusions and recommendations. The ultimate goal will be to install and secure the wind turbine in position using an integrated approach to avoid using lifting vessels. To date, an initial feasibility study has been carried out where four different concepts were considered. The next phase of the project will be to address a number of possible risks and constraints before the chosen concept can be demonstrated to be viable. The work is being carried out by Setech Ltd, Armstrong Technology Associates Ltd and Smith Rea Energy Ltd for the DTI.

  17. Method of proportioning stone to stowing installations underground

    Energy Technology Data Exchange (ETDEWEB)

    Szafarczyk, J.; Kubek, F.

    1992-07-01

    Reviews types of stowing intallations and the technology of supplying after-washing stone used. It is recommended to take advantage of downward inclined stowing pipeline sections for underground feeding of the stowing stone. Calculation of the mass of stone fed to a stowing pipeline is explained. First experience of using the method in the Jankowice black coal mine in 1991 is reported on. About 8,000 t of stone were stowed using the method during 7 months. The stowing installation consists of a tippler, a belt conveyor and a batcher of about 10 m[sup 3]. The capacity of the installation is 30 m[sup 3]/h. Suitable proportions of slag-crushed stone mixtures are recommended.

  18. Estimating Availability for Systems with Redundancy, Spares and Installation Times

    Science.gov (United States)

    1981-03-01

    equations for general resupply distribution and are [7] k X.ik i-i Pk = Pi-l Pi~j c+s k XPo =i i-i k=o i=l Pi X= (X) [c-max (o,i-s)] i 8. General...installation LDT - mean logistic down time (time to get a component) MTBF - mean time between failure r - l/MTTI f - l/MTBF Case 1: Installation time...DRCPS-P, ATTN: Ms. Lamb 1 DRCMM-RS 1 DRCMM-MS 1 DRCRE I DRCQA I Commandant, US Army Logistics Mgt Center, Ft. Lee, VA 23801 1 Office, Asst Sec’y of

  19. Numerical study of fairing installed between brackets based on CFD

    Science.gov (United States)

    Xi, Peng; Xiong, Ying; Tang, Xin

    2017-10-01

    In view of the low speed and instability of the flow between the two arms of the bracket in front of the propeller, the fairing is installed between the arms of the bracket taking example of compensating duct, in order to speed up the flow between the bracket arms and improve the flow quality. A four-propeller surface ship was studied and an integral mathematic model including hull, appendage and propellers was established. Using a RANS solver, its installation height, angle and airfoil is optimized. Then ship models with fairing and without fairing are calculated. The result shows that fairing improves propeller efficiency behind ship with 1.1% of the outer propeller and 1.6% of the inner propeller, which indicates that fairing helps improve the flow quality

  20. High Voltage Installation of PS Linac 1 Preinjector

    CERN Multimedia

    CERN PhotoLab

    1974-01-01

    The high-voltage installation of the linac 1 preinjector in its house-sized Faraday cage. Originally driven by a 520 kV Cockcroft-Walton generator, at the time of this picture the HV came from a 520 kV SAMES generator. The column in the front carries a capacitor. The cubicle in the right background is the electronics platform (see 7403120). The round structure at left houses the ion source, from where the protons (and sometimes other ions), electrostatically accelerated to 520 keV, enter the Alvarez structure of linac 1, to be accelerated to 50 MeV. Jean-Luc Vallet is busy with servicing the installation. See also 7403064X, 7403066X.

  1. Rate-based structural health monitoring using permanently installed sensors

    Science.gov (United States)

    Corcoran, Joseph

    2017-09-01

    Permanently installed sensors are becoming increasingly ubiquitous, facilitating very frequent in situ measurements and consequently improved monitoring of `trends' in the observed system behaviour. It is proposed that this newly available data may be used to provide prior warning and forecasting of critical events, particularly system failure. Numerous damage mechanisms are examples of positive feedback; they are `self-accelerating' with an increasing rate of damage towards failure. The positive feedback leads to a common time-response behaviour which may be described by an empirical relation allowing prediction of the time to criticality. This study focuses on Structural Health Monitoring of engineering components; failure times are projected well in advance of failure for fatigue, creep crack growth and volumetric creep damage experiments. The proposed methodology provides a widely applicable framework for using newly available near-continuous data from permanently installed sensors to predict time until failure in a range of application areas including engineering, geophysics and medicine.

  2. LHCb: Installation and operation of the LHCb Silicon Tracker detector

    CERN Multimedia

    Esperante Pereira, D

    2009-01-01

    The LHCb experiment has been designed to perform high-precision measurements of CP violation and rare decays of B hadrons. The construction and installation phases of the Silicon Tracker (ST) of the experiment were completed by early summer 2008. The LHCb Silicon Tracker sums up to a total sensitive area of about 12 m^2 using silicon micro-strip technology and withstands charged particle fluxes of up to 5 x 10^5cm^−2s^−1. We will report on the preparation of the detectors for the first LHC beams. Selected results from the commissioning in LHCb are shown, including the first beam-related events accumulated during LHC injection tests in September 2008. Lessons are drawn from the experience gathered during the installation and commissioning.

  3. The Analysis of Soil Resistance During Screw Displacement Pile Installation

    Directory of Open Access Journals (Sweden)

    Krasinski Adam

    2015-02-01

    Full Text Available The application of screw displacement piles (SDP is still increasing due to their high efficiency and many advantages. However, one technological problem is a serious disadvantage of those piles. It relates to the generation of very high soil resistance during screw auger penetration, especially when piles are installed in non-cohesive soils. In many situations this problem causes difficulties in creating piles of designed length and diameter. It is necessary to find a proper method for prediction of soil resistance during screw pile installation. The analysis of screw resistances based on model and field tests is presented in the paper. The investigations were carried out as part of research project, financed by the Polish Ministry of Science and Higher Education. As a result of tests and analyses the empirical method for prediction of rotation resistance (torque during screw auger penetration in non-cohesive subsoil based on CPT is proposed.

  4. Installation Restoration Program. Phase 1: Records Search, Williams AFB, Arizona

    Science.gov (United States)

    1984-02-01

    activities. Project Manager/Engineer for over 25 industrial projects including iron and steel, industrial coke, distillery, tannery , poultry, meat...Review 4-2 Industrial Operations (Shops) 4-3 TABLE OF CONTENTS (Continued) SECTION 4 Hazardous Waste Storage 4-12 (Continued) Waste Oil Management 4...LIST - INDUSTRIAL SHOPS E-1 APPENDIX F PHOTOGRAPHS F-i APPENDIX G USAF INSTALLATION RESTORATION PROGRAM HAZARD G-1 ASSESSMENT RATING METHODOLOGY 4u

  5. Generalized Pan-European Geological Database for Shallow Geothermal Installations

    OpenAIRE

    Johannes Müller; Antonio Galgaro; Giorgia Dalla Santa; Matteo Cultrera; Constantine Karytsas; Dimitrios Mendrinos; Sebastian Pera; Rodolfo Perego; Nick O’Neill; Riccardo Pasquali; Jacques Vercruysse; Leonardo Rossi; Adriana Bernardi; David Bertermann

    2018-01-01

    The relatively high installation costs for different types of shallow geothermal energy systems are obstacles that have lowered the impact of geothermal solutions in the renewable energy market. In order to reduce planning costs and obtain a lithological overview of geothermal potentials and drilling conditions, a pan-European geological overview map was created using freely accessible JRC (Joint Research Centre) data and ArcGIS software. JRC data were interpreted and merged together in order...

  6. Entity Resolution Workflow Installation Process and User Guide

    Science.gov (United States)

    2013-07-01

    with an entity extractor called English Information Extractor (ENIE) developed by City University of New York’s (CUNY) BLENDER lab‡. The user is not...CUNY BLENDER . http://nlp.cs.qc.cuny.edu/ (accessed June 2013). 2 alternate entity extractor. Another entity extractor called A Nearly-New...is now installed and ready to use. Please see the section 6 to learn how to use the ERW Web application. 6. ERW Web Application User Guide The ERW

  7. The performative turn at Inhotim: installation art and Baudelairean modernity

    OpenAIRE

    Lauren S. Weingarden

    2013-01-01

    This article explores the participatory turn in installation art as part of a trajectory from Baudelairean modernity to twentyfirst-century postmodernity, as represented at Inhotim, the outdoor contemporary art museum and botanical gardens in Brumadinho, MG. In his 1862 essay “The Painter of ModernLife,” Charles Baudelaire defined modernity as fleeting, transitory and fragmentary. Baudelairean modernity initiated a breakdown of boundaries between art and life and between high art aesthetics a...

  8. The magnetic horn being installed in the CNGS target chamber

    CERN Multimedia

    Maximilien Brice

    2006-01-01

    The magnetic system that focuses the beam of particles arising from the graphite target of the CERN Neutrinos to Gran Sasso project (CNGS) has been installed in its final position in the tunnel.The CNGS secondary beam magnetic system consists of two elements: the horn and the reflector, both acting as focusing lenses for the positively-charged pions and kaons produced by proton interactions in the target.

  9. Installation of a new cryogenic infrastructure at SM18

    CERN Multimedia

    MS18

    2013-01-01

    Part of the SM18 Hall is devoted to tests on radiofrequency (RF) cavities and cryomodules used for beam acceleration in various CERN experiments and accelerators. This movie presents the installation of the new cryogenic infrastructure in this area. It consists of a cryogenic line and six service modules, which will supply each of the six test stations. Almost 50 m of line, from the helium tank to the last test station, have been replaced.

  10. A hydroponic design for microgravity and gravity installations

    Science.gov (United States)

    Fielder, Judith; Leggett, Nickolaus

    1990-01-01

    A hydroponic system is presented that is designed for use in microgravity or gravity experiments. The system uses a sponge-like growing medium installed in tubular modules. The modules contain the plant roots and manage the flow of the nutrient solution. The physical design and materials considerations are discussed, as are modifications of the basic design for use in microgravity or gravity experiments. The major external environmental requirements are also presented.

  11. Solar space and water heating system installed at Charlottesville, Virginia

    Science.gov (United States)

    1980-09-01

    The solar energy system located at David C. Wilson Neuropsychiatric Hospital, Charlottesville, Virginia, is described. The solar energy system consists of 88 single glazed, Sunworks 'Solector' copper base plate collector modules, hot water coils in the hot air ducts, a Domestic Hot Water (DHW) preheat tank, a 3,000 gallon concrete urethane insulated storage tank and other miscellaneous components. Extracts from the site files, specifications, drawings, installation, operation and maintenance instructions are included.

  12. Installation, Commissioning and startup of the CMS experiment

    CERN Multimedia

    CERN. Geneva

    2008-01-01

    Will outline the construction phases of CMS, followed by specific strategy used by CMS to commission the experiment concurrently with the installation in the cavern. All along examples of the performance of the detector obtained mainly from cosmic ray data will be shown. At the end some example of early physics result aimed for the 2008 LHC run will be shown. Prerequisite knowledge: Some knowledge of basic particle detectors will make it easier to follow the talk.

  13. Power supply regulation systems installed in the Fermilab accelerators

    Energy Technology Data Exchange (ETDEWEB)

    Hays, S.; Wolff, D.; Pfeffer, H.

    1991-11-01

    A variety of current and voltage regulation systems have been installed in the Fermilab large magnet system. The four major systems employ different methods to achieve the desired degree of regulation. The methods include computer control and feedback, adaptive learning, precision (10ppm) current monitoring, and the use of feed-forward signals. This paper will explain each method used and present the measured regulation of the above systems. Also an overview of planned upgrades and improvements will be presented.

  14. Solar heating system installed at Jackson, Tennessee. Final report

    Energy Technology Data Exchange (ETDEWEB)

    None

    1980-10-01

    The solar energy heating system installed at the Coca-Cola Bottling Works in Jackson, Tennessee is described. The system consists of 9480 square feet of Owens-Illinois evacuated tubular solar collectors with attached specular cylindrical reflectors and will provide space heating for the 70,000 square foot production building in the winter, and hot water for the bottle washing equipment the remainder of the year. Component specifications and engineering drawings are included. (WHK)

  15. Zinc Bromide Flow Battery Installation for Islanding and Backup Power

    Science.gov (United States)

    2016-09-18

    FINAL REPORT Zinc Bromide Flow Battery Installation for Islanding and Backup Power ESTCP Project EW-201242 SEPTEMBER 2016 Ryan...Bromide (Zn/Br) Flow Battery -based Energy Storage System (ESS) at the Marine Corps Air Station (MCAS) Miramar. The effort integrates an innovative Zn...Zn/Br) Flow Battery -based Energy Storage System (ESS) at the Marine Corps Air Station (MCAS) Miramar. The effort integrates an innovative Zn/Br

  16. First results from imaging riometer installed at Indian Antarctic ...

    Indian Academy of Sciences (India)

    Cosmic noise absorption (CNA) measurred by imaging riometer, is an excellent tool to passively study the high latitude D-region ionospheric conditions and dynamics. An imaging riometer has been installed at Indian Antarctic station Maitri (geographic 70.75°S, 11.75°E; corrected geomagnetic 63.11°S, 53.59°E) in ...

  17. Sustainability Indicators for the Army Installation Management Command

    Science.gov (United States)

    2011-03-01

    Man- agement Systems (EMS) conformance Req 1 EMS must conform to require- ments set forth by ISO 14001 ; must also identify and show com- pliance...Implement Sustainable Installation Mana- gement - ISO 14001 P2.2 Implement Sustainable Facilities P2.3 Expand Use of Renewable Energy P2.4 Execute...Organization for Standardization ( ISO ) 14001 • Potable water usage • Projects (New Construction) implemented to meet 2 points for LEED to support

  18. Electro-fueloil installations. Lessons of past experience

    Energy Technology Data Exchange (ETDEWEB)

    Rys, D. (Electricite de France (EDF))

    1989-10-01

    The combination od an electric boiler with boilers consuming fuel with a view to get an electro-fueloil installation does not pose any big problem. However, it is necessary to respect a minimum number of basic principles giving satisfaction, on the energetical level as well as on the level of the service rendered. A great amount of expert's reports and experimental tests permits to set forth the main points to be observed.

  19. Optimizing microgrid architecture on Department of Defense installations

    OpenAIRE

    Ulmer, Nicholas A.

    2014-01-01

    Approved for public release; distribution is unlimited Energy managers are faced with the challenge of upgrading their installation microgrids in a tight fiscal environment, while meeting the challenges of incorporating higher percentages of renewable energy sources and providing better energy assurance during commercial grid failures. Incorporating renewable sources of energy into a microgrid is challenging due to the intermittent nature of supply. Using historical solar data and simulate...

  20. Enlaces de datos En VHF (VDL dentro del contexto CNS/ATM para la prestación de los servicios de tránsito aéreo en Colombia

    Directory of Open Access Journals (Sweden)

    Édgar Leonardo Gómez Gómez

    2012-09-01

    Full Text Available En este artículo se analiza el protocolo de comunicaciones por enlaces de datos en VHF (VDL, el cual, junto con técnicas de posicionamiento satelital, es uno de los pilares fundamentales dentro del concepto CNS/ATM planteado por la Organización de Aviación Civil Internacional (OACI, el cual busca la implantación de nuevas tecnologías para la prestación de los servicios de tránsito aéreo en las áreas de comunicaciones, navegación y vigilancia de aeronaves a nivel mundial. Se presenta el tipo de sistemas usados actualmente por la Unidad Administrativa Especial de Aeronáutica Civil (UAEAC para la prestación de estos servicios en Colombia, y se hace un comparativo para establecer las ventajas que tiene la implantación de las nuevas tecnologías planteadas en el concepto CNS/ATM, teniendo en cuenta las condiciones particulares de terreno y de flujo de tránsito aéreo que presenta Colombia. Además, se presentan los proyectos de implementación de subredes basadas en enlaces de datos VDL más relevantes a nivel mundial, los cuales permiten obtener resultados de pruebas de funcionamiento, como un paso fundamental hacia la consolidación a nivel mundial de este tipo de tecnología.

  1. Reduction of Dynamic Loads in Mine Lifting Installations

    Science.gov (United States)

    Kuznetsov, N. K.; Eliseev, S. V.; Perelygina, A. Yu

    2018-01-01

    Article is devoted to a problem of decrease in the dynamic loadings arising in transitional operating modes of the mine lifting installations leading to heavy oscillating motions of lifting vessels and decrease in efficiency and reliability of work. The known methods and means of decrease in dynamic loadings and oscillating motions of the similar equipment are analysed. It is shown that an approach based on the concept of the inverse problems of dynamics can be effective method of the solution of this problem. The article describes the design model of a one-ended lifting installation in the form of a two-mass oscillation system, in which the inertial elements are the mass of the lifting vessel and the reduced mass of the engine, reducer, drum and pulley. The simplified mathematical model of this system and results of an efficiency research of an active way of reduction of dynamic loadings of lifting installation on the basis of the concept of the inverse problems of dynamics are given.

  2. Installation of the Ion Accelerator for the Surface Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Kwon, Hyeok-Jung; Kim, Han-Sung; Chung, Bo-Hyun; Ahn, Tae-Sung; Kim, Dae-Il; Kim, Cho-Rong; Cho, Yong-Sub [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2015-10-15

    In this paper, an introduction to the accelerator, an installation status at KOMAC and the operation plan of the accelerator are discussed. A pelletron, which has been used over 25 years at KIGAM, is moved and installed at KOMAC in order to supply a qualified service to ion beam users. The system will be installed in September and component tests will be carried. The operation of the system starts in 2016 after it gets operation license from Nuclear Safety and Security Commission. Korea Multi-purpose Accelerator Complex (KOMAC) is operating several ion beam accelerators to provide various ion beams to users. Those are a 100 MeV proton linear accelerator, a 220 keV ion implanter for gaseous ion beams, a 150 keV metal ion implanter and a 20 keV high-current ion implanter. All of those are the machine for user service and it is important to qualify the results of the irradiation conditions for user service. For this reason, an electrostatic tandem accelerator, which has been operating over 25 years at Korea Institute of Geoscience and Mineral Resources (KIGAM), is moved to KOMAC in order to supply the qualified and quantified data on the irradiation species.

  3. Design and installation manual for thermal energy storage

    Energy Technology Data Exchange (ETDEWEB)

    Cole, R L; Nield, K J; Rohde, R R; Wolosewicz, R M

    1980-01-01

    The purpose of this manual is to provide information on the design and installation of thermal energy storage in active solar systems. It is intended for contractors, installers, solar system designers, engineers, architects, and manufacturers who intend to enter the solar energy business. The reader should have general knowledge of how solar heating and cooling systems operate and knowledge of construction methods and building codes. Knowledge of solar analysis methods such as f-Chart, SOLCOST, DOE-1, or TRNSYS would be helpful. The information contained in the manual includes sizing storage, choosing a location for the storage device, and insulation requirements. Both air-based and liquid-based systems are covered with topics on designing rock beds, tank types, pump and fan selection, installation, costs, and operation and maintenance. Topics relevant to latent heat storage include properties of phase-change materials, sizing the storage unit, insulating the storage unit, available systems, and cost. Topics relevant to heating domestic water include safety, single- and dual-tank systems, domestic water heating with air- and liquid-based space heating systems, and stand alone domestics hot water systems. Several appendices present common problems with storage systems and their solutions, heat transfer fluid properties, economic insulation thickness, heat exchanger sizing, and sample specifications for heat exchangers, wooden rock bins, steel tanks, concrete tanks, and fiberglass-reinforced plastic tanks.

  4. Environmental assessment: Kotzebue Wind Installation Project, Kotzebue, Alaska

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-05-01

    The DOE is proposing to provide financial assistance to the Kotzebue Electric Association to expand its existing wind installation near Kotzebue, Alaska. Like many rural Alaska towns, Kotzebue uses diesel-powered generators to produce its electricity, the high cost of which is currently subsidized by the Alaska State government. In an effort to provide a cost effective and clean source of electricity, reduce dependence on diesel fuel, and reduce air pollutants, the DOE is proposing to fund an experimental wind installation to test commercially available wind turbines under Arctic conditions. The results would provide valuable information to other Alaska communities experiencing similar dependence on diesel-powered generators. The environmental assessment for the proposed wind installation assessed impacts to biological resources, land use, electromagnetic interference, coastal zone, air quality, cultural resources, and noise. It was determined that the project does not constitute a major Federal action significantly affecting the quality of the human environment. Therefore, the preparation of an environmental impact statement is not required, and DOE has issued a Finding of No Significant Impact.

  5. Design and installation manual for thermal energy storage

    Energy Technology Data Exchange (ETDEWEB)

    Cole, R L; Nield, K J; Rohde, R R; Wolosewicz, R M [eds.

    1979-02-01

    The purpose for this manual is to provide information on the design and installation of thermal energy storage in solar heating systems. It is intended for contractors, installers, solar system designers, engineers, architects, and manufacturers who intend to enter the solar energy business. The reader should have general knowledge of how solar heating systems operate and knowledge of construction methods and building codes. Knowledge of solar analysis methods such as f-chart, SOLCOST, DOE-1, or TRNSYS would be helpful. The information contained in the manual includes sizing storage, choosing a location for the storage device, and insulation requirements. Both air-based and liquid-based systems are covered with topics on designing rock beds, tank types, pump and fan selection, installation, costs, and operation and maintenance. Topics relevant to heating domestic water include safety, single- and dual-tank systems, domestic water heating with air- and liquid-based space heating system, and stand-alone domestic hot water systems. Several appendices present common problems with storage systems and their solutions, heat transfer fluid properties, heat exchanger sizing, and sample specifications for heat exchangers, wooden rock bins, steel tanks, concrete tanks, and fiberglass-reinforced plastic tanks.

  6. EMISSION AND TRENDS IN RECLAIMING WASTE HEAT IN INDUSTRIAL INSTALATIONS

    Directory of Open Access Journals (Sweden)

    Lech Hys

    2013-04-01

    Full Text Available The article presents the analysis of waste heat emission in a typical industrial installation. On the basis of the process monitoring system, periodic analyses of fumes composition, installation process manual and the conducted measurements of the heat fluxes from individual sources emitting heat on the way of natural convection from the devices’ coats and forced convection in the fumes flux were calculated. According to the authors the heat of temperature 140–155 °C and surface power density 860–970 W/m2 emitted by devices’ covers can be reclaimed in ORC techniques, Peltier’s modules and the systems realising Stirling cycle. Part of the waste heat included in fumes, which makes c.a. 76% of the total emission from the installation, should be returned to the process of fuel oxidation, what will reduce the emission by c.a. 18% and the volume of consumed fuel by c.a. 25 m3 CH4/h, according to the presented calculations.

  7. Règle d'installation vidéosurveillance

    CERN Document Server

    2011-01-01

    Ce référentiel définit les exigences techniques minimales applicables aux systèmes de vidéosurveillance, avec des caméras implantées à l’intérieur ou l’extérieur. Il donne des recommandations pour concevoir, installer et maintenir des systèmes de vidéosurveillance dans des applications de sécurité. Pour une vidéosurveillance efficace, on pourra appliquer la méthodologie proposée : comment réaliser l’analyse de risque ? Quel rôle attribuer au système de vidéosurveillance ? quel système mettre en place, avec quelles fonctions et quelles caractéristiques techniques ? comment réaliser l’installation ? comment assurer la maintenance du système ? Cette nouvelle édition a notamment pour objectifs de : compléter les rôles de la vidéosurveillance (gestion d'activité) ; clarifier la définition des objectifs de prise de vue ; inclure l'utilisation d'une cible normalisée pour la réception de l'installation ; mettre à disposition un outil d'aide pour les petits systèmes ;...

  8. Measure Guideline: Combined Space and Water Heating Installation and Optimization

    Energy Technology Data Exchange (ETDEWEB)

    Schoenbauer, B. [NorthernSTAR Building America Partnership, St. Paul, MN (United States); Bohac, D. [NorthernSTAR Building America Partnership, St. Paul, MN (United States); Huelman, P. [NorthernSTAR Building America Partnership, St. Paul, MN (United States)

    2017-03-01

    Combined space and water heater (combi or combo) systems are defined by their dual functionality. Combi systems provide both space heating and water heating capabilities with a single heat source. This guideline will focus on the installation and operation of residential systems with forced air heating and domestic hot water (DHW) functionality. Past NorthernSTAR research has used a combi system to replace a natural gas forced air distribution system furnace and tank type water heater (Schoenbauer et al. 2012; Schoenbauer, Bohac, and McAlpine 2014). The combi systems consisted of a water heater or boiler heating plant teamed with a hydronic air handler that included an air handler, water coil, and water pump to circulate water between the heating plant and coil. The combi water heater or boiler had a separate circuit for DHW. Past projects focused on laboratory testing, field characterization, and control optimization of combi systems. Laboratory testing was done to fully characterize and test combi system components; field testing was completed to characterize the installed performance of combi systems; and control methodologies were analyzed to understand the potential of controls to simplify installation and design and to improve system efficiency and occupant comfort. This past work was relied upon on to create this measure guideline.

  9. Measure Guideline: Combined Space and Water Heating Installation and Optimization

    Energy Technology Data Exchange (ETDEWEB)

    Schoenbauer, B. [Univ. of Minnesota, St. Paul, MN (United States). NorthernSTAR Building America Partnership; Bohac, D. [Univ. of Minnesota, St. Paul, MN (United States). NorthernSTAR Building America Partnership; Huelman, P. [Univ. of Minnesota, St. Paul, MN (United States). NorthernSTAR Building America Partnership

    2017-03-03

    Combined space and water heater (combi or combo) systems are defined by their dual functionality. Combi systems provide both space heating and water heating capabilities with a single heat source. This guideline will focus on the installation and operation of residential systems with forced air heating and domestic hot water (DHW) functionality. Past NorthernSTAR research has used a combi system to replace a natural gas forced air distribution system furnace and tank type water heater (Schoenbauer et al. 2012; Schoenbauer, Bohac, and McAlpine 2014). The combi systems consisted of a water heater or boiler heating plant teamed with a hydronic air handler that included an air handler, water coil, and water pump to circulate water between the heating plant and coil. The combi water heater or boiler had a separate circuit for DHW. Past projects focused on laboratory testing, field characterization, and control optimization of combi systems. Laboratory testing was done to fully characterize and test combi system components; field testing was completed to characterize the installed performance of combi systems; and control methodologies were analyzed to understand the potential of controls to simplify installation and design and to improve system efficiency and occupant comfort. This past work was relied upon on to create this measure guideline.

  10. Empirically Derived Strength of Residential Roof Structures for Solar Installations.

    Energy Technology Data Exchange (ETDEWEB)

    Dwyer, Stephen F.; Sanchez, Alfred; Campos, Ivan A.; Gerstle, Walter H.

    2014-12-01

    Engineering certification for the installation of solar photovoltaic (PV) modules on wood roofs is often denied because existing wood roofs do not meet structural design codes. This work is intended to show that many roofs are actually sufficiently strong given the conservatism in codes, documented allowable strengths, roof structure system effects, and beam composite action produced by joist-sheathing interaction. This report provides results from a testing program to provide actual load carrying capacity of residential rooftops. The results reveal that the actual load carrying capacity of structural members and systems tested are significantly stronger than allowable loads provided by the International Residential Code (IRC 2009) and the national structural code found in Minimum Design Loads for Buildings and Other Structures (ASCE 7-10). Engineering analysis of residential rooftops typically ignores the system affects and beam composite action in determining rooftop stresses given a potential PV installation. This extreme conservatism combined with conservatism in codes and published allowable stress values for roof building materials (NDS 2012) lead to the perception that well built homes may not have adequate load bearing capacity to enable a rooftop PV installation. However, based on the test results presented in this report of residential rooftop structural systems, the actual load bearing capacity is several times higher than published values (NDS 2012).

  11. First Linac4 DTL & CCDTL cavities installed in tunnel

    CERN Multimedia

    Katarina Anthony

    2014-01-01

    On 5 June, the first Drift Tube Linac (DTL) was successfully transported to its forever home in the Linac4 tunnel. Similarly, the first Cell-Coupled Drift Tube Linac (CCDTL) was installed on 6 June. These moves marked the end of years of design and manufacturing by Linac4 teams.   Although it may seem like a relatively routine transport operation, the DTL's move was a landmark event for the entire Linac4 collaboration. "Along with the first four Cell-Coupled DTL modules, which were installed on the following two working days, these are the first accelerating structures after front-end commissioning to be installed in the tunnel," says Frank Gerigk, who is responsible for all Linac4 accelerating structures. "It is a major milestone, because work on all these structures started well over a decade ago." The transport operation was also quite a victory for the Linac4 DTL team, whose journey to a complete DTL structure has been a bit of a wild ride. &qu...

  12. Last End Cap Toroid installation : The Pharaonic enterprise

    CERN Document Server

    Arnaud Foussat

    After the successful and impressive transport feat from Building 191 to Point 1 was carried out by the Friderici crew on 28th June, the second and last Toroid End Cap, ECT-C, was transferred into the surface building, SX1, on 2nd July. The ECT-C was installed in the ATLAS cavern on the C-side on 12th July. As the person responsible for the project, in my opinion, one of the crucial points of this project was to design all the tooling and installation sequences taking into account the building infrastructure dimensional constraints. View of the ECT installation tooling and preparation for the ECT-C descent into the ATLAS 80m-shaft by the ATLAS magnet group and DBS teams. The movement of the 240-ton magnet and 12-m diameter toroid end-cap was achieved in collaboration with SCALES, a subcontractor company, using a hydraulic gantry able to lower the ECT inside the shaft by 5m below the floor level . This allowed the DBS team to attach the end-cap with the 2 x 140 tons overhead crane and lower it onto the c...

  13. Development and installation of Picostrain sensors in structural systems

    Science.gov (United States)

    Sener, Joseph C.; Latta, Bernard M.; Ross, Jimmy D.

    2004-07-01

    The concept of the Picostrain sensor technology is based on a standard, commercially available, electrical cable assembly embedded in pavement or structural members. The concept has been developed through the 1990s and patented by the Idaho Transportation Department (ITD) in 2003. The objective of this new technology is to build an inexpensive, easily installed and maintained sensor system for the purposes of vehicle classification (VC), vehicle identification (VI), weigh-in-motion (WIM), and vehicle tracking (VT) applications along with real-time monitoring and evaluation of structural performance under static and dynamic traffic loading. It is intended, in the future, that these sensors will be further developed to replace curently utilized expensive embedded pavement and structural sensors for ultimate improvement of transportation decision-making and planning. This will also help to document the movement of people and goods along with the evironmental, social, economic and financial parameters with an emphasis on tracking movements in social life for security based upon the use of this durable and reliable transducers. Approximately, 400 sensors have been installed on and in the reinforced concrete structural members of the West Park Center River Crossing Bridge (Bridge) and the Micron Engineering Center (MEC) building (Building) at Boise State University (BSU) in Boise, Idaho, USA, since 1998. These sensors were installed: in bridge pile caps, piers, girders and decks; bridge abutment embankments; building footings, columns, beams, floor slabs; and, have been linked to instrument cabinets on site. These sensors installed structures may now be called "smart" structures since they contain a resident sensing system capable of maintaining a constant watch over the integrity of the structure. These sensing systems will be able to evaluate the applied loads, as well as the static and dynamic response of the structure. This paper introduces and describes the new

  14. The effect of cleanliness control during installation work on the amount of accumulated dust in ducts of new HVAC installations.

    Science.gov (United States)

    Holopainen, R; Tuomainen, M; Asikainen, V; Pasanen, P; Säteri, J; Seppänen, O

    2002-09-01

    The aim of this study was to evaluate the amount of dust in supply air ducts in recently installed ventilation systems. The samples for the determination of dust accumulation were collected from supply air ducts in 18 new buildings that have been constructed according to two different cleanliness control levels classified as category P1 (low oil residues and protected against contaminations) and category P2, as defined in the Classification of Indoor Climate, Construction and Building Materials. In the ducts installed according to the requirements of cleanliness category P1 the mean amount of accumulated dust was 0.9 g/m2 (0.4-2.9 g/m2), and in the ducts installed according to the cleanliness category P2 it was 2.3 g/m2 (1.2-4.9 g/m2). A significant difference was found in the mean amounts of dust between ducts of categories P1 and P2 (P < 0.008). The cleanliness control procedure in category P1 proved to be a useful and effective tool for preventing dust accumulation in new air ducts during the construction process. Additionally, the ducts without residual oil had lower amounts of accumulated dust indicating that the demand for oil free components in the cleanliness classification is reasonable.

  15. The air quality in ventilation installations. Practical guidelines; Qualite de l'air dans les installations aerauliques. Guide pratique

    Energy Technology Data Exchange (ETDEWEB)

    Angeli, L. [France Air, 91 - Chilly Mazarin (France); Bianchina, M. [Unelvent, 93 - Le Bourget (France); Blazy, M. [Anjos, 01 - Torcieu (France); Boulanger, X. [Aldes, 21 - Chenove (France); Chiesa, M. [Atlantic (France); Duclos, M. [Groupe Titanair, 69 - Lyon (France); Hubert, D.; Kridorian, O. [Groupe Astato, Blanc Mesnil (France); Josserand, O. [Carrier (Belgium); Lancieux, C. [Camfil, 60 - Saint Martin Longueau (France); Lemaire, J.C. [Agence de l' Environnement et de la Maitrise de l' Energie, ADEME, 75 - Paris (France); Petit, Ph. [Compagnie Industrielle d' Applications Thermiques ( CIAT ), 75 - Paris (France); Ribot, B. [Electricite de France (EDF), 75 - Paris (France); Tokarek, S. [Gaz de France (GDF), 75 - Paris (France); Bernard, A.M.; Tissot, A. [Centre Technique des Industries Aerauliques et Thermiques (CETIAT), 69 - Villeurbanne (France)

    2004-07-01

    The present guide aims to provide design departments, maintenance companies and builders with practical guidelines and recommendations for the installation of ventilation and air-conditioning systems. The objective is to ensure good Indoor Air Quality (IAQ) and to safeguard the health and well-being of the occupants. The guide deals with aspects of design, dimensioning, installation and servicing, all of which play a major role in guaranteeing IAQ and duct-work hygiene. These steps are reviewed for the principal ventilation systems met in both residential and commercial premises. The first part presents the system and draws the attention of the user to specific points which require particular care in term of IAQ. The second part details recommended practice component by component, in respect of design, installation and servicing. Application of these simple guidelines during the various project stages is essential, in order to ensure a good IAQ in ventilation systems. Content: introduction; good ventilation; systems: exhaust ventilation, balanced ventilation, air handling unit, terminal ventilation units, impact of systems on indoor air quality, components: air inlet, air filter, heat recovery unit, heating or cooling coil, humidifier, mechanical fan unit, cowl and hybrid ventilation fan, mixing box, ventilation duct-work, air outlet and air terminal device; references.

  16. Demonstration of river crossing technology for installation of environmental horizontal wells: AMH-6 and AMH-7 installation report

    Energy Technology Data Exchange (ETDEWEB)

    Moore, D. B.

    1993-07-01

    The Department of Energy`s (DOE) Office of Technology Development initiated an integrated demonstration of innovative technologies and systems for cleanup of volatile organic compounds (VOCs) in soils and groundwater. This drilling project is part of the directional drilling task for the integrated technology demonstration at the Savannah River Site (SRS). One of the objectives of the drilling task is the demonstration of multiple drilling technologies. The technologies can then be compared and evaluated in terms of technical performance and cost effectiveness. Petroleum horizontal well technology and utility industry horizontal well technology have been previously demonstrated at the SRS. The petroleum industry directional drilling technology was demonstrated by Eastman Christensen Environmental Corporation (ECEC). ECEC directionally drilled and installed four horizontal wells in the M Area. Charles Machine Works, working with Sandia National Laboratory, demonstrated a utility industry directional drilling technology by installing one horizontal well in the M Area. The demonstration that is the subject of this report involved river crossing horizontal well technology for the installation of two M-Area Settling Basin soil gas extraction wells.

  17. Approaches for Evaluating the Impact of Urban Encroachment on Installation Training/Testing

    National Research Council Canada - National Science Library

    Westervelt, James D

    2004-01-01

    .... Over time, land uses and land ownership near installations can change. After such changes, nearby land owners may demand that installations curtail mission-related activities that are incompatible with civilian residential areas...

  18. THE NATURAL COLD ACCUMULATOR AND VACUUM INSTALLATION FOR MILK COOLING IN REPUBLIC OF MOLDOVA

    Directory of Open Access Journals (Sweden)

    Cretu V.

    2010-04-01

    Full Text Available Based on theoretical and experimental research of the milk cooling process was elaborated mathematical model of accumulator with natural cold and vacuum installations, which allows determining the operating system installations, mentioned from environmental parameters.

  19. Tunnels: different construction methods and its use for pipelines installation

    Energy Technology Data Exchange (ETDEWEB)

    Mattos, Tales; Soares, Ana Cecilia; Assis, Slow de; Bolsonaro, Ralfo; Sanandres, Simon [Petroleo do Brasil S.A. (PETROBRAS), Rio de Janeiro, RJ (Brazil)

    2009-07-01

    In a continental dimensions country like Brazil, the pipeline modal faces the challenge of opening ROW's in the most different kind of soils with the most different geomorphology. To safely fulfill the pipeline construction demand, the ROW opening uses all techniques in earthworks and route definition and, where is necessary, no digging techniques like horizontal directional drilling, micro tunneling and also full size tunnels design for pipelines installation in high topography terrains to avoid geotechnical risks. PETROBRAS has already used the tunnel technique to cross higher terrains with great construction difficult, and mainly to make it pipeline maintenance and operation easier. For the GASBOL Project, in Aparados da Serra region and in GASYRG, in Bolivia, two tunnels were opened with approximately 700 meters and 2,000 meters each one. The GASBOL Project had the particularity of being a gallery with only one excavation face, finishing under the hill and from this point was drilled a vertical shaft was drilled until the top to install the pipeline section, while in GASYRG Project the tunnel had two excavation faces. Currently, two projects are under development with tunnels, one of then is the Caraguatatuba-Taubate gas pipeline (GASTAU), with a 5 km tunnel, with the same concepts of the GASBOL tunnel, with a gallery to be opened with the use of a TBM (Tunneling Boring Machine), and a shaft to the surface, and the gas pipeline Cabiunas-Reduc III (GASDUC III) project is under construction with a 3.7 km tunnel, like the GASYRG tunnel with two faces. This paper presents the main excavation tunneling methods, conventional and mechanized, presenting the most relevant characteristics from both and, in particular, the use of tunnels for pipelines installation. (author)

  20. CCS on Offshore Oil and Gas Installation - Design of Post Combustion Capture System and Steam Cycle

    OpenAIRE

    Nord, Lars O.; Anantharaman, Rahul; Chikukwa, Actor; Mejdell, Thor

    2017-01-01

    Most of the released CO2 on offshore oil and gas installation originates from the gas turbines that power the installations. For certain offshore installations, CO2 capture and storage (CCS) could be an alternative to decrease the CO2 emissions. When opting for a chemical absorption CO2 capture system, a heat source for the stripper reboiler is needed. Since most offshore installations are powered by simple cycle GTs, there is typically no steam available that could be used for stripper reboi...