WorldWideScience

Sample records for vhf radio aurora

  1. VHF spectrum monitoring using Meraka cognitive radio platform

    CSIR Research Space (South Africa)

    Aderonmu, AI

    2012-11-01

    Full Text Available discuss the Meraka Cognitive Radio Platform (MCRP) developed using the second version of the Universal Serial Radio Peripheral (USRP2) hardware and the GNU Radio software. We also discussed how the spectrum monitoring system is being implemented...

  2. Spontaneous Radio Frequency Emissions from Natural Aurora. Chapter 4

    Science.gov (United States)

    LaBelle, J.

    2009-01-01

    At high latitudes, suitably sensitive radio experiments tuned below 5 MHz detect up to three types of spontaneous radio emissions from the Earth s ionosphere. In recent years, ground-based and rocket-borne experiments have provided strong evidence for theoretical explanations of the generation mechanism of some of these emissions, but others remain unexplained. Achieving a thorough understanding of these ionospheric emissions, accessible to ground-based experiments, will not only bring a deeper understanding of Earth s radio environment and the interactions between waves and particles in the ionosphere but also shed light on similar spontaneous emissions occurring elsewhere in Earth s environment as well as other planetary and stellar atmospheres.

  3. Creation of visible artificial optical emissions in the aurora by high-power radio waves

    Science.gov (United States)

    Pedersen, Todd. R.; Gerken, Elizabeth A.

    2005-02-01

    Generation of artificial light in the sky by means of high-power radio waves interacting with the ionospheric plasma has been envisaged since the early days of radio exploration of the upper atmosphere, with proposed applications ranging from regional night-time street lighting to atmospheric measurements. Weak optical emissions have been produced for decades in such ionospheric `heating' experiments, where they serve as key indicators of electron acceleration, thermal heating, and other effects of incompletely understood wave-particle interactions in the plasma under conditions difficult to replicate in the laboratory. The extremely low intensities produced previously have, however, required sensitive instrumentation for detection, preventing applications beyond scientific research. Here we report observations of radio-induced optical emissions bright enough to be seen by the naked eye, and produced not in the quiet mid-latitude ionosphere, but in the midst of a pulsating natural aurora. This may open the door to visual applications of ionospheric heating technology or provide a way to probe the dynamics of the natural aurora and magnetosphere.

  4. Antennas for VHF/UHF personal radio: A theoretical and experimental study of characteristics and performance

    DEFF Research Database (Denmark)

    Andersen, Jørgen Bach; Hansen, Flemming

    1977-01-01

    A theoretical analysis of the characteristics of small personal radio antennas for the 68- to 470-MHz frequency range is given. Representing the human body by a simplified lossy dielectric structure, the influence of the body on the performance of the antenna is investigated in detail...... to efficiency and radiation patterns at 80, 160, and 450 MHz, and it is demonstrated how the physical length of the antenna affects the antenna performance. The design of a very short and compact personal radio antenna is described....

  5. On the Origin of Io’s Ultraviolet Aurora. Planetary Radio Emissions| PLANETARY RADIO EMISSIONS VII 7|

    OpenAIRE

    H. O. Rucker; Shaposhnikov, V. E.; Zatsev, V. V.

    2011-01-01

    A model involving an additional contribution to Io’s ultraviolet (UV) aurora is presented. A mechanism for heating of electrons of Io’s ionospheric plasma up to sufficient energies for the excitation of Io’s atmospheric oxygen and emitting of observed UV emission is proposed. The mechanism operates by the effect of the different magnetization of the electrons and ions in Io’s ionosphere which in the course of Io’s motion through the Jovian magnetic field causes the creation of a charge-separa...

  6. Development of a passive VHF radar system using software-defined radio for equatorial plasma instability studies

    Science.gov (United States)

    Tuysuz, B.; Urbina, J.; Lind, F. D.

    2013-07-01

    In this paper, a bistatic passive radar receiver system named "Coherent-scatter Atmospheric Passive Radar Imager (CAPRI)" is described. It is primarily designed to study the dynamics of the upper atmosphere by utilizing "transmitters of opportunity" as the RF target illuminators. CAPRI is constructed using the open source software-defined radio toolkit, GNU Radio, to meet the signal processing requirements in combination with the open source hardware, Universal Software Radio Peripheral 2, for data acquisition. The resultant system is highly flexible, and we present the details of the design as well as a performance analysis. CAPRI will be deployed in Peru, near the magnetic equator, for long-term operations in the area. FM stations near Lima, Peru, will be utilized with the targets of interest being the equatorial electrojet and the spread F. The results will then be compared to the Jicamarca Unattended Long-term investigations of the Ionosphere and Atmosphere (JULIA) radar data, and CAPRI will be used to improve the simultaneous time and spatial coverage in the region in a more cost-effective manner.

  7. AuroraMAX!

    Science.gov (United States)

    Donovan, E.; Spanswick, E. L.; Chicoine, R.; Pugsley, J.; Langlois, P.

    2011-12-01

    AuroraMAX is a public outreach and education initiative that brings auroral images to the public in real time. AuroraMAX utilizes an observing station located just outside Yellowknife, Canada. The station houses a digital All-Sky Imager (ASI) that collects full-colour images of the night sky every six seconds. These images are then transmitted via satellite internet to our web server, where they are made instantly available to the public. Over the last two years this program has rapidly become one of the most successful outreach programs in the history of Space Science in Canada, with hundreds of thousands of distinct visitors to the CSA AuroraMAX website, thousands of followers on social media, and hundreds of newspaper, magazine, radio, and television spots. Over the next few years, the project will expand to include a high-resolution SLR delivering real-time auroral images (also from Yellowknife), as well as a program where astronauts on the ISS will take pictures of the aurora with a handheld SLR. The objectives of AuroraMAX are public outreach and education. The ASI design, operation, and software were based on infrastructure that was developed for the highly successful ASI component of the NASA THEMIS mission as well as the Canadian Space Agency (CSA) Canadian GeoSpace Monitoring (CGSM) program. So from an education and public outreach perspective, AuroraMAX is a single camera operating in the Canadian north. On the other hand, AuroraMAX is one of nearly 40 All-Sky Imagers that are operating across North America. The AuroraMAX camera produces data that is seamlessly integrated with the CGSM ASI data, and made widely available to the Space Science community through open-access web and FTP sites. One of our objectives in the next few years is to incorporate some of the data from the THEMIS and CGSM imagers into the AuroraMAX system, to maximize viewing opportunities and generate more real-time data for public outreach. This is an exemplar of a program that

  8. Dicty_cDB: VHF264 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF264 (Link to dictyBase) - - - Contig-U16260-1 VHF264P (Link to Original site) VHF...264F 606 VHF264Z 693 VHF264P 1279 - - Show VHF264 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-C/VHF264Q.Seq.d/ Representative seq. ID VHF...264P (Link to Original site) Representative DNA sequence >VHF264 (VHF264Q) /CSM/VH/VHF2-C/VHF...DRRKNIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHFEMPKEDKLPAGCTS

  9. Dicty_cDB: VHF181 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF181 (Link to dictyBase) - - - Contig-U16260-1 VHF181P (Link to Original site) VHF...181F 610 VHF181Z 416 VHF181P 1006 - - Show VHF181 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-D/VHF181Q.Seq.d/ Representative seq. ID VHF...181P (Link to Original site) Representative DNA sequence >VHF181 (VHF181Q) /CSM/VH/VHF1-D/VHF...VKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKVSG DMRYMSCRADEQERGITIKSSSVSLHF

  10. Dicty_cDB: VHF777 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF777 (Link to dictyBase) - - - Contig-U16283-1 VHF777P (Link to Original site) VHF...777F 474 VHF777Z 669 VHF777P 1123 - - Show VHF777 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-D/VHF777Q.Seq.d/ Representative seq. ID VHF...777P (Link to Original site) Representative DNA sequence >VHF777 (VHF777Q) /CSM/VH/VHF7-D/VHF...PNIIGVEHYKVATDVQKILXRI*itsryychfryg*fi *rpksncipcs*dstflittirscprxhqygr*ir*tlrlyq

  11. Dicty_cDB: VHF354 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF354 (Link to dictyBase) - - - Contig-U16260-1 VHF354P (Link to Original site) VHF...354F 617 VHF354Z 721 VHF354P 1318 - - Show VHF354 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-C/VHF354Q.Seq.d/ Representative seq. ID VHF...354P (Link to Original site) Representative DNA sequence >VHF354 (VHF354Q) /CSM/VH/VHF3-C/VHF...no Acid sequence LSSAKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGD

  12. Dicty_cDB: VHF590 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF590 (Link to dictyBase) - - - Contig-U16306-1 VHF590P (Link to Original site) VHF...590F 115 VHF590Z 603 VHF590P 698 - - Show VHF590 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-D/VHF590Q.Seq.d/ Representative seq. ID VHF...590P (Link to Original site) Representative DNA sequence >VHF590 (VHF590Q) /CSM/VH/VHF5-D/VHF5...qlphvlrqlk*sqnfhkkylkkvqeqqq--- ---rwifhrwccfqsthdamyflyqxfgslsw*snlxrpkist*xfyhifghfw*rls*l ss*ipi*lqkwysyv

  13. Dicty_cDB: VHF536 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF536 (Link to dictyBase) - - - Contig-U16531-1 VHF536P (Link to Original site) VHF...536F 255 VHF536Z 685 VHF536P 920 - - Show VHF536 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-B/VHF536Q.Seq.d/ Representative seq. ID VHF...536P (Link to Original site) Representative DNA sequence >VHF536 (VHF536Q) /CSM/VH/VHF5-B/VHF5...ti*mlhliskvmtvh*mslslfyggyfl*lsi*llwnysig qvvvcliksikxerllkstmt--- ---*erlcl*ilxlvsichf

  14. Dicty_cDB: VHF730 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF730 (Link to dictyBase) - - - Contig-U15767-1 VHF730P (Link to Original site) VHF...730F 569 VHF730Z 718 VHF730P 1267 - - Show VHF730 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-B/VHF730Q.Seq.d/ Representative seq. ID VHF...730P (Link to Original site) Representative DNA sequence >VHF730 (VHF730Q) /CSM/VH/VHF7-B/VHF...QEKRIPVLNSMDANDSINKKA RISWPDGFKYFFVDNQAGDSESAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQXFN DVSYPV--- ---lhvvvvkxvhtlpvnvnqivhf

  15. Dicty_cDB: VHF649 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF649 (Link to dictyBase) - - - Contig-U11031-1 VHF649P (Link to Original site) VHF...649F 562 VHF649Z 671 VHF649P 1213 - - Show VHF649 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF6-C/VHF649Q.Seq.d/ Representative seq. ID VHF...649P (Link to Original site) Representative DNA sequence >VHF649 (VHF649Q) /CSM/VH/VHF6-C/VHF...PNTPPTIKIELPSQSILKPSGQLKK*x* Translated Amino Acid sequence (All Frames) Frame A: i*qlvchlsivlfhhqviyphvlklekhf

  16. Dicty_cDB: VHF527 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF527 (Link to dictyBase) - - - Contig-U16260-1 VHF527P (Link to Original site) VHF...527F 571 VHF527Z 456 VHF527P 1007 - - Show VHF527 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-B/VHF527Q.Seq.d/ Representative seq. ID VHF...527P (Link to Original site) Representative DNA sequence >VHF527 (VHF527Q) /CSM/VH/VHF5-B/VHF...AKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQXRGITIKSSSVSLHF

  17. Dicty_cDB: VHF294 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF294 (Link to dictyBase) - - - Contig-U16441-1 VHF294P (Link to Original site) VHF...294F 573 VHF294Z 215 VHF294P 768 - - Show VHF294 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-D/VHF294Q.Seq.d/ Representative seq. ID VHF...294P (Link to Original site) Representative DNA sequence >VHF294 (VHF294Q) /CSM/VH/VHF2-D/VHF2...ssfst*scisfttfry*gfsdctfr*fhfn**RFWFNMEQCII QWVMFYS--- ---DCHVSIKKFFKWWQRLDRWCCXXXSCXXXSWWFWFPTFLRIQISNXXY*k

  18. Dicty_cDB: VHF690 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF690 (Link to dictyBase) - - - Contig-U11064-1 VHF690P (Link to Original site) VHF...690F 199 VHF690Z 419 VHF690P 598 - - Show VHF690 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF6-D/VHF690Q.Seq.d/ Representative seq. ID VHF...690P (Link to Original site) Representative DNA sequence >VHF690 (VHF690Q) /CSM/VH/VHF6-D/VHF6...vllksqsknqyl*hlikslidfinif*hgmhqiyhqrkkn*nq *k--- ---rrwfpr*rernhhfqlc*sts*rgcryw

  19. Dicty_cDB: VHF273 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF273 (Link to dictyBase) - - - Contig-U11514-1 VHF273P (Link to Original site) VHF...273F 644 VHF273Z 678 VHF273P 1302 - - Show VHF273 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-D/VHF273Q.Seq.d/ Representative seq. ID VHF...273P (Link to Original site) Representative DNA sequence >VHF273 (VHF273Q) /CSM/VH/VHF2-D/VHF...ctr*ccnvkdwchyssrl*syrs*ts*nrsifidr*iftsh*kdw**s llwfsnetr*skmcchcnwckhflwscckfstrnrrtwssssys*kywslly*fhrhlg

  20. Dicty_cDB: VHF243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF243 (Link to dictyBase) - - - Contig-U16423-1 VHF243P (Link to Original site) VHF...243F 580 VHF243Z 334 VHF243P 894 - - Show VHF243 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-B/VHF243Q.Seq.d/ Representative seq. ID VHF...243P (Link to Original site) Representative DNA sequence >VHF243 (VHF243Q) /CSM/VH/VHF2-B/VHF2...AATCNAGATATTCCAGATTGGTTTGAAAAGATGG TACA sequence update 2002.10.25 Translated Amino Acid sequence ifihadkff*RISHF

  1. Dicty_cDB: VHF134 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF134 (Link to dictyBase) - - - Contig-U16260-1 VHF134P (Link to Original site) VHF...134F 533 VHF134Z 404 VHF134P 917 - - Show VHF134 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-B/VHF134Q.Seq.d/ Representative seq. ID VHF...134P (Link to Original site) Representative DNA sequence >VHF134 (VHF134Q) /CSM/VH/VHF1-B/VHF1...cid sequence LSSAKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHFEMPKE

  2. Dicty_cDB: VHF892 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF892 (Link to dictyBase) - - - Contig-U16260-1 VHF892P (Link to Original site) VHF...892F 140 VHF892Z 417 VHF892P 537 - - Show VHF892 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF8-D/VHF892Q.Seq.d/ Representative seq. ID VHF...892P (Link to Original site) Representative DNA sequence >VHF892 (VHF892Q) /CSM/VH/VHF8-D/VHF8... Translated Amino Acid sequence TIKSSSVSLHFEMPXEDKLPAGCTSHEFLINLIDSPSHVDFS--- ---ELTASPNILEPIYLVEITAPENAIGGI

  3. Dicty_cDB: VHF479 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF479 (Link to dictyBase) - - - Contig-U11426-1 VHF479P (Link to Original site) VHF...479F 629 VHF479Z 691 VHF479P 1300 - - Show VHF479 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF4-D/VHF479Q.Seq.d/ Representative seq. ID VHF...479P (Link to Original site) Representative DNA sequence >VHF479 (VHF479Q) /CSM/VH/VHF4-D/VHF...EKNPQEWRWSGGFFVDSISDYVVKSRNTERPDHDSLLF HVNIKEKQGTHFIRIPLSSKESPPYIIQNDTQFKISFFQRDSPENIDYIEPKEKLCYGWD EPSAEYVL

  4. Dicty_cDB: VHF754 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF754 (Link to dictyBase) - - - Contig-U16531-1 VHF754P (Link to Original site) VHF...754F 526 VHF754Z 624 VHF754P 1130 - - Show VHF754 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-C/VHF754Q.Seq.d/ Representative seq. ID VHF...754P (Link to Original site) Representative DNA sequence >VHF754 (VHF754Q) /CSM/VH/VHF7-C/VHF...ixnkmqwlkmlqvk*killk*ekvvslgiiftipf--- ---flvsichfnchc*itfccsrwnnlxllxfldsryllqw*

  5. Dicty_cDB: VHF461 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF461 (Link to dictyBase) - - - Contig-U11551-1 VHF461P (Link to Original site) VHF...461F 646 VHF461Z 261 VHF461P 887 - - Show VHF461 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF4-C/VHF461Q.Seq.d/ Representative seq. ID VHF...461P (Link to Original site) Representative DNA sequence >VHF461 (VHF461Q) /CSM/VH/VHF4-C/VHF4...TTAAATTATTAAAAATAGTAAATAAAAAAAA sequence update 2002.10.25 Translated Amino Acid sequence fyfifenfkthfhiiffl

  6. Dicty_cDB: VHF781 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF781 (Link to dictyBase) - - - Contig-U16440-1 VHF781P (Link to Original site) VHF...781F 452 VHF781Z 680 VHF781P 1112 - - Show VHF781 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-D/VHF781Q.Seq.d/ Representative seq. ID VHF...781P (Link to Original site) Representative DNA sequence >VHF781 (VHF781Q) /CSM/VH/VHF7-D/VHF...vlkmmmlkf*xixftr*r Frame C: glldinkleeiik*rfhlfylfl*rlllayhfhkilfqlisktaligsnfnhyiqikmim y*l*iqdqrmf*kdqqmvv

  7. Dicty_cDB: VHF435 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF435 (Link to dictyBase) - - - Contig-U16260-1 VHF435P (Link to Original site) VHF...435F 616 VHF435Z 703 VHF435P 1299 - - Show VHF435 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF4-B/VHF435Q.Seq.d/ Representative seq. ID VHF...435P (Link to Original site) Representative DNA sequence >VHF435 (VHF435Q) /CSM/VH/VHF4-B/VHF...AKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHF

  8. Dicty_cDB: VHF553 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF553 (Link to dictyBase) - - - Contig-U16433-1 VHF553P (Link to Original site) VHF...553F 122 VHF553Z 533 VHF553P 635 - - Show VHF553 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-C/VHF553Q.Seq.d/ Representative seq. ID VHF...553P (Link to Original site) Representative DNA sequence >VHF553 (VHF553Q) /CSM/VH/VHF5-C/VHF5...ed Amino Acid sequence syhfylfiy*IIIYLLNYYLLSCVNYLPINFNILYIY--- ---YVINLTLDGDNVNGFPKTVTVKPAPSXEQXYAEGEGLVKVF

  9. Dicty_cDB: VHF163 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF163 (Link to dictyBase) - - - Contig-U11129-1 VHF163P (Link to Original site) VHF1...63F 611 VHF163Z 654 VHF163P 1245 - - Show VHF163 Library VH (Link to library) Clone ID VHF1...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-C/VHF163Q.Seq.d/ Representative seq. ID VHF1...63P (Link to Original site) Representative DNA sequence >VHF163 (VHF163Q) /CSM/VH/VHF1-C/VHF1...nt alignments: (bits) Value VHF163 (VHF163Q) /CSM/VH/VHF1-C/VHF163Q.Seq.d/ 2357 0.0 VHM584 (VHM584Q) /CSM/VH

  10. Dicty_cDB: VHF444 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (Link to library) VHF444 (Link to dictyBase) - G20601 DDB0204337 Contig-U12392-1 VHF444P (Link to Original...site) VHF444F 579 VHF444Z 213 VHF444P 772 - - Show VHF444 Library VH (Link to library) Clone ID VHF444 (Link...tsukuba.ac.jp/CSM/VH/VHF4-B/VHF444Q.Seq.d/ Representative seq. ID VHF444P (Link to Original site) Representative...Representative DNA sequence >VHF444 (VHF444Q) /CSM/VH/VHF4-B/VHF444Q.Seq.d/ CAAAAGAAATAAATAATTATGCCATCA...significant alignments: (bits) Value VHF444 (VHF444Q) /CSM/VH/VHF4-B/VHF444Q.Seq.d/ 1479 0.0 VHA836 (VHA836Q)

  11. Dicty_cDB: VHF338 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF338 (Link to dictyBase) - - - Contig-U14303-1 VHF338P (Link to Original site) VHF3...38F 208 VHF338Z 685 VHF338P 873 - - Show VHF338 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF338Q.Seq.d/ Representative seq. ID VHF3...38P (Link to Original site) Representative DNA sequence >VHF338 (VHF338Q) /CSM/VH/VHF3-B/VHF3...significant alignments: (bits) Value VHF338 (VHF338Q) /CSM/VH/VHF3-B/VHF338Q.Seq.d/ 1296 0.0 VHK267 (VHK267Q

  12. Dicty_cDB: VHF394 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF394 (Link to dictyBase) - - - Contig-U16260-1 VHF394P (Link to Original site) VHF3...94F 563 VHF394Z 417 VHF394P 960 - - Show VHF394 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-D/VHF394Q.Seq.d/ Representative seq. ID VHF3...94P (Link to Original site) Representative DNA sequence >VHF394 (VHF394Q) /CSM/VH/VHF3-D/VHF3...nt alignments: (bits) Value VHF394 (VHF394Q) /CSM/VH/VHF3-D/VHF394Q.Seq.d/ 1776 0

  13. Dicty_cDB: VHF340 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF340 (Link to dictyBase) - - - Contig-U11939-1 VHF340P (Link to Original site) VHF3...40F 113 VHF340Z 506 VHF340P 599 - - Show VHF340 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF340Q.Seq.d/ Representative seq. ID VHF3...40P (Link to Original site) Representative DNA sequence >VHF340 (VHF340Q) /CSM/VH/VHF3-B/VHF3...Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF340 (VHF340Q) /CSM/VH/VHF3-B/VHF3

  14. Dicty_cDB: VHF329 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF329 (Link to dictyBase) - - - Contig-U16260-1 VHF329P (Link to Original site) VHF3...29F 618 VHF329Z 633 VHF329P 1231 - - Show VHF329 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF329Q.Seq.d/ Representative seq. ID VHF3...29P (Link to Original site) Representative DNA sequence >VHF329 (VHF329Q) /CSM/VH/VHF3-B/VHF3...s CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF329 (VHF329Q) /CSM/VH/VHF3

  15. VHF signal power suppression in stratiform and convective precipitation

    Directory of Open Access Journals (Sweden)

    A. J. McDonald

    2006-03-01

    Full Text Available Previous studies have indicated that VHF clear-air radar return strengths are reduced during periods of precipitation. This study aims to examine whether the type of precipitation, stratiform and convective precipitation types are identified, has any impact on the relationships previously observed and to examine the possible mechanisms which produce this phenomenon. This study uses a combination of UHF and VHF wind-profiler data to define periods associated with stratiform and convective precipitation. This identification is achieved using an algorithm which examines the range squared corrected signal to noise ratio of the UHF returns for a bright band signature for stratiform precipitation. Regions associated with convective rainfall have been defined by identifying regions of enhanced range corrected signal to noise ratio that do not display a bright band structure and that are relatively uniform until a region above the melting layer.

    This study uses a total of 68 days, which incorporated significant periods of surface rainfall, between 31 August 2000 and 28 February 2002 inclusive from Aberystwyth (52.4° N, 4.1° W. Examination suggests that both precipitation types produce similar magnitude reductions in VHF signal power on average. However, the frequency of occurrence of statistically significant reductions in VHF signal power are very different. In the altitude range 2-4 km stratiform precipitation is related to VHF signal suppression approximately 50% of the time while in convective precipitation suppression is observed only 27% of the time. This statistical result suggests that evaporation, which occurs more often in stratiform precipitation, is important in reducing the small-scale irregularities in humidity and thereby the radio refractive index. A detailed case study presented also suggests that evaporation reducing small-scale irregularities in humidity may contribute to the observed VHF signal

  16. VHF signal power suppression in stratiform and convective precipitation

    Directory of Open Access Journals (Sweden)

    A. J. McDonald

    2006-03-01

    Full Text Available Previous studies have indicated that VHF clear-air radar return strengths are reduced during periods of precipitation. This study aims to examine whether the type of precipitation, stratiform and convective precipitation types are identified, has any impact on the relationships previously observed and to examine the possible mechanisms which produce this phenomenon. This study uses a combination of UHF and VHF wind-profiler data to define periods associated with stratiform and convective precipitation. This identification is achieved using an algorithm which examines the range squared corrected signal to noise ratio of the UHF returns for a bright band signature for stratiform precipitation. Regions associated with convective rainfall have been defined by identifying regions of enhanced range corrected signal to noise ratio that do not display a bright band structure and that are relatively uniform until a region above the melting layer. This study uses a total of 68 days, which incorporated significant periods of surface rainfall, between 31 August 2000 and 28 February 2002 inclusive from Aberystwyth (52.4° N, 4.1° W. Examination suggests that both precipitation types produce similar magnitude reductions in VHF signal power on average. However, the frequency of occurrence of statistically significant reductions in VHF signal power are very different. In the altitude range 2-4 km stratiform precipitation is related to VHF signal suppression approximately 50% of the time while in convective precipitation suppression is observed only 27% of the time. This statistical result suggests that evaporation, which occurs more often in stratiform precipitation, is important in reducing the small-scale irregularities in humidity and thereby the radio refractive index. A detailed case study presented also suggests that evaporation reducing small-scale irregularities in humidity may contribute to the observed VHF signal suppression.

  17. Dicty_cDB: VHF187 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF187 (Link to dictyBase) - - - Contig-U16363-1 VHF187P (Link to Original site) VHF1...87F 549 VHF187Z 707 VHF187P 1236 - - Show VHF187 Library VH (Link to library) Clone ID VHF1...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-D/VHF187Q.Seq.d/ Representative seq. ID VHF1...87P (Link to Original site) Representative DNA sequence >VHF187 (VHF187Q) /CSM/VH/VHF1-D/VHF1...* Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF187 (VHF1

  18. Dicty_cDB: VHF368 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF368 (Link to dictyBase) - - - Contig-U12673-1 VHF368P (Link to Original site) VHF3...68F 597 VHF368Z 746 VHF368P 1323 - - Show VHF368 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-C/VHF368Q.Seq.d/ Representative seq. ID VHF3...68P (Link to Original site) Representative DNA sequence >VHF368 (VHF368Q) /CSM/VH/VHF3-C/VHF3...ikfpknkii*nki k*nkiky Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF368 (VHF3

  19. Reconfigurable, Digital EVA Radio Project

    Data.gov (United States)

    National Aeronautics and Space Administration — AeroAstro proposes to develop a low-power, low-volume and lightweight, state-of-the-art digital radio capable of operating in a wide variety of bands, from VHF...

  20. Dicty_cDB: VHF348 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF348 (Link to dictyBase) - - - Contig-U13926-1 VHF348P (Link to Original site) VHF3...48F 539 VHF348Z 473 VHF348P 992 - - Show VHF348 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF348Q.Seq.d/ Representative seq. ID VHF3...48P (Link to Original site) Representative DNA sequence >VHF348 (VHF348Q) /CSM/VH/VHF3-B/VHF3...ksxvlmliltck Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF3

  1. Dicty_cDB: VHF312 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF312 (Link to dictyBase) - - - Contig-U15897-1 VHF312P (Link to Original site) VHF3...12F 543 VHF312Z 483 VHF312P 1006 - - Show VHF312 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF312Q.Seq.d/ Representative seq. ID VHF3...12P (Link to Original site) Representative DNA sequence >VHF312 (VHF312Q) /CSM/VH/VHF3-A/VHF3... 4.0 %: extracellular, including cell wall 4.0 %: plasma membrane 4.0 %: peroxisomal >> prediction for VHF31

  2. Dicty_cDB: VHF375 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF375 (Link to dictyBase) - - - Contig-U16260-1 VHF375P (Link to Original site) VHF3...75F 432 VHF375Z 670 VHF375P 1082 - - Show VHF375 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-D/VHF375Q.Seq.d/ Representative seq. ID VHF3...75P (Link to Original site) Representative DNA sequence >VHF375 (VHF375Q) /CSM/VH/VHF3-D/VHF3...pperekv*pqksqiltnstknskqfkshxsfqr*xsnlkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF3

  3. Dicty_cDB: VHF190 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available F0-ATPase putative regulatory protein IF1 (if1) mRNA, complete cds; nuclear gene for mitochondrial produc...VH (Link to library) VHF190 (Link to dictyBase) - - - Contig-U12594-1 - (Link to Original site) VHF1...90F 581 - - - - - - Show VHF190 Library VH (Link to library) Clone ID VHF190 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF1-D/VHF190Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF190 (VHF190Q) /CSM/VH/VHF1-D/VHF190Q.Seq.d/ ATTTTTCATTTTAAAAA

  4. Dicty_cDB: VHF331 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF331 (Link to dictyBase) - - - - - (Link to Original site) VHF3...31F 609 - - - - - - Show VHF331 Library VH (Link to library) Clone ID VHF331 (Link to dictyBase) Atlas ID... - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF3...31Q.Seq.d/ Representative seq. ID - (Link to Original site) Representative DNA sequence >VHF3...31 (VHF331Q) /CSM/VH/VHF3-B/VHF331Q.Seq.d/ AACTCTCGAGTGCAAAAAAAGTAAAGTACAAAATGGTTAATTTCA

  5. Dicty_cDB: VHF709 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF709 (Link to dictyBase) - - - Contig-U15897-1 - (Link to Original site) - - VHF...709Z 602 - - - - Show VHF709 Library VH (Link to library) Clone ID VHF709 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF7-A/VHF709Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF709 (VHF709Q) /CSM/VH/VHF7-A/VHF709Q.Seq.d/ XXXXXXXXXXCGTCCAA...vestir Frame B: ---sknfttrsrlqlccsfnglxpr**rw*tnrqhyhg*cksiwsssfnlsryyw*yrcs ilpqiq*kwchhsnlpiw*wsflyhf

  6. Dicty_cDB: VHF236 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF236 (Link to dictyBase) - - - Contig-U14303-1 - (Link to Original site) - - VHF...236Z 611 - - - - Show VHF236 Library VH (Link to library) Clone ID VHF236 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF2-B/VHF236Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF236 (VHF236Q) /CSM/VH/VHF2-B/VHF236Q.Seq.d/ XXXXXXXXXXTGCCATT...VQKISQELKHLT*tfvsylvlk Frame B: ---plvicc*ninvlhfveilsxhglay*xhcfplvlv*fqilsrmiqs

  7. Dicty_cDB: VHF140 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF140 (Link to dictyBase) - - - Contig-U15309-1 - (Link to Original site) - - VHF...140Z 518 - - - - Show VHF140 Library VH (Link to library) Clone ID VHF140 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF1-B/VHF140Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF140 (VHF140Q) /CSM/VH/VHF1-B/VHF140Q.Seq.d/ XXXXXXXXXXCCGATAA...EDYINMQIKQLENSENSQELIQKLNEHLSEYKASVEEIKHNVQNN Frame C: ---iixvtlmlflqngilhfigviil

  8. Dicty_cDB: VHF507 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF507 (Link to dictyBase) - - - Contig-U11594-1 - (Link to Original site) - - VHF...507Z 541 - - - - Show VHF507 Library VH (Link to library) Clone ID VHF507 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF5-A/VHF507Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF507 (VHF507Q) /CSM/VH/VHF5-A/VHF507Q.Seq.d/ XXXXXXXXXXTACCAAT...nvhsmiwihvglxlvigx*sncfvttsfikst mmvllcstftmllkpsixwivvsmkkyf*clemnxhfw*sviki*knv

  9. Dicty_cDB: VHF321 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF321 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) VHF...321F 617 - - - - - - Show VHF321 Library VH (Link to library) Clone ID VHF321 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF321Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF321 (VHF321Q) /CSM/VH/VHF3-A/VHF321Q.Seq.d/ AACTCTCGAGTGCAAAA...VIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHFEMPKEDKLPAGCTSHEFLINLIDSPGHVDFS SEVTAALRVTDGALVVIDC

  10. Dicty_cDB: VHF866 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF866 (Link to dictyBase) - - - Contig-U16600-1 - (Link to Original site) - - VHF...866Z 388 - - - - Show VHF866 Library VH (Link to library) Clone ID VHF866 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF8-C/VHF866Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF866 (VHF866Q) /CSM/VH/VHF8-C/VHF866Q.Seq.d/ XXXXXXXXXXAAGCAGC...Frame C: ---qhnnifklafptiknftgvpmxfvmtnegdnlgnftvkthfakffstyyscgeaghh yfdsccn*y*qkqgckfhs*h*xkssrr*lcfxqnwfi

  11. Modeling the Jovian aurora

    Science.gov (United States)

    Waite, J. Hunter, Jr.

    1992-01-01

    The Jovian aurora is the most powerful aurora in the solar system, over 100 times more powerful than the Earth's aurora. These magnificent visual displays can provide important information about the planetary magnetosphere which is responsible for the acceleration of energetic particles that produce aurora at any planet. Similarities and differences in planetary auroral emissions are thus a viable means of classifying and studying both comparative atmospheric and magnetospheric processes. For instance, at Earth the solar wind is the primary source of auroral power while at Jupiter it is conjectured that the rotation of the planet is the major source of magnetospheric and auroral power. The purpose of this IR project was to develop a model: (1) for use in interpreting the existing set of multispectral observations of Jupiter's aurora; and (2) to design new experiments based on the findings to improve understanding of the underlying auroral processes.

  12. The detection of variable radio emission from the fast rotating magnetic hot B-star HR\\xA07355 and evidence for its X-ray aurorae

    Science.gov (United States)

    Leto, P.; Trigilio, C.; Oskinova, L.; Ignace, R.; Buemi, C. S.; Umana, G.; Ingallinera, A.; Todt, H.; Leone, F.

    2017-05-01

    In this paper, we investigate the multiwavelength properties of the magnetic early B-type star HR 7355. We present its radio light curves at several frequencies, taken with the Jansky Very Large Array, and X-ray spectra, taken with the XMM-Newton X-ray telescope. Modelling of the radio light curves for the Stokes I and V provides a quantitative analysis of the HR 7355 magnetosphere. A comparison between HR 7355 and a similar analysis for the Ap star CU Vir allows us to study how the different physical parameters of the two stars affect the structure of the respective magnetospheres where the non-thermal electrons originate. Our model includes a cold thermal plasma component that accumulates at high magnetic latitudes that influences the radio regime, but does not give rise to X-ray emission. Instead, the thermal X-ray emission arises from shocks generated by wind stream collisions close to the magnetic equatorial plane. The analysis of the X-ray spectrum of HR 7355 also suggests the presence of a non-thermal radiation. Comparison between the spectral index of the power-law X-ray energy distribution with the non-thermal electron energy distribution indicates that the non-thermal X-ray component could be the auroral signature of the non-thermal electrons that impact the stellar surface, the same non-thermal electrons that are responsible for the observed radio emission. On the basis of our analysis, we suggest a novel model that simultaneously explains the X-ray and the radio features of HR 7355 and is likely relevant for magnetospheres of other magnetic early-type stars.

  13. Dicty_cDB: VHF155 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF155 (Link to dictyBase) - - - - VHF155P (Link to Original site) VHF155F 587 VHF1...55Z 643 VHF155P 1210 - - Show VHF155 Library VH (Link to library) Clone ID VHF155 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1...-C/VHF155Q.Seq.d/ Representative seq. ID VHF155P (Link to... Original site) Representative DNA sequence >VHF155 (VHF155Q) /CSM/VH/VHF1-C/VHF155Q.Seq.d/ ATTCTCGATACTGGAA

  14. Dicty_cDB: VHF392 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF392 (Link to dictyBase) - - - - VHF392P (Link to Original site) VHF392F 568 VHF3...92Z 375 VHF392P 923 - - Show VHF392 Library VH (Link to library) Clone ID VHF392 (Link ...to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3...-D/VHF392Q.Seq.d/ Representative seq. ID VHF392P (Link to ...Original site) Representative DNA sequence >VHF392 (VHF392Q) /CSM/VH/VHF3-D/VHF392Q.Seq.d/ AACTCTCGAGTGCAAAA

  15. Dicty_cDB: VHF366 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF366 (Link to dictyBase) - - - Contig-U12131-1 | Contig-U13633-1 VHF3...66P (Link to Original site) VHF366F 590 VHF366Z 544 VHF366P 1114 - - Show VHF366 Library VH (Link to library) Clone ID VHF3...131-1 | Contig-U13633-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-C/VHF3...66Q.Seq.d/ Representative seq. ID VHF366P (Link to Original site) Representative DNA sequence >VHF366 (VHF3...66Q) /CSM/VH/VHF3-C/VHF366Q.Seq.d/ AATAATTTATTATTATTATTAATAAGTAATAGAAATAAAAGATGGAACCAATTCCAGATA

  16. Dicty_cDB: VHF310 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF310 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) - - VHF3...10Z 625 - - - - Show VHF310 Library VH (Link to library) Clone ID VHF310 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF310Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF310 (VHF310Q) /CSM/VH/VHF3-A/VHF310Q.Seq.d/ XXXXXXXXXXTCGTCAA...omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF310 (VHF310Q) /CSM/VH/VHF3-A/VHF3

  17. Dicty_cDB: VHF315 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF315 (Link to dictyBase) - G20600 DDB0169270 Contig-U12450-1 VHF3...15P (Link to Original site) VHF315F 216 VHF315Z 353 VHF315P 549 - - Show VHF315 Library VH (Link to library) Clone ID VHF3...ontig-U12450-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF3...15Q.Seq.d/ Representative seq. ID VHF315P (Link to Original site) Representative DNA sequence >VHF315 (VHF315Q) /CSM/VH/VHF3...-A/VHF315Q.Seq.d/ ATTAAAAAACTTCTTACTTGGACACCCCTTTTATATATATAAATAAAAACTTCTAAATAT AAATCCCA

  18. Dicty_cDB: VHF381 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF381 (Link to dictyBase) - - - Contig-U16508-1 - (Link to Original site) - - VHF3...81Z 645 - - - - Show VHF381 Library VH (Link to library) Clone ID VHF381 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF3-D/VHF381Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF381 (VHF381Q) /CSM/VH/VHF3-D/VHF381Q.Seq.d/ XXXXXXXXXXCAACCAA...ignments: (bits) Value VHF381 (VHF381Q) /CSM/VH/VHF3-D/VHF381Q.Seq.d/ 1223 0.0 VHP767 (VHP767Q) /CSM/VH/VHP7

  19. Dicty_cDB: VHF210 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF210 (Link to dictyBase) - - - Contig-U12400-1 | Contig-U16431-1 VHF...210P (Link to Original site) VHF210F 613 VHF210Z 636 VHF210P 1229 - - Show VHF210 Library VH (Link to library) Clone ID VHF...400-1 | Contig-U16431-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-A/VHF...210Q.Seq.d/ Representative seq. ID VHF210P (Link to Original site) Representative DNA sequence >VHF210 (VHF...210Q) /CSM/VH/VHF2-A/VHF210Q.Seq.d/ AATAAAATGATAAGATCATCAATAAAAAATAAAATAACAACAACAAAAAGTTTATCATGT

  20. Dicty_cDB: VHF575 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF575 (Link to dictyBase) - - - Contig-U15481-1 | Contig-U15981-1 VHF...575P (Link to Original site) VHF575F 586 VHF575Z 397 VHF575P 963 - - Show VHF575 Library VH (Link to library) Clone ID VHF...81-1 | Contig-U15981-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-D/VHF...575Q.Seq.d/ Representative seq. ID VHF575P (Link to Original site) Representative DNA sequence >VHF575 (VHF...575Q) /CSM/VH/VHF5-D/VHF575Q.Seq.d/ ATAATAATACAAAGAAGAAATGAAAAATATAAATAATAAAATTTTAAAGATTTTTATTCT

  1. Dicty_cDB: VHF296 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF296 (Link to dictyBase) - G23392 DDB0187414 Contig-U12449-1 VHF...296P (Link to Original site) VHF296F 241 VHF296Z 482 VHF296P 703 - - Show VHF296 Library VH (Link to library) Clone ID VHF...ontig-U12449-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-D/VHF...296Q.Seq.d/ Representative seq. ID VHF296P (Link to Original site) Representative DNA sequence >VHF296 (VHF296Q) /CSM/VH/VHF...2-D/VHF296Q.Seq.d/ GATTATCAGAAAGATTACATTATGAAATTATACCAGATTGTATTAAAATTATTGAAAGCT CAAAACAA

  2. Dicty_cDB: VHF436 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF436 (Link to dictyBase) - - - - VHF436P (Link to Original site) VHF436F 618 VHF...436Z 699 VHF436P 1297 - - Show VHF436 Library VH (Link to library) Clone ID VHF436 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF...4-B/VHF436Q.Seq.d/ Representative seq. ID VHF436P (Link to... Original site) Representative DNA sequence >VHF436 (VHF436Q) /CSM/VH/VHF4-B/VHF436Q.Seq.d/ AACTCTCGAGTGCAAA

  3. Dicty_cDB: VHF158 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF158 (Link to dictyBase) - - - - VHF158P (Link to Original site) VHF158F 608 VHF...158Z 693 VHF158P 1281 - - Show VHF158 Library VH (Link to library) Clone ID VHF158 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF...1-C/VHF158Q.Seq.d/ Representative seq. ID VHF158P (Link to... Original site) Representative DNA sequence >VHF158 (VHF158Q) /CSM/VH/VHF1-C/VHF158Q.Seq.d/ AACTCTCGAGTGCAAA

  4. Dicty_cDB: VHF847 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF847 (Link to dictyBase) - - - Contig-U15351-1 | Contig-U16514-1 VHF...847P (Link to Original site) VHF847F 478 VHF847Z 709 VHF847P 1167 - - Show VHF847 Library VH (Link to library) Clone ID VHF...351-1 | Contig-U16514-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF8-B/VHF...847Q.Seq.d/ Representative seq. ID VHF847P (Link to Original site) Representative DNA sequence >VHF847 (VHF...847Q) /CSM/VH/VHF8-B/VHF847Q.Seq.d/ TATGATGTTCCACTTATAATTCAAACGGTTGCCAATAATAAATCAACAAAACTCANTCTT

  5. Dicty_cDB: VHF272 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF272 (Link to dictyBase) - - - Contig-U15754-1 VHF272P (Link to Original site) VHF...272F 515 VHF272Z 603 VHF272P 1098 - - Show VHF272 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-C/VHF272Q.Seq.d/ Representative seq. ID VHF...272P (Link to Original site) Representative DNA sequence >VHF272 (VHF272Q) /CSM/VH/VHF2-C/VHF...id sequence (All Frames) Frame A: ixfssq**wnkkd*mihy*eiligrigvpm*vidngqlfvkimvvnhgptfhtimldhvh idgqrivlvdfvidfkifv*v*hf

  6. What Is the Aurora?

    Science.gov (United States)

    Clarke, John T.

    2004-12-01

    ```When I use a word,' Humpty Dumpty said in a rather scornful tone, `it means just what I choose it to mean-neither more nor less.''' From Through the Looking Glass, by Lewis Carroll. While writing a review chapter on Jupiter's aurora, I have given some thought recently to a general definition of the aurora. I have studied auroral emissions from Jupiter, Saturn, and Uranus for the last 20 years, and I at first blithely assumed that there was general agreement for the better understood terrestrial aurora.

  7. A single starfish Aurora kinase performs the combined functions of Aurora-A and Aurora-B in human cells.

    Science.gov (United States)

    Abe, Yusuke; Okumura, Eiichi; Hosoya, Takamitsu; Hirota, Toru; Kishimoto, Takeo

    2010-11-15

    Aurora, an essential mitotic kinase, is highly conserved during evolution. Most vertebrates have at least two Aurora kinases, Aurora-A and Aurora-B, which have distinct functions in the centrosome-spindle and inner centromere-midbody, respectively. However, some non-vertebrate deuterostomes have only a single Aurora. It remains to be verified whether the single Aurora performs the same functions as vertebrate Auroras A and B combined. We have isolated a cDNA of a single Aurora (ApAurora) from the echinoderm starfish, Asterina pectinifera, and show that ApAurora displays most features of both Aurora-A and Aurora-B in starfish oocytes and early embryos. Furthermore, ApAurora that is stably expressed in HeLa cells can substitute for both human Aurora-A and Aurora-B when either is reduced by RNAi. A single ApAurora thus has properties of both Aurora-A and Aurora-B in starfish eggs and HeLa cells. Together with phylogenetic analysis indicating that ApAurora forms a clade with all types of vertebrate Auroras and single Auroras of non-vertebrate deuterostomes, our observations support the idea that the single Aurora found in non-vertebrate deuterostomes represents the ancestor that gave rise to various types of vertebrate Auroras. This study thus provides functional evidence for phylogenetic considerations.

  8. Anechoic chamber for VHF and UHF bands

    Science.gov (United States)

    Morikawa, Takao; Sugiura, Akira; Harima, Katsushige; Masuzawa, Hiroshi

    1995-06-01

    Built in 1969, the anechoic chamber of CRL has been used to the fullest by researchers in many fields such as EMI, EMC, antenna design, standard of electric field intensity, and type approval testing. In particular, in the early days of space development in Japan, many satellite-born antennas were developed in this anechoic chamber. However, a quarter of a century has passed since its construction and deteriorated performance due to superannuation sometimes caused difficulties in experiments conducted in the chamber. In 1993, CRL constructed a Measuring Facility for Radio Research (MFRR) and the anechoic chamber for VHF-UHF bands was remodeled as one of the sub-facilities of MFRR. The remodeling work included full replacement of the electromagnetic shielding, absorbers and measurement system. Since the remodeled anechoic chamber is being used not only for EMI tests but also for other purposes, a full-anechoic chamber has been adopted. In addition the chamber has been designed for the frequency range between 30 MHz and 10 GHz. After the remodeling work, the performance of the chamber is greatly improved. The average shielding factor is better than 85 dB for all frequency ranges and the unwanted reflection characteristic is -30 dB for frequencies above 1 GHZ. This paper summarizes the remodeling work, and the specifications and performance of the remodeled anechoic chamber.

  9. A system for mapping sources of VHF and electric field pulses from in-cloud lightning at KSC

    Science.gov (United States)

    Thomson, Ewen M.; Medelius, Pedro J.

    1991-01-01

    The literature concerning VHF radiation and wideband electric fields from in-cloud lightning is reviewed. VHF location systems give impressive radio images of lightning in clouds with high spatial and temporal resolution. Using systems based on long and short baseline time-or-arrival and interferometry, workers have detected VHF sources that move at speeds of 10(exp 5) to 10(exp 8) m/s. The more slowly moving sources appear to be associated with channel formation but the physical basis for the higher speeds is not clear. In contrast, wideband electric fields are directly related to physical parameters such as current and tortuosity. A long baseline system is described to measure simultaneously VHF radiation and wideband electric fields at five stations at Kennedy Space Center. All signals are detected over remote, isolated ground planes with fiber optics for data transmission. The modification of this system to map rapidly varying dE/dt pulses is discussed.

  10. Miniaturization for ultrathin metamaterial perfect absorber in the VHF band

    Science.gov (United States)

    Khuyen, Bui Xuan; Tung, Bui Son; Yoo, Young Joon; Kim, Young Ju; Kim, Ki Won; Chen, Liang-Yao; Lam, Vu Dinh; Lee, Youngpak

    2017-03-01

    An efficient resolution for ultrathin metamaterial perfect absorber (MPA) is proposed and demonstrated in the VHF radio band (30-300 MHz). By adjusting the lumped capacitors and the through vertical interconnects, the absorber is miniaturized to be only λ/816 and λ/84 for its thickness and periodicity with respect to the operating wavelength (at 102 MHz), respectively. The detailed simulation and calculation show that the MPA can maintain an absorption rate over 90% in a certain range of incident angle and with a wide variation of capacitance. Additionally, we utilized the advantages of the initial single-band structure to realize a nearly perfect dual-band absorber in the same range. The results were confirmed by both simulation and experiment at oblique incidence angles up to 50°. Our work is expected to contribute to the actualization of future metamaterial-based devices working at radio frequency.

  11. Visible Jovian Aurora

    Science.gov (United States)

    1997-01-01

    Jupiter's aurora on the night side of the planet is seen here at five different wavelengths. Jupiter's bright crescent, which is about half illuminated, is out of view to the right. North is at the top. The images are centered at 57 degrees north and 184 degrees West and were taken on April 2, 1997 at a range of 1.7 million kilometers (1.05 million miles) by the Solid State Imaging (SSI) camera system aboard NASA's Galileo spacecraft.Although Jupiter's aurora had been imaged from Earth in the ultraviolet and infrared, these are the first images at visible wavelengths, where most of the emission takes place. CLR stands for clear (no filter) and shows the integrated brightness at all wavelengths. The other panels show the violet, green, red, and 889 nanometer-wavelength filtered images. The brightness of the aurora is roughly independent of wavelength, at least at the spectral resolution obtainable with these filters.As on Earth, the aurora is caused by electrically charged particles striking the upper atmosphere, causing the molecules of the atmosphere to glow. The brightness in the different filters contains information about the energy of the impinging particles and the composition of the upper atmosphere. If atomic hydrogen were the only emitter, the light would be much stronger in the red filter, which is not consistent with the observed distribution.The Jet Propulsion Laboratory, Pasadena, CA manages the mission for NASA's Office of Space Science, Washington, DC.This image and other images and data received from Galileo are posted on the World Wide Web, on the Galileo mission home page at: http://galileo.jpl.nasa.gov. Background information and educational context for the images can be found at: http:/ /www.jpl.nasa.gov/galileo/sepo.

  12. Night Side Jovian Aurora

    Science.gov (United States)

    1997-01-01

    Jovian aurora on the night side of the planet. The upper bright arc is auroral emission seen 'edge on' above the planetary limb with the darkness of space as a background. The lower bright arc is seen against the dark clouds of Jupiter. The aurora is easier to see on the night side of Jupiter because it is fainter than the clouds when they are illuminated by sunlight. Jupiter's north pole is out of view to the upper right. The images were taken in the clear filter (visible light) and are displayed in shades of blue.As on Earth, the auroral emission is caused by electrically charged particles striking the upper atmosphere from above. The particles travel along the magnetic field lines of the planet, but their origin is not fully understood. The field lines where the aurora is most intense cross the Jovian equator at large distances (many Jovian radii) from the planet. The faint background throughout the image is scattered light in the camera. This stray light comes from the sunlit portion of Jupiter, which is out of the image to the right. In multispectral observations the aurora appears red, consistent with glow from atomic hydrogen in Jupiter's atmosphere. Galileo's unique perspective allows it to view the night side of the planet at short range, revealing details that cannot be seen from Earth. These detailed features are time dependent, and can be followed in sequences of Galileo images.North is at the top of the picture. A grid of planetocentric latitude and west longitude is overlain on the images. The images were taken on November 5, 1997 at a range of 1.3 million kilometers by the Solid State Imaging (SSI) system on NASA's Galileo spacecraft.The Jet Propulsion Laboratory, Pasadena, CA manages the Galileo mission for NASA's Office of Space Science, Washington, DC. JPL is an operating division of California Institute of Technology (Caltech).This image and other images and data received from Galileo are posted on the World Wide Web, on the Galileo mission home

  13. Dicty_cDB: VHF476 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uences producing significant alignments: (bits) Value VHF476 (VHF476Q) /CSM/VH/VHF4-D/VHF476Q.Seq.d/ 198 2e-...46 own update 2003.10.17 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value...e 2008.10.29 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value (Q54AX5) R

  14. Aurorae in Australian Aboriginal Traditions

    Science.gov (United States)

    Hamacher, Duane W.

    2013-07-01

    Transient celestial phenomena feature prominently in the astronomical knowledge and traditions of Aboriginal Australians. In this paper, I collect accounts of the Aurora Australis from the literature regarding Aboriginal culture. Using previous studies of meteors, eclipses, and comets in Aboriginal traditions, I anticipate that the physical properties of aurora, such as their generally red colour as seen from southern Australia, will be associated with fire, death, blood, and evil spirits. The survey reveals this to be the case and also explores historical auroral events in Aboriginal cultures, aurorae in rock art, and briefly compares Aboriginal auroral traditions with other global indigenous groups, including the Maori of New Zealand.

  15. Aurorae in Australian Aboriginal Traditions

    CERN Document Server

    Hamacher, Duane W

    2013-01-01

    Transient celestial phenomena feature prominently in the astronomical knowledge and traditions of Aboriginal Australians. In this paper, I collect accounts of the Aurora Australis from the literature regarding Aboriginal culture. Using previous studies of meteors, eclipses, and comets in Aboriginal traditions, I anticipate that the physical properties of aurora, such as their generally red colour as seen from southern Australia, will be associated with fire, death, blood, and evil spirits. The survey reveals this to be the case and also explores historical auroral events in Aboriginal cultures, aurorae in rock art, and briefly compares Aboriginal auroral traditions with other global indigenous groups, including the Maori of New Zealand.

  16. Structure, optical properties and thermal stability of HfErO films deposited by simultaneous RF and VHF magnetron sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, H.Y. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Nanjing University of Posts and Telecommunications, School of Tongda, Nanjing (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); He, H.J.; Zhang, Z.; Jin, C.G.; Yang, Y.; Wang, Y.Y.; Ye, C. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Zhuge, L.J. [Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Soochow University, Analysis and Testing Center, Suzhou (China); Wu, X.M. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Chinese Academy of Sciences, State Key Laboratory of Functional Materials for Informatics, Shanghai Institute of Microsystem and Information Technology, Shanghai (China)

    2015-01-23

    HfErO films are deposited on Si substrates by simultaneous radio frequency (RF) and very high frequency (VHF) magnetron sputtering technique. The content of the doped ingredient of Er and the body composition of HfO{sub x} are, respectively, controlled through the VHF and RF powers. Low content of Er doping in the HfErO films can be achieved, because the VHF source of 27.12 MHz has higher ion energy and lower ion flux than the RF source resulting in low sputtering rate in the magnetron sputtering system. The structure, optical properties and thermal stability of the HfErO films are investigated in this work. Results show that the doped content of Er is independently controlled by the VHF power. The oxygen vacancies are created by the Er incorporation. The hafnium in the HfErO films forms mixed valence of Hf{sup 2+} and Hf{sup 4+}. The HfErO films are composed with the structures of HfO{sub 2}, HfO and ErO{sub x}, which can be optimized through the VHF power. At high VHF power, the Hf-Er-O bonds are formed, which demonstrates that the Er atoms are doped into the lattice of HfO{sub 2} in the HfErO films. The HfErO films have bad thermal stability as the crystallization temperature decreases from 900 to 800 C. After thermal annealing, cubic phase of HfO{sub 2} are stabilized, which is ascribed to the oxygen vacancies creation by the Er incorporation. The optical properties such as the refractive index and the optical band gap of the HfErO films are optimized by the VHF power. (orig.)

  17. Testing VHF/GPS collar design and safety in the study of free-roaming horses.

    Directory of Open Access Journals (Sweden)

    Gail H Collins

    Full Text Available Effective and safe monitoring techniques are needed by U.S. land managers to understand free-roaming horse behavior and habitat use and to aid in making informed management decisions. Global positioning system (GPS and very high frequency (VHF radio collars can be used to provide high spatial and temporal resolution information for detecting free-roaming horse movement. GPS and VHF collars are a common tool used in wildlife management, but have rarely been used for free-roaming horse research and monitoring in the United States. The purpose of this study was to evaluate the design, safety, and detachment device on GPS/VHF collars used to collect free-roaming horse location and movement data. Between 2009 and 2010, 28 domestic and feral horses were marked with commercial and custom designed VHF/GPS collars. Individual horses were evaluated for damage caused by the collar placement, and following initial observations, collar design was modified to reduce the potential for injury. After collar modifications, which included the addition of collar length adjustments to both sides of the collar allowing for better alignment of collar and neck shapes, adding foam padding to the custom collars to replicate the commercial collar foam padding, and repositioning the detachment device to reduce wear along the jowl, we observed little to no evidence of collar wear on horses. Neither custom-built nor commercial collars caused injury to study horses, however, most of the custom-built collars failed to collect data. During the evaluation of collar detachment devices, we had an 89% success rate of collar devices detaching correctly. This study showed that free-roaming horses can be safely marked with GPS and/or VHF collars with minimal risk of injury, and that these collars can be a useful tool for monitoring horses without creating a risk to horse health and wellness.

  18. 47 CFR 80.911 - VHF transmitter.

    Science.gov (United States)

    2010-10-01

    ... MARITIME SERVICES Compulsory Radiotelephone Installations for Small Passenger Boats § 80.911 VHF..., measured at the power input terminals to the transmitter, and the output power of the transmitter, terminated in a matching artificial load, must be measured at the end of 10 minutes of continuous operation...

  19. Disturbances in VHF/UHF telemetry links as a possible effect of the 2003 Hokkaido Tokachi-oki earthquake

    Directory of Open Access Journals (Sweden)

    H. Nagamoto

    2008-08-01

    Full Text Available The data on radio telemetry links (for water information at VHF/UHF in Hokkaido are used to investigate the rate of disturbances on radio links (or connection failure and its association with a huge earthquake, Tokachi-oki earthquake on 26 September 2003. Especially, the telemetry links at the Tokachi region closest to the earthquake epicenter, showed a significant increase in disturbances on radio links two weeks to a few days before the earthquake on the basis of analysis during a long interval from 1 June 2002 to 3 November 2007 (over 5 years. We suggest that these severe disturbances in VHF/UHF telemetry links are attributed to the generation of seismogenic VHF/UHF radio noises (emissions. Based on this idea, we have estimated that the intensity of these seismogenic emissions is on the order of 10–19 dB μV/m. Finally, the present result was compared with other physical parameters already obtained for this earthquake.

  20. Identification of clouds and aurorae in optical data images

    CERN Document Server

    Seviour, R; Honary, F

    2003-01-01

    In this paper we present an automatic image recognition technique used to identify clouds and aurorae in digital images, taken with a CCD all-sky imager. The image recognition algorithm uses image segmentation to generate a binary block object image. Object analysis is then performed on the binary block image, the results of which are used to assess whether clouds, aurorae and stars are present in the original image. The need for such an algorithm arises because the optical study of particle precipitation into the Earth's atmosphere by the Ionosphere and Radio Propagation Group at Lancaster generates vast data-sets, over 25 000 images/year, making manual classification of all the images impractical.

  1. Dicty_cDB: VHF729 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ences producing significant alignments: (bits) Value VHF729 (VHF729Q) /CSM/VH/VHF...4-A/CHC421Q.Seq.d/ 139 9e-33 own update 2002.12.27 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value... 139 2e-29 1 dna update 2008.10.31 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value

  2. From ultrafast spectroscopy to bidirectional molecular switches: DHA/VHF

    Science.gov (United States)

    Schmidhammer, U.; De Waele, V.; Buntinx, G.; Riedle, E.

    The photoconversion from dihydroazulene (DHA) to vinylheptafulvene (VHF) is governed by two mechanisms: The ring opening proceeds on the excited energy surface on the picosecond time scale. It is followed by an intemal conversion to the VHF ground state that is accelerated by the presence of a conical intersection in the case of cyclopenta-DHA. This conical intersection hinders the photoinduced back reaction from the final VHF products. However, we successfully photoconverted the cyanophenyl-VHF-cis back to the DHA with a second delayed pulse. This opens the route to the development of bistable DHAs.

  3. Forming and detection of digital watermarks in the System for Automatic Identification of VHF Transmissions

    Directory of Open Access Journals (Sweden)

    О. В. Шишкін

    2013-07-01

    Full Text Available Forming and detection algorithms for digital watermarks are designed for automatic identification of VHF radiotelephone transmissions in the maritime and aeronautical mobile services. An audible insensitivity and interference resistance of embedded digital data are provided by means of OFDM technology jointly with normalized distortions distribution and data packet detection by the hash-function. Experiments were carried out on the base of ship’s radio station RT-2048 Sailor and USB ADC-DAC module of type Е14-140M L-CARD in the off-line processing regime in Matlab medium

  4. The Kilometric Radio Emission Spectrum: Relationship to Auroral Acceleration Processes.

    Science.gov (United States)

    1981-01-31

    direct in situ maeasure- ments of aurora at any of these planets in the near future, any advances which can be made in understanding the relationship of...monochromatic emissions sweeping through a large range of frequencies is a common fea- ture of solar radio bursts [Kundu, 1965] and Jovian decametric radio...above the aurora , J. Geophys. Res., 75, 7140, 1970. Chiu, Y. T., and M. Schlulz, Self-consistent particle and parallel electrostatic field

  5. Dicty_cDB: VHF823 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uences producing significant alignments: (bits) Value VHF823 (VHF823Q) /CSM/VH/VH...186Q.Seq.d/ 86 1e-16 own update 2009. 4. 4 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value...-13 1 dna update 2008.10.31 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value

  6. Kajian implementasi radio siaran digital di Indonesia [Study of digital radio broadcasting implementation in Indonesia

    Directory of Open Access Journals (Sweden)

    Amry Daulat Gultom

    2015-12-01

    Full Text Available Peraturan Menteri Komunikasi dan Informatika RI nomor 21 tahun 2009 tentang  Standar Penyiaran Digital Untuk Penyiaran Radio pada Pita VHF di Indonesia menyatakan bahwa dalam rangka mengatasi permasalahan penggunaan frekuensi VHF Band II untuk penyiaran radio FM yang tidak sesuai dengan rencana induk, serta tidak terpenuhinya permohonan untuk penggunaan kanal frekuensi dari masyarakat, maka perlu dicarikan saluran siaran alternatif dengan menggunakan sistem penyiaran radio digital standard DAB Family. Hingga saat ini belum ada perkembangan berarti terkait implementasinya, sehingga perlu dilakukan penelitian untuk mengetahui potensi radio siaran digital, kesiapan dari sisi pemerintah, operator, dan masyarakat, dan kendala yang dihadapi serta merumuskan strategi yang akan digunakan mengatasinya. Metode analisis yang digunakan adalah SWOT dan TOWS kualitatif dari data wawancara dan studi literatur. Hasil penelitian menunjukkan bahwa pihak stasiun radio sudah siap terhadap digitalisasi radio siaran, pihak pemerintah belum begitu siap karena belum adanya regulasi pendukung Permen Kominfo tentang standard radio digital, dan masyarakat juga belum siap karena kurangnya sosialisasi dan masih susah didapatkannya perangkat penerima siaran radio digital. Pengintegrasian penerima siaran radio digital pada kendaraan bermotor roda empat dan telepon genggam yang baru dapat meningkatkan keberadaan perangkat penerima siaran radio digital.*****The Minister of Communication and Information Regulation number 21 of 2009 on Digital Broadcasting Standards for VHF Band Radio Broadcasting in Indonesia stated that in order to overcome the problems of VHF Band II frequency utilization for FM radio broadcasting that is not in accordance with the master plan, as well as non-fulfillment of the request for frequency channels utilization of the society, neeed to find alternative broadcast channel by DAB Family digital radio broadcasting system. Until now there has no

  7. Periodisme i literatura: Aurora Bertrana

    Directory of Open Access Journals (Sweden)

    Neus Real

    2014-06-01

    Full Text Available This article relates the activity in the press of the writer Aurora Bertrana with her literature, and it makes evident the interdependence of journalism and literary creation in the first stage of the author’s production. It also analyzes the key role of this interaction in the construction of her image as well as in the consolidation of her intellectual prestige.

  8. Morphologies of omega band auroras

    Science.gov (United States)

    Sato, Natsuo; Yukimatu, Akira Sessai; Tanaka, Yoshimasa; Hori, Tomoaki

    2017-08-01

    We examined the morphological signatures of 315 omega band aurora events observed using the Time History of Events and Macroscale Interactions during Substorm ground-based all-sky imager network over a period of 8 years. We find that omega bands can be classified into the following three subtypes: (1) classical (O-type) omega bands, (2) torch or tongue (T-type) omega bands, and (3) combinations of classical and torch or tongue (O/T-type) omega bands. The statistical results show that T-type bands occur the most frequently (45%), followed by O/T-type bands (35%) and O-type bands (18%). We also examined the morphologies of the omega bands during their formation, from the growth period to the declining period through the maximum period. Interestingly, the omega bands are not stable, but rather exhibit dynamic changes in shape, intensity, and motion. They grow from small-scale bumps (seeds) at the poleward boundary of preexisting east-west-aligned auroras, rather than via the rotation or shear motion of preexisting east-west-aligned auroras, and do not exhibit any shear motion during the periods of auroral activity growth. Furthermore, the auroral luminosity is observed to increase during the declining period, and the total time from the start of the growth period to the end of the declining period is found to be about 20 min. Such dynamical signatures may be important in determining the mechanism responsible for omega band formation.

  9. Hydrogeology baseline study Aurora Mine

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-31

    A baseline hydrogeologic study was conducted in the area of Syncrude`s proposed Aurora Mine in order to develop a conceptual regional hydrogeologic model for the area that could be used to understand groundwater flow conditions. Geologic information was obtained from over 2,000 coreholes and from data obtained between 1980 and 1996 regarding water level for the basal aquifer. A 3-D numerical groundwater flow model was developed to provide quantitative estimates of the potential environmental impacts of the proposed mining operations on the groundwater flow system. The information was presented in the context of a regional study area which encompassed much of the Athabasca Oil Sands Region, and a local study area which was defined by the lowlands of the Muskeg River Basin. Characteristics of the topography, hydrology, climate, geology, and hydrogeology of the region are described. The conclusion is that groundwater flow in the aquifer occurs mostly in a westerly direction beneath the Aurora Mine towards its inferred discharge location along the Athabasca River. Baseflow in the Muskeg River is mostly related to discharge from shallow surficial aquifers. Water in the river under baseflow conditions was fresh, of calcium-carbonate type, with very little indication of mineralization associated with deeper groundwater in the Aurora Mine area. 44 refs., 5 tabs., 31 figs.

  10. Significance of Aurora B overexpression in hepatocellular carcinoma. Aurora B Overexpression in HCC

    Directory of Open Access Journals (Sweden)

    Lin Zhong-Zhe

    2010-08-01

    Full Text Available Abstract Background To investigate the significance of Aurora B expression in hepatocellular carcinoma (HCC. Methods The Aurora B and Aurora A mRNA level was measured in 160 HCCs and the paired nontumorous liver tissues by reverse transcription-polymerase chain reaction. Mutations of the p53 and β-catenin genes were analyzed in 134 and 150 tumors, respectively, by direct sequencing of exon 2 to exon 11 of p53 and exon 3 of β-catenin. Anticancer effects of AZD1152-HQPA, an Aurora B kinase selective inhibitor, were examined in Huh-7 and Hep3B cell lines. Results Aurora B was overexpressed in 98 (61% of 160 HCCs and in all 7 HCC cell lines examined. The overexpression of Aurora B was associated with Aurora A overexpression (P = 0.0003 and p53 mutation (P = 0.002 and was inversely associated with β-catenin mutation (P = 0.002. Aurora B overexpression correlated with worse clinicopathologic characteristics. Multivariate analysis confirmed that Aurora B overexpression was an independent poor prognostic factor, despite its interaction with Aurora A overexpression and mutations of p53 and β-catenin. In Huh-7 and Hep3B cells, AZD1152-HQPA induced proliferation blockade, histone H3 (Ser10 dephosphorylation, cell cycle disturbance, and apoptosis. Conclusion Aurora B overexpression is an independent molecular marker predicting tumor invasiveness and poor prognosis of HCC. Aurora B kinase selective inhibitors are potential therapeutic agents for HCC treatment.

  11. Analysis of the VHF-UHF electromagnetic radiation of lightning: Application to a model of the negative stepped leader propagation

    Science.gov (United States)

    Taudiere, Isabelle

    1991-03-01

    The space and time characteristics of the VHF-UHF radiation from lightning are analyzed on the bases of 300 MHz emission sources, localized in three dimensions by interferometric measurements. The main phases that contribute to the development of intracloud lightning are examined in detail, also using electric field measurements at the lower frequency. This research is complemented by an experimental and theoretical analysis of long discharge (8m) radio emissions generated with both polarities in the laboratory. These investigations revealed that the VHF radiation is associated with the channel reillumination phase accompanying each step in the negative spark. The outcome of this work is the creation of a simple model for the propagation of the negative leader. The current and the radiated field during this phase of the discharge are computed from an equivalent electric circuit using the physical laws governing the variation of resistance. The extrapolation of these results to the case of the stepped leader of natural lightning is discussed.

  12. Communications Tests with Tactical Radios in a Large Urban Area.

    Science.gov (United States)

    1981-07-01

    side if necesary and identify by block number) Military Operations in Built-Up Areas ( MOBA ) CH16S Communications Tactical Radios VHF 20. ADST14ACT...complete netting of tactical radios under MOBA conditions. These tests are planned for the spring of 1981. 4 COMMUNICATIONS TESTS WITH TkCTICAL RADIOS IN A...Areas ( MOBA ) was initi- ated by the US Army Human Engineering Laboratory (USAHEL) as part of their MOBA Lead Laboratory responsibility after a search of

  13. Hydrogeology of the Aurora Mine

    Energy Technology Data Exchange (ETDEWEB)

    Donald, S.; Davidson, T. [Golder Associates, Edmonton, AB (Canada); Kampala, G. [Syncrude Canada Ltd., Edmonton, AB (Canada)

    1997-12-31

    A groundwater model was constructed using information from approximately 1000 exploration drillholes to study the hydrogeological impacts from the proposed development of the Aurora Mine. Particular attention was paid to ground water withdrawal rates from the basal aquifer during various stages of the development, potential leakage from the Athabasca River to the depressurization wells, and the increase in deep percolation rates from surface water catchment within the area of influence of the depressurization wells. Results indicate depressurization rates of up to 27,000 cubic metres per day from the basal aquifer during mine development, and negligible to low impact on vertical leakage beneath the McClelland Lake Subwatershed.

  14. Generation of proton aurora by magnetosonic waves.

    Science.gov (United States)

    Xiao, Fuliang; Zong, Qiugang; Wang, Yongfu; He, Zhaoguo; Su, Zhenpeng; Yang, Chang; Zhou, Qinghua

    2014-06-05

    Earth's proton aurora occurs over a broad MLT region and is produced by the precipitation of low-energy (2-10 keV) plasmasheet protons. Proton precipitation can alter chemical compositions of the atmosphere, linking solar activity with global climate variability. Previous studies proposed that electromagnetic ion cyclotron waves can resonate with protons, producing proton scattering precipitation. A long-outstanding question still remains whether there is another mechanism responsible for the proton aurora. Here, by performing satellite data analysis and diffusion equation calculations, we show that fast magnetosonic waves can produce trapped proton scattering that yields proton aurora. This provides a new insight into the mechanism of proton aurora. Furthermore, a ray-tracing study demonstrates that magnetosonic wave propagates over a broad MLT region, consistent with the global distribution of proton aurora.

  15. Mesospheric ozone destruction by high-energy electron precipitation associated with pulsating aurora

    Science.gov (United States)

    Turunen, Esa; Kero, Antti; Verronen, Pekka T.; Miyoshi, Yoshizumi; Oyama, Shin-Ichiro; Saito, Shinji

    2016-10-01

    Energetic particle precipitation into the upper atmosphere creates excess amounts of odd nitrogen and odd hydrogen. These destroy mesospheric and upper stratospheric ozone in catalytic reaction chains, either in situ at the altitude of the energy deposition or indirectly due to transport to other altitudes and latitudes. Recent statistical analysis of satellite data on mesospheric ozone reveals that the variations during energetic electron precipitation from Earth's radiation belts can be tens of percent. Here we report model calculations of ozone destruction due to a single event of pulsating aurora early in the morning on 17 November 2012. The presence of high-energy component in the precipitating electron flux (>200 keV) was detected as ionization down to 68 km altitude, by the VHF incoherent scatter radar of European Incoherent Scatter (EISCAT) Scientific Association (EISCAT VHF) in Tromsø, Norway. Observations by the Van Allen Probes satellite B showed the occurrence of rising tone lower band chorus waves, which cause the precipitation. We model the effect of high-energy electron precipitation on ozone concentration using a detailed coupled ion and neutral chemistry model. Due to a 30 min, recorded electron precipitation event we find 14% odd oxygen depletion at 75 km altitude. The uncertainty of the higher-energy electron fluxes leads to different possible energy deposition estimates during the pulsating aurora event. We find depletion of odd oxygen by several tens of percent, depending on the precipitation characteristics used in modeling. The effect is notably maximized at the sunset time following the occurrence of the precipitation.

  16. Dicty_cDB: VHF145 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF145 (Link to dictyBase) - - - Contig-U15430-1 VHF145E (Link...) Clone ID VHF145 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15430-1 Ori...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116984 |AC116984.2 Dictyos... theta DNA for complete sequence of nucleomorph chromosome 2. 48 2e-07 2 ES451909 | PREDICTED: similar to PI...al 16.0 %: nuclear 8.0 %: vacuolar 8.0 %: endoplasmic reticulum 4.0 %: cytoskeletal >> prediction for VHF145

  17. Broadband Grounded Vertical Antennas for 30-180 MHZ (VHF)

    Science.gov (United States)

    2013-10-18

    antennas are well known for their broadband gain (monocone, bicone ) but are never combined with a monopole. An eccentric combination of broadband...DATES COVERED 00-00-2014 to 00-00-2014 4. TITLE AND SUBTITLE Broadband Grounded Vertical Antennas For 30-180 MZH (VHF) 5a. CONTRACT NUMBER 5b...18 Attorney Docket No. 102536 1 of 17 BROADBAND GROUNDED VERTICAL ANTENNAS FOR 30-180 MHZ (VHF) STATEMENT OF GOVERNMENT INTEREST

  18. Control of centrin stability by Aurora A.

    Directory of Open Access Journals (Sweden)

    Kara B Lukasiewicz

    Full Text Available Aurora A is an oncogenic serine/threonine kinase which can cause cell transformation and centrosome amplification when over-expressed. Human breast tumors show excess Aurora A and phospho-centrin in amplified centrosomes. Here, we show that Aurora A mediates the phosphorylation of and localizes with centrin at the centrosome, with both proteins reaching maximum abundance from prophase through metaphase, followed by their precipitous loss in late stages of mitosis. Over-expression of Aurora A results in excess phospho-centrin and centrosome amplification. In contrast, centrosome amplification is not seen in cells over-expressing Aurora A in the presence of a recombinant centrin mutant lacking the serine phosphorylation site at residue 170. Expression of a kinase dead Aurora A results in a decrease in mitotic index and abrogation of centrin phosphorylation. Finally, a recombinant centrin mutation that mimics centrin phosphorylation increases centrin's stability against APC/C-mediated proteasomal degradation. Taken together, these results suggest that the stability of centrin is regulated in part by Aurora A, and that excess phosphorylated centrin may promote centrosome amplification in cancer.

  19. Late mitotic functions of Aurora kinases.

    Science.gov (United States)

    Afonso, Olga; Figueiredo, Ana C; Maiato, Helder

    2017-02-01

    The coordination between late mitotic events such as poleward chromosome motion, spindle elongation, DNA decondensation, and nuclear envelope reformation (NER) is crucial for the completion of chromosome segregation at the anaphase-telophase transition. Mitotic exit is driven by a decrease of Cdk1 kinase activity and an increase of PP1/PP2A phosphatase activities. More recently, Aurora kinases have also emerged as master regulators of late mitotic events and cytokinesis. Aurora A is mainly associated with spindle poles throughout mitosis and midbody during telophase, whereas Aurora B re-localizes from centromeres in early mitosis to the spindle midzone and midbody as cells progress from anaphase to the completion of cytokinesis. Functional studies, together with the identification of a phosphorylation gradient during anaphase, established Aurora B as a major player in the organization of the spindle midzone and in the spatiotemporal coordination between chromosome segregation and NER. Aurora A has been less explored, but a cooperative role in spindle midzone stability has also been proposed, implying that both Aurora A and B contribute to accurate chromosome segregation during mitotic exit. Here, we review the roles of the Aurora kinases in the regulation of late mitotic events and discuss how they work together with other mitotic players to ensure an error-free mitosis.

  20. Occurrence and average behavior of pulsating aurora

    Science.gov (United States)

    Partamies, N.; Whiter, D.; Kadokura, A.; Kauristie, K.; Nesse Tyssøy, H.; Massetti, S.; Stauning, P.; Raita, T.

    2017-05-01

    Motivated by recent event studies and modeling efforts on pulsating aurora, which conclude that the precipitation energy during these events is high enough to cause significant chemical changes in the mesosphere, this study looks for the bulk behavior of auroral pulsations. Based on about 400 pulsating aurora events, we outline the typical duration, geomagnetic conditions, and change in the peak emission height for the events. We show that the auroral peak emission height for both green and blue emission decreases by about 8 km at the start of the pulsating aurora interval. This brings the hardest 10% of the electrons down to about 90 km altitude. The median duration of pulsating aurora is about 1.4 h. This value is a conservative estimate since in many cases the end of event is limited by the end of auroral imaging for the night or the aurora drifting out of the camera field of view. The longest durations of auroral pulsations are observed during events which start within the substorm recovery phases. As a result, the geomagnetic indices are not able to describe pulsating aurora. Simultaneous Antarctic auroral images were found for 10 pulsating aurora events. In eight cases auroral pulsations were seen in the southern hemispheric data as well, suggesting an equatorial precipitation source and a frequent interhemispheric occurrence. The long lifetimes of pulsating aurora, their interhemispheric occurrence, and the relatively high-precipitation energies make this type of aurora an effective energy deposition process which is easy to identify from the ground-based image data.

  1. Long term observations of Saturn's northern auroras

    Science.gov (United States)

    Nichols, Jonathan

    2011-10-01

    Auroral emissions are a vital tool in diagnosing the dynamics of planetary magnetospheres. While SaturnA?s southern UV auroras have been observed with high-sensitivity cameras onboard the Hubble Space Telescope {HST}, the northern auroras have only been observed at very oblique angles. Our understanding of SaturnA?s auroral emissions is thus only half complete. However, Saturn has now passed equinox and is moving toward summer in the northern hemisphere, such that the northern auroras are now visible from Earth, and recent results from HST have indicated that SaturnA?s northern auroras are not simply mirror images of the southern. The changing seasons are also expected to result in significant changes in magnetospheric phenomena related to the auroras. Observing these changes is a specific goal of the Cassini Solstice Mission {CSM} and, since joint HST-Cassini observations have repeatedly proved to be invaluable, CSM operations are currently being planned specifically with joint HST observations in mind. The observations proposed here will thus execute over Cycles 18-20, and will address the following science questions:What is the morphology of SaturnA?s northern auroras? Do SaturnA?s auroras change with the planetA?s season? How are the auroral emissions of different wavelengths related?The importance of long term HST observations of SaturnA?s northern auroras are highlighted by the fact that recent key discoveries would have been missed without the multiyear archive of observations of the planetA?s southern auroras. The opportunity to obtain HST images while Cassini makes specifically-tailored supporting observations is an extremely valuable opportunity, and HST is the only instrument capable of providing sustained, high time resolution observations of Saturns auroral emission.

  2. Measurements and simulation of ionospheric scattering on VHF and UHF radar signals: Channel scattering function

    Science.gov (United States)

    Rogers, Neil C.; Cannon, Paul S.; Groves, Keith M.

    2009-02-01

    The design and operation of transionospheric VHF and UHF radars requires knowledge of amplitude and phase scintillation due to ionospheric scattering. Phase coherence is of particular importance where long coherent integration periods and large bandwidths are required. A thin phase screen, parabolic equation based, Trans-Ionospheric Radio Propagation Simulator (TIRPS) is described. Modeled channel scattering functions (CSFs) are compared to experimental VHF and UHF data derived from the Advanced Research Projects Agency Long-range Tracking and Instrumentation Radar on Kwajalein Island (9.4°N, 166.8°E). TIRPS quantitatively reproduces the experimental results, including the quasi-parabolic profile observed in the measured CSFs under strong turbulence conditions. Variations in the simulated CSF with ionospheric phase screen parameters are also presented. Under conditions of high integrated strength of turbulence (CkL), a low phase spectral index (p = 1), indicating relatively dense small-scale irregularities, produces pronounced range spreading. Conversely, when the spectral index is high (p = 4), indicative of strong focusing/defocusing by large-scale irregularities, there is increased Doppler spreading and, when the outer scale of irregularities is large, a greater likelihood of asymmetry of the CSF about the zero Doppler axis.

  3. VHF/UHF radar observations of tropical mesoscale convective systems over southern India

    Directory of Open Access Journals (Sweden)

    K. Kishore Kumar

    2005-07-01

    Full Text Available Several campaigns have been carried out to study the convective systems over Gadanki (13.5° N, 79.2° E, a tropical station in India, using VHF and UHF radars. The height-time sections of several convective systems are investigated in detail to study reflectivity, turbulence and vertical velocity structure. Structure and dynamics of the convective systems are the main objectives of these campaigns. The observed systems are classified into single- and multi-cell systems. It has been observed that most of the convective systems at this latitude are multi-cellular in nature. Simultaneous VHF and UHF radar observations are used to classify the observed precipitating systems as convective, intermediary and stratiform regions. Composite height profiles of vertical velocities in these regions were obtained and the same were compared with the profiles obtained at other geographical locations. These composite profiles of vertical velocity in the convective regions have shown their peaks in the mid troposphere, indicating that the maximum latent heat is being released at those heights. These profiles are very important for numerical simulations of the convective systems, which vary significantly from one geographical location to the other. Keywords. Meteorology and atmospheric dynamics (Mesoscale meteorology; Convective processes – Radio science (Remote sensing

  4. The impact of an ICME on the Jovian X-ray aurora

    OpenAIRE

    Dunn, William R.; Branduardi-Raymont, Graziella; Elsner, Ronald F.; Vogt, Marissa F.; Lamy, Laurent; Ford, Peter G.; Coates, Andrew J.; Gladstone, G. Randall; Jackman, Caitriona M.; Nichols, Jonathan D.; Rae, I. Jonathan; Varsani, Ali; Kimura, Tomoki; Hansen, Kenneth C.; Jasinski, Jamie M.

    2016-01-01

    International audience; We report the first Jupiter X-ray observations planned to coincide with an interplanetary coronal mass ejection (ICME). At the predicted ICME arrival time, we observed a factor of ∼8 enhancement in Jupiter's X-ray aurora. Within 1.5 h of this enhancement, intense bursts of non-Io decametric radio emission occurred. Spatial, spectral, and temporal characteristics also varied between ICME arrival and another X-ray observation two days later. Gladstone et al. (2002) disco...

  5. Aurora Bertrana: bringing "otherness" home

    Directory of Open Access Journals (Sweden)

    M. Pilar Godayol i Nogué

    2008-01-01

    Full Text Available “Decidida a viure al preu que sigui” underscores contemporary writer Maria-Antònia Oliver in her prologue to Aurora Bertrana’s fourth book, El Marroc sensual i fanàtic (1936. The urge to travel, to explore the world and to slake her thirst for new experiences shaped much of the personality and the work of this Girona-born writer. Taking her own travels as a starting point, Bertrana distinguished herself in the genre of travel writing on exotic countries, which at that time underwent a significant revival in Catalonia. Bertrana’s originality lies partly in the image of the woman traveller that she consciously cultivated for herself, and partly in the way she narrates her travels. This article seeks to recover this author and make visible her singular way of presenting otherness.

  6. Meteor head echo altitude distributions and the height cutoff effect studied with the EISCAT HPLA UHF and VHF radars

    Directory of Open Access Journals (Sweden)

    A. Westman

    2004-04-01

    Full Text Available Meteor head echo altitude distributions have been derived from data collected with the EISCAT VHF (224MHz and UHF (930MHz high-power, large-aperture (HPLA radars. At the high-altitude end, the distributions cut off abruptly in a manner reminiscent of the trail echo height ceiling effect observed with classical meteor radars. The target dimensions are shown to be much smaller than both the VHF and the UHF probing wavelengths, but the cutoff heights for the two systems are still clearly different, the VHF cutoff being located several km above the UHF one. A single-collision meteor-atmosphere interaction model is used to demonstrate that meteors in the (1.3–7.2µg mass range will ionise such that critical electron density at 224MHz is first reached at or around the VHF cutoff altitude and critical density at 930MHz will be reached at the UHF cutoff altitude. The observed seasonal variation in the cutoff altitudes is shown to be a function of the seasonal variation of atmospheric density with altitude. Assuming that the electron density required for detection is in the order of the critical density, the abrupt altitude cutoffs can be explained as a consequence of the micrometeoroid joint size-speed distribution dropping off so fast at the large-mass, high-velocity end that above a certain altitude the number of detectable events becomes vanishingly small. Conversely, meteors at the low-mass end of the distribution will be gradually retarded such that the ionisation they generate never reaches critical density. These particles will remain unobservable.Key words. Radio science (instruments and techniques – Interplatery physics (interplanetary dust – General or miscellaneous (new fields

  7. Determining the mechanism of cusp proton aurora.

    Science.gov (United States)

    Xiao, Fuliang; Zong, Qiugang; Su, Zhenpeng; Yang, Chang; He, Zhaoguo; Wang, Yongfu; Gao, Zhonglei

    2013-01-01

    Earth's cusp proton aurora occurs near the prenoon and is primarily produced by the precipitation of solar energetic (2-10 keV) protons. Cusp auroral precipitation provides a direct source of energy for the high-latitude dayside upper atmosphere, contributing to chemical composition change and global climate variability. Previous studies have indicated that magnetic reconnection allows solar energetic protons to cross the magnetopause and enter the cusp region, producing cusp auroral precipitation. However, energetic protons are easily trapped in the cusp region due to a minimum magnetic field existing there. Hence, the mechanism of cusp proton aurora has remained a significant challenge for tens of years. Based on the satellite data and calculations of diffusion equation, we demonstrate that EMIC waves can yield the trapped proton scattering that causes cusp proton aurora. This moves forward a step toward identifying the generation mechanism of cusp proton aurora.

  8. Ultimate VHF Broadband Interferometer Zen KAWASAKI and Manabu AKITA

    Science.gov (United States)

    Kawasaki, Z.; Akita, M.

    2013-12-01

    Lightning Research Group of Osaka University (LRGOU) has been developing an interferometer for thunderstorm monitoring during these two decades. When LRGOU initiated this project, many related scientists claimed that LRGOU's system was a time of arrival and it must be a sophisticated TOA system. However the key technology of the system were broad band and digital data processing, and it is named the VHF broad band digital interferometer (BDITF), because the phase difference of Fourier components played the very important role. Then the BDITF finally has been realized as a quasi-real time lightning monitoring system, and LRGOU has been operating their BDITFs around Osaka area. Since the BDITF captures the VHF impulses associated with lightning discharges by amplitude triggering, it occasionally misses one of the bi-directional leader progressions because of relatively small amplitude VHF impulses mainly emitted by positive leader tips. All of high density of VHF pulses associated with recoil leaders may not be recorded. Then the ordinary BDITF is able to be accepted as the practical operational system, but from the aspect of science it has been sioriously expected to be improved its performance. To overcome the difficulty New Mexico Institute of Mining and Technology (NMIMT) and LRGOU have started the joint project, and a continuous recording system for digital signals is adopted [M. Stock et al, and M Akita et al,]. The field campaigns have been conducting in New Mexico and in Japan, and successful observations are accomplished. The algorithm to identify individual VHF pulses associated with lightning discharges from back ground noise and/or artificial noise, the dispersion of phase differences for all Fourier components is examined. In case by of small dispersion it is concluded that analyzed VHF pulse has high possibility to be emitted by lightning discharges. This interpretation means that the recorded VHF pulse shape might maintain without deformation during

  9. Final environmental assessment for vegetation control at VHF stations, microwave stations, electrical substations, and pole yards

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-10-13

    Southwestern Power Adm. operates very high frequency (VHF) and microwave radio stations, electrical substations, and pole yards for electric power transmission throughout AR, MO, and OK. Vegetation growth at the stations must be suppressed for safety of operation and personnel. Southwestern has been using a combination of mechanical/manual and herbicide control for this purpose; Federally- mandated reductions in staff and budgetary resources require Southwestern to evaluate all potentially efficient methods for vegetation control. Three alternatives were examined: no action, mechanical/manual control, and (proposed) a combination of mechanical/manual and herbicide control. Environmental impacts on air and water quality, wetlands, wildlife, endangered species, archaeological and other resources, farmland, human health, transportation, etc. were evaluated.

  10. Hubble Images Reveal Jupiter's Auroras

    Science.gov (United States)

    1996-01-01

    These images, taken by the Hubble Space Telescope, reveal changes in Jupiter's auroral emissions and how small auroral spots just outside the emission rings are linked to the planet's volcanic moon, Io. The images represent the most sensitive and sharply-detailed views ever taken of Jovian auroras.The top panel pinpoints the effects of emissions from Io, which is about the size of Earth's moon. The black-and-white image on the left, taken in visible light, shows how Io and Jupiter are linked by an invisible electrical current of charged particles called a 'flux tube.' The particles - ejected from Io (the bright spot on Jupiter's right) by volcanic eruptions - flow along Jupiter's magnetic field lines, which thread through Io, to the planet's north and south magnetic poles. This image also shows the belts of clouds surrounding Jupiter as well as the Great Red Spot.The black-and-white image on the right, taken in ultraviolet light about 15 minutes later, shows Jupiter's auroral emissions at the north and south poles. Just outside these emissions are the auroral spots. Called 'footprints,' the spots are created when the particles in Io's 'flux tube' reach Jupiter's upper atmosphere and interact with hydrogen gas, making it fluoresce. In this image, Io is not observable because it is faint in the ultraviolet.The two ultraviolet images at the bottom of the picture show how the auroral emissions change in brightness and structure as Jupiter rotates. These false-color images also reveal how the magnetic field is offset from Jupiter's spin axis by 10 to 15 degrees. In the right image, the north auroral emission is rising over the left limb; the south auroral oval is beginning to set. The image on the left, obtained on a different date, shows a full view of the north aurora, with a strong emission inside the main auroral oval.The images were taken by the telescope's Wide Field and Planetary Camera 2 between May 1994 and September 1995.This image and other images and data

  11. Effects of implanted radio transmitters with percutaneous antennas on the behavior of Canada Geese

    Science.gov (United States)

    Hupp, Jerry W.; Ruhl, G.A.; Pearce, John M.; Mulcahy, Daniel M.; Tomeo, M.A.

    2003-01-01

    We examined whether surgically-implanted radio transmitters with percutaneous antennas affected behavior of Lesser Canada Geese (Branta canadensis parvipes) in Anchorage, Alaska. We implanted either a 26-g VHF radio transmitter or a larger VHF radio that was the same mass (35 g) and shape as a satellite transmitter in the coelom of adult females captured during molt in 2000. A control group of females was marked with leg bands. We simultaneously observed behavior of radio-marked and control females from 4-62 d following capture. We observed no differences in the proportion of time birds in different treatments allocated among grazing, resting, comfort, walking, and alert behavior. Females in different treatments spent a similar proportion of time in the water. Implantation of radio transmitters did not affect the frequency of agonistic interactions. We conclude that coelomic radio transmitters with percutaneous antennas had minimal effects on the behavior of Canada Geese.

  12. Evaluation of the Aurora Application Shade Measurement Accuracy

    Energy Technology Data Exchange (ETDEWEB)

    2015-12-01

    Aurora is an integrated, Web-based application that helps solar installers perform sales, engineering design, and financial analysis. One of Aurora's key features is its high-resolution remote shading analysis.

  13. From VHF to UHF CMOS-MEMS Monolithically Integrated Resonators

    DEFF Research Database (Denmark)

    Teva, Jordi; Berini, Abadal Gabriel; Uranga, A.

    2008-01-01

    This paper presents the design, fabrication and characterization of microresonators exhibiting resonance frequencies in the VHF and UHF bands, fabricated using the available layers of the standard and commercial CMOS technology, AMS-0.35mum. The resonators are released in a post-CMOS process cons...

  14. 2-Aminobenzimidazoles as potent Aurora kinase inhibitors.

    Science.gov (United States)

    Zhong, Min; Bui, Minna; Shen, Wang; Baskaran, Subramanian; Allen, Darin A; Elling, Robert A; Flanagan, W Michael; Fung, Amy D; Hanan, Emily J; Harris, Shannon O; Heumann, Stacey A; Hoch, Ute; Ivy, Sheryl N; Jacobs, Jeffrey W; Lam, Stuart; Lee, Heman; McDowell, Robert S; Oslob, Johan D; Purkey, Hans E; Romanowski, Michael J; Silverman, Jeffrey A; Tangonan, Bradley T; Taverna, Pietro; Yang, Wenjin; Yoburn, Josh C; Yu, Chul H; Zimmerman, Kristin M; O'Brien, Tom; Lew, Willard

    2009-09-01

    This Letter describes the discovery and key structure-activity relationship (SAR) of a series of 2-aminobenzimidazoles as potent Aurora kinase inhibitors. 2-Aminobenzimidazole serves as a bioisostere of the biaryl urea residue of SNS-314 (1c), which is a potent Aurora kinase inhibitor and entered clinical testing in patients with solid tumors. Compared to SNS-314, this series of compounds offers better aqueous solubility while retaining comparable in vitro potency in biochemical and cell-based assays; in particular, 6m has also demonstrated a comparable mouse iv PK profile to SNS-314.

  15. Relationship between propagation direction of gravity waves in OH and OI airglow images and VHF radar echo occurrence during the SEEK-2 campaign

    Directory of Open Access Journals (Sweden)

    F. Onoma

    2005-10-01

    Full Text Available We report simultaneous observations of atmospheric gravity waves (AGW in OI (557.7nm and OH airglow images and VHF radar backscatter from field-aligned irregularities (FAI in the E-region during the SEEK-2 (Sporadic-E Experiment over Kyushu 2 campaign period from 29 July to 9 August 2002. An all-sky imager was operated at Nishino-Omote (30.5 N, 130.1 E, Japan. On 14 nights, 17 AGW events were detected in OI and OH airglow images. AGW propagated mostly toward the northeast or southeast. From comparison with the E-region FAI occurrence, which is detected by a nearby VHF radar (31.57MHz, we found that AGW tended to propagate southeastward during FAI events. This result suggests that the interaction between AGW and E-region plasma plays an important role in generating FAI. Furthermore, polarization electric fields generated directly by AGW may contribute to the FAI generation.

    Keywords. Atmospheric composition and structure (Airglow and aurora, Ionosphere (Ionospheric irregularities, Mid-latitude ionosphere

  16. Simultaneous observation of sporadic E with a rapid-run ionosonde and VHF coherent backscatter radar

    Directory of Open Access Journals (Sweden)

    T. Maruyama

    2006-03-01

    Full Text Available During the SEEK 2 rocket campaign, ionograms were recorded every minute at the Yamagawa Radio Observatory at about 90km west of the region monitored by a VHF (very high frequency coherent backscatter radar. Sporadic E-layer parameters, which include the critical (foEs and blanketing (fbEs frequencies, the layer height (h'Es, and the width of the range spread of sporadic E-traces, were compared with RTI (range-time-intensity plots of VHF quasi-periodic (QP and continuous coherent backscatter echoes. A close relationship was found between the appearance of QP echoes in the RTI plots and the level of spatial inhomogeneity in sporadic E plasma, signified here by the difference between foEs and fbEs. During QP echo events, foEs increased while fbEs decreased, so that the difference foEs-fbEs was enhanced, indicating the development of strong spatial structuring in electron density within a sporadic E-layer. On the other hand, increases in sporadic E range spreading also correlated with the occurrence of QP echoes but the degree of correlation varied from event to event. Continuous radar echoes were observed in association with low altitude sporadic E-layers, located well below 100 km and at times as low as 90 km. During the continuous echo events, both foEs and fbEs were less variable, and the difference foEs-fbEs was small and not as dynamic as in the QP echoes. On the other hand, the Es-layer spread intensified during continuous echoes, which means that some patchiness or corrugation in those low altitude layers is also necessary for the continuous backscatter echoes to take place.

  17. Simultaneous observation of sporadic E with a rapid-run ionosonde and VHF coherent backscatter radar

    Directory of Open Access Journals (Sweden)

    T. Maruyama

    2006-03-01

    Full Text Available During the SEEK 2 rocket campaign, ionograms were recorded every minute at the Yamagawa Radio Observatory at about 90km west of the region monitored by a VHF (very high frequency coherent backscatter radar. Sporadic E-layer parameters, which include the critical (foEs and blanketing (fbEs frequencies, the layer height (h'Es, and the width of the range spread of sporadic E-traces, were compared with RTI (range-time-intensity plots of VHF quasi-periodic (QP and continuous coherent backscatter echoes. A close relationship was found between the appearance of QP echoes in the RTI plots and the level of spatial inhomogeneity in sporadic E plasma, signified here by the difference between foEs and fbEs. During QP echo events, foEs increased while fbEs decreased, so that the difference foEs-fbEs was enhanced, indicating the development of strong spatial structuring in electron density within a sporadic E-layer. On the other hand, increases in sporadic E range spreading also correlated with the occurrence of QP echoes but the degree of correlation varied from event to event. Continuous radar echoes were observed in association with low altitude sporadic E-layers, located well below 100 km and at times as low as 90 km. During the continuous echo events, both foEs and fbEs were less variable, and the difference foEs-fbEs was small and not as dynamic as in the QP echoes. On the other hand, the Es-layer spread intensified during continuous echoes, which means that some patchiness or corrugation in those low altitude layers is also necessary for the continuous backscatter echoes to take place.

  18. Signal processing techniques for phase-coded HF-VHF radars

    Directory of Open Access Journals (Sweden)

    J. A. Baskaradas

    2003-06-01

    Full Text Available HF-VHF radar techniques are easy to employ and commonly used in geophysical applications. They include deep radio soundings, used for probing the ionosphere, stratosphere-mesosphere measurement, weather forecast and radio-glaciology. Fast algorithms and powerful processors facilitate the development of several kinds of low power radars, but the reduction of the transmitted power has to be compensated by on-line processing of an encoded signal to maintain a favorable signal-to-noise ratio suitable for detection. Moreover, radars have to reconstruct return echoes with different travel times due to various origins (multi-path, adjacent objects, etc.. Such needs can be accomplished by means of signal phase coding and one of the most attractive is the reversal phase code. The composite echo signal must be processed to extract the physical information useful for the measurement considered. In this paper some algorithms used for on-line processing of phase-coded signals will be described, both in time and frequency domain.

  19. Proyecto Aurora: Building a Community of Women.

    Science.gov (United States)

    Noya, Gladys R. Capella

    1997-01-01

    Describes the development of Proyecto Aurora, a program to develop and implement educational, support, and research programs to benefit low-income women in Puerto Rico. Portraits of some clients illustrate the rewards and challenges of working with this community and furthering their educational experiences and opportunities. (SLD)

  20. Pulsating Aurora in Eveningside Giant Auroral Undulations

    Science.gov (United States)

    Ahrns, M. J.; Hampton, D. L.

    2016-12-01

    Giant auroral undulation events are characterized by large, periodic wavelike auroral structures occurring in at the boundary of the diffuse electron aurora and the subauroral zone. Previous papers regarding giant undulations (e.g. Lui et. al. 1982) were limited to satellite overpasses which provided only a snapshot of the event. We present high temporal and spatial resolution allsky camera imagery of several events. This imagery reveals pulsating aurora to be associated with giant undulations. This pulsating aurora is unusual in that it is in the evening sector, occurring within a very well-defined area, and is not closely associated with substorm activity. The data also yields undulation amplitude, phase speed, and wavelength, which is presented along with radar measurements of the ionospheric plasma drift for several events. Preliminary results suggest the undulations appear at areas of strong shear flow near the auroral/subauroral boundary, and give a dispersion relationship by comparing the wavelength and phase speed for various events. Lui, A. T. Y., C. I. Meng, and S. Ismail (1982), Large amplitude undulations on the equatorward boundary of the diffuse aurora, J. Geophys. Res., 87, 2385-2400.

  1. Phase and coherence analysis of VHF scintillation over Christmas Island

    Directory of Open Access Journals (Sweden)

    E. B. Shume

    2014-03-01

    Full Text Available This short paper presents phase and coherence data from the cross-wavelet transform applied on longitudinally separated very high frequency (VHF equatorial ionospheric scintillation observations over Christmas Island. The phase and coherence analyses were employed on a pair of scintillation observations, namely, the east-looking and west-looking VHF scintillation monitors at Christmas Island. Our analysis includes 3 years of peak season scintillation data from 2008, 2009 (low solar activity, and 2011 (moderate solar activity. In statistically significant and high spectral coherence regions of the cross-wavelet transform, scintillation observations from the east-looking monitor lead those from the west-looking monitor by about 20 to 60 (40 ± 20 min (most frequent lead times. Using several years (seasons and solar cycle of lead (or lag and coherence information of the cross-wavelet transform, we envisage construction of a probability model for forecasting scintillation in the nighttime equatorial ionosphere.

  2. Strong Solar Control of Infrared Aurora on Jupiter: Correlation Since the Last Solar Maximum

    Science.gov (United States)

    Kostiuk, T.; Livengood, T. A.; Hewagama, T.

    2009-01-01

    Polar aurorae in Jupiter's atmosphere radiate throughout the electromagnetic spectrum from X ray through mid-infrared (mid-IR, 5 - 20 micron wavelength). Voyager IRIS data and ground-based spectroscopic measurements of Jupiter's northern mid-IR aurora, acquired since 1982, reveal a correlation between auroral brightness and solar activity that has not been observed in Jovian aurora at other wavelengths. Over nearly three solar cycles, Jupiter auroral ethane emission brightness and solar 10.7 cm radio flux and sunspot number are positively correlated with high confidence. Ethane line emission intensity varies over tenfold between low and high solar activity periods. Detailed measurements have been made using the GSFC HIPWAC spectrometer at the NASA IRTF since the last solar maximum, following the mid-IR emission through the declining phase toward solar minimum. An even more convincing correlation with solar activity is evident in these data. Current analyses of these results will be described, including planned measurements on polar ethane line emission scheduled through the rise of the next solar maximum beginning in 2009, with a steep gradient to a maximum in 2012. This work is relevant to the Juno mission and to the development of the Europa Jupiter System Mission. Results of observations at the Infrared Telescope Facility (IRTF) operated by the University of Hawaii under Cooperative Agreement no. NCC5-538 with the National Aeronautics and Space Administration, Science Mission Directorate, Planetary Astronomy Program. This work was supported by the NASA Planetary Astronomy Program.

  3. PMSE Observations With the Tri-Static EISCAT VHF Radars

    Science.gov (United States)

    Mann, I.; Tjulin, A.; Häggström, I.

    2013-12-01

    The polar mesospheric summer echoes (PMSE) are generated in the ionosphere at roughly 80 to 90 altitude by electron irregularities in the presence of charged solid particles and PMSE are most likely observed when ice particles form onto nanodust. PMSE formation is an important part in understanding mesospheric processes, but is also an interesting example for dusty plasma phenomena occurring in space. To investigate the phenomena that lead to formation of PMSE it is helpful to study the radar reflectivity of the mesosphere at different angles. PMSE were previously studied at different aspect angles in order to better understand the scattering process. Another way is observing PMSE from multiple sites simultaneously. During this summer the EISCAT radars that are located in Northern Scandinavia could for the first time be used for tri-static observations in the VHF band and we carried out observations during three subsequent days in June 2013. The radar signal was transmitted in zenith direction with the EISCAT VHF antenna near Tromsø (69.59 deg N, 19.23 deg E) and the scattered signal was measured from Tromsø, Kiruna (67.86 deg N, 20.44 deg E) and Sodankylä (67.36 deg N, 26.63 deg E). Zenith observations were simultaneously carried out with the Tromsø UHF radar (933 MHz). Other groups have previously reported the observations of PMSE simultaneously with the EISCAT VHF and UHF radars, but with a much lower occurrence rate for the UHF. UHF observations made during this campaign are dominated by incoherent scatter. The VHF system in Tromsø detected PMSE for a large fraction of the observation time. The VHF receivers in Kiruna and Sodankylä were pointed at typical PMSE heights above the Tromsø transmitter and detected radar reflections at the same time and altitude as the Tromsø radar. These observations are among the first tri-static observations of PMSE. Preliminary results from the campaign will be presented and discussed.

  4. Student Attitudes to Radio. I.E.T. Papers on Broadcasting: Number 108.

    Science.gov (United States)

    Brown, Duncan H.

    This report describes a study conducted by the Audio-Visual Media Research Group of the Open University to investigate student attitudes, over time, to the value of radio as a course component. Results of a January 1979 survey using a questionnaire are reported with tables and analyzed according to (1) whether a student had access to a VHF radio…

  5. Aurora A's functions during mitotic exit: the Guess Who game

    Directory of Open Access Journals (Sweden)

    David eReboutier

    2015-12-01

    Full Text Available Until recently, the knowledge of Aurora A kinase functions during mitosis was limited to pre-metaphase events, particularly centrosome maturation, G2/M transition, and mitotic spindle assembly. However, an involvement of Aurora A in post-metaphase events was also suspected, but not clearly demonstrated due to the technical difficulty to perform the appropriate experiments. Recent developments of both an analog specific version of Aurora A, and of small molecule inhibitors have led to the first demonstration that Aurora A is required for the early steps of cytokinesis. As in pre-metaphase, Aurora A plays diverse functions during anaphase, essentially participating in astral microtubules dynamics and central spindle assembly and functioning. The present review describes the experimental systems used to decipher new functions of Aurora A during late mitosis and situate these functions into the context of cytokinesis mechanisms.

  6. The Jovian Aurora - Electron or ion precipitation?

    Science.gov (United States)

    Waite, J. H., Jr.; Clarke, J. T.; Cravens, T. E.; Hammond, C. M.

    1988-01-01

    High signal-to-noise spectra of the Jovian aurora obtained at 1200 to 1500 A by the IUE Observatory were examined for the existence of sulfur and oxygen emissions that would be expected if the UV emissions were produced by precipitating heavy ions. The results of these measurements and subsequent spectral modeling, using a model of heavy aurora constructed by Horanyi et al. (1988), showed mixed evidence of the oxygen and sulfur emissions. It was noted that only the UV emissions which are produced above the UV absorbing hydrocarbon layer were observed by the IUE and Voyager UV spectrometers. This fact, combined with the recent observations of the longitudinal distribution of the Jovian UV aurora, indicates that electrons as well as ions play a role in Jovian auroral processes. Based on the observations, it is suggested that heavy-ion auroral energy deposition is concentrated at altitudes below the homopause, while electrons with energies of 10 to 30 keV are responsible for the bulk of the observable UV and EUV emissions.

  7. Polar Embedding for Aurora Image Retrieval.

    Science.gov (United States)

    Yang, Xi; Gao, Xinbo; Tian, Qi

    2015-11-01

    Exploring the multimedia techniques to assist scientists for their research is an interesting and meaningful topic. In this paper, we focus on the large-scale aurora image retrieval by leveraging the bag-of-visual words (BoVW) framework. To refine the unsuitable representation and improve the retrieval performance, the BoVW model is modified by embedding the polar information. The superiority of the proposed polar embedding method lies in two aspects. On the one hand, the polar meshing scheme is conducted to determine the interest points, which is more suitable for images captured by circular fisheye lens. Especially for the aurora image, the extracted polar scale-invariant feature transform (polar-SIFT) feature can also reflect the geomagnetic longitude and latitude, and thus facilitates the further data analysis. On the other hand, a binary polar deep local binary pattern (polar-DLBP) descriptor is proposed to enhance the discriminative power of visual words. Together with the 64-bit polar-SIFT code obtained via Hamming embedding, the multifeature index is performed to reduce the impact of false positive matches. Extensive experiments are conducted on the large-scale aurora image data set. The experimental result indicates that the proposed method improves the retrieval accuracy significantly with acceptable efficiency and memory cost. In addition, the effectiveness of the polar-SIFT scheme and polar-DLBP integration are separately demonstrated.

  8. Evolutionary reconstruction and population genetics analysis of aurora kinases.

    Directory of Open Access Journals (Sweden)

    Balu Kamaraj

    Full Text Available BACKGROUND: Aurora kinases belong to the highly conserved kinase family and play a vital role in cell cycle regulation. The structure and function of these kinases are inter-related and sometimes they also act as substitutes in case of knockdown of other aurora kinases. METHOD: In this work we carried out the evolutionary reconstruction and population genetic studies of aurora kinase proteins. Substitution saturation test, CAI (Codon adaptation index, gene expression and RSCU (Relative synonymous codon usage values were computed for all the three aurora kinases. Linear regression method was used to check the dependency of gene expression on their CAI values. RESULTS: The results suggested that aurora-B and aurora-C has shown convergence in their evolutionary pathway. Moreover, the aurora-A I57V mutation showed high penetrance in human population and exist at very high frequency (84.4% when compared to the native residue (15.6%. The mutation showed notable range of functional gain and seemed to be promising for the evolution of aurora-A function. Mutant allele might also become a challenging prospect for understanding the pattern of evolution followed by cell cycle kinases. CONCLUSION: The overall result suggested that the aurora-A is currently under the evolutionary transition and to determine the functional significance of the mutation further investigation are required.

  9. The first operation and results of the Chung-Li VHF radar

    Science.gov (United States)

    Chao, J. K.; Kuo, F. S.; Chu, Y. S.; Fu, I. J.; Rottger, J.; Liu, C. H.

    1986-01-01

    The Chung-Li Very High Frequency (VHF) radar is used in the dual-mode operations, applying Doppler beam-swinging as well as the spaced-antenna-drift method. The design of the VHF radar is examined. Results of performance tests are discussed.

  10. The impact of an ICME on the Jovian X-ray aurora.

    Science.gov (United States)

    Dunn, William R; Branduardi-Raymont, Graziella; Elsner, Ronald F; Vogt, Marissa F; Lamy, Laurent; Ford, Peter G; Coates, Andrew J; Gladstone, G Randall; Jackman, Caitriona M; Nichols, Jonathan D; Rae, I Jonathan; Varsani, Ali; Kimura, Tomoki; Hansen, Kenneth C; Jasinski, Jamie M

    2016-03-01

    We report the first Jupiter X-ray observations planned to coincide with an interplanetary coronal mass ejection (ICME). At the predicted ICME arrival time, we observed a factor of ∼8 enhancement in Jupiter's X-ray aurora. Within 1.5 h of this enhancement, intense bursts of non-Io decametric radio emission occurred. Spatial, spectral, and temporal characteristics also varied between ICME arrival and another X-ray observation two days later. Gladstone et al. (2002) discovered the polar X-ray hot spot and found it pulsed with 45 min quasiperiodicity. During the ICME arrival, the hot spot expanded and exhibited two periods: 26 min periodicity from sulfur ions and 12 min periodicity from a mixture of carbon/sulfur and oxygen ions. After the ICME, the dominant period became 42 min. By comparing Vogt et al. (2011) Jovian mapping models with spectral analysis, we found that during ICME arrival at least two distinct ion populations, from Jupiter's dayside, produced the X-ray aurora. Auroras mapping to magnetospheric field lines between 50 and 70 RJ were dominated by emission from precipitating sulfur ions (S7+,…,14+). Emissions mapping to closed field lines between 70 and 120 RJ and to open field lines were generated by a mixture of precipitating oxygen (O7+,8+) and sulfur/carbon ions, possibly implying some solar wind precipitation. We suggest that the best explanation for the X-ray hot spot is pulsed dayside reconnection perturbing magnetospheric downward currents, as proposed by Bunce et al. (2004). The auroral enhancement has different spectral, spatial, and temporal characteristics to the hot spot. By analyzing these characteristics and coincident radio emissions, we propose that the enhancement is driven directly by the ICME through Jovian magnetosphere compression and/or a large-scale dayside reconnection event.

  11. ROAN Remote radio meteor detection sensor

    Science.gov (United States)

    Lesanu, C. E.

    2016-01-01

    Only few meteor enthusiasts across the world today, approaches systematically the radio meteor detection technique, one of the reasons being the difficulty to build and install proper permanent antennas, especially when low-VHF frequency opportunity transmitters are used as illuminators. Other reasons were in the past the relatively high cost of the entire system, receivers and computers, and not ultimately the high power consumption of the system in a 24/7 operation, when using regular personal computers. The situation changed in the recent years with the advent of the low cost software defined radio SDR receivers and low consumption/cost single board computers SBC. A commercial off-the-shelf hardware based remote radio meteor detection sensor is presented.

  12. Frequency domain interferometry mode observations of PMSE using the EISCAT VHF radar

    Directory of Open Access Journals (Sweden)

    P. B. Chilson

    2000-12-01

    Full Text Available During the summer of 1997 investigations into the nature of polar mesosphere summer echoes (PMSE were conducted using the European incoherent scatter (EISCAT VHF radar in Norway. The radar was operated in a frequency domain interferometry (FDI mode over a period of two weeks to study the frequency coherence of the returned radar signals. The operating frequencies of the radar were 224.0 and 224.6 MHz. We present the first results from the experiment by discussing two 4-h intervals of data collected over two consecutive nights. During the first of the two days an enhancement of the FDI coherence, which indicates the presence of distinct scattering layers, was found to follow the lower boundary of the PMSE. Indeed, it is not unusual to observe that the coherence values are peaked around the heights corresponding to both the lower- and upper-most boundaries of the PMSE layer and sublayers. A Kelvin-Helmholtz mechanism is offered as one possible explanation for the layering structure. Additionally, our analysis using range-time-pseudocolor plots of signal-to-noise ratios, spectrograms of Doppler velocity, and estimates of the positions of individual scattering layers is shown to be consistent with the proposition that upwardly propagating gravity waves can become steepened near the mesopause.Key words: Ionosphere (polar ionosphere · Meteorology and Atmospheric Dynamics (middle atmosphere dynamics · Radio Science (Interferometry

  13. Frequency domain interferometry mode observations of PMSE using the EISCAT VHF radar

    Directory of Open Access Journals (Sweden)

    P. B. Chilson

    Full Text Available During the summer of 1997 investigations into the nature of polar mesosphere summer echoes (PMSE were conducted using the European incoherent scatter (EISCAT VHF radar in Norway. The radar was operated in a frequency domain interferometry (FDI mode over a period of two weeks to study the frequency coherence of the returned radar signals. The operating frequencies of the radar were 224.0 and 224.6 MHz. We present the first results from the experiment by discussing two 4-h intervals of data collected over two consecutive nights. During the first of the two days an enhancement of the FDI coherence, which indicates the presence of distinct scattering layers, was found to follow the lower boundary of the PMSE. Indeed, it is not unusual to observe that the coherence values are peaked around the heights corresponding to both the lower- and upper-most boundaries of the PMSE layer and sublayers. A Kelvin-Helmholtz mechanism is offered as one possible explanation for the layering structure. Additionally, our analysis using range-time-pseudocolor plots of signal-to-noise ratios, spectrograms of Doppler velocity, and estimates of the positions of individual scattering layers is shown to be consistent with the proposition that upwardly propagating gravity waves can become steepened near the mesopause.

    Key words: Ionosphere (polar ionosphere · Meteorology and Atmospheric Dynamics (middle atmosphere dynamics · Radio Science (Interferometry

  14. On the VHF source retrieval errors associated with Lightning Mapping Arrays (LMAs)

    Science.gov (United States)

    Koshak, W. J.

    2016-12-01

    A common method for retrieving the lightning Very High Frequency (VHF) radio source (x, y, z, t) emission is to minimize a (reduced) chi-squared function that indicates how well the model arrival times associated with the model source represent the arrival time measurements at each Lightning Mapping Array (LMA) site. The Levenberg-Marquardt (LM) algorithm is usually employed to find the minimum of the chi-squared function, and the model source producing this minimum is considered to be the optimal source solution. Because the chi-squared mathematical surface is nonlinear, it is important to feed the LM algorithm an accurate initial guess (xo, yo, zo, to) in parameter space to avoid parameter searches that terminate at a relative minima of the chi-squared surface. Source initialization is commonly performed using a linear retrieval algorithm first introduced in Koshak and Solakiewicz (1996), and further applied in Koshak et al. (2004). Monte Carlo simulations and theoretical inferences both show that source retrieval errors (particularly source altitude errors) increase with horizontal source range. In the present study, the effect of modifying certain elements of the retrieval (i. e., the LMA site locations, the number of sites employed, and the retrieval algorithm characteristics) are examined to assess and quantify associated improvements in retrieval results.

  15. Very Compact and Broadband Active Antenna for VHF Band Applications

    Directory of Open Access Journals (Sweden)

    Y. Taachouche

    2012-01-01

    Full Text Available An active receiving antenna with small size consisting of a monopole loaded with a transistor bipolar is presented in this paper. A transistor is used in order to miniaturize the receiving active antenna size in VHF band. The vertical size of the structure is equal to λ/175, where λ is the wavelength at the lower frequency of the bandwidth. Despite the very small size of the antenna, the frequency bandwidth is very wide and the gain is suitable for FM application with sensitive receivers.

  16. Preliminary studies of the helminth parasites of Limicolaria Aurora in ...

    African Journals Online (AJOL)

    Specimens of Limicolaria aurora collected from Ile-Ife area were surveyed for infection with parasitic helminthes. The snails were picked from bushes and dissected and examined in the laboratory. Four different helminth parasites comprising of 3 nematodes and a digenetic trematode were observed in L. aurora.

  17. Jung's quest for the "Aurora consurgens"

    DEFF Research Database (Denmark)

    Haaning, Aksel

    2014-01-01

    The paper focuses on the year 1929 when Jung published ‘A European commentary’ to Richard Wilhelm's German translation of the Taoist text The Secret of the Golden Flower. This shows that Jung had already started on the track of European alchemy by following up Conrad Waldkirch's preface in Artis...... Auriferae (1593); and it raises the question of whether this could be the possible missing link to Jung's subsequent research in Alchemy and Hermetic Philosophy in the years to come. It is argued that here was the beginning of Jung's quest for the Aurora consurgens, the publication of which concludes...

  18. Initial results of VLF Campaign observation with High-resolution Aurora Imaging Network (VLF-Chain) over Canada

    Science.gov (United States)

    Shiokawa, Kazuo

    2012-07-01

    Whistler-mode waves in the VLF/ELF frequency range interact with high-energy (~10 keV) electrons to cause diffuse and pulsating auroras, and with MeV electrons in the radiation belts. However, simultaneous high-time resolution measurements of aurora and these waves have previously not been done sufficiently. We made a campaign observation of such high-time resolution measurements at Athabasca (54.72N, 246.69E, MLAT=61.3) and Fort Vermillion (58.38N, 243.99E, MLAT=64.5) using two loop antennas and several auroral cameras for February 16-26, 2012. The loop antennas at both stations measure east-west and north-south magnetic field variations with a sampling rate of 100 kHz. The panchromatic all-sky cameras at both stations measure auroras with a sampling rate of 30 Hz. The sampling timings of both instruments are corrected by GPS receivers. In addition we installed an oblique looking narrow-FoV EMCCD camera at Athabasca with a sampling rate of 100 Hz, to measure height variation of pulsating aurora. At Athabasca, routine measurements by an induction magnetometer, a proton photometer, an all-sky airglow imager, LF standard wave receiver, were also carried out. We also tried to compare these observations with satellite measurements by REIMEI, THEMIS, NOAA, and DMSP. In this presentation we will show initial results obtained from this comprehensive campaign of aurora and radio wave measurements at subauroral latitudes.

  19. An isolated, bright cusp aurora at Saturn

    Science.gov (United States)

    Kinrade, J.; Badman, S. V.; Bunce, E. J.; Tao, C.; Provan, G.; Cowley, S. W. H.; Grocott, A.; Gray, R. L.; Grodent, D.; Kimura, T.; Nichols, J. D.; Arridge, C. S.; Radioti, A.; Clarke, J. T.; Crary, F. J.; Pryor, W. R.; Melin, H.; Baines, K. H.; Dougherty, M. K.

    2017-06-01

    Saturn's dayside aurora displays a number of morphological features poleward of the main emission region. We present an unusual morphology captured by the Hubble Space Telescope on 14 June 2014 (day 165), where for 2 h, Saturn's FUV aurora faded almost entirely, with the exception of a distinct emission spot at high latitude. The spot remained fixed in local time between 10 and 15 LT and moved poleward to a minimum colatitude of 4°. It was bright and persistent, displaying intensities of up to 49 kR over a lifetime of 2 h. Interestingly, the spot constituted the entirety of the northern auroral emission, with no emissions present at any other local time—including Saturn's characteristic dawn arc, the complete absence of which is rarely observed. Solar wind parameters from propagation models, together with a Cassini magnetopause crossing and solar wind encounter, indicate that Saturn's magnetosphere was likely to have been embedded in a rarefaction region, resulting in an expanded magnetosphere configuration during the interval. We infer that the spot was sustained by reconnection either poleward of the cusp or at low latitudes under a strong component of interplanetary magnetic field transverse to the solar wind flow. The subsequent poleward motion could then arise from either reconfiguration of successive open field lines across the polar cap or convection of newly opened field lines. We also consider the possible modulation of the feature by planetary period rotating current systems.

  20. Jovian-like aurorae on Saturn.

    Science.gov (United States)

    Stallard, Tom; Miller, Steve; Melin, Henrik; Lystrup, Makenzie; Cowley, Stan W H; Bunce, Emma J; Achilleos, Nicholas; Dougherty, Michele

    2008-06-19

    Planetary aurorae are formed by energetic charged particles streaming along the planet's magnetic field lines into the upper atmosphere from the surrounding space environment. Earth's main auroral oval is formed through interactions with the solar wind, whereas that at Jupiter is formed through interactions with plasma from the moon Io inside its magnetic field (although other processes form aurorae at both planets). At Saturn, only the main auroral oval has previously been observed and there remains much debate over its origin. Here we report the discovery of a secondary oval at Saturn that is approximately 25 per cent as bright as the main oval, and we show this to be caused by interaction with the middle magnetosphere around the planet. This is a weak equivalent of Jupiter's main oval, its relative dimness being due to the lack of as large a source of ions as Jupiter's volcanic moon Io. This result suggests that differences seen in the auroral emissions from Saturn and Jupiter are due to scaling differences in the conditions at each of these two planets, whereas the underlying formation processes are the same.

  1. The Jovian aurora: Electron or ion precipitation

    Energy Technology Data Exchange (ETDEWEB)

    Waite, J.H., Jr. (NASA Marshall Space Flight Center, Huntsville, AL (USA)); Clarke, J.T. (NASA Goddard Space Flight Center, Greenbelt, MD (USA)); Cravens, T.E. (Univ. of Michigan, Ann Arbor (USA)); Hammond, C.M. (Univ. of California, Los Angeles (USA))

    1988-07-01

    High signal-to-noise spectra of the Jovian aurora at UV wavelengths obtained using the International Ultraviolet Explorer Observatory (including the brightest Jovian aurora observed to date) are used to study the existence of sulfur and oxygen emissions which would be associated with the precipitation of energetic heavy ions in the upper Jovian atmosphere. Model calculations of heavy ion precipitation and corresponding estimates of the associated sulfur and oxygen UV emissions carried out in the preceding companion paper of Horanyi et al. suggest emission values for 1,304-{angstrom} O I emission that are at least 50 times larger than the upper limit values set by the IUE observations reported here. On the other hand a possible emission feature of S II at 1,256 {angstrom} is comparable to the theoretically predicted emission intensity. Earlier X ray observations and in situ plasma observations have indicated the existence of energetic heavy ion precipitation in the Jovian auroral zone. Based on the IUE observations reported here, the authors suggest a scenario where heavy ion auroral energy deposition is concentrated at altitudes below the homopause (i.e. > 300 keV/nucleon) and electrons with energies of 10 to 30 keV are responsible for the bulk of the observable UV and EUV emissions since they deposit their energy above the methane-absorbing layer defined by the homopause.

  2. The Jovian aurora: Electron or ion precipitation

    Science.gov (United States)

    Waite, J. H., Jr.; Clarke, J. T.; Cravens, T. E.

    1986-01-01

    High signal-to-noise spectra of the Jovian aurora at UV wavelengths obtained using the International Ultraviolet Explorer Observatory (including the brightest Jovian aurora observed to date) set strigent upper limits for sulfur and oxygen emissions, which would be associated with the precipitation of energetic heavy ions in the upper Jovian atmosphere if they were solely responsible for Jovian auroral processes. Model calculations of heavy ion precipitation and corresponding estimates of the associated sulfur and oxygen UV emissions previously carried out suggest emission values for 1304 A OI emission that are at least 30 times larger than the upper limit values set by the IUE observations reported. On the other hand the observed (feature of SII at 1256 A of 2 kR) is quite comparable to the theoretically predicted emission intensity. Taken together these observations and calculations suggest that electron as well as ion precipitation play a role in Jovian auroral processes. In light of earlier X-ray observations and in-situ plasma observations that suggest energetic heavy ion precipitation in the Jovian auroral zone, a scenario is suggested where heavy ion auroral energy deposition is concentrated at altitudes below the homopause. Electrons with energies of 10 to 30 keV are responsible for the bulk of the observable UV and EUV emissions since they deposit their energy above the methane absorbing layer defined by the homopause.

  3. Jovian aurora: electron or ion precipitation

    Energy Technology Data Exchange (ETDEWEB)

    Waite, J.H. Jr.; Clarke, J.T.; Cravens, T.E.

    1986-01-01

    High signal-to-noise spectra of the Jovian aurora at UV wavelengths obtained using the International Ultraviolet Explorer Observatory (including the brightest Jovian aurora observed to date) set strigent upper limits for sulfur and oxygen emissions, which would be associated with the precipitation of energetic heavy ions in the upper Jovian atmosphere if they were solely responsible for Jovian auroral processes. Model calculations of heavy ion precipitation and corresponding estimates of the associated sulfur and oxygen UV emissions previously carried out suggest emission values for 1304 A OI emission that are at least 30 times larger than the upper limit values set by the IUE observations reported. On the other hand the observed (feature of SII at 1256 A of 2 kR) is quite comparable to the theoretically predicted emission intensity. Taken together these observations and calculations suggest that electron as well as ion precipitation play a role in Jovian auroral processes. In light of earlier X-ray observations and in-situ plasma observations that suggest energetic heavy ion precipitation in the Jovian auroral zone, a scenario is suggested where heavy ion auroral energy deposition is concentrated at altitudes below the homopause. Electrons with energies of 10 to 30 keV are responsible for the bulk of the observable UV and EUV emissions since they deposit their energy above the methane absorbing layer defined by the homopause.

  4. ROSAT observations of the Jupiter aurora

    Science.gov (United States)

    Waite, J. H., Jr.; Bagenal, F.; Seward, F.; Na, C.; Gladstone, G. R.; Cravens, T. E.; Hurley, K. C.; Clarke, J. T.; Elsner, R.; Stern, S. A.

    1994-01-01

    Roentgen satellite (ROSAT) high-resolution imager (HRI) and position sensitive proportional counter (PSPC) observations of Jupiter obtained in April 1991 and May 1992 reveal soft X-ray emissions apparently associated with Jupiter's aurora and similar to X-ray emssions observed earlier by the Einstein Observatory. The HRI images show emission mainly from Jupiter's northern hemisphere at all Jovian longitudes observed, and there is some indication of a longitudinal modulation of the emission in phase with well-known ultraviolet modulation of the northern aurora. The PSPC data reveal a very soft spectrum. Comparison of the observed spectrum with models for both electron bremsstrahlung radiation and line emission from S and O ions indicates that the line spectrum gives a much better statistical fit to the observed spectrum. The X ray observations presented here therefore support the hypothesis that ion precipitation is the most likely cause of the Jovian X ray emissions, a result first suggested by the Einstein results (Metzger et al., 1983).

  5. Radio Journalism.

    Science.gov (United States)

    Bittner, John R.; Bittner, Denise A.

    This book, a how-to-do-it guide for the novice and the professional alike, deals with several aspects of radio journalism: producing documentaries, preparing and announcing radio news, ethics and responsibility, regulation of radio journalism, and careers. It traces the history and growth of radio news, shows its impact on the public, and…

  6. Environmental Baseline Survey, Fitzsimmons Army Medical Center, Aurora, Colorado. Volume II - Appendices A-G.

    Science.gov (United States)

    1996-05-01

    AURORA 80011 COD982591133 EAST MIDDLE SCH 1 1275 FRASER ST F23 AURORA 80011 COD100711530 ELECTRONIC METAL PRODUCTS 1,3,60 21000 E 32ND PKY AURORA 80011...COD982591133 DRIVER EDUCATION 90 BUCKLEY RD UNIT B AURORA 3 80011 COD100711530 EAST MIDDLE SCHOOL 1275 FRASER ST RI9 AURORA 3 80011E COD054936604 ELECTRONIC ... METAL PRODUCTS INC 21000 E 32ND PKY AURORA 2 80011 COD100711548 ELKHART ELEMENTARY SCHOOL 1020 EAGLE ST R12 AURORA 3 80011 COD982597783 ENVIRO HEALTH

  7. Extraction of forest stand parameters from CARABAS VHF SAR images

    Energy Technology Data Exchange (ETDEWEB)

    Walter, Fredrik [Swedish Univ. of Agricultural Sciences, Uppsala (Sweden). Centre for Image Analysis

    1999-10-01

    Methods for extracting stand-wise forest parameters from CARABAS VHF SAR images have been developed and evaluated. CARABAS is a unique airborne synthetic aperture radar (SAR), developed by the Swedish Defence Research Establishment. It differs a lot from ordinary microwave radars by using wavelengths between 3.3 and 15 m, making the image intensity highly correlated to stem volume. Furthermore, by providing its own illumination source, the sensor operates independently of daylight and weather conditions. Empirical regression models have been developed for relating backscattering amplitude to stem volume, stem diameter, and tree height. To make comparison between CARABAS image data and forest parameters effective, a fully automatic geo-coding algorithm was developed. Image texture features have also been investigated. By using the variogram as a discriminating feature, CARABAS images and aerial images were segmented into homogeneous regions. Furthermore, a method for discriminating recently clear felled areas from forested areas, combining information from Almaz-1 SAR images and SPOT panchromatic data has also been developed, serving as a comparison to the main work of this thesis. For forest stands at near-horizontal ground, the results for estimating stem volume, stem diameter, and tree height from CARABAS image data are very satisfactory. The root mean square errors for the estimates are comparable to subjective ground-based inventories for dense forest stands. The methods and algorithms described in this thesis have been developed towards an operational remote sensing tool. Altogether, significant potential for mapping of forest characteristics exists using the CARABAS VHF SAR sensor 57 refs, 14 figs, 7 tabs

  8. Were Greek temples oriented towards aurorae?

    Science.gov (United States)

    Liritzis, Ioannis; Vassiliou, Helen

    2006-02-01

    Two ancient Greek temples of Apollo at Bassae (Phigaleia, western Peloponnese, Greece), and Thermon at Aetolia, (Aetoloacarnania, western central Greece), have a north-south orientation of their main entrances. This is a rather rare alignment of temples in general and specifically of Apollo in classical Greece, where most of them have broadly an east-west orientation. Based on historical and mythological accounts, as well as astronomical orientation measurements, the northern direction orientation of these constructions may relate to the rare, albeit impressive, occurrence of aurorae borealis, the northern lights. These strong lights are attributed to god Apollo by the epithet ``hyperborean'', meaning to the northern lands. Attribution is supported by archaeomagnetic directional data accompanied by auroral occurrence during those times.

  9. Hyperspectral all-sky imaging of auroras.

    Science.gov (United States)

    Sigernes, Fred; Ivanov, Yuriy; Chernouss, Sergey; Trondsen, Trond; Roldugin, Alexey; Fedorenko, Yury; Kozelov, Boris; Kirillov, Andrey; Kornilov, Ilia; Safargaleev, Vladimir; Holmen, Silje; Dyrland, Margit; Lorentzen, Dag; Baddeley, Lisa

    2012-12-03

    A prototype auroral hyperspectral all-sky camera has been constructed and tested. It uses electro-optical tunable filters to image the night sky as a function of wavelength throughout the visible spectrum with no moving mechanical parts. The core optical system includes a new high power all-sky lens with F-number equal to f/1.1. The camera has been tested at the Kjell Henriksen Observatory (KHO) during the auroral season of 2011/2012. It detects all sub classes of aurora above ~½ of the sub visual 1kR green intensity threshold at an exposure time of only one second. Supervised classification of the hyperspectral data shows promise as a new method to process and identify auroral forms.

  10. Aurora A, mitotic entry, and spindle bipolarity

    Science.gov (United States)

    Liu, Quentin; Ruderman, Joan V.

    2006-01-01

    The kinase Aurora-A (Aur-A), which is enriched at centrosomes, is required for centrosome maturation and accurate chromosome segregation, and recent work implicates centrosomes as sites where the earliest activation of cyclin B1-cdc2 occurs. Here, we have used Xenopus egg extracts to investigate Aur-A's contribution to cell cycle progression and spindle morphology in the presence or absence of centrosomes. We find that addition of active Aur-A accelerates cdc2 activation and mitotic entry. Depletion of endogenous Aur-A or addition of inactive Aur-A, which lead to monopolar spindles, delays but does not block mitotic entry. These effects on timing and spindle structure do not require the presence of centrosomes or chromosomes. The catalytic domain alone of Aur-A is sufficient to restore spindle bipolarity; additional N-terminal sequences function in mitotic timing. PMID:16581905

  11. Jovian VLF chorus and Io torus aurora

    Science.gov (United States)

    Inan, U. S.

    1986-01-01

    A test particle model of the cyclotron resonance interaction of waves and trapped radiation belt particles is used to estimate the energetic electron fluxes precipitated by Jovian VLF chorus waves observed on the Voyager 1 and 2 spacecraft near the Io torus. The precipitation fluxes induced by 1-s-long chorus wave packets at L = 7.6 and 8.6 are estimated to be bursts of 5s duration with a peak of 0.3-3 and 0.7-7 ergs/sq cm s that consist of electrons of 5-100 keV energy and that arrives at the ionosphere 15 s after the generation of the chorus wave at the equatorial plane. The effects in the Jovian ionosphere of the chorus-induced precipitation are estimated using existing ionospheric models. A possible experiment for measuring Jovian chorus-induced aurora is proposed and discussed.

  12. Exposure of radio officers to radio frequency radiation on Danish merchant ships.

    Science.gov (United States)

    Skotte, J

    1984-12-01

    Exposure of radio officers to radio frequency radiation from telegraphy and telephony equipment on ships was investigated. Eighty-five measurements were made of 12 radio transmitters operating in the 400 kHz to 25 MHz range (power up to 1200 W) and three VHF telephony transmitters in the 150 MHz band. Field measurements were made at positions normally occupied by radio officers approximately 1 m, 0.5 m and 0.25 m from the antenna feed lines. The distance between the radio operator and the measurement location was at least 0.5 m. The ratio of the electric and magnetic field strength squared (MF and HF transmitters) to ANSI C95.1-1982 radio frequency protection guides ranged from 0.001 to 0.26 (geometric mean 0.02) at the location of the seated radio officer's head. A minimum distance of 0.5 m between antenna feed lines and personnel is recommended. This would normally ensure an exposure below the ANSI safety levels.

  13. Exposure of radio officers to radio frequency radiation on Danish merchant ships

    Energy Technology Data Exchange (ETDEWEB)

    Skotte, J.

    1984-12-01

    Exposure of radio officers to radio frequency radiation from telegraphy and telephony equipment on ships was investigated. Eighty-five measurements were made of 12 radio tranmitters operating in the 400 kHz to 25 MHz range (power up to 1200 W) and three VHF telephony transmitters in the 150 MHz band. Field measurments were made at positions normally occupied by radio officers approximately 1 m, 0.5 m and 0.25 m from the antenna feed lines. The distance between the radio operator and the measurement location was at least 0.5 m. The ratio of the electric and magnetic field strength squared (MF and HF transmitters) to ANSI C95.1-1982 radio frequency protection guides ranged from 0.001 to 0.26 (geometric mean 0.02) at the location of the seated radio officer's head. A minimum distance of 0.5 m between antenna feed lines and personnel is recommended. This would normally ensure an exposure below the ANSI safety levels.

  14. Research Ship Aurora Australis Underway Meteorological Data, Quality Controlled

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Research Ship Aurora Australis Underway Meteorological Data (delayed ~10 days for quality control) are from the Shipboard Automated Meteorological and Oceanographic...

  15. Simulation of Controller Pilot Data Link Communications over VHF Digital Link Mode 3

    Science.gov (United States)

    Bretmersky, Steven C.; Murawski, Robert; Nguyen, Thanh C.; Raghavan, Rajesh S.

    2004-01-01

    The Federal Aviation Administration (FAA) has established an operational plan for the future Air Traffic Management (ATM) system, in which the Controller Pilot Data Link Communications (CPDLC) is envisioned to evolve into digital messaging that will take on an ever increasing role in controller to pilot communications, significantly changing the way the National Airspace System (NAS) is operating. According to FAA, CPDLC represents the first phase of the transition from the current analog voice system to an International Civil Aviation Organization (ICAO) compliant system in which digital communication becomes the alternate and perhaps primary method of routine communication. The CPDLC application is an Air Traffic Service (ATS) application in which pilots and controllers exchange messages via an addressed data link. CPDLC includes a set of clearance, information, and request message elements that correspond to existing phraseology employed by current Air Traffic Control (ATC) procedures. These message elements encompass altitude assignments, crossing constraints, lateral deviations, route changes and clearances, speed assignments, radio frequency assignments, and various requests for information. The pilot is provided with the capability to respond to messages, to request clearances and information, to report information, and to declare/rescind an emergency. A 'free text' capability is also provided to exchange information not conforming to defined formats. This paper presents simulated results of the aeronautical telecommunication application Controller Pilot Data Link Communications over VHF Digital Link Mode 3 (VDL Mode 3). The objective of this simulation study was to determine the impact of CPDLC traffic loads, in terms of timely message delivery and capacity of the VDL Mode 3 subnetwork. The traffic model is based on and is used for generating air/ground messages with different priorities. Communication is modeled for the en route domain of the Cleveland

  16. Statistics of 150-km echoes over Jicamarca based on low-power VHF observations

    Directory of Open Access Journals (Sweden)

    J. L. Chau

    2006-07-01

    Full Text Available In this work we summarize the statistics of the so-called 150-km echoes obtained with a low-power VHF radar operation at the Jicamarca Radio Observatory (11.97 S, 76.87 W, and 1.3 dip angle at 150-km altitude in Peru. Our results are based on almost four years of observations between August 2001 and July 2005 (approximately 150 days per year. The majority of the observations have been conducted between 08:00 and 17:00 LT. We present the statistics of occurrence of the echoes for each of the four seasons as a function of time of day and altitude. The occurrence frequency of the echoes is ~75% around noon and start decreasing after 15:00 LT and disappear after 17:00 LT in all seasons. As shown in previous campaign observations, the 150-echoes appear at a higher altitude (>150 km in narrow layers in the morning, reaching lower altitudes (~135 km around noon, and disappear at higher altitudes (>150 km after 17:00 LT. We show that although 150-km echoes are observed all year long, they exhibit a clear seasonal variability on altitudinal coverage and the percentage of occurrence around noon and early in the morning. We also show that there is a strong day-to-day variability, and no correlation with magnetic activity. Although our results do not solve the 150-km riddle, they should be taken into account when a reasonable theory is proposed.

  17. Wideband VHF radio channel modelling and characterisation beyond line-or-sight.

    OpenAIRE

    Feramez, Michael

    2017-01-01

    The dawn of the information age brought to light technical and economic challenges in delivering broadband telecommunication services to subscribers in rural and remote areas; challenges created by tiny pockets of subscribers scattered over a vast network service area. Dealing with such challenges calls for an appropriate system engineering approach and the utilisation of suitable network building blocks, which could differ significantly from those of the urban areas. The aim of this thesis, ...

  18. Preservation of minimally processed 'aurora-1' peaches using additives

    OpenAIRE

    Ramilo Nogueira Martins; Ben-Hur Mattiuz; Leandra Oliveira Santos; Cristiane Maria Ascari Morgado; Claudia Fabrino Machado Mattiuz

    2011-01-01

    'Aurora-1' peaches establishes an interesting alternative as a minimally processed product, due to its characteristics like flavor, color, smell, and also because of its handling resistance. However, it has a short shelf life after a fresh-cut due to enzymatic browning and stone cavity collapse. The main purpose of this research was to test the additive with antioxidant effect to prevent browning in minimally processed 'Aurora-1' peaches. The minimal processing consists of washing, sanitizing...

  19. Radio Mariackie

    OpenAIRE

    Tytko, Marek Mariusz

    1993-01-01

    Tekst dotyczy początków katolickiego Radia Mariackiego w Krakowie w 1993 r. The text concerns the begining of the Mariackie Radio [The Mariackie Broadcasting, the Maria's Radio Station, the Maria's Broadcasting, the Maria's Radio) in Cracow 1993.

  20. Sporadic aurorae observed in East Asia

    Directory of Open Access Journals (Sweden)

    D. M. Willis

    2007-03-01

    aurorae observed in the United States during the interval AD 1880–1940. The localised nature and spatial structure of some sporadic aurorae observed in East Asia is indicated by the use of descriptive terms such as "lightning", "rainbow", "streak" and "grid".

  1. Sporadic aurorae observed in East Asia

    Directory of Open Access Journals (Sweden)

    D. M. Willis

    2007-03-01

    Full Text Available All the accessible auroral observations recorded in Chinese and Japanese histories during the interval AD 1840–1911 are investigated in detail. Most of these auroral records have never been translated into a Western language before. The East Asian auroral reports provide information on the date and approximate location of each auroral observation, together with limited scientific information on the characteristics of the auroral luminosity such as colour, duration, extent, position in the sky and approximate time of occurrence. The full translations of the original Chinese and Japanese auroral records are presented in an appendix, which contains bibliographic details of the various historical sources. (There are no known reliable Korean observations during this interval. A second appendix discusses a few implausible "auroral" records, which have been rejected. The salient scientific properties of all exactly dated and reliable East Asian auroral observations in the interval AD 1840–1911 are summarised succinctly. By comparing the relevant scientific information on exactly dated auroral observations with the lists of great geomagnetic storms compiled by the Royal Greenwich Observatory, and also the tabulated values of the Ak (Helsinki and aa (Greenwich and Melbourne magnetic indices, it is found that 5 of the great geomagnetic storms (aa>150 or Ak>50 during either the second half of the nineteenth century or the first decade of the twentieth century are clearly identified by extensive auroral displays observed in China or Japan. Indeed, two of these great storms produced auroral displays observed in both countries on the same night. Conversely, at least 29 (69% of the 42 Chinese and Japanese auroral observations occurred at times of weak-to-moderate geomagnetic activity (aa or Ak≤50. It is shown that these latter auroral displays are very similar to the more numerous (about 50 examples of sporadic aurorae observed in the United States

  2. Application of radio phase modes to modification and remote sensing of the atmosphere and space

    Science.gov (United States)

    Isham, B.; Mohammadi, S.; Chau, J.; Hysell, D. L.; Daldorff, L. K.; Thide, B.; Bergman, J.

    2009-12-01

    Radio phase modes are a low-frequency electromagnetic wave (radio) manifestation of photon orbital angular momentum (OAM) modes. At optical (laser) wavelengths OAM is an active area of theoretical and experimental research. Theory and modelling of radio phase modes show they may also easily be generated and, under certain conditions, detected with modern radio antenna arrays. Transimission of radio phase modes has been attempted using the HAARP HF transmitter in Alaska and the Jicamarca VHF radar in Peru. The HAARP experiment was designed to search for ionospheric modification effects of phase modes, while the Jicamarca experiment explored the possibility of using phase modes for remote sensing. Further work at Jicamarca will be aimed at verifying phase mode transmission and detection capabilities by using the moon as a reflector. Other potential applications of phase modes include the detection of radio OAM generated by astrophysical sources and their use in communications as a way of transmitting multiple signals at a single frequency.

  3. The ultraviolet spectra of the Jovian aurora

    Energy Technology Data Exchange (ETDEWEB)

    Liu, W.; Dalgarno, A. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, Massachusetts 02138 (United States)

    1996-08-01

    The ultraviolet spectra of molecular hydrogen H{sub 2} due to electron impact excitation are calculated and compared with the high-resolution (0.56 A) spectra of the Jovian aurora obtained with the {ital Hubble} {ital Space} {ital Telescope} Goddard High-Resolution Spectrograph. All the observed features are reproduced by electron impact excitation emissions of H{sub 2}, and the predicted intensities agree well with the observed intensities. Accurate molecular parameters are used, and effects of secondary electrons are included. The auroral emissions are reproduced by energetic electron impact excitation of H{sub 2} with a temperature of 400{endash}600 K. Large temperature gradients occur with respect to altitude within the auroral emission regions. The auroral spectra contain a cascade contribution to the Lyman band emission from high-lying {ital E} and {ital F} states that are populated by the low-energy secondary electrons produced as the energetic auroral electrons slow down. {copyright} {ital 1996 The American Astronomical Society.}

  4. Dancing Lights: Creating the Aurora Story

    Science.gov (United States)

    Wood, E. L.; Cobabe-Ammann, E. A.

    2009-12-01

    Science tells a story about our world, our existence, our history, and the larger environment our planet occupies. Bearing this in mind, we created a series of lessons for 3rd-5th grades using a cross-disciplinary approach to teaching about the aurora by incorporating stories, photos, movies, and geography into the science in order to paint a broad picture and answer the question, “why do we care?” The fundamental backbone of the program is literacy. Students write and illustrate fiction and non-fiction work, poetry, and brochures that solidify both language arts skills and science content. In a time when elementary teachers relegate science to less than one hour per week, we have developed a novel science program that can be easily integrated with other topics during the typical school day to increase the amount of science taught in a school year. We are inspiring students to take an interest in the natural world with this program, a stepping-stone for larger things.

  5. Aurora Kinase A deficiency during skin development impairs cell division and stratification

    Science.gov (United States)

    Torchia, Enrique C.; Zhang, Lei; Huebner, Aaron J.; Sen, Subrata; Roop, Dennis R.

    2012-01-01

    Aurora Kinase-A (Aurora-A) promotes timely entry into mitosis, centrosome maturation, and formation of bipolar spindles. To address the role of Aurora-A in skin development and homeostasis, we interbred a floxed Aurora-A (Aurora-Afl) mouse with the Cre-deleter strain, K14.Cre. Aurora-Afl/fl;Krt14.Cre (Aurora-A−/−) mice died shortly after birth. These mice had translucent skin, and histological evaluation showed that the dorsal skin was very thin and fragile with frank erosions. Although the expression of the basal layer marker Krt14 and the differentiation marker Krt1 was evident in Aurora-A−/− epidermis, there was a marked reduction in the number of suprabasal layers and basal keratinocytes. Dye exclusion assays also showed defects in barrier function. Unlike WT cells, Aurora-A−/− basal progenitors were delayed in forming two layers at E13.5 when embryonic skin begins to stratify. Increased numbers of mitotic cells, apoptotic bodies, and polyploid keratinocytes were evident in Aurora-A−/− epidermis, indicating that a deficiency in Aurora-A promotes aberrant mitosis, mitotic slippage and cell death. Lastly, Aurora-A−/− keratinocytes displayed centrosomal abnormalities that included centrosomes located at non-apical sites in basal cells. Thus, the deletion of Aurora-A in the developing epidermis alters centrosome function of basal keratinocytes and markedly impairs their ability to divide and stratify. PMID:22832491

  6. Aurora kinase-A deficiency during skin development impairs cell division and stratification.

    Science.gov (United States)

    Torchia, Enrique C; Zhang, Lei; Huebner, Aaron J; Sen, Subrata; Roop, Dennis R

    2013-01-01

    Aurora kinase-A (Aurora-A) promotes timely entry into mitosis, centrosome maturation, and formation of bipolar spindles. To address the role of Aurora-A in skin development and homeostasis, we interbred a floxed Aurora-A (Aurora-A(fl)) mouse with the Cre-deleter strain, K14.Cre. Aurora-A(fl/fl);Krt14.Cre (Aurora-A(-/-)) mice died shortly after birth. These mice had translucent skin, and histological evaluation showed that the dorsal skin was very thin and fragile with frank erosions. Although the expression of the basal layer marker keratin 14 and the differentiation marker keratin 1 was evident in Aurora-A(-/-) epidermis, there was a marked reduction in the number of suprabasal layers and basal keratinocytes. Dye exclusion assays also showed defects in barrier function. Unlike wild-type cells, Aurora-A(-/-) basal progenitors were delayed in forming two layers at embryonic day (E)13.5 when embryonic skin begins to stratify. Increased numbers of mitotic cells, apoptotic bodies, and polyploid keratinocytes were evident in Aurora-A(-/-) epidermis, indicating that a deficiency in Aurora-A promotes aberrant mitosis, mitotic slippage, and cell death. Finally, Aurora-A(-/-) keratinocytes displayed centrosomal abnormalities that included centrosomes located at nonapical sites in basal cells. Thus, the deletion of Aurora-A in the developing epidermis alters centrosome function of basal keratinocytes and markedly impairs their ability to divide and stratify.

  7. Aurora Borealis, A Painting by Frederic Edwin Church

    Science.gov (United States)

    Love, J. J.

    2015-12-01

    This year marks the sesquicentennial anniversary of the end of the American Civil War. In 1865, the same year as the War's end, the great American landscape artist, Frederic Edwin Church, unveiled Aurora Borealis, a painting that depicts a fantastic, far-northern place, an auroral arch stretched across a quiet night-time sky, above dark mountains and a frozen sea. Church was born in Connecticut, lived in New York, and traveled to Labrador; he would have often seen the northern lights. Church might have also been influenced by the spectacular displays of aurora that were caused by some unusually intense magnetic storms in 1859. Aurora Borealis can certainly be interpreted in terms of 19th-century romanticism, scientific philosophy, and Arctic missions of exploration, all subjects of interest to Church. As with so many of his paintings, Church's meticulous attention to detail in Aurora Borealis reveals his deep admiration of nature. But his depiction of auroral light is a curious and possibly intentional departure from natural verisimilitude. Some art historians have suggested that Church painted Aurora Borealis as a subdued tribute to the end of the Civil War, with the drapery of auroral light forming an abstract representation of the American flag. If so, then colors of the flag have been unfurled across a cold and barren landscape, not in extravagant celebration, but in somber recognition of the reality of post-war desolation and an uncertain future.

  8. Making Sense of the Aurora: A Research Project

    Directory of Open Access Journals (Sweden)

    Robert Marc Friedman

    2012-05-01

    Full Text Available The article provides an introduction to a on-going research project based at University of Tromsø that seeks to analyze the history of efforts to make sense of the aurora borealis from the early 1700s through to the Cold War. Following brilliant displays of the northern lights in the early eighteenth century, natural philosophers strove to explain this phenomenon that evoked widespread fear and superstition. It was not until well into the twentieth century that consensual explanation emerged for this, one of the great enigmas in the history of science. From the start, the quest to explain the aurora borealis became enmeshed with patriotic science and nationalist sentiments. The history of efforts to understand the nature and cause of the aurora poses a number of thematic problems. Being a fleeting and at times rapidly changing phenomenon, only occasionally seen south of far-northern latitudes, the aurora needed to be constituted as an object able to be brought into the domain of rational science. Observational accounts of the aurora came most often from by personsliving or travelling in the far north or in the Arctic, but these persons were generally not trained scientists: Whose witnessing counted and how was authority negotiated among professional scientists and amateurs?

  9. Aurora B interaction of centrosomal Nlp regulates cytokinesis.

    Science.gov (United States)

    Yan, Jie; Jin, Shunqian; Li, Jia; Zhan, Qimin

    2010-12-17

    Cytokinesis is a fundamental cellular process, which ensures equal abscission and fosters diploid progenies. Aberrant cytokinesis may result in genomic instability and cell transformation. However, the underlying regulatory machinery of cytokinesis is largely undefined. Here, we demonstrate that Nlp (Ninein-like protein), a recently identified BRCA1-associated centrosomal protein that is required for centrosomes maturation at interphase and spindle formation in mitosis, also contributes to the accomplishment of cytokinesis. Through immunofluorescent analysis, Nlp is found to localize at midbody during cytokinesis. Depletion of endogenous Nlp triggers aborted division and subsequently leads to multinucleated phenotypes. Nlp can be recruited by Aurora B to the midbody apparatus via their physical association at the late stage of mitosis. Disruption of their interaction induces aborted cytokinesis. Importantly, Nlp is characterized as a novel substrate of Aurora B and can be phosphorylated by Aurora B. The specific phosphorylation sites are mapped at Ser-185, Ser-448, and Ser-585. The phosphorylation at Ser-448 and Ser-585 is likely required for Nlp association with Aurora B and localization at midbody. Meanwhile, the phosphorylation at Ser-185 is vital to Nlp protein stability. Disruptions of these phosphorylation sites abolish cytokinesis and lead to chromosomal instability. Collectively, these observations demonstrate that regulation of Nlp by Aurora B is critical for the completion of cytokinesis, providing novel insights into understanding the machinery of cell cycle progression.

  10. Aurora B Interaction of Centrosomal Nlp Regulates Cytokinesis*

    Science.gov (United States)

    Yan, Jie; Jin, Shunqian; Li, Jia; Zhan, Qimin

    2010-01-01

    Cytokinesis is a fundamental cellular process, which ensures equal abscission and fosters diploid progenies. Aberrant cytokinesis may result in genomic instability and cell transformation. However, the underlying regulatory machinery of cytokinesis is largely undefined. Here, we demonstrate that Nlp (Ninein-like protein), a recently identified BRCA1-associated centrosomal protein that is required for centrosomes maturation at interphase and spindle formation in mitosis, also contributes to the accomplishment of cytokinesis. Through immunofluorescent analysis, Nlp is found to localize at midbody during cytokinesis. Depletion of endogenous Nlp triggers aborted division and subsequently leads to multinucleated phenotypes. Nlp can be recruited by Aurora B to the midbody apparatus via their physical association at the late stage of mitosis. Disruption of their interaction induces aborted cytokinesis. Importantly, Nlp is characterized as a novel substrate of Aurora B and can be phosphorylated by Aurora B. The specific phosphorylation sites are mapped at Ser-185, Ser-448, and Ser-585. The phosphorylation at Ser-448 and Ser-585 is likely required for Nlp association with Aurora B and localization at midbody. Meanwhile, the phosphorylation at Ser-185 is vital to Nlp protein stability. Disruptions of these phosphorylation sites abolish cytokinesis and lead to chromosomal instability. Collectively, these observations demonstrate that regulation of Nlp by Aurora B is critical for the completion of cytokinesis, providing novel insights into understanding the machinery of cell cycle progression. PMID:20864540

  11. Skp2 is required for Aurora B activation in cell mitosis and spindle checkpoint.

    Science.gov (United States)

    Wu, Juan; Huang, Yu-Fan; Zhou, Xin-Ke; Zhang, Wei; Lian, Yi-Fan; Lv, Xiao-Bin; Gao, Xiu-Rong; Lin, Hui-Kuan; Zeng, Yi-Xin; Huang, Jian-Qing

    2015-01-01

    The Aurora B kinase plays a critical role in cell mitosis and spindle checkpoint. Here, we showed that the ubiquitin E3-ligase protein Skp2, also as a cell-cycle regulatory protein, was required for the activation of Aurora B and its downstream protein. When we restored Skp2 knockdown Hela cells with Skp2 and Skp2-LRR E3 ligase dead mutant we found that Skp2 could rescue the defect in the activation of Aurora B, but the mutant failed to do so. Furthermore, we discovered that Skp2 could interact with Aurora B and trigger Aurora B Lysine (K) 63-linked ubiquitination. Finally, we demonstrated the essential role of Skp2 in cell mitosis progression and spindle checkpoint, which was Aurora B dependent. Our results identified a novel ubiquitinated substrate of Skp2, and also indicated that Aurora B ubiquitination might serve as an important event for Aurora B activation in cell mitosis and spindle checkpoint.

  12. Letter to the Editor: Complete maps of the aspect sensitivity of VHF atmospheric radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    1999-08-01

    Full Text Available Using the MU radar at Shigaraki, Japan (34.85°N, 136.10°E, we measure the power distribution pattern of VHF radar echoes from the mid-troposphere. The large number of radar beam-pointing directions (320 allows the mapping of echo power from 0° to 40° from zenith, and also the dependence on azimuth, which has not been achieved before at VHF wavelengths. The results show how vertical shear of the horizontal wind is associated with a definite skewing of the VHF echo power distribution, for beam angles as far as 30° or more from zenith, so that aspect sensitivity cannot be assumed negligible at any beam-pointing angle that most existing VHF radars are able to use. Consequently, the use of VHF echo power to calculate intensity of atmospheric turbulence, which assumes only isotropic backscatter at large beam zenith angles, will sometimes not be valid.Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; turbulence; instruments and techniques

  13. Design and Development of VHF Antennas for Space Borne Signal of Opportunity Receivers for Cubesat Platforms

    Science.gov (United States)

    Deshpande, Manohar; Piepmeier, Jeffrey

    2015-01-01

    Design and Development of VHF Antennas for Space Borne Signal of Opportunity Receivers for Cubesat Platforms. Space borne microwave remote sensors at VHF/UHF frequencies are important instruments to observe reflective properties of land surfaces through thick and heavy forestation on a global scale. One of the most cost effective ways of measuring land reflectivity at VHF/UHF frequencies is to use signals transmitted by existing communication satellites (operating at VHF/UHF band) as a signal of opportunity (SoOp) signal and passive receivers integrated with airborne/space borne platforms operating in the Low Earth Orbit (LEO). One of the critical components of the passive receiver is two antennas (one to receive only direct signal and other to receive only reflected signal) which need to have ideally high (>30dB) isolation. However, because of small size of host platforms and broad beam width of dipole antennas, achieving adequate isolation between two channels is a challenging problem and need to be solved for successful implementation of space borne SoOp technology for remote sensing. In this presentation a novel enabling VHF antenna technology for Cubesat platforms is presented to receive direct as well as reflected signal with needed isolation. The novel scheme also allows enhancing the gain of individual channels by factor of 2 without use of reflecting ground plane

  14. A Cell Biologist’s Field Guide to Aurora Kinase Inhibitors

    Directory of Open Access Journals (Sweden)

    Christian eDe Groot

    2015-12-01

    Full Text Available Aurora kinases are essential for cell division and are frequently misregulated in human cancers. Based on their potential as cancer therapeutics, a plethora of small molecule Aurora kinase inhibitors have been developed, with a subset having been adopted as tools in cell biology. Here, we fill a gap in the characterization of Aurora kinase inhibitors by using biochemical and cell-based assays to systematically profile a panel of 10 commercially available compounds with reported selectivity for Aurora A (MLN8054, MLN8237, MK-5108, MK-8745, Genentech Aurora Inhibitor 1, Aurora B (Hesperadin, ZM447439, AZD1152-HQPA, GSK1070916 or Aurora A/B (VX-680. We quantify the in vitro effect of each inhibitor on the activity of Aurora A alone, as well as Aurora A and Aurora B bound to fragments of their activators, TPX2 and INCENP, respectively. We also report kinome profiling results for a subset of these compounds to highlight potential off-target effects. In a cellular context, we demonstrate that immunofluorescence-based detection of LATS2 and histone H3 phospho-epitopes provides a facile and reliable means to assess potency and specificity of Aurora A versus Aurora B inhibition, and that G2 duration measured in a live imaging assay is a specific readout of Aurora A activity. Our analysis also highlights variation between HeLa, U2OS and hTERT-RPE1 cells that impacts selective Aurora A inhibition. For Aurora B, all 4 tested compounds exhibit excellent selectivity and do not significantly inhibit Aurora A at effective doses. For Aurora A, MK-5108 and MK-8745 are significantly more selective than the commonly used inhibitors MLN8054 and MLN8237. A crystal structure of an Aurora A/MK-5108 complex that we determined suggests the chemical basis for this higher specificity. Taken together, our quantitative biochemical and cell-based analyses indicate that AZD1152-HQPA and MK-8745 are the best current tools for selectively inhibiting Aurora B and Aurora A

  15. Optical tomography of the aurora and EISCAT

    Directory of Open Access Journals (Sweden)

    H. U. Frey

    Full Text Available Tomographic reconstruction of the three-dimensional auroral arc emission is used to obtain vertical and horizontal distributions of the optical auroral emission. Under the given experimental conditions with a very limited angular range and a small number of observers, algebraic reconstruction methods generally yield better results than transform techniques. Different algebraic reconstruction methods are tested with an auroral arc model and the best results are obtained with an iterative least-square method adapted from emission-computed tomography. The observation geometry used during a campaign in Norway in 1995 is tested with the arc model and root-mean-square errors, to be expected under the given geometrical conditions, are calculated. Although optimum geometry was not used, root-mean-square errors of less than 2% for the images and of the order of 30% for the distribution could be obtained. The method is applied to images from real observations. The correspondence of original pictures and projections of the reconstructed volume is discussed, and emission profiles along magnetic field lines through the three-dimensionally reconstructed arc are calibrated into electron density profiles with additional EISCAT measurements. Including a background profile and the temporal changes of the electron density due to recombination, good agreement can be obtained between measured profiles and the time-sequence of calculated profiles. These profiles are used to estimate the conductivity distribution in the vicinity of the EISCAT site. While the radar can only probe the ionosphere along the radar beam, the three-dimensional tomography enables conductivity estimates in a large area around the radar site.

    Key words. Tomography · Aurora · EISCAT · Ionosphere · Conductivity

  16. VHF/UHF/microwave LOS terrestrial propagation and system design

    Science.gov (United States)

    Fitzsimons, T. K.

    1986-10-01

    The telecommunication frequency range under discussion is from 30 MHz up to tens of GHz. For military communications this means the use of systems such as Combat Net Radio, Single-Channel Radio Access, Tactical and Fixed Radio Relay, Air-Ground-Air Systems, Common User Information Systems and Tactical Satellite. For civil communications the systems are not dissimilar - mobile radio, fixed radio relay systems, Air Traffic Control, etc. Of course there is a considerable amount of broadcasting and there are military and civil radar systems in these frequency bands. The spectrum range from 30 MHz to about 5 GHz is for the military in particular, prime spectrum; wide bandwidths (hence digital transmission) can be achieved, most propagation mechanisms are relatively stable and most of this part of the spectrum can be used by tactical systems either operating on the move or moving frequently to new sites. In addition to considerations of wanted performance and necessary characteristics such as ECM, the military systems are designed to meet requirements for rapid deployment in an environment which is difficult and unpredictable from the electromagnetic environment, topographic, and meteorological aspects.

  17. Fluorescent photoaffinity probes for mitotic protein kinase Aurora A.

    Science.gov (United States)

    Lavogina, Darja; Kisand, Katariina; Raidaru, Gerda; Uri, Asko

    2015-08-15

    We combined the advantages of the selective inhibitor VX689, the bisubstrate-analogue conjugate approach, and photoreactive amino acids to develop 8 photoaffinity probes for Aurora A. The most efficient compounds possessed one-digit nanomolar KD values in the equilibrium binding assay, inhibited Aurora A at elevated concentrations of ATP in the phosphorylation assay in the presence of TPX2, and formed covalent complexes with the recombinant kinase or Aurora A in HeLa cells upon UV-irradiation. The recognition of the correct target by the probes during formation of the covalent complex in the biochemical assay and in situ was demonstrated by competition experiments using the non-labelled inhibitors VX689 and MLN8237. Copyright © 2015 Elsevier Ltd. All rights reserved.

  18. Aurora kinase inhibitor patents and agents in clinical testing: an update (2011 - 2013).

    Science.gov (United States)

    Cheung, Chun Hei Antonio; Sarvagalla, Sailu; Lee, Jane Ying-Chieh; Huang, Yi-Chun; Coumar, Mohane Selvaraj

    2014-09-01

    Aurora kinase A, B and C, members of serine/threonine kinase family, are key regulators of mitosis. As Aurora kinases are overexpressed in many of the human cancers, small-molecule inhibitors of Aurora kinase have emerged as a possible treatment option for cancer. In 2009 and 2011, the literature pertaining to Aurora kinase inhibitors and their patents was reviewed. Here, the aim is to update the information for Aurora kinase inhibitors in clinical trials and the patents filed between the years 2011 and 2013. Pubmed, Scopus®, Scifinder®, USPTO, EPO and www.clinicaltrials.gov databases were used for searching the literature and patents for Aurora kinase inhibitors. Even though both Aurora sub-type selective as well as pan-selective inhibitors show preclinical and clinical efficacy, so far no Aurora kinase inhibitor has been approved for clinical use. Particularly, dose-limiting toxicity (neutropenia) is a key issue that needs to be addressed. Preliminary evidence suggests that the use of selective Aurora A inhibitors could avoid Aurora B-mediated neutropenia in clinical settings. Also, use of adjunctive agents such as granulocyte stimulating factor to overcome neutropenia associated with Aurora B inhibition could be an answer to overcome the toxicity and bring Aurora inhibitors to market in the future.

  19. New Predictions of the Jovian Aurora: Location, Latitudinal Width, and Intensity

    Science.gov (United States)

    Tsurutani, B. T.; Arballo, J. K.; Ho, C. M.; Lin, N. G.; Kellogg, P. J.; Cornileau-Wehrlin, N.; Krupp, N.

    1995-01-01

    A model/theory for the Jovian aurora is formed based on a similar model for the dayside aurora at Earth and recent Ulysses field and particle measurements at Jupiter. Items discussed are plasma boundary layer, wave-particle resonant interactions, and the model's prediction of the aurora's location, latitudinal width, and intensity.

  20. PENUMBUHAN LAPISAN TIPIS SILIKON MIKROKRISTAL TERHIDROGENASI DENGAN TEKNIK HWC-VHF-PECVD

    Directory of Open Access Journals (Sweden)

    Ida Usman

    2012-02-01

    Full Text Available Telah dikembangkan teknik HWC-VHF-PECVD (Hot Wire Cell Very High Frequency Plasma Enhanced Chemical Vapor Deposition untuk menumbuhkan lapisan tipis silikon mikrokristal terhidrogenasi (mc-Si:H. Dari hasil penumbuhan lapisan tipis yang dilakukan, teknik HWC-VHF-PECVD memperlihatkan laju deposisi yang lebih tinggi dibandingkan laju deposisi lapisan tipis yang diperoleh dari teknik PECVD maupun teknik VHF-PECVD konvensional. Berdasarkan hasil pengukuran XRD dan SEM, lapisan yang diperoleh pada temperatur filamen yang rendah masih berstruktur amorf. Indikasi yang mengarah pada pembentukan lapisan tipis berstruktur mikrokristalin mulai terlihat pada temperatur filamen ≥ 500oC, dimana puncak-puncak di fraksi spektrum XRD untuk orientasi kristalin tertentu mulai terbentu, sejalan dengan pembentukan butiran-butiran kristalin dari hasil foto SEM permukaan lapisan-lapisan tersebut.

  1. Radio pill antenna range test

    Science.gov (United States)

    Cummins, W. F.; Kane, R. J.

    1992-05-01

    In order to investigate the potential of a proposed 'radio pill' beacon transmitter, a range test experiment was devised and carried out in the VHF frequency range. Calculations and previous work indicated that optimum sensitivity and, thus, distance would be obtained in this frequency range provided body radio-frequency (RF) absorption was not too great. A ferrite-core loop antenna is compatible with a pill geometry and has better radiation efficiency than an air core loop. The ferrite core may be a hollow cylinder with the electronics and batteries placed inside. However, this range test was only concerned with experimentally developing test range data on the ferrite core antenna itself. A one turn strap loop was placed around a 9.5 mm diameter by 18.3 mm long stack of ferrite cores. This was coupled to a 50 Omega transmission line by 76 mm of twisted pair line and a capacitive matching section. This assembly was excited by a signal generator at output levels of -10 to +10 dBm. Signals were received on a VHF receiver and tape recorder coupled to a 14 element, circularly polarized Yagi antenna at a height of 2.5 m. Field strength measurements taken at ranges of 440, 1100, and 1714 m. Maximum field strengths referenced to 0 dBm transmitter level were -107 to -110 dB at 440 m, -124 to -127 dBm at 1100 m, and -116 to -119 dBm at 1714 m when the antenna cylinder was horizontal. Field strengths with a vertical antenna were about 6 dB below these values. The latter transmit site was elevated and had a clear line-of-site path to the receiving site. The performance of this test antenna was better than that expected from method-of-moment field calculations. When this performance data is scaled to a narrow bandwidth receiving system, ground level receiving ranges of a few to 10 km can be expected. Clear line-of-sight ranges where either or both the transmitter and receiver are elevated could vary from several km to 100 km.

  2. Navigation GPS/GLONASS in the Arctic and aurora

    Directory of Open Access Journals (Sweden)

    Chernouss S. A.

    2016-12-01

    Full Text Available The correspondence of the time-spatial distribution of the radiances of the aurora oval and time-spatial changes in the parameters of the navigation satellites' signal has been shown. For this aim the experimental data on the regional and local heterogeneities of the Total Electron Content (or TEC and the data on the signal delays in the polar ionosphere have been analyzed. Using the data concerning aurora as the indicator of disturbances in the work of the GPS/GLONASS systems can give the opportunity to increase considerably the accuracy of positioning in the Arctic with the help of satellite navigation systems (SNS.

  3. Geomagnetic activity control on VHF scintillations over an Indian low ...

    Indian Academy of Sciences (India)

    The satellite radio beacon measurements because of their better time resolution, relative accuracy and potential for data continuity became a valuable and effective technique for the study of geomag- netic disturbances such as storms on ionospheric electron density and irregularities. During these events ionosphere shows ...

  4. Polarization of Hazes and Aurorae on Jupiter

    Science.gov (United States)

    Yanamandra-Fisher, Padma A.; McLean, Will; PACA_Jupiter

    2017-10-01

    Our solar system planets show a large variety of atmospheric polarization properties, from the thick, highly polarizing haze on Titan and the poles of Jupiter, Rayleigh scattering by molecules on Uranus and Neptune, to clouds in the equatorial region of Jupiter or on Venus. Changes in the clouds/thermal filed can be brought about by endogenic dynamical processes such merger of vortices; global, planetary scale upheavals, and external factors such as celestial collisions (such as D/Shoemaker-Levy 9 impact with Jupiter in 1994, etc.). Although the range of phase angles available from Earth for outer planets is restricted to a narrow range, limb polarization measurements provide constraints on the polarimetric properties. For example, at the equator, much of the observed reflected radiation is due to the presence of clouds and therefore, low polarization. Polar asymmetry exists between the two poles, while the planetary disk is unpolarized. Jupiter is known to exhibit a strong polar limb polarization and a low equatorial limb polarization due to the presence of haze particles and Rayleigh scattering at the poles. In contrast, at the equator, the concentration of particulates in the high atmosphere might change, changing the polarimetric signature and aurorae at both poles. The polarimetric maps, in conjunction with thermal maps and albedo maps, can provide constraints on modeling efforts to understand the nature of the aerosols/hazes in Jovian atmosphere. With Jupiter experiencing morphological changes at many latitudes, we have initiated a polarimetric observing campaign of Jupiter, in conjunction with The PACA Project. With NASA/Juno mission in a 53-day orbit around Jupiter, and recent outbreaks in the atmosphere, changes in the polarimetric signature will provide insight to the changes occurring in the atmosphere. Some of our observations are acquired by a team of professional/amateur planetary imagers astronomers based in the U.K., Australia and Europe. France

  5. BOOK REVIEW: Electron acceleration in the aurora and beyond

    Science.gov (United States)

    McClements, K. G.

    1999-08-01

    measurements of flare accelerated electrons at the Earth's orbit, despite acknowledging that uncertainties in propagation effects make it very difficult to reconstruct conditions at the Sun from such measurements. Similar remarks apply to the final chapter, on acceleration of cosmic ray electrons. Again, attention is focused almost exclusively on measurements of particles rather than the radiation signature of those particles, in this case synchrotron radiation by ultrarelativistic electrons. No mention is made of radio and X ray data, indicating that electrons with energies of up to around 1014eV are being accelerated at shocks associated with shell type supernova remnants. Interestingly, resonant acceleration of electrons by lower hybrid waves has been invoked by A.A. Galeev [Sov. Phys.-JETP 59 (1984) 965] as a mechanism for the production of cosmic ray electrons: although Galeev's paper is not cited in this book, the process he describes is very similar to that proposed by Dr Bryant for electron acceleration in the aurora and other near Earth plasma environments. The book contains a number of physics errors. For example, on page 17 the time derivative of a magnetic field is equated to an induced electric field, rather than the curl of one. On page 21, the author invokes Larmor's formula for the power radiated by a non-relativistic charged particle, and then combines it with the relativistic relation between acceleration and energy to estimate the maximum acceleration rate. The book has also been badly proofread. For example, Figure 1.15 appears twice: where it is first used, on page 8, it is clear that the accompanying caption and text refer to a different figure. I found several errors in the reference list (one of my own publications is cited as two separate papers, with both citations containing inaccuracies). Having said that, the reference list is impressively comprehensive and eclectic. It includes, for example, Swift's `Gulliver's Travels': a spacecraft in the

  6. Nutritive potentials and utilization of garden snail (Limicolaria aurora ...

    African Journals Online (AJOL)

    The possibility of using garden snail (Limicolaria aurora) meat meal as a protein source in fish feeds was tested in Clarias gariepinus fingerlings. Five isonitrogenous (43% crude protein) diets in which garden snail meat meal was used to replace fish meal at 0%, (control diet), 25, 50, 75 and 100% inclusion levels were used ...

  7. Nutritive potentials and utilization of garden snail (Limicolaria aurora ...

    African Journals Online (AJOL)

    AJB SERVER

    2006-10-16

    Oct 16, 2006 ... The possibility of using garden snail (Limicolaria aurora) meat meal as a protein source in fish feeds was tested in ... garden snail meat meal was used to replace fish meal at 0%, (control diet), 25, 50, 75 and 100% inclusion levels ..... in a diet could provide the essential amino acid requirement of the fish ...

  8. Genetic diversity in two populations of Limicolaria aurora (Jay, 1839 ...

    African Journals Online (AJOL)

    This study seeks to use shell morphology and random amplified polymorphic DNA-polymerase chain reaction (RAPDPCR) to examine gross morphological differences in populations of L. aurora from New Bussa (guinea savannah) and Benin City (tropical rain forest) in Nigeria and possibly delimit the populations into sub ...

  9. Transient aurora on Jupiter from injections of magnetospheric electrons.

    Science.gov (United States)

    Mauk, B H; Clarke, J T; Grodent, D; Waite, J H; Paranicas, C P; Williams, D J

    2002-02-28

    Energetic electrons and ions that are trapped in Earth's magnetosphere can suddenly be accelerated towards the planet. Some dynamic features of Earth's aurora (the northern and southern lights) are created by the fraction of these injected particles that travels along magnetic field lines and hits the upper atmosphere. Jupiter's aurora appears similar to Earth's in some respects; both appear as large ovals circling the poles and both show transient events. But the magnetospheres of Jupiter and Earth are so different---particularly in the way they are powered---that it is not known whether the magnetospheric drivers of Earth's aurora also cause them on Jupiter. Here we show a direct relationship between Earth-like injections of electrons in Jupiter's magnetosphere and a transient auroral feature in Jupiter's polar region. This relationship is remarkably similar to what happens at Earth, and therefore suggests that despite the large differences between planetary magnetospheres, some processes that generate aurorae are the same throughout the Solar System.

  10. Canine osteosarcoma cells exhibit resistance to aurora kinase inhibitors.

    Science.gov (United States)

    Cannon, C M; Pozniak, J; Scott, M C; Ito, D; Gorden, B H; Graef, A J; Modiano, J F

    2015-03-01

    We evaluated the effect of Aurora kinase inhibitors AZD1152 and VX680 on canine osteosarcoma cells. Cytotoxicity was seen in all four cell lines; however, half-maximal inhibitory concentrations were significantly higher than in human leukaemia and canine lymphoma cells. AZD1152 reduced Aurora kinase B phosphorylation, indicating resistance was not because of failure of target recognition. Efflux mediated by ABCB1 and ABCG2 transporters is one known mechanism of resistance against these drugs and verapamil enhanced AZD1152-induced apoptosis; however, these transporters were only expressed by a small percentage of cells in each line and the effects of verapamil were modest, suggesting other mechanisms contribute to resistance. Our results indicate that canine osteosarcoma cells are resistant to Aurora kinase inhibitors and suggest that these compounds are unlikely to be useful as single agents for this disease. Further investigation of these resistance mechanisms and the potential utility of Aurora kinase inhibitors in multi-agent protocols is warranted. © 2013 Blackwell Publishing Ltd.

  11. Discrete and broadband electron acceleration in Jupiter's powerful aurora.

    Science.gov (United States)

    Mauk, B H; Haggerty, D K; Paranicas, C; Clark, G; Kollmann, P; Rymer, A M; Bolton, S J; Levin, S M; Adriani, A; Allegrini, F; Bagenal, F; Bonfond, B; Connerney, J E P; Gladstone, G R; Kurth, W S; McComas, D J; Valek, P

    2017-09-06

    The most intense auroral emissions from Earth's polar regions, called discrete for their sharply defined spatial configurations, are generated by a process involving coherent acceleration of electrons by slowly evolving, powerful electric fields directed along the magnetic field lines that connect Earth's space environment to its polar regions. In contrast, Earth's less intense auroras are generally caused by wave scattering of magnetically trapped populations of hot electrons (in the case of diffuse aurora) or by the turbulent or stochastic downward acceleration of electrons along magnetic field lines by waves during transitory periods (in the case of broadband or Alfvénic aurora). Jupiter's relatively steady main aurora has a power density that is so much larger than Earth's that it has been taken for granted that it must be generated primarily by the discrete auroral process. However, preliminary in situ measurements of Jupiter's auroral regions yielded no evidence of such a process. Here we report observations of distinct, high-energy, downward, discrete electron acceleration in Jupiter's auroral polar regions. We also infer upward magnetic-field-aligned electric potentials of up to 400 kiloelectronvolts, an order of magnitude larger than the largest potentials observed at Earth. Despite the magnitude of these upward electric potentials and the expectations from observations at Earth, the downward energy flux from discrete acceleration is less at Jupiter than that caused by broadband or stochastic processes, with broadband and stochastic characteristics that are substantially different from those at Earth.

  12. Discrete and broadband electron acceleration in Jupiter's powerful aurora

    Science.gov (United States)

    Mauk, B. H.; Haggerty, D. K.; Paranicas, C.; Clark, G.; Kollmann, P.; Rymer, A. M.; Bolton, S. J.; Levin, S. M.; Adriani, A.; Allegrini, F.; Bagenal, F.; Bonfond, B.; Connerney, J. E. P.; Gladstone, G. R.; Kurth, W. S.; McComas, D. J.; Valek, P.

    2017-09-01

    The most intense auroral emissions from Earth's polar regions, called discrete for their sharply defined spatial configurations, are generated by a process involving coherent acceleration of electrons by slowly evolving, powerful electric fields directed along the magnetic field lines that connect Earth's space environment to its polar regions. In contrast, Earth's less intense auroras are generally caused by wave scattering of magnetically trapped populations of hot electrons (in the case of diffuse aurora) or by the turbulent or stochastic downward acceleration of electrons along magnetic field lines by waves during transitory periods (in the case of broadband or Alfvénic aurora). Jupiter's relatively steady main aurora has a power density that is so much larger than Earth's that it has been taken for granted that it must be generated primarily by the discrete auroral process. However, preliminary in situ measurements of Jupiter's auroral regions yielded no evidence of such a process. Here we report observations of distinct, high-energy, downward, discrete electron acceleration in Jupiter's auroral polar regions. We also infer upward magnetic-field-aligned electric potentials of up to 400 kiloelectronvolts, an order of magnitude larger than the largest potentials observed at Earth. Despite the magnitude of these upward electric potentials and the expectations from observations at Earth, the downward energy flux from discrete acceleration is less at Jupiter than that caused by broadband or stochastic processes, with broadband and stochastic characteristics that are substantially different from those at Earth.

  13. A homologue of Drosophila aurora kinase is oncogenic and amplified in human colorectal cancers.

    Science.gov (United States)

    Bischoff, J R; Anderson, L; Zhu, Y; Mossie, K; Ng, L; Souza, B; Schryver, B; Flanagan, P; Clairvoyant, F; Ginther, C; Chan, C S; Novotny, M; Slamon, D J; Plowman, G D

    1998-06-01

    Genetic and biochemical studies in lower eukaryotes have identified several proteins that ensure accurate segregation of chromosomes. These include the Drosophila aurora and yeast Ipl1 kinases that are required for centrosome maturation and chromosome segregation. We have identified two human homologues of these genes, termed aurora1 and aurora2, that encode cell-cycle-regulated serine/threonine kinases. Here we demonstrate that the aurora2 gene maps to chromosome 20q13, a region amplified in a variety of human cancers, including a significant number of colorectal malignancies. We propose that aurora2 may be a target of this amplicon since its DNA is amplified and its RNA overexpressed, in more than 50% of primary colorectal cancers. Furthermore, overexpression of aurora2 transforms rodent fibroblasts. These observations implicate aurora2 as a potential oncogene in many colon, breast and other solid tumors, and identify centrosome-associated proteins as novel targets for cancer therapy.

  14. Combined EISCAT radar and optical multispectral and tomographic observations of black aurora

    Science.gov (United States)

    Gustavsson, B.; Kosch, M. J.; Senior, A.; Kavanagh, A. J.; BräNdströM, B. U. E.; Blixt, E. M.

    2008-06-01

    Black auroras are recognized as spatially well-defined regions within a uniform diffuse auroral background where the optical emission is significantly reduced. Black auroras typically appear post-magnetic midnight and during the substorm recovery phase, but not exclusively so. We report on the first combined multimonochromatic optical imaging, bistatic white-light TV recordings and incoherent scatter radar observations of black aurora by EISCAT of the phenomenon. From the relatively larger reduction in luminosity at 4278 Å than at 8446 Å we show that nonsheared black auroras are most probably not caused by downward directed electrical fields at low altitude. From the observations, we determine this by relating the height and intensity of the black aurora to precipitating particle energy within the surrounding background diffuse aurora. The observations are more consistent with an energy selective loss cone. Hence the mechanism causing black aurora is most probably active in the magnetosphere rather than close to Earth.

  15. Solar Radio

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Scientists monitor the structure of the solar corona, the outer most regions of the Sun's atmosphere, using radio waves (100?s of MHz to 10?s of GHz). Variations in...

  16. Design VHF Antennas for Space Borne Receivers for SmallSats

    Science.gov (United States)

    Deshpande, Manohar

    2017-01-01

    Space borne microwave remote sensors at VHF/UHF frequencies are important instruments to observe reflective properties of land surfaces through thick and heavy forestation on a global scale. One of the most cost effective ways of measuring land reflectivity at VHF/UHF frequencies is to use signals transmitted by existing communication satellites (operating at VHF/UHF band) as a signal of opportunity (SoOp) signal and passive receivers integrated with airborne/space borne platforms operating in the Low Earth Orbit (LEO). One of the critical components of the passive receiver is two antennas (one to receive only direct signal and other to receive only reflected signal) which need to have ideally high (>30dB) isolation. However, because of small size of host platforms and broad beam width of dipole antennas, achieving adequate isolation between two channels is a challenging problem and need to be solved for successful implementation of space borne SoOp technology for remote sensing. In this presentation a novel enabling VHF antenna technology for Cubesat platforms is presented to receive direct as well as reflected signal with needed isolation. The novel scheme also allows enhancing the gain of individual channels by factor of 2 without use of reflecting ground plane.

  17. A VHF Class E DC-DC Converter with Self-Oscillating Gate Driver

    DEFF Research Database (Denmark)

    Andersen, Toke Meyer; Christensen, Søren K.; Knott, Arnold

    2011-01-01

    This paper describes the analysis and design of a DC-DC converter topology which is operational at frequencies in the Very High Frequency (VHF) band ranging from 30 MHz − 300 MHz. The presented topology, which consists of a class E inverter, class E rectifier, and self-oscillating gate driver, is...

  18. First wind shear observation in PMSE with the tristatic EISCAT VHF radar

    Science.gov (United States)

    Mann, I.; Häggström, I.; Tjulin, A.; Rostami, S.; Anyairo, C. C.; Dalin, P.

    2016-11-01

    The Polar Summer Mesosphere has the lowest temperatures that occur in the entire Earth system. Water ice particles below the optically observable size range participate there in the formation of strong radar echoes (Polar Mesospheric Summer Echoes, PMSE). To study PMSE we carried out observations with the European Incoherent Scatter (EISCAT) VHF and EISCAT UHF radar simultaneously from a site near Tromsø (69.58°N, 19.2272°E) and observed VHF backscattering also with the EISCAT receivers in Kiruna (67.86°N, 20.44°E) and Sodankylä (67.36°N, 26.63°E). This is one of the first tristatic measurements with EISCAT VHF, and we therefore describe the observations and geometry in detail. We present observations made on 26 June 2013 from 7:00 to 13:00 h UT where we found similar PMSE patterns with all three VHF receivers and found signs of wind shear in PMSE. The observations suggest that the PMSE contains sublayers that move in different directions horizontally, and this points to Kelvin-Helmholtz instability possibly playing a role in PMSE formation. We find no signs of PMSE in the UHF data. The electron densities that we derive from observed incoherent scatter at UHF are at PMSE altitudes close to the noise level but possibly indicate reduced electron densities directly above the PMSE.

  19. An analysis on the mid-latitude scintillation and coherence frequency bandwidth using transionospheric VHF signals

    Energy Technology Data Exchange (ETDEWEB)

    Juang, Zhen [Los Alamos National Laboratory; Roussel-dupre, Robert [Los Alamos National Laboratory

    2008-01-01

    An analysis was perfonned on the mid-latitude scintillation and coherence frequency bandwidth (Fcoh) using transionospheric VHF signal data. The data include 1062 events spanning from November 1997 to June 2002. Each event records FORTE satellite received VHF signals from LAPP located at Los Alamos, New Mexico. Fcohs were derived to study scintillation characteristics on diurnal and seasonal variations, as well as changes due to solar and geomagnetic activities. Comparisons to the VHFIUHF coherence frequency bandwidth studies previously reported at equatorial and mid-latitude regions are made using a 4th power frequency dependence relationship. Furthennore, a wideband ionospheric scintillation model, WBMOD, was used to estimate Fcohs and compared with our VHF Fcoh values. Our analysis indicates mid-latitude scintillation characteristics that are not previously revealed. At the VHF bottom frequency range (3035 MHz), distinguished smaller Fcohs are found in time period from sunset to midnight, in wann season from May to August, and in low solar activity years. The effects of geomagnetic storm activity on Fcoh are characterized by a sudden transition at a Kp index of 50-60. Comparisons with median Fcohs estimated from other studies validated our VHF Fcohs for daytime while an order of magnitude larger Fcohs are found for nighttime, implying a time-dependent issue in applying the 4th order power relationship. Furthermore, comparisons with WBMOD-estimated Fcohs indicated generally matched median scintillation level estimates while differences do exist for those events undergoing high geomagnetic stonn activity which may imply underestimates of scintillation level by the WBMOD in the mid-latitude regions.

  20. Molecular Switching in Confined Spaces: Effects of Encapsulating the DHA/VHF Photo-Switch in Cucurbiturils

    DEFF Research Database (Denmark)

    Petersen, Michael Å.; Rasmussen, Brian; Andersen, Nicolaj N.

    2017-01-01

    complexes, the kinetics of the thermal VHF-to-DHA back-reaction is accelerated, while in CB8 inclusion complexes, the kinetics is slowed down as compared to the free photo-switch. The effect of the CB encapsulation of the photo-switch can be effectively canceled by introducing a guest that binds the CB more...... strongly. According to DFT calculations, a stabilization of the reactive s-cis VHF conformer relative to the s-trans VHF appears to be a contributing factor responsible for the accelerated back-reaction when encapsulated in CB7....

  1. Aurora-A interacts with AP-2α and down regulates its transcription activity.

    Directory of Open Access Journals (Sweden)

    Lihui Zou

    Full Text Available Aurora-A is a serine/threonine protein kinase and plays an important role in the control of mitotic progression. Dysregulated expression of Aurora-A impairs centrosome separation and maturation, which lead to disrupted cell cycle progression and tumorigenesis. However, the molecular mechanism by which Aurora-A causes cell malignant transformation remains to be further defined. In this report, using transcription factors array and mRNA expression profiling array, we found that overexpression of Aurora-A suppressed transcription activity of AP-2α, a tumor suppressor that is often downregulated in variety of tumors, and inhibited expression of AP-2α-regulated downstream genes. These array-based observations were further confirmed by microwell colorimetric TF assay and luciferase reporter assay. Downregulated transcription activity of AP-2α by Aurora-A was found to be associated with reduced AP-2α protein stability, which appeared to be mediated by Aurora-A enhanced ubiquitin-dependent proteasomal degradation of AP-2α protein. Interestingly, Aurora-A-mediated AP-2α degradation was likely dependent Aurora-A kinase activity since inhibition of Aurora-A kinase activity was able to rescue Aurora-A-induced degradation of AP-2α. Moreover, we defined a physical interaction between Aurora-A and AP-2α, and such interaction might bridge the suppressive effect of Aurora-A on AP-2α protein stability. These findings provide new insights into molecular mechanism by which Aurora-A acts as an oncogenic molecule in tumor occurrence and malignant development.

  2. VHF/UHF filters and multicouplers application of air resonators

    CERN Document Server

    Piette, Bernard

    2013-01-01

    This book describes the various devices used in radio communication and broadcasting to achieve high selectivity filtering and coupling. After providing a background in the basics of microwave theory and more detailed material - including a special chapter on precision and errors in measurement - the reader will find detailed descriptions, manufacturing processes, and, for the most useful instances, a number of worked-through formulas, which will allow engineers and technicians to design circuits or components for filtering or coupling applications. Content is covered in this format across a b

  3. Radio astronomy

    CERN Document Server

    Alder, Berni

    1975-01-01

    Methods in Computational Physics, Volume 14: Radio Astronomy is devoted to the role of the digital computer both as a control device and as a calculator in addressing problems related to galactic radio noise. This volume contains four chapters and begins with a technical description of the hardware and the special data-handling problems of using radioheliography, with an emphasis on a selection of observational results obtained with the Culgoora radioheliograph and their significance to solar physics and to astrophysics in general. The subsequent chapter examines interstellar dispersion, i

  4. Investigation into the Effects of VHF and UHF Band Radiation on Hewlett-Packard (HP) Cesium Beam Frequency Standards

    National Research Council Canada - National Science Library

    Dickens, Andrew

    1994-01-01

    This paper documents an investigation into reports which have indicated that exposure to VHF and UHF band radiation has adverse effects on the frequency stability of HP cesium beam frequency standards...

  5. Aurora-A regulates MCRS1 function during mitosis.

    Science.gov (United States)

    Meunier, Sylvain; Timón, Krystal; Vernos, Isabelle

    2016-07-02

    The mitotic spindle is made of microtubules (MTs) nucleated through different pathways involving the centrosomes, the chromosomes or the walls of pre-existing MTs. MCRS1 is a RanGTP target that specifically associates with the chromosome-driven MTs protecting them from MT depolymerases. MCRS1 is also needed for the control of kinetochore fiber (K-fiber) MT minus-ends dynamics in metaphase. Here, we investigated the regulation of MCRS1 activity in M-phase. We show that MCRS1 is phosphorylated by the Aurora-A kinase in mitosis on Ser35/36. Although this phosphorylation has no role on MCRS1 localization to chromosomal MTs and K-fiber minus-ends, we show that it regulates MCRS1 activity in mitosis. We conclude that Aurora-A activity is particularly important in the tuning of K-fiber minus-ends dynamics in mitosis.

  6. Physical interpretation of phase- and group-motion in auroras

    Science.gov (United States)

    Semeter, J. L.

    2015-12-01

    It is well established that fine-scale features in the aurora (motion than the mesoscale arcs (order 10-km) within which they are embedded. These scale-dependent distinctions may be conveniently captured and quantified through the formalism of phase- and group- motion from classical wave theory. But less clear is how such empirical propagation models should be connected to the underlying physics of energy release and dissipation in the magnetosphere. This paper seeks to connect multi-scale models of auroral motion to dynamic wave-particle interactions in the magnetotail and near-Earth auroral acceleration region (AAR). Our focus is on auroras associated with the established phases of the substorm cycle (growth, onset, expansion, recovery). A unifying construct is the 'backward wave' (oppositely directed phase- and group- motion), which is argued to be a natural consequence of magnetic reconnection and concomitant release of magnetic stress, applicable to both the magnetotail and the AAR domains.

  7. Aurora kinase A controls meiosis I progression in mouse oocytes

    Czech Academy of Sciences Publication Activity Database

    Šašková, Adéla; Šolc, Petr; Baran, V.; Kubelka, Michal; Schultz, R. M.; Motlík, Jan

    2008-01-01

    Roč. 7, č. 15 (2008), s. 2368-2376 ISSN 1538-4101 R&D Projects: GA ČR GA305/06/1413; GA ČR GD204/05/H023 Institutional research plan: CEZ:AV0Z50450515 Keywords : aurora-A * MTOC * CDK1 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.120, year: 2008 www.landesbioscience.com/journals/cc/article/6361

  8. Characteristics of north jovian aurora from STIS FUV spectral images

    OpenAIRE

    Gustin, J.; Grodent, D.; Ray, L. C.; Bonfond, B.; Bunce, E. J.; Nichols, J. D.; Ozak, N.

    2016-01-01

    We analyzed two observations obtained in Jan. 2013, consisting of spatial scans of the jovian north ultraviolet aurora with the HST Space Telescope Imaging Spectrograph (STIS) in the spectroscopic mode. The color ratio (CR) method, which relates the wavelength-dependent absorption of the FUV spectra to the mean energy of the precipitating electrons, allowed us to determine important characteristics of the entire auroral region. The results show that the spatial distribution of the precipitati...

  9. The CUL3-KLHL18 ligase regulates mitotic entry and ubiquitylates Aurora-A

    Directory of Open Access Journals (Sweden)

    Saili Moghe

    2012-02-01

    The cullin-RING family of ubiquitin ligases regulates diverse cellular functions, such as cell cycle control, via ubiquitylation of specific substrates. CUL3 targets its substrates through BTB proteins. Here we show that depletion of CUL3 and the BTB protein KLHL18 causes a delay in mitotic entry. Centrosomal activation of Aurora-A, a kinase whose activity is required for entry into mitosis, is also delayed in depleted cells. Moreover, we identify Aurora-A as a KLHL18-interacting partner. Overexpression of KLHL18 and CUL3 promotes Aurora-A ubiquitylation in vivo, and the CUL3-KLHL18-ROC1 ligase ubiquitylates Aurora-A in vitro. Our study reveals that the CUL3-KLHL18 ligase is required for timely entry into mitosis, as well as for the activation of Aurora-A at centrosomes. We propose that the CUL3-KLHL18 ligase regulates mitotic entry through an Aurora-A-dependent pathway.

  10. Aurorae. Firework in the sky. 2. upd. ed.; Polarlichter. Feuerwerk am Himmel

    Energy Technology Data Exchange (ETDEWEB)

    Pfoser, Andreas; Eklund, Tom

    2013-07-01

    Aurorae are fascinating phenomena. As aurora borealis and aurora australis occurring in the polar regions of both earth hemispheres, their incessant color and shape games put people in wonder. The meteorologist Andreas Pfoser explains the physical connections, which lead to the formation of this natural phenomenon. The link with the activity of the sun and the interaction in the earth atmosphere are explained detailedly and understandably. The fantastic recordings, presented in generous horizontal format has collected the Finnish aurora photographer Tom Eklund over a period of time of 14 years. Thereby it succeeded, to document also some events, the origin of which on our daystar were recorded by solar satellites, so that the sequence of events from the solar eruption until the aurora spectacle can be reproduced. The present 2nd edition contains new scientific findings. Additionally numerous aurora pictures were replaced by more actual photos created with modern technology.

  11. Aurorasaurus: A citizen science platform for viewing and reporting the aurora

    Science.gov (United States)

    MacDonald, E. A.; Case, N. A.; Clayton, J. H.; Hall, M. K.; Heavner, M.; Lalone, N.; Patel, K. G.; Tapia, A.

    2015-09-01

    A new, citizen science-based, aurora observing and reporting platform has been developed with the primary aim of collecting auroral observations made by the general public to further improve the modeling of the aurora. In addition, the real-time ability of this platform facilitates the combination of citizen science observations with auroral oval models to improve auroral visibility nowcasting. Aurorasaurus provides easily understandable aurora information, basic gamification, and real-time location-based notification of verified aurora activity to engage citizen scientists. The Aurorasaurus project is one of only a handful of space weather citizen science projects and can provide useful results for the space weather and citizen science communities. Early results are promising with over 2000 registered users submitting over 1000 aurora observations and verifying over 1700 aurora sightings posted on Twitter.

  12. Investigation into the effects of VHF and UHF band radiation on Hewlett-Packard (HP) Cesium Beam Frequency Standards

    Science.gov (United States)

    Dickens, Andrew

    1995-01-01

    This paper documents an investigation into reports which have indicated that exposure to VHF and UHF band radiation has adverse effects on the frequency stability of HP cesium beam frequency standards. Tests carried out on the basis of these reports show that sources of VHF and UHF radiation such as two-way hand held police communications devices do cause reproducible adverse effects. This investigation examines reproducible effects and explores possible causes.

  13. Digitale radio

    NARCIS (Netherlands)

    Schiphorst, Roelof; Zondervan, L.

    2007-01-01

    Als eerste in Europa heeft Nederland begin december 2006 de omschakeling van analoge naar digitale ethertelevisie gemaakt. Voor de analoge FM-radio is er ook een digitale variant, T-DAB. T-DAB staat voor 'Terrestrial Digital Audio Broadcasting'. Dit artikel gaat verder in op deze techniek en de

  14. The Grand Aurorae Borealis Seen in Colombia in 1859

    CERN Document Server

    Cárdenas, Freddy Moreno; Domínguez, Santiago Vargas

    2015-01-01

    On Thursday, September 1, 1859, the British astronomer Richard Carrington, for the first time ever, observes a spectacular gleam of visible light on the surface of the solar disk, the photosphere. The Carrington Event, as it is nowadays known by scientists, occurred because of the high solar activity that had visible consequences on Earth, in particular reports of outstanding aurorae activity that amazed thousands of people in the western hemisphere during the dawn of September 2. The geomagnetic storm, generated by the solar-terrestrial event, had such a magnitude that the auroral oval expanded towards the equator, allowing low latitudes, like Panama's 9$^\\circ$ N, to catch a sight of the aurorae. An expedition was carried out to review several historical reports and books from the northern cities of Colombia, allowing the identification of a narrative from Monter\\'ia, Colombia (8$^\\circ$ 45' N), that describes phenomena resembling those of an aurorae borealis, such as fire-like lights, blazing and dazzling ...

  15. Physiological and tumoral consequences of Aurora B deregulation in adult mammals

    OpenAIRE

    González Loyola, Alejandra

    2015-01-01

    Tesis doctoral inédita leída en la Universidad Autónoma de Madrid, Facultad de Ciencias, Departamento de Biología Molecular. Fecha de lectura: 23-01-2015 Aurora B (Aurkb), one of the three members of the mammalian Aurora kinase family, is the catalytic component of the Chromosomal Passenger Complex (CPC), an essential regulator of chromosome segregation in mitosis. Despite the numerous studies on Aurora B function in cells, the physiological effects of Aurora B deregulation in viv...

  16. Evolutionary relationships of Aurora kinases: Implications for model organism studies and the development of anti-cancer drugs

    Directory of Open Access Journals (Sweden)

    Patrick Denis R

    2004-10-01

    Full Text Available Abstract Background As key regulators of mitotic chromosome segregation, the Aurora family of serine/threonine kinases play an important role in cell division. Abnormalities in Aurora kinases have been strongly linked with cancer, which has lead to the recent development of new classes of anti-cancer drugs that specifically target the ATP-binding domain of these kinases. From an evolutionary perspective, the species distribution of the Aurora kinase family is complex. Mammals uniquely have three Aurora kinases, Aurora-A, Aurora-B, and Aurora-C, while for other metazoans, including the frog, fruitfly and nematode, only Aurora-A and Aurora-B kinases are known. The fungi have a single Aurora-like homolog. Based on the tacit assumption of orthology to human counterparts, model organism studies have been central to the functional characterization of Aurora kinases. However, the ortholog and paralog relationships of these kinases across various species have not been rigorously examined. Here, we present comprehensive evolutionary analyses of the Aurora kinase family. Results Phylogenetic trees suggest that all three vertebrate Auroras evolved from a single urochordate ancestor. Specifically, Aurora-A is an orthologous lineage in cold-blooded vertebrates and mammals, while structurally similar Aurora-B and Aurora-C evolved more recently in mammals from a duplication of an ancestral Aurora-B/C gene found in cold-blooded vertebrates. All so-called Aurora-A and Aurora-B kinases of non-chordates are ancestral to the clade of chordate Auroras and, therefore, are not strictly orthologous to vertebrate counterparts. Comparisons of human Aurora-B and Aurora-C sequences to the resolved 3D structure of human Aurora-A lends further support to the evolutionary scenario that vertebrate Aurora-B and Aurora-C are closely related paralogs. Of the 26 residues lining the ATP-binding active site, only three were variant and all were specific to Aurora-A. Conclusions In

  17. AURORA on MEGSAT 1 a photon counting observatory for the Earth UV night-sky background and Aurora emission

    CERN Document Server

    Monfardini, A; Stalio, R; Mahne, N; Battiston, R; Menichelli, M; Mazzinghi, P

    2001-01-01

    A low-mass, low-cost photon-counting scientific payload has been developed and launched on a commercial microsatellite in order to study the near-UV night-sky background emission with a telescope nicknamed 'Notte' and the Aurora emission with 'Alba'. AURORA, this is the name of the experiment, will determine, with the 'Notte' channel, the overall night-side photon background in the 300-400 nm spectral range, together with a particular 2 sup + N sub 2 line (lambda sub c =337 nm). The 'Alba' channel, on the other hand, will study the Aurora emissions in four different spectral bands (FWHM=8.4-9.6 nm) centered on: 367 nm (continuum evaluation), 391 nm (1 sup - N sup + sub 2), 535 nm (continuum evaluation), 560 nm (OI). The instrument has been launched on the 26 September, 2000 from the Baikonur cosmodrome on a modified SS18 Dnepr-1 'Satan' rocket. The satellite orbit is nearly circular (h sub a sub p sub o sub g sub e sub e =648 km, e=0.0022), and the inclination of the orbital plane is 64.56 deg. An overview of...

  18. Broadband VHF observations for lightning impulses from a small satellite SOHLA-1 (Maido 1)

    Science.gov (United States)

    Morimoto, T.; Kikuchi, H.; Ushio, T.; Kawasaki, Z.; Hidekazu, H.; Aoki, T.

    2009-12-01

    Lightning Research Group of Osaka University (LRG-OU) has been developing VHF Broadband Digital Interferometer (DITF) to image precise lightning channels and monitor lightning activity widely. The feature of broadband DITF is its ultrawide bandwidth (from 25MHz to 100MHz) and implicit redundancy for estimating VHF source location. LRG-OU considers an application of the broadband DITF to the spaceborne measurement system and joins the SOHLA (Space Oriented Higashi-Osaka Leading Associate) satellite project. The SOHLA satellite project represents a technology transfer program to expand the range of the space development community in Japan. The objective is to get SMEs (Small and Medium sized manufacturing Enterprises) involved in small space projects and new space technologies. Under the cooperative agreement, JAXA (Japan Aerospace Exploration Agency) intends to contribute to socio-economic development by returning its R&D results to society, and SOHLA tries to revitalize the local economy through the commercialization of versatile small satellites. According to the agreement, JAXA provides SOHLA its technical information on small satellites and other technical assistance for the development of the small satellites, SOHLA-1. The prime objective of the SOHLA-1 program is to realize low-cost and short term development of a microsatellite which utilizes the components and bus technologies of JAXA’s MicroLabSat. SOHLA-1 is a spin-stabilized microsatellite of MicroLabSat heritage (about 50 kg). The spin axis is fixed to inertial reference frame. The spin axis (z-axis) lies in the plane containing the solar direction and the normal to the orbital plane. LRG-OU takes responsibility for a science mission of SOHLA-1. To examine the feasibility of the DITF receiving VHF lightning impulses in space, LRG-OU proposes the BMW (Broadband Measurement of Waveform for VHF Lightning Impulses). BMW consists of a single pair of an antenna, a band-pass filter, an amplifier, and an

  19. Chandra's Observations of Jupiter's X-Ray Aurora During Juno Upstream and Apojove Intervals

    Science.gov (United States)

    Jackman, C.M.; Dunn, W.; Kraft, R.; Gladstone, R.; Branduardi-Raymont, G.; Knigge, C.; Altamirano, D.; Elsner, R.

    2017-01-01

    The Chandra space telescope has recently conducted a number of campaigns to observe Jupiter's X-ray aurora. The first set of campaigns took place in summer 2016 while the Juno spacecraft was upstream of the planet sampling the solar wind. The second set of campaigns took place in February, June and August 2017 at times when the Juno spacecraft was at apojove (expected close to the magnetopause). We report on these upstream and apojove campaigns including intensities and periodicities of auroral X-ray emissions. This new era of jovian X-ray astronomy means we have more data than ever before, long observing windows (up to 72 kiloseconds for this Chandra set), and successive observations relatively closely spaced in time. These features combine to allow us to pursue novel methods for examining periodicities in the X-ray emission. Our work will explore significance testing of emerging periodicities, and the search for coherence in X-ray pulsing over weeks and months, seeking to understand the robustness and regularity of previously reported hot spot X-ray emissions. The periods that emerge from our analysis will be compared against those which emerge from radio and UV wavelengths.

  20. Jupiter’s Magnificent AuroraI Lightshow: Initial observations and results from the Juno Mission.

    Science.gov (United States)

    Greathouse, Thomas K.; Bolton, Scott J.; Gladstone, Randy; Connerney, John E. P.; Adriani, Alberto; Kurth, William S.; Mauk, Barry; Valek, Philip; Levin, Steven; Hue, Vincent; Juno Mission Team

    2017-10-01

    The Juno spacecraft carries with it an impressive suite of instruments to study Jupiter’s aurora and its response to variations in Jupiter’s magnetosphere. The UV and near-infrared auroral emissions serve as a “witness plate” or “viewing screen” to some of the complex processes occurring in Jupiter’s giant magnetosphere. Observations by the particle instruments (JEDI and JADE) measure the electron and ion particle distributions at the spacecraft, while the MAG instrument measures the instantaneous magnitude and orientation of Jupiter’s magnetic field and the Waves instrument measures auroral plasma waves and radio emissions. With these measurements and model predictions of how the position of the spacecraft maps to the upper atmosphere of Jupiter in magnetic field coordinates, UVS and JIRAM can observe how Jupiter’s upper atmosphere reacts to the magnetospheric loading observed at Juno. We will present select results from the 6 successful perijoves to date and possibly something from the 8th Perijove planned for September 1st, 2017.

  1. Comparison study of Lightning VHF interferometric and LF time-of-arival maps

    Science.gov (United States)

    Kudo, A.; Stock, M.; Kawasaki, Z.; Ushio, T.

    2016-12-01

    Lightning discharges radiate broad band frequency electromagnetic waves from ULF to UHF. Using sensors which detect this radiation is an effective technique to detect lightning flashes, even if they are in a cloud. If multiple sensors are present, a lightning flash can be located using various techniques. At low frequencies, the power radiated by lightning is very high, but because the wavelengths are long, the location resolution is somewhat low. At very high frequencies, the wavelengths are much shorter allowing for much better location resolution, but the power radiation is also much lower, making it more difficult to detect. The VHF band is a good compromise between good location resolution, and good detection efficiency. One technique to locate VHF signals from lightning is interferometry. Using this technique, the signals arriving at three or more VHF broadband antennas are coherently combined to produce an image of the lightning flash. The current generation broadband lightning interferometer being developed in Japan by RAIRAN and the University of Osaka called Lightning Interferometer via VHF Emission (LIVE). Currently, LIVE is installed in Kaizuka, a city to the south of Osaka, near Osaka Bay to observe Japanese summer lightning. In the current study, we are comparing the high detail, 2-dimensional lightning maps produced by LIVE to the lower detail, 3-dimensional maps produced by a low frequency time-of-arrival system called the Broadband Observation network for Lightning and Thunderstorms (BOLT). In order to better compare the data, a new GPS timing device is being developed for LIVE to allow high absolute timing accuracy without sacrificing one of the 4 high speed digitizer channels. The objectives of the study are to better understand Japanese summer lightning, and to prepare for a future campaign as part of the GLM validation study.

  2. Bias-Voltage Stabilizer for HVHF Amplifiers in VHF Pulse-Echo Measurement Systems

    Directory of Open Access Journals (Sweden)

    Hojong Choi

    2017-10-01

    Full Text Available The impact of high-voltage–high-frequency (HVHF amplifiers on echo-signal quality is greater with very-high-frequency (VHF, ≥100 MHz ultrasound transducers than with low-frequency (LF, ≤15 MHz ultrasound transducers. Hence, the bias voltage of an HVHF amplifier must be stabilized to ensure stable echo-signal amplitudes. We propose a bias-voltage stabilizer circuit to maintain stable DC voltages over a wide input range, thus reducing the harmonic-distortion components of the echo signals in VHF pulse-echo measurement systems. To confirm the feasibility of the bias-voltage stabilizer, we measured and compared the deviations in the gain of the HVHF amplifier with and without a bias-voltage stabilizer. Between −13 and 26 dBm, the measured gain deviations of a HVHF amplifier with a bias-voltage stabilizer are less than that of an amplifier without a bias-voltage stabilizer. In order to confirm the feasibility of the bias-voltage stabilizer, we compared the pulse-echo responses of the amplifiers, which are typically used for the evaluation of transducers or electronic components used in pulse-echo measurement systems. From the responses, we observed that the amplitudes of the echo signals of a VHF transducer triggered by the HVHF amplifier with a bias-voltage stabilizer were higher than those of the transducer triggered by the HVHF amplifier alone. The second, third, and fourth harmonic-distortion components of the HVHF amplifier with the bias-voltage stabilizer were also lower than those of the HVHF amplifier alone. Hence, the proposed scheme is a promising method for stabilizing the bias voltage of an HVHF amplifier, and improving the echo-signal quality of VHF transducers.

  3. First wind shear observation in PMSE with the tristatic EISCAT VHF radar

    OpenAIRE

    Mann, Ingrid; Häggström, I.; Tjulin, A; Rostami, S; Anyairo, CC; Dalin, P

    2016-01-01

    (c) American Geophysical Union, reprinted with permission. Article also available at source: https://doi.org/10.1002/2016JA023080 The Polar Summer Mesosphere has the lowest temperatures that occur in the entire Earth system. Water ice particles below the optically observable size range participate there in the formation of strong radar echoes (Polar Mesospheric Summer Echoes, PMSE). To study PMSE we carried out observations with the European Incoherent Scatter (EISCAT) VHF and EIS...

  4. Bias-Voltage Stabilizer for HVHF Amplifiers in VHF Pulse-Echo Measurement Systems.

    Science.gov (United States)

    Choi, Hojong; Park, Chulwoo; Kim, Jungsuk; Jung, Hayong

    2017-10-23

    The impact of high-voltage-high-frequency (HVHF) amplifiers on echo-signal quality is greater with very-high-frequency (VHF, ≥100 MHz) ultrasound transducers than with low-frequency (LF, ≤15 MHz) ultrasound transducers. Hence, the bias voltage of an HVHF amplifier must be stabilized to ensure stable echo-signal amplitudes. We propose a bias-voltage stabilizer circuit to maintain stable DC voltages over a wide input range, thus reducing the harmonic-distortion components of the echo signals in VHF pulse-echo measurement systems. To confirm the feasibility of the bias-voltage stabilizer, we measured and compared the deviations in the gain of the HVHF amplifier with and without a bias-voltage stabilizer. Between -13 and 26 dBm, the measured gain deviations of a HVHF amplifier with a bias-voltage stabilizer are less than that of an amplifier without a bias-voltage stabilizer. In order to confirm the feasibility of the bias-voltage stabilizer, we compared the pulse-echo responses of the amplifiers, which are typically used for the evaluation of transducers or electronic components used in pulse-echo measurement systems. From the responses, we observed that the amplitudes of the echo signals of a VHF transducer triggered by the HVHF amplifier with a bias-voltage stabilizer were higher than those of the transducer triggered by the HVHF amplifier alone. The second, third, and fourth harmonic-distortion components of the HVHF amplifier with the bias-voltage stabilizer were also lower than those of the HVHF amplifier alone. Hence, the proposed scheme is a promising method for stabilizing the bias voltage of an HVHF amplifier, and improving the echo-signal quality of VHF transducers.

  5. 2-D inner-shelf current observations from a single VHF WEllen RAdar (WERA) station

    Science.gov (United States)

    Voulgaris, G.; Kumar, N.; Gurgel, K.-W.; Warner, J.C.; List, J.H.

    2011-01-01

    The majority of High Frequency (HF) radars used worldwide operate at medium to high frequencies (8 to 30 MHz) providing spatial resolutions ranging from 3 to 1.5 km and ranges from 150 to 50 km. This paper presents results from the deployment of a single Very High Frequency (VHF, 48 MHz) WEllen RAdar (WERA) radar with spatial resolution of 150 m and range 10-15 km, used in the nearshore off Cape Hatteras, NC, USA. It consisted of a linear array of 12 antennas operating in beam forming mode. Radial velocities were estimated from radar backscatter for a variety of wind and nearshore wave conditions. A methodology similar to that used for converting acoustically derived beam velocities to an orthogonal system is presented for obtaining 2-D current fields from a single station. The accuracy of the VHF radar-derived radial velocities is examined using a new statistical technique that evaluates the system over the range of measured velocities. The VHF radar velocities showed a bias of 3 to 7 cm/s over the experimental period explainable by the differences in radar penetration and in-situ measurement height. The 2-D current field shows good agreement with the in-situ measurements. Deviations and inaccuracies are well explained by the geometric dilution analysis. ?? 2011 IEEE.

  6. The Radio JOVE Project - Shoestring Radio Astronomy

    Science.gov (United States)

    Thieman, J.; Flagg, R.; Greenman, W.; Higgins, C.; Reyes, F.; Sky, J.

    2010-01-01

    Radio JOVE is an education and outreach project intended to give students and other interested individuals hands-on experience in learning radio astronomy. They can do this through building a radio telescope from a relatively inexpensive kit that includes the parts for a receiver and an antenna as well as software for a computer chart recorder emulator (Radio Skypipe) and other reference materials

  7. Space Telecommunications Radio System STRS Cognitive Radio

    Science.gov (United States)

    Briones, Janette C.; Handler, Louis M.

    2013-01-01

    Radios today are evolving from awareness toward cognition. A software defined radio (SDR) provides the most capability for integrating autonomic decision making ability and allows the incremental evolution toward a cognitive radio. This cognitive radio technology will impact NASA space communications in areas such as spectrum utilization, interoperability, network operations, and radio resource management over a wide range of operating conditions. NASAs cognitive radio will build upon the infrastructure being developed by Space Telecommunication Radio System (STRS) SDR technology. This paper explores the feasibility of inserting cognitive capabilities in the NASA STRS architecture and the interfaces between the cognitive engine and the STRS radio. The STRS architecture defines methods that can inform the cognitive engine about the radio environment so that the cognitive engine can learn autonomously from experience, and take appropriate actions to adapt the radio operating characteristics and optimize performance.

  8. Spiral structures and regularities in magnetic field variations and auroras

    Directory of Open Access Journals (Sweden)

    Y. I. Feldstein

    2012-02-01

    Full Text Available The conception of spiral shaped precipitation regions, where solar corpuscles penetrate the upper atmosphere, was introduced into geophysics by C. Störmer and K. Birkeland at the beginning of the last century. Later, in the course of the XX-th century, spiral distributions were disclosed and studied in various geophysical phenomena. Most attention was devoted to spiral shapes in the analysis of regularities pertaining to the geomagnetic activity and auroras.

    We review the historical succession of perceptions about the number and positions of spiral shapes, that characterize the spatial-temporal distribution of magnetic disturbances. We describe the processes in the upper atmosphere, which are responsible for the appearance of spiral patterns. We considered the zones of maximal aurora frequency and of maximal particle precipitation intensity, as offered in the literature, in their connection with the spirals.

    We discuss the current system model, that is closely related to the spirals and that appears to be the source for geomagnetic field variations during magnetospheric substorms and storms. The currents in ionosphere and magnetosphere constitute together with field-aligned (along the geomagnetic field lines currents (FACs a common 3-D current system. At ionospheric heights, the westward and eastward electrojets represent characteristic elements of the current system. The westward electrojet covers the longitudinal range from the morning to the evening hours, while the eastward electrojet ranges from afternoon to near-midnight hours. The polar electrojet is positioned in the dayside sector at cusp latitudes. All these electrojets map along the magnetic field lines to certain plasma structures in the near-Earth space. The first spiral distribution of auroras was found based on observations in Antarctica for the nighttime-evening sector (N-spiral, and later in the nighttime-evening (N-spiral and morning (M-spiral sectors both in

  9. Polo-Like Kinase-1 Controls Aurora A Destruction by Activating APC/C-Cdh1

    NARCIS (Netherlands)

    van Leuken, Renske; Clijsters, Linda; van Zon, Wouter; Lim, Dan; Yao, XueBiao; Wolthuis, Rob M. F.; Yaffe, Michael B.; Medema, Rene H.; van Vugt, Marcel A. T. M.

    2009-01-01

    Polo-like kinase-1 (Plk1) is activated before mitosis by Aurora A and its cofactor Bora. In mitosis, Bora is degraded in a manner dependent on Plk1 kinase activity and the E3 ubiquitin ligase SCF-beta TrCP. Here, we show that Plk1 is also required for the timely destruction of its activator Aurora A

  10. Bora and Aurora-A continue to activate Plk1 in mitosis.

    Science.gov (United States)

    Bruinsma, Wytse; Macurek, Libor; Freire, Raimundo; Lindqvist, Arne; Medema, René H

    2014-02-15

    Polo-like kinase-1 (Plk1) is required for proper cell division. Activation of Plk1 requires phosphorylation on a conserved threonine in the T-loop of the kinase domain (T210). Plk1 is first phosphorylated on T210 in G2 phase by the kinase Aurora-A, in concert with its cofactor Bora. However, Bora was shown to be degraded prior to entry into mitosis, and it is currently unclear how Plk1 activity is sustained in mitosis. Here we show that the Bora-Aurora-A complex remains the major activator of Plk1 in mitosis. We show that a small amount of Aurora-A activity is sufficient to phosphorylate and activate Plk1 in mitosis. In addition, a fraction of Bora is retained in mitosis, which is essential for continued Aurora-A-dependent T210 phosphorylation of Plk1. We find that once Plk1 is activated, minimal amounts of the Bora-Aurora-A complex are sufficient to sustain Plk1 activity. Thus, the activation of Plk1 by Aurora-A may function as a bistable switch; highly sensitive to inhibition of Aurora-A in its initial activation, but refractory to fluctuations in Aurora-A activity once Plk1 is fully activated. This provides a cell with robust Plk1 activity once it has committed to mitosis.

  11. 78 FR 64196 - Approval of Subzone Status: Pillow Kingdom, Inc., Aurora, Colorado

    Science.gov (United States)

    2013-10-28

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF COMMERCE Foreign-Trade Zones Board Approval of Subzone Status: Pillow Kingdom, Inc., Aurora, Colorado On August 21... existing activation limit of FTZ 123, on behalf of Pillow Kingdom, Inc., in Aurora, Colorado. The...

  12. AURORA BOREALIS - European Research Icebreaker With Drilling Capability

    Science.gov (United States)

    Biebow, N.; Lembke-Jene, L.; Kunz-Pirrung, M.; Thiede, J.

    2008-12-01

    The polar oceans are the least known areas of the globe, in although they hold the key to many of our climate´s secrets. How does the sea ice coverage and the sea water properties change? How do plants and animals survive under the most extreme conditions of the earth? Which information of past climate change can be read from the sediments at the sea-floor and how can the future changing climate be predicted? In order to answer such and further questions, for the moment a hypermodern research vessel, the AURORA BOREALIS, is planned, which can handle the cool summers and freezing winters of the polar oceans and which can drill deep into the sea floor. AURORA BOREALIS will be the most advanced Research Icebreaker in the world with a multi-functional role of drilling in deep ocean basins and supporting climate/environmental research and decision support for stakeholder governments for the next 35-40 years. It will have a high icebreaking capacity to penetrate autonomously (single ship operation) into the central Arctic Ocean with more than 2.5 meters of ice cover, during all seasons of the year. The new technological features will include dynamic positioning in closed sea- ice cover, satellite navigation and ice-management support and the deployment and operation of Remotely Operated Vehicles (ROV) and Autonomous Underwater Vehicles (AUVs) from the twin moon-pools. A unique feature of the vessel is the deep-sea drilling rig, which will enable sampling of the ocean floor and sub-sea up to 5000 m water and 1000 m penetration at the most inhospitable places on earth. The drilling capability will be deployed in both Polar Regions on the long run and AURORA BOREALIS will be the only vessel worldwide that could undertake this type of scientific investigation.

  13. Jupiter's Mid-Infrared Aurora: Solar Connection and Minor Constituents

    Science.gov (United States)

    Kostiuk, Theodore; Livengood, T.A.; Fast, K.E.; Hewagama, T.; Schmilling, F.; Sonnabend, G.; Delgado, J.

    2009-01-01

    High spectral resolution in the 12 pin region of the polar regions of Jupiter reveal unique information on auroral phenomena and upper stratospheric composition. Polar aurorae in Jupiter's atmosphere radiate; throughout the electromagnetic spectrum from X-ray through mid-infrared (mid-IR, 5 - 20 micron wavelength). Voyager IRIS data and ground-based. spectroscopic measurements of Jupiter's northern mid-IR aurora acquired since 1982, reveal a correlation between auroral brightness and solar activity that has not been observed in Jovian aurora at other wavelengths. Over nearly three solar cycles, Jupiter auroral ethane, emission brightness and solar 10.7-cm radar flux and sunspot number are positively correlated with high confidence. Ethane line emission intensity varies over tenfold between low and high scalar activity periods. Detailed measurements have been made using the GSFC HIPWAC spectrometer at the NASA IRTF since the last solar maximum, following the mid-IR emission through the declining phase toward solar minimum. An even more convincing correlation with solar activity is evident in these data. The spectra measured contain features that cannot be attributed to ethane and are most likely spectra of minor constituents whose molecular bands overlap the v9 band of ethane. Possible candidates are allene, propane, and other higher order hydrocarbons. These features appear to be enhanced in the active polar regions. Laboratory measurements at comparable spectral resolution of spectra of candidate molecules will be used to identify the constituents. Current analyses of these results will be described, including planned measurements on polar ethane line emission scheduled through the rise of the next solar maximum beginning in 2009, with a steep gradient to a maximum in 2012. This work is relevant to the Juno mission and to the development of the NASA/ESA Europa Jupiter System Mission.

  14. Artificial auroras in the upper atmosphere. I - Electron beam injections

    Science.gov (United States)

    Burch, J. L.; Mende, S. B.; Kawashima, N.; Roberts, W. T.; Taylor, W. W. L.; Neubert, T.; Gibson, W. C.; Marshall, J. A.; Swenson, G. R.

    1993-03-01

    The Atlas-1 Spacelab payload's Space Experiments with Particle Accelerators generated artificial electron beams for the stimulation of auroral emissions at southern auroral latitudes. Optical measurements were made by the Shuttle Orbiter's onboard TV cameras, as well as by the Atmospheric Emissions Photometric Imager (in both white light and the 427.8 nm N2(+) emission line). Shuttle-based auroral imaging furnished a novel perspective on the artificial auroras; the emissions were traced from 295 km to the 110 km level along the curved magnetic-field lines.

  15. Artificial auroras in the upper atmosphere. I - Electron beam injections

    Science.gov (United States)

    Burch, J. L.; Mende, S. B.; Kawashima, N.; Roberts, W. T.; Taylor, W. W. L.; Neubert, T.; Gibson, W. C.; Marshall, J. A.; Swenson, G. R.

    1993-01-01

    The Atlas-1 Spacelab payload's Space Experiments with Particle Accelerators generated artificial electron beams for the stimulation of auroral emissions at southern auroral latitudes. Optical measurements were made by the Shuttle Orbiter's onboard TV cameras, as well as by the Atmospheric Emissions Photometric Imager (in both white light and the 427.8 nm N2(+) emission line). Shuttle-based auroral imaging furnished a novel perspective on the artificial auroras; the emissions were traced from 295 km to the 110 km level along the curved magnetic-field lines.

  16. The dawn of Aurora kinase research: from fly genetics to the clinic.

    Directory of Open Access Journals (Sweden)

    Mar eCarmena

    2015-11-01

    Full Text Available Aurora kinases comprise a family of highly conserved serine-threonine protein kinases that play a pivotal role in the regulation of cell cycle. Aurora kinases are not only involved in the control of multiple processes during cell division but also coordinate chromosomal and cytoskeletal events, contributing to the regulation of checkpoints and ensuring the smooth progression of the cell cycle.Because of their fundamental contribution to cell cycle regulation, Aurora kinases were originally identified in independent genetic screens designed to find genes involved in the regulation of cell division. The first aurora mutant was part of a collection of mutants isolated in C. Nusslein-Volhard’s laboratory. This collection was screened in D. M. Glover’s laboratory in search for mutations disrupting the centrosome cycle in embryos derived from homozygous mutant mothers. The mutants identified were given names related to the polar regions, and included not only aurora but also the equally famous polo. Ipl1, the only Aurora in yeast, was identified in a genetic screen looking for mutations that caused chromosome segregation defects. The discovery of a second Aurora-like kinase in mammals opened a new chapter in the research of Aurora kinases. The rat kinase AIM was found to be highly homologous to the fly and yeast proteins, but localised at the midzone and midbody and was proposed to have a role in cytokinesis. Homologs of the equatorial Aurora (Aurora B were identified in metazoans ranging from flies to humans. Xenopus Aurora B was found to be in a complex with the chromosomal passenger INCENP, and both proteins were shown to be essential in flies for chromosome structure, segregation, central spindle formation and cytokinesis. Fifteen years on, Aurora kinase research is an active field of research. After the successful introduction of the first anti-mitotic agents in cancer therapy, both Auroras have become the focus of attention as targets for

  17. Expression of Aurora-B and FOXM1 predict poor survival in patients with nasopharyngeal carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Pei-Yu; Luo, Dong-Hua; Mai, Hai-Qiang [State Key Laboratory of Oncology in South China, Collaborative Innovation Center for Cancer Medicine, Guangzhou (China); Sun Yat-sen University Cancer Center, Department of Nasopharyngeal Carcinoma, Guangzhou (China); Li, Yan; Zeng, Ting-Ting; Li, Meng-Qing [State Key Laboratory of Oncology in South China, Collaborative Innovation Center for Cancer Medicine, Guangzhou (China); Hou, Xue; Zhang, Li [State Key Laboratory of Oncology in South China, Collaborative Innovation Center for Cancer Medicine, Guangzhou (China); Sun Yat-sen University Cancer Center, Department of Medical Oncology, Guangzhou (China)

    2015-08-15

    The purpose of this work was to investigate the relationship between Aurora-B, FOXM1, and clinical outcomes in patients with nasopharyngeal carcinoma (NPC) who were treated with a combination of induction chemotherapy and radiotherapy. The expression of Aurora-B and FOXM1 were investigated by immunohistochemistry using a tissue microarray (TMA) containing samples from 166 NPC patients who were treated with cisplatin (DDP) + fluorouracil (5-FU) induction chemotherapy and radiotherapy between 1999 and 2005. The relationship of Aurora-B, FOXM1, and survival of these NPC patients was analyzed. Informative TMA results were obtained in 91 tumor cases for Aurora-B and 93 tumor cases for FOXM1. The 8-year failure-free survival rate (FFS) for the Aurora-B-negative and Aurora-B-positive group was 65.6 and 37.3 %, respectively (p = 0.024), and the 8-year distant FFS (D-FFS) rate was 65.6 and 41.5 %, respectively (p = 0.047). The 8-year overall survival (OS) in the FOXM1-negative group was moderately higher than in the FOXM1-positive group (58.4 vs 39.1 %, p = 0.081). Cox regression analysis revealed that for FFS, Aurora-B expression was a significant prognostic factor (p = 0.025), while for D-FFS, Aurora-B expression was a marginally significant prognostic factor (p = 0.056). When FOXM1 expression was analyzed, the Cox regression analyses showed that FOXM1 expression was a marginally significant prognostic factor (p = 0.056) for OS. Correlation analysis showed that Aurora-B and FOXM1 expression had no significant correlation. Aurora-B and FOXM1 were both adverse prognostic markers for NPC patients treated with chemoradiotherapy. However, the two markers had no significant correlation. (orig.) [German] Ziel war die Untersuchung der Beziehung zwischen Aurora-B, FOXM1 und den klinischen Ergebnissen bei Patienten mit nasopharyngealem Karzinom (NPC), die mit einer Kombinationstherapie aus Induktionschemotherapie und Radiotherapie behandelt wurden. Die Expression von Aurora-B und

  18. A FRET biosensor reveals spatiotemporal activation and functions of aurora kinase A in living cells

    Science.gov (United States)

    Bertolin, Giulia; Sizaire, Florian; Herbomel, Gaëtan; Reboutier, David; Prigent, Claude; Tramier, Marc

    2016-01-01

    Overexpression of AURKA is a major hallmark of epithelial cancers. It encodes the multifunctional serine/threonine kinase aurora A, which is activated at metaphase and is required for cell cycle progression; assessing its activation in living cells is mandatory for next-generation drug design. We describe here a Förster's resonance energy transfer (FRET) biosensor detecting the conformational changes of aurora kinase A induced by its autophosphorylation on Thr288. The biosensor functionally replaces the endogenous kinase in cells and allows the activation of the kinase to be followed throughout the cell cycle. Inhibiting the catalytic activity of the kinase prevents the conformational changes of the biosensor. Using this approach, we discover that aurora kinase A activates during G1 to regulate the stability of microtubules in cooperation with TPX2 and CEP192. These results demonstrate that the aurora kinase A biosensor is a powerful tool to identify new regulatory pathways controlling aurora kinase A activation. PMID:27624869

  19. The Aurora B kinase in chromosome biorientation and spindle checkpoint signalling

    Directory of Open Access Journals (Sweden)

    Veronica eKrenn

    2015-10-01

    Full Text Available Aurora B, a member of the Aurora family of serine/threonine protein kinases, is a key player in chromosome segregation. As part of a macromolecular complex known as the chromosome passenger complex, Aurora B concentrates early during mitosis in the proximity of centromeres and kinetochores, the sites of attachment of chromosomes to spindle microtubules. There, it contributes to a number of processes that impart fidelity to cell division, including kinetochore stabilization, kinetochore-microtubule attachment, and the regulation of a surveillance mechanism named the spindle assembly checkpoint. In the regulation of these processes, Aurora B is the fulcrum of a remarkably complex network of interactions that feed back on its localization and activation state. In this review we discuss the multiple roles of Aurora B during mitosis, focusing in particular on its role at centromeres and kinetochores. Many details of the network of interactions at these locations remain poorly understood, and we focus here on several crucial outstanding questions.

  20. Proteomic analysis of human metaphase chromosomes reveals Topoisomerase II alpha as an Aurora B substrate

    DEFF Research Database (Denmark)

    Morrison, Ciaran; Henzing, Alexander J; Jensen, Ole Nørregaard

    2002-01-01

    The essential Aurora B kinase is a chromosomal passenger protein that is required for mitotic chromosome alignment and segregation. Aurora B function is dependent on the chromosome passenger, INCENP. INCENP, in turn, requires sister chromatid cohesion for its appropriate behaviour. Relatively few...... substrates have been identified for Aurora B, so that the precise role it plays in controlling mitosis remains to be elucidated. To identify potential novel mitotic substrates of Aurora B, extracted chromosomes were prepared from mitotically-arrested HeLa S3 cells and incubated with recombinant human Aurora...... B in the presence of radioactive ATP. Immunoblot analysis confirmed the HeLa scaffold fraction to be enriched for known chromosomal proteins including CENP-A, CENP-B, CENP-C, ScII and INCENP. Mass spectrometry of bands excised from one-dimensional polyacrylamide gels further defined the protein...

  1. Dynamic properties of throat aurora revealed by simultaneous ground and satellite observations

    Science.gov (United States)

    Chen, X.-C.; Han, D.-S.; Lorentzen, D. A.; Oksavik, K.; Moen, J. I.; Baddeley, L. J.

    2017-03-01

    Throat aurora is defined as south-north aligned auroral arcs equatorward of the dayside cusp aurora and was suggested to be the results of cold magnetospheric plasma interaction with magnetopause reconnection, but its observational properties have not yet been well established. In this paper we carefully examine a sequence of throat auroras observed over Svalbard on 27 December 2003. Observations from 630.0 nm [OI] show that poleward moving throat auroras frequently show brightening followed by dimming in auroral intensity, and sometimes, the brightening throat aurora is a precursor of poleward moving auroral forms. Simultaneous all-sky images and HF radar backscatter observations along geomagnetic meridian show that the throat aurora brightening is drifting with ionospheric E × B convection and is colocated with enhanced spectral width poleward of the convection reversal boundary (CRB), while its dimming tends to be in the vicinity of the CRB. This leads us to propose that the throat aurora brightening and dimming may be on the open and closed field lines, respectively. Particle data from NOAA 16 confirm that the dimming throat aurora is associated with precipitation of magnetosheath-like particles mixed with magnetospheric ions (>30 keV), which is characteristic of the low-latitude boundary layer. For particle data from Defense Meteorological Satellite Program F16, we notice that the dimming throat aurora is associated with lower fluxes of magnetosheath-like electrons accompanied with magnetospheric electrons, which is most likely on closed field lines. The dynamic properties of throat aurora presented in this paper are thus important to understand its generation mechanisms.

  2. Basal aurora kinase B activity is sufficient for histone H3 phosphorylation in prophase

    Directory of Open Access Journals (Sweden)

    Ly-Thuy-Tram Le

    2013-02-01

    Histone H3 phosphorylation is the hallmark of mitosis deposited by aurora kinase B. Benzo[e]pyridoindoles are a family of potent, broad, ATP-competitive aurora kinase inhibitors. However, benzo[e]pyridoindole C4 only inhibits histone H3 phosphorylation in prophase but not in metaphase. Under the C4 treatment, the cells enter into mitosis with dephosphorylated histone H3, assemble chromosomes normally and progress to metaphase, and then to anaphase. C4 also induces lagging chromosome in anaphase but we demonstrated that these chromosome compaction defects are not related to the absence of H3 phosphorylation in prophase. As a result of C4 action, mitosis lasts longer and the cell cycle is slowed down. We reproduced the mitotic defects with reduced concentrations of potent pan aurora kinase as well as with a specific aurora B ATP-competitive inhibitor; we therefore propose that histone H3 phosphorylation and anaphase chromosome compaction involve the basal activity of aurora kinase B. Our data suggest that aurora kinase B is progressively activated at mitosis entry and at anaphase onset. The full activation of aurora kinase B by its partners, in prometaphase, induces a shift in the catalytic domain of aurora B that modifies its affinity for ATP. These waves of activation/deactivation of aurora B correspond to different conformations of the chromosomal complex revealed by FRAP. The presence of lagging chromosomes may have deleterious consequences on the daughter cells and, unfortunately, the situation may be encountered in patients receiving treatment with aurora kinase inhibitors.

  3. Tracking patchy pulsating aurora through all-sky images

    Directory of Open Access Journals (Sweden)

    E. Grono

    2017-07-01

    Full Text Available Pulsating aurora is frequently observed in the evening and morning sector auroral oval. While the precipitating electrons span a wide range of energies, there is increasing evidence that the shape of pulsating auroral patches is controlled by structures in near-equatorial cold plasma; these patches appear to move with convection, for example. Given the tremendous and rapidly increasing amount of auroral image data from which the velocity of these patches can be inferred, it is timely to develop and implement techniques for the automatic identification of pulsating auroral patch events in these data and for the automatic determination of the velocity of individual patches from that data. As a first step towards this, we have implemented an automatic technique for determining patch velocities from sequences of images from the Time History of Events and Macroscale Interactions during Substorms (THEMIS all-sky imager (ASI and applied it to many pulsating aurora events. Here we demonstrate the use of this technique and present the initial results, including a comparison between ewograms (east–west keograms and time series of patch position as determined by the algorithm. We discuss the implications of this technique for remote sensing convection in the inner magnetosphere.

  4. Preservation of minimally processed 'aurora-1' peaches using additives

    Directory of Open Access Journals (Sweden)

    Ramilo Nogueira Martins

    2011-12-01

    Full Text Available 'Aurora-1' peaches establishes an interesting alternative as a minimally processed product, due to its characteristics like flavor, color, smell, and also because of its handling resistance. However, it has a short shelf life after a fresh-cut due to enzymatic browning and stone cavity collapse. The main purpose of this research was to test the additive with antioxidant effect to prevent browning in minimally processed 'Aurora-1' peaches. The minimal processing consists of washing, sanitizing, peelings and fruit stone extraction. After that, longitudinal cuts were made to obtain eight segments per fruit. The slices were immersed into the following treatment solutions: control (immersion in 2% ascorbic acid; 2% ascorbic acid + 2% calcium chloride; 1% sodium isoascorbate; 1% citric acid; 1% L-cysteine hydrochloride. The products were placed into rigid polystyrene trays branded MEIWA M-54, covered with 14 µm PVC film (OmnifilmTM and kept in cold storage at 3ºC ± 2ºC and 65% RH for twelve days, and evaluated each three days. Appraised variables were appearance, soluble solids, titratable acidity, soluble carbohydrates and reducing sugars, total and soluble pectin, ascorbic acid, and peroxidase and polyphenol oxidase enzyme activity. L-cysteine gave to the minimally processed products a shelf life of twelve days, limmited by off-flavor. The treatment with ascorbic acid was efficient to maintainthe ascorbic acid content, with a shelf-life of nine days, limited by enzymatic browning.

  5. Tracking patchy pulsating aurora through all-sky images

    Science.gov (United States)

    Grono, Eric; Donovan, Eric; Murphy, Kyle R.

    2017-07-01

    Pulsating aurora is frequently observed in the evening and morning sector auroral oval. While the precipitating electrons span a wide range of energies, there is increasing evidence that the shape of pulsating auroral patches is controlled by structures in near-equatorial cold plasma; these patches appear to move with convection, for example. Given the tremendous and rapidly increasing amount of auroral image data from which the velocity of these patches can be inferred, it is timely to develop and implement techniques for the automatic identification of pulsating auroral patch events in these data and for the automatic determination of the velocity of individual patches from that data. As a first step towards this, we have implemented an automatic technique for determining patch velocities from sequences of images from the Time History of Events and Macroscale Interactions during Substorms (THEMIS) all-sky imager (ASI) and applied it to many pulsating aurora events. Here we demonstrate the use of this technique and present the initial results, including a comparison between ewograms (east-west keograms) and time series of patch position as determined by the algorithm. We discuss the implications of this technique for remote sensing convection in the inner magnetosphere.

  6. Observations of the Jovian UV aurora by Voyager

    Science.gov (United States)

    Herbert, Floyd; Sandel, B. R.; Broadfoot, A. L.

    1987-01-01

    The observations of the Jovian aurora made by the Voyager UV spectrometer (UVS) during 1979 are analyzed, with special consideration given to the model fitting process. Several different estimates of the function specifying auroral arc geometry were tried, with the Broadfoot et al. (1981) estimate, found by probing with the tip of the UVS slit, giving the best agreement; this agreement is slightly better than the agreement with the Io torus footprint computed by Roederer et al. (1977). The results suggest that the UVS observations are more sensitive to the surface field geometry than are the Voyager flyby in situ observations. The results of a study of intensity maximum positions indicate that the particles exciting the spatially variable portion of the aurora are drifting west, implying either that these particles are electrons or that they are positive ions drifting east more slowly than the corotation lag of the Io torus region carries them to the west. The latter case is most consistent with the high-energy charged particle measurements.

  7. Nima- and Aurora-related kinases of malaria parasites.

    Science.gov (United States)

    Carvalho, Teresa Gil; Doerig, Christian; Reininger, Luc

    2013-07-01

    Completion of the life cycle of malaria parasite requires a succession of developmental stages which vary greatly with respect to proliferation status, implying a tightly regulated control of the parasite's cell cycle, which remains to be understood at the molecular level. Progression of the eukaryotic cell cycle is controlled by members of mitotic kinase of the families CDK (cyclin-dependent kinases), Aurora, Polo and NIMA. Plasmodium parasites possess cyclin-dependent protein kinases and cyclins, which strongly suggests that some of the principles underlying cell cycle control in higher eukaryotes also operate in this organism. However, atypical features of Plasmodium cell cycle organization and important divergences in the composition of the cell cycle machinery suggest the existence of regulatory mechanisms that are at variance with those of higher eukaryotes. This review focuses on several recently described Plasmodium protein kinases related to the NIMA and Aurora kinase families and discusses their functional involvement in parasite's biology. Given their demonstrated essential roles in the erythrocytic asexual cycle and/or sexual stages, these enzymes represent novel potential drug targets for antimalarial intervention aiming at inhibiting parasite replication and/or blocking transmission of the disease. This article is part of a Special Issue entitled: Inhibitors of Protein Kinases (2012). Copyright © 2013 Elsevier B.V. All rights reserved.

  8. Arsenic-induced Aurora-A activation contributes to chromosome instability and tumorigenesis

    Science.gov (United States)

    Wu, Chin-Han; Tseng, Ya-Shih; Yang, Chao-Chun; Kao, Yu-Ting; Sheu, Hamm-Ming; Liu, Hsiao-Sheng

    2013-11-01

    Arsenic may cause serious environmental pollution and is a serious industrial problem. Depending on the dosage, arsenic may trigger the cells undergoing either proliferation or apoptosis-related cell death. Because of lack of the proper animal model to study arsenic induced tumorigenesis, the accurate risk level of arsenic exposure has not been determined. Arsenic shows genotoxic effect on human beings who uptake water contaminated by arsenic. Chromosome aberration is frequently detected in arsenic exposure-related diseases and is associated with increased oxidative stress and decreased DNA repairing activity, but the underlying mechanism remains elusive. Aurora-A is a mitotic kinase, over-expression of Aurora-A leads to centrosome amplification, chromosomal instability and cell transformation. We revealed that Aurora-A is over-expressed in the skin and bladder cancer patients from blackfoot-disease endemic areas. Our cell line studies reveal that arsenic exposure between 0.5 μM and 1 μM for 2-7 days are able to induce Aurora-A expression and activation based on promoter activity, RNA and protein analysis. Aurora-A overexpression further increases the frequency of unsymmetrical chromosome segregation through centrosome amplification followed by cell population accumulated at S phase in immortalized keratinocyte (HaCaT) and uroepithelial cells (E7). Furthermore, Aurora-A over-expression was sustained for 1-4 weeks by chronic treatment of immortalized bladder and skin cells with NaAsO2. Aurora-A promoter methylation and gene amplification was not detected in the long-term arsenic treated E7 cells. Furthermore, the expression level of E2F1 transcription factor (E2F1) is increased in the presence of arsenic, and arsenic-related Aurora-A over-expression is transcriptionally regulated by E2F1. We further demonstrated that overexpression of Aurora-A and mutant Ha-ras or Aurora-A and mutant p53 may act additively to trigger arsenic-related bladder and skin cancer

  9. Measurements methodology for evaluation of Digital TV operation in VHF high-band

    Science.gov (United States)

    Pudwell Chaves de Almeida, M.; Vladimir Gonzalez Castellanos, P.; Alfredo Cal Braz, J.; Pereira David, R.; Saboia Lima de Souza, R.; Pereira da Soledade, A.; Rodrigues Nascimento Junior, J.; Ferreira Lima, F.

    2016-07-01

    This paper describes the experimental setup of field measurements carried out for evaluating the operation of the ISDB-TB (Integrated Services Digital Broadcasting, Terrestrial, Brazilian version) standard digital TV in the VHF-highband. Measurements were performed in urban and suburban areas in a medium-sized Brazilian city. Besides the direct measurements of received power and environmental noise, a measurement procedure involving the injection of Gaussian additive noise was employed to achieve the signal to noise ratio threshold at each measurement site. The analysis includes results of static reception measurements for evaluating the received field strength and the signal to noise ratio thresholds for correct signal decoding.

  10. Luminous phenomena and electromagnetic VHF wave emission originated from earthquake-related radon exhalation

    Science.gov (United States)

    Seki, A.; Tobo, I.; Omori, Y.; Muto, J.; Nagahama, H.

    2013-12-01

    Anomalous luminous phenomena and electromagnetic wave emission before or during earthquakes have been reported (e.g., the 1965 Matsushiro earthquake swarm). However, their mechanism is still unsolved, in spite of many models for these phenomena. Here, we propose a new model about luminous phenomena and electromagnetic wave emission during earthquake by focusing on atmospheric radon (Rn-222) and its daughter nuclides (Po-218 and Po-214). Rn-222, Po-218 and Po-214 are alpha emitters, and these alpha particles ionize atmospheric molecules. A light emission phenomenon, called 'the air luminescence', is caused by de-excitation of the ionized molecules of atmospheric nitrogen due to electron impact ionization from alpha particles. The de-excitation is from the second positive system of neutral nitrogen molecules and the first negative system of nitrogen molecule ion. Wavelengths of lights by these transitions include the visible light wavelength. So based on this mechanism, we proposed a new luminous phenomenon model before or during earthquake: 1. The concentration of atmospheric radon and its daughter nuclides increase anomalously before or during earthquakes, 2. Nitrogen molecules and their ions are excited by alpha particles emitted from Rn-222, Po-218 and Po-214, and air luminescence is generated by their de-excitation. Similarly, electromagnetic VHF wave emission can be explained by ionizing effect of radon and its daughter nuclides. Boyarchuk et al. (2005) proposed a model that electromagnetic VHF wave emission is originated when excited state of neutral clusters changes. Radon gas ionizes atmosphere and forms positively and negatively charged heavy particles. The process of ion hydration in ordinary air can be determined by the formation of complex chemically active structures of the various types of ion radicals. As a result of the association of such hydration radical ions, a neutral cluster, which is dipole quasi-molecules, is formed. A neutral cluster

  11. Observations of Mesospheric Turbulence by Rocket Probe and VHF Radar, Part 2.4A

    Science.gov (United States)

    Royrvik, O.; Smith, L. G.

    1984-01-01

    Data from the Jicamarca VHF radar and from a Languir probe fine-structure on a Nike Orion rocket launched from Punto Lobos, Peru, have been compared. A single mesospheric scattering layer was observed by the radar. The Langmuir probe detected irregularities in the electron-density profile in a narrow region between 85.2 and 86.6 km. It appears from a comparison between these two data sets that turbulence in the neutral atmosphere is the mechanism generating the refractive index irregularities.

  12. Targeting Aurora B to the equatorial cortex by MKlp2 is required for cytokinesis.

    Directory of Open Access Journals (Sweden)

    Mayumi Kitagawa

    Full Text Available Although Aurora B is important in cleavage furrow ingression and completion during cytokinesis, the mechanism by which kinase activity is targeted to the cleavage furrow and the molecule(s responsible for this process have remained elusive. Here, we demonstrate that an essential mitotic kinesin MKlp2 requires myosin-II for its localization to the equatorial cortex, and this event is required to recruit Aurora B to the equatorial cortex in mammalian cells. This recruitment event is also required to promote the highly focused accumulation of active RhoA at the equatorial cortex and stable ingression of the cleavage furrow in bipolar cytokinesis. Specifically, in drug-induced monopolar cytokinesis, targeting Aurora B to the cell cortex by MKlp2 is essential for cell polarization and furrow formation. Once the furrow has formed, MKlp2 further recruits Aurora B to the growing furrow. This process together with continuous Aurora B kinase activity at the growing furrow is essential for stable furrow propagation and completion. In contrast, a MKlp2 mutant defective in binding myosin-II does not recruit Aurora B to the cell cortex and does not promote furrow formation during monopolar cytokinesis. This mutant is also defective in maintaining the ingressing furrow during bipolar cytokinesis. Together, these findings reveal that targeting Aurora B to the cell cortex (or the equatorial cortex by MKlp2 is essential for the maintenance of the ingressing furrow for successful cytokinesis.

  13. Correlated variations of UV and radio emissions during an outstanding Jovian auroral event

    Science.gov (United States)

    Prange, R.; Zarka, P.; Ballester, G. E.; Livengood, T. A.; Denis, L.; Carr, T.; Reyes, F.; Bame, S. J.; Moos, H. W.

    1993-01-01

    An exceptional Jovian aurora was detected in the FUV on December 21, 1990, by means of Vilspa and Goddard Space Flight Center (GFSC) International Ultraviolet Explorer (IUE) observations. This event included intensification by a factor of three between December 20 and 21, leading to the brightest aurora identified in the IUE data analyzed, and, in the north, to a shift of the emission peak towards larger longitudes. The Jovian radio emission simultaneously recorded at decameter wavelengths in Nancay also exhibits significant changes, from a weak and short-duration emission on December 20 to a very intense one, lasting several hours, on December 21. Confirmation of this intense radio event is also found in the observations at the University of Florida on December 21. The emissions are identified as right-handed Io-independent 'A' (or 'non Io-A') components from the northern hemisphere. The radio source region deduced from the Nancay observations lies, for both days, close to the UV peak emission, exhibiting in particular a similar shift of the source region toward larger longitudes from one day to the next. A significant broadening of the radio source was also observed and it is shown that on both days, the extent of the radio source closely followed the longitude range for which the UV brightness exceeds a given threshold. The correlated variations, both in intensity and longitude, strongly suggest that a common cause triggered the variation of the UV and radio emissions during this exceptional event. On one hand, the variation of the UV aurora could possibly be interpreted according to the Prange and Elkhamsi (1991) model of diffuse multicomponent auroral precipitation (electron and ion): it would arise from an increase in the precipitation rate of ions together with an inward shift of their precipitation locus from L approximately equal 10 to L approximately equal 6. On the other hand, the analysis of Ulysses observations in the upstream solar wind suggests that

  14. Simulations of the neutral structure within the dusk side aurora

    Directory of Open Access Journals (Sweden)

    H. F. Parish

    2006-10-01

    Full Text Available Observations of neutral winds from rocket release experiments within the premidnight and postmidnight substorm recovery phase aurora, show very large E-region neutral winds of several hundred m/s, where winds measured on the dusk side are even larger than those on the dawn side. These large winds are also associated with strong shears, and there is evidence that some of the regions below these shears may be unstable. The mechanisms which generate this strong vertical structure are not well understood. It is also not known whether the acceleration conditions in the pre and post midnight sectors of the aurora may produce significantly different neutral responses on the dawn and dusk sides. Simulations have been performed using a three-dimensional high resolution limited area thermosphere model to try to understand the neutral structure within the dawn and dusk side aurora. When simulations are performed using auroral forcing alone, for equivalent conditions within the dawn and dusk sectors, differences are found in the simulated response on each side. When measured values of auroral forcing parameters, and background winds and tides consistent with recent observations, are used as model inputs, some of the main features of the zonal and meridional wind observations are reproduced in the simulations, but the magnitude of the peak zonal wind around 140 km tends to be too small and the maximum meridional wind around 130 km is overestimated. The winds above 120 km altitude are found to be sensitive to changes in electric fields and ion densities, as was the case for the dawn side, but the effects of background winds and tides on the magnitudes of the winds above 120 km are found to be relatively small on the dusk side. The structure below 120 km appears to be related mainly to background winds and tides rather than auroral forcing, as was found in earlier studies on the dawn side, although the peak magnitudes of simulated wind variations in the 100 to

  15. Arsenic treatment increase Aurora-A overexpression through E2F1 activation in bladder cells.

    Science.gov (United States)

    Kao, Yu-Ting; Wu, Chin-Han; Wu, Shan-Ying; Lan, Sheng-Hui; Liu, Hsiao-Sheng; Tseng, Ya-Shih

    2017-04-18

    Arsenic is a widely distributed metalloid compound that has biphasic effects on cultured cells. In large doses, arsenic can be toxic enough to trigger cell death. In smaller amounts, non-toxic doses may promote cell proliferation and induces carcinogenesis. Aberration of chromosome is frequently detected in epithelial cells and lymphocytes of individuals from arsenic contaminated areas. Overexpression of Aurora-A, a mitotic kinase, results in chromosomal instability and cell transformation. We have reported that low concentration (≦1 μM) of arsenic treatment increases Aurora-A expression in immortalized bladder urothelial E7 cells. However, how arsenic induces carcinogenesis through Aurora-A activation remaining unclear. Bromodeoxyuridine (BrdU) staining, MTT assay, and flow cytometry assay were conducted to determine cell proliferation. Messenger RNA and protein expression levels of Aurora-A were detected by reverse transcriptional-PCR and Western blotting, respectively. Centrosome of cells was observed by immunofluorescent staining. The transcription factor of Aurora-A was investigated by promoter activity, chromosome immunoprecipitation (ChIP), and small interfering RNA (shRNA) assays. Mouse model was utilized to confirm the relationship between arsenic and Aurora-A. We reveal that low dosage of arsenic treatment increased cell proliferation is associated with accumulated cell population at S phase. We also detected increased Aurora-A expression at mRNA and protein levels in immortalized bladder urothelial E7 cells exposed to low doses of arsenic. Arsenic-treated cells displayed increased multiple centrosome which is resulted from overexpressed Aurora-A. Furthermore, the transcription factor, E2F1, is responsible for Aurora-A overexpression after arsenic treatment. We further disclosed that Aurora-A expression and cell proliferation were increased in bladder and uterus tissues of the BALB/c mice after long-term arsenic (1 mg/L) exposure for 2 months. We

  16. A Low Power RC-Coupled VHF Amplifier Designed for Fabrication by Hybrid Microcircuit Techniques.

    Science.gov (United States)

    RADIOFREQUENCY AMPLIFIERS, HYBRID CIRCUITS, MICROMINIATURIZATION , VERY HIGH FREQUENCY, MODULES(ELECTRONICS), TRANSISTOR AMPLIFIERS, RADIO RECEIVERS, COMMUNICATION EQUIPMENT, SATELLITE COMMUNICATIONS.

  17. Exploring the Secrets of the Aurora Second Edition

    CERN Document Server

    Akasofu, Syun-Ichi

    2007-01-01

    This new edition of Exploring the Secrets of the Aurora is based on the author's own experiences as a scientist. It describes the history of progress made in auroral science and magnetospheric physics by providing examples of ideas, controversies, struggles, acceptance, and success. Although no general methodologies are mentioned, the hope is that the reader will learn about the history of progress in auroral science and examples of dealing with the many controversies. This book aims to help young scientific researchers learn how to persevere during periods of controversy and struggles for acceptance. In this second edition, by utilizing multiple examples, Akasofu is successful in demonstrating the importance and usefulness of Synthesis. "Probably the book's most valuable contribution to the history of space physics is precisely the narration of the discovery of substorms.---The book has special features.---Akasofu's coverage of the history of pre-space age solar-terrestrial relations is the most comprehensiv...

  18. Observations of optical aurora modulated by resonant Alfven waves

    Energy Technology Data Exchange (ETDEWEB)

    Xu, B.L.; Samson, C.; Liu, W.W. [Univ. of Alberta (Canada)] [and others

    1993-07-01

    The authors present a study of the modulation behavior of optical aurora, done using the CANOPUS array to look at the optical lines 5577 and 4709{angstrom}, along with magnetometer data. They looked for modulation in the range 1 to 4 mHz, which would be an indication of Alfven wave modulation by resonant waves propagating along field lines. The authors show by several examples that such modulation is seen over an array of latitudes, and that they typically see spectral peaks near 1.3, 1.9, and 3.1 mHz, and in addition large phase shifts are observed when the effects are looked at across the latitude maximum where they are observed. These observations support resonant Alfven waves as the origin of such modulation effects.

  19. Analysis of ionospheric parameters by the software system "Aurora"

    Science.gov (United States)

    Polozov, Yury; Fetisova, Nadezhda

    2017-10-01

    The paper presents methods of modeling and analysis of ionospheric parameters, which realized in the program system of complex analysis of geophysical parameters "Aurora". The methods allow to analyze of characteristic changes in the ionospheric parameters and allocate the anomalous features during periods of ionospheric disturbances. The algorithm parameters are adapted for analyzing the ionospheric data of the Paratunka station (Kamchatka) and based on results of the estimates (station data of Yakutsk, Gakona, etc. were analyzed). Methods can be applied for the mid-latitude region. The system is implemented in the public domain (http://aurorasa.ikir.ru%243a8580/" ext-link-type="uri">http://aurorasa.ikir.ru:8580). The research was supported by RSF Grant, project No 14-11-00194.

  20. Centromeric Transcription Regulates Aurora-B Localization and Activation

    Directory of Open Access Journals (Sweden)

    Michael D. Blower

    2016-05-01

    Full Text Available Centromeric transcription is widely conserved; however, it is not clear what role centromere transcription plays during mitosis. Here, I find that centromeres are transcribed in Xenopus egg extracts into a long noncoding RNA (lncRNA; cen-RNA that localizes to mitotic centromeres, chromatin, and spindles. cen-RNAs bind to the chromosomal passenger complex (CPC in vitro and in vivo. Blocking transcription or antisense inhibition of cen-RNA leads to a reduction of CPC localization to the inner centromere and misregulation of CPC component Aurora-B activation independently of known centromere recruitment pathways. Additionally, transcription is required for normal bipolar attachment of kinetochores to the mitotic spindle, consistent with a role for cen-RNA in CPC regulation. This work demonstrates that cen-RNAs promote normal kinetochore function through regulation of the localization and activation of the CPC and confirm that lncRNAs are components of the centromere.

  1. The charge spectrum of positive ions in a hydrogen aurora

    Science.gov (United States)

    Lynch, J.; Pulliam, D.; Leach, R.; Scherb, F.

    1976-01-01

    An auroral ion charge spectrometer was flown into a hydrogen aurora on a Javelin sounding rocket launched from Churchill, Manitoba. The instrument contained an electrostatic analyzer which selected particles with incident energy per unit charge up to 20 keV/charge and an 80-kV power supply which accelerated these ions onto an array of solid state detectors. Ions tentatively identified as H(+), He(+2), and O(+) were detected from 225 to 820 km in altitude. The experiment did not discriminate between H(+) and He(+), or between O(+), N(+), and C(+). Upper limits of highly charged heavy ion abundances have been set at 20% of the He(+2) and 0.15% of the H(+). It is concluded that both terrestrial and solar wind sources play significant roles in auroral ion precipitation.

  2. Limit on rotational energy available to excite Jovian aurora

    Science.gov (United States)

    Eviatar, A.; Siscoe, G. L.

    1980-01-01

    There is a fundamental relationship between the power that is extracted from Jupiter's rotation to drive magnetospheric processes and the rate at which mass is injected into the Io plasma torus. Half of this power is consumed by bulk motion of the plasma and the other half represents an upper limit on the energy from rotation available for dissipation and in particular to excite the Jovian aurora. Since the rotation of the planet is the only plausible source of energy, the power inferred from the observed auroral intensities requires a plasma injection rate of 2.6 x 10 to the 29th AMU/sec or greater. This in turn leads to a residence time of a torus particle of 48 days or less. These results raise doubts about the applicability of equilibrium thermodynamics to the determination of plasma parameters in the Io torus.

  3. Jovian X-Ray Aurora and Energetic Oxygen Ion Precipitation

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Weihong; Schultz, D. R.

    1999-11-20

    The X-ray line spectra of highly charged oxygen ions excited by charge transfer interaction with the molecular hydrogen in the auroral atmosphere of Jupiter are calculated. The calculations utilize our calculated cross sections of state-selective charge transfer and the available cross-section data of ionization and stripping. Comparison of these spectra with high-resolution spectral observations may provide a sensitive probe of the characteristics of the heavy ions precipitating into the Jovian auroral atmosphere. On the basis of the much higher X-ray efficiency of heavy ions than of electrons, it is concluded that the Jovian aurora may be accounted for by a combination of energetic heavy-ion precipitation and energetic electron precipitation, which produces the auroral X-ray and ultraviolet emissions, respectively. (c) (c) 1999. The American Astronomical Society.

  4. Ultraviolet Emission from Oxygen Precipitating into Jovian Aurora

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Weihong; Schultz, D. R.

    2000-02-10

    The ultraviolet emission-line spectra of precipitating oxygen atoms and ions excited by charge transfer interaction with the molecular hydrogen in the auroral atmosphere of Jupiter are calculated using our computed cross sections of state-selective charge transfer. The charge transfer processes preferentially populate the ground states of neutral oxygen and low-charge ions and the highly excited states of high-charge ions, yielding low UV and high X-ray efficiencies, respectively. Much weaker than the underlying emission spectrum of H2 excited by energetic electron precipitation, the UV emission from oxygen is not expected to be discernible in the Jovian auroral spectrum. This reconciles the absence of UV emission with the presence of X-ray emission from the heavy ions precipitating in the Jovian aurora. (c) (c) 2000. The American Astronomical Society.

  5. Diffuse Jovian aurora influenced by plasma injection from Io

    Science.gov (United States)

    Thorne, R. M.; Tsurutani, B. T.

    1979-01-01

    The paper demonstrates that the broad band of whistler-mode waves observed within the high density torus surrounding Io is consistent with electron cyclotron generation. Cyclotron resonant instability of Jovian energetic electrons is enhanced due to the lower resonant electron energy within the equatorial high density plasma torus surrounding the orbit of Io. The higher energy resonant electron scattering and the corresponding energetic electron lifetimes indicate that an efficient local acceleration process is required to replenish the precipitating relativistic electrons. Calculated energy deposition into the Jovian atmosphere should provide a dominant source of middle atmospheric ionization and excite a continuous band of diffuse auroral emission. It is suggested that the diffuse Jovian aurora should be influenced by the variable volcanic activity on Io which is thought to be an important source of plasma, since the cyclotron scattering process is strongly influenced by the ambient equatorial thermal plasma density.

  6. An HF and lower VHF spectrum assessment system exploiting instantaneously wideband capture

    Science.gov (United States)

    Barnes, Rod I.; Singh, Malkiat; Earl, Fred

    2017-09-01

    We report on a spectral environment evaluation and recording (SEER) system, for instantaneously wideband spectral capture and characterization in the HF and lower VHF band, utilizing a direct digital receiver coupled to a data recorder. The system is designed to contend with a wide variety of electromagnetic environments and to provide accurately calibrated spectral characterization and display from very short (ms) to synoptic scales. The system incorporates a novel RF front end involving automated gain and equalization filter selection which provides an analogue frequency-dependent gain characteristic that mitigates the high dynamic range found across the HF and lower VHF spectrum. The system accurately calibrates its own internal noise and automatically subtracts this from low variance, external spectral estimates, further extending the dynamic range over which robust characterization is possible. Laboratory and field experiments demonstrate that the implementation of these concepts has been effective. Sensitivity to varying antenna load impedance of the internal noise reduction process has been examined. Examples of software algorithms to provide extraction and visualization of spectral behavior over narrowband, wideband, short, and synoptic scales are provided. Application in HF noise spectral density monitoring, spectral signal strength assessment, and electromagnetic interference detection is possible with examples provided. The instantaneously full bandwidth collection provides some innovative applications, and this is demonstrated by the collection of discrete lightning emissions, which form fast ionograms called "flashagrams" in power-delay-frequency plots.

  7. PMSE strength during enhanced D region electron densities: Faraday rotation and absorption effects at VHF frequencies

    Science.gov (United States)

    Chau, Jorge L.; Röttger, Jürgen; Rapp, Markus

    2014-10-01

    In this paper we study the effects of absorption and Faraday rotation on measurements of polar mesosphere summer echoes (PMSE). We found that such effects can produce significant reduction of signal-to-noise ratio (SNR) when the D region electron densities (Ne) are enhanced, and VHF radar systems with linearly polarized antennas are used. In particular we study the expected effects during the strong solar proton event (SPE) of July 2000, also known as the Bastille day flare event. During this event, a strong anti-correlation between the PMSE SNR and the D-region Ne was found over three VHF radar sites at high latitudes: Andøya, Kiruna, and Svalbard. This anti-correlation has been explained (a) in terms of transport effects due to strong electric fields associated to the SPE and (b) due to a limited amount of aerosol particles as compared to the amount of D-region electrons. Our calculations using the Ne profiles used by previous researchers explain most, if not all, of the observed SNR reduction in both time (around the SPE peak) and altitude. This systematic effect, particularly the Faraday rotation, should be recognized and tested, and possibly avoided (e.g., using circular polarization), in future observations during the incoming solar maximum period, to contribute to the understanding of PMSE during enhanced D region Ne.

  8. Realidad, mito y deseo. La mirada grecolatina de Aurora Luque

    Directory of Open Access Journals (Sweden)

    Virtanen, Ricardo

    2011-08-01

    Full Text Available Aurora Luque’s poetry is one of the most representative of contemporary poetry, located within a Greek culturalism, where myth and reality blend into everyday life. Luque’s poetry is characterized by irony, nonchalance, frivolity and dedramatization. The article presents a series of poems where one can find a demystification of the classical element. A poetry stressed by some topoi such as carpe diem or Catullus’ odio et amo, which have been always represented from a light-hearted glance ruled by the spirit of Eros. The article also emphasizes the play on intertextuality –following Catullus– as well as the epicurean inclination/spirit/passion of the autor.

    La poesía de Aurora Luque representa una de las poéticas más representativas de nuestra contemporaneidad, ubicada dentro de un culturalismo grecista, donde mito y realidad se conjugan dentro de la cotidianidad. La poesía de Luque se caracteriza por su ironía, desenfado, frivolidad y desdramatización. El artículo presenta una serie de poemas donde se produce una desmitificación del elemento clásico. Una poesía marcada por algunos topoi como el carpe diem o el odio et amo catuliano, siempre representados desde una mirada desenfada y dominada por el espíritu del Eros. El artículo destaca además el juego de intertextualidad –en seguimiento de Catulo– así como la vocación epicúrea de la autora.

  9. Sensing Chromosome Bi-Orientation by Spatial Separation of Aurora B Kinase from Kinetochore Substrates

    NARCIS (Netherlands)

    Liu, Dan; Vader, Gerben; Vromans, Martijn J. M.; Lampson, Michael A.; Lens, Susanne M. A.

    2009-01-01

    Successful cell division requires that chromosomes attach to opposite poles of the mitotic spindle (bi-orientation). Aurora B kinase regulates chromosome-spindle attachments by phosphorylating kinetochore substrates that bind microtubules. Centromere tension stabilizes bi-oriented attachments, but

  10. Jupiter's magnetosphere and aurorae observed by the Juno spacecraft during its first polar orbits

    DEFF Research Database (Denmark)

    Connerney, J. E. P.; Adriani, Alberto; Allegrini, F.

    2017-01-01

    for Juno's passage over the poles and traverse of Jupiter's hazardous inner radiation belts. Juno's energetic particle and plasma detectors measured electrons precipitating in the polar regions, exciting intense aurorae, observed simultaneously by the ultraviolet and infrared imaging spectrographs. Juno...

  11. Spectral observations of transient features in the FUV Jovian polar aurora

    OpenAIRE

    Gérard, Jean-Claude; Gustin, Jacques; Grodent, Denis; Clarke, J T; Grard, Aline

    2003-01-01

    Images of the Jovian FUV aurora show several morphologically and dynamically different regions. The main oval is usually fairly steady while the high-latitude emission inside the oval can vary over timescales of

  12. Molecular Switching in Confined Spaces: Effects of Encapsulating the DHA/VHF Photo-Switch in Cucurbiturils.

    Science.gov (United States)

    Petersen, Michael Å; Rasmussen, Brian; Andersen, Nicolaj N; Sauer, Stephan P A; Nielsen, Mogens Brøndsted; Beeren, Sophie R; Pittelkow, Michael

    2017-09-18

    Confinement of reactive chemical species uniquely affects chemical reactivity by restricting the physical space available and by restricting access to interactions with the solvent. In Nature, for example, confined protein binding pockets govern processes following photoisomerization reactions and the isomerizations themselves. Here we describe the first example of a dihydroazulene/vinylheptafulvene (DHA/VHF) photo-switch functioning in water, and we show how its switching behavior is strongly influenced by supramolecular interactions with a series of cucurbit[n]uril (CB) host molecules. In CB7 inclusion complexes, the kinetics of the thermal VHF-to-DHA back-reaction is accelerated, while in CB8 inclusion complexes, the kinetics is slowed down as compared to the free photo-switch. The effect of the CB encapsulation of the photo-switch can be effectively canceled by introducing a guest that binds the CB more strongly. According to DFT calculations, a stabilization of the reactive s-cis VHF conformer relative to the s-trans VHF appears to be a contributing factor responsible for the accelerated back-reaction when encapsulated in CB7. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  13. A New Peak of Leonids observed by Radio Technics

    Science.gov (United States)

    Suzuki, K.; Maegawa, K.; Minagawa, Y.

    Radio meteor observations with amateur ham radio wave have been carried out in Japan since August, 1996, by using forward-scattered meteor echoes of VHF radio waves (53.75MHz, 50W, CW) transmitted in Sabae, Fukui prefecture. A strong activity of Leonids was observed between 22h and 01h on November 16/17 (UT), 1996. The hourly rate of long duration echoes reached over 50 times larger than in non-shower period and 1.2 to 1.5 times larger than that at the normal maximum of Leonids, respectively. This enhanced activity occurred at a solar longitude (SL) of 234.95 plus or minus 0.05 degrees (2000.0 eq.), and is probably different from normal peak of Leonids at 235.45 plus or minus 0.05 degrees(2000.0 eq.) observed in 1990's. A corresponding peak in 1995 was also reported by visual meteor observation by many observers in Japan. The ascending node of Comet Tempel-Tuttle in 1966 was at 235.11 degrees in SL, and is closer to the new peak than the normal one (at 235.45 degrees in SL).

  14. The aurora sign in a patient with type B Niemann-Pick disease

    Energy Technology Data Exchange (ETDEWEB)

    Costa e. Silva, Eduardo J. da [Instituto Materno Infantil Professor Fernando Figueira, Departamento de Radiologia, Recife, Pernambuco (Brazil); IMIP, Departamento de Radiologia-Rua dos Coelhos, Recife, PE (Brazil); Cavalcanti de Albuquerque, Silvio; Queiroz Praxedes, Eduardo L. de; Amaral, Fernando J. do [Instituto Materno Infantil Professor Fernando Figueira, Departamento de Radiologia, Recife, Pernambuco (Brazil)

    2007-01-15

    The aurora sign, a sonographic sign found on the sagittal and transverse view, refers to multiple bands of ring-down artifacts posterior to the right hemidiaphragm. Parenchymal lung disease should be suspected when this is present. We report a case of type B Niemann-Pick disease with pulmonary involvement and the aurora sign on abdominal sonography. High-resolution CT of the chest showed corresponding thickened interlobular septa. (orig.)

  15. A FRET biosensor reveals spatiotemporal activation and functions of aurora kinase A in living cells

    OpenAIRE

    Bertolin, Giulia; Sizaire, Florian; Herbomel, Ga?tan; Reboutier, David; Prigent, Claude; Tramier, Marc

    2016-01-01

    Overexpression of AURKA is a major hallmark of epithelial cancers. It encodes the multifunctional serine/threonine kinase aurora A, which is activated at metaphase and is required for cell cycle progression; assessing its activation in living cells is mandatory for next-generation drug design. We describe here a F?rster's resonance energy transfer (FRET) biosensor detecting the conformational changes of aurora kinase A induced by its autophosphorylation on Thr288. The biosensor functionally r...

  16. Cenozoic extension along the reactivated Aurora Fault System in the East Antarctic Craton

    Science.gov (United States)

    Cianfarra, Paola; Maggi, Matteo

    2017-04-01

    The East Antarctic Craton is characterized by major intracontinental basins and highlands buried under the 34 Ma East Antarctic Ice Sheet. Their formation remains a major open question. Paleozoic to Cenozoic intraplate extensional tectonic activity has been proposed for their development and in this work the latter hypothesis is supported. Here we focus on the Aurora Trench (AT) within the Aurora Subglacial Basin (latitude 75°-77°S, longitude 117°-118°E) whose origin is still poorly constrained. The AT is an over 150-km-long, 25-km-wide subglacial trough, elongated in the NNW-SSE direction. Geophysical campaigns allowed better definition of the AT physiography showing typical half-graben geometry. The rounded morphology of the western flank of the AT was simulated through tectonic numerical modelling. We consider the subglacial landscape to primarily reflect the locally preserved relict morphology of the tectonic processes affecting the interior of East Antarctica in the Cenozoic. The bedrock morphology was replicated through the activity of the listric Aurora Trench Fault, characterized by a basal detachment at 34 km (considered the base of the crust according to available geophysical interpretations) and vertical displacements ranging between 700 and 300 m. The predicted displacement is interpreted as the (partial) reactivation of a weaker zone along a major Precambrian crustal-scale tectonic boundary. We propose that the Aurora Trench Fault is the southern continuation of the > 1000 km long Aurora Fault independently recognized by previous studies. Together they form the Aurora Fault System, a long lived tectonic boundary with poly-phased tectonic history within the EAC that bounds the eastern side of the Aurora Subglacial Basin. The younger Cenozoic reactivation of the investigated segment of the Aurora Fault System relates to the intraplate propagation of far-field stresses associated to the plate-scale kinematics in the Southern Ocean.

  17. Radio frequency detection assembly and method for detecting radio frequencies

    Science.gov (United States)

    Cown, Steven H.; Derr, Kurt Warren

    2010-03-16

    A radio frequency detection assembly is described and which includes a radio frequency detector which detects a radio frequency emission produced by a radio frequency emitter from a given location which is remote relative to the radio frequency detector; a location assembly electrically coupled with the radio frequency detector and which is operable to estimate the location of the radio frequency emitter from the radio frequency emission which has been received; and a radio frequency transmitter electrically coupled with the radio frequency detector and the location assembly, and which transmits a radio frequency signal which reports the presence of the radio frequency emitter.

  18. Historical space weather monitoring of prolonged aurora activities in Japan and in China

    Science.gov (United States)

    Kataoka, Ryuho; Isobe, Hiroaki; Hayakawa, Hisashi; Tamazawa, Harufumi; Kawamura, Akito Davis; Miyahara, Hiroko; Iwahashi, Kiyomi; Yamamoto, Kazuaki; Takei, Masako; Terashima, Tsuneyo; Suzuki, Hidehiko; Fujiwara, Yasunori; Nakamura, Takuji

    2017-02-01

    Great magnetic storms are recorded as aurora sightings in historical documents. The earliest known example of "prolonged" aurora sightings, with aurora persistent for two or more nights within a 7 day interval at low latitudes, in Japan was documented on 21-23 February 1204 in Meigetsuki, when a big sunspot was also recorded in China. We have searched for prolonged events over the 600 year interval since 620 in Japan based on the catalogue of Kanda and over the 700 year interval since 581 in China based on the catalogues of Tamazawa et al. (2017) and Hayakawa et al. (2015). Before the Meigetsuki event, a significant fraction of the 200 possible aurora sightings in Sòng dynasty (960-1279) of China was detected at least twice within a 7 day interval and sometimes recurred with approximately the solar rotation period of 27 days. The majority of prolonged aurora activity events occurred around the maximum phase of solar cycles rather than around the minimum, as estimated from the 14C analysis of tree rings. They were not reported during the Oort Minimum (1010-1050). We hypothesize that the prolonged aurora sightings are associated with great magnetic storms resulting from multiple coronal mass ejections from the same active region. The historical documents therefore provide useful information to support estimation of great magnetic storm frequency, which are often associated with power outages and other societal concerns.

  19. A SUMOylation Motif in Aurora-A: Implications in Spindle Dynamics and Oncogenesis

    Directory of Open Access Journals (Sweden)

    Ignacio ePérez de Castro

    2011-12-01

    Full Text Available Aurora-A is a serine/threonine kinase that plays critical roles in centrosome maturation, spindle dynamics and chromosome orientation and is frequently found overexpressed in human cancers. In this work, we show that Aurora-A interacts with the SUMO conjugating enzyme UBC9 and co-localizes with SUMO-1 in mitotic cells. Aurora-A can be SUMOylated in vitro and mutation in the highly conserved SUMOylation residue lysine 249 results in the induction of mitotic defects characterized by defective and multipolar spindles. The Aurora-AK249R mutant has normal kinase activity but it displays altered dynamics at the mitotic spindle. In addition, ectopic expression of the Aurora-AK249R mutant results in a significant increase in the susceptibility to malignant transformation induced by the Ras oncogene and an increased protection against apoptosis in tumor cells treated with mitotic poisons. These data suggest that modification by SUMO residues may control Aurora-A function at the spindle and suggest that deficient SUMOylation of this kinase may have relevant implications in tumor development or cancer therapy.

  20. Complementary code and digital filtering for detection of weak VHF radar signals from the mesoscale. [SOUSY-VHF radar, Harz Mountains, Germany

    Science.gov (United States)

    Schmidt, G.; Ruster, R.; Czechowsky, P.

    1983-01-01

    The SOUSY-VHF-Radar operates at a frequency of 53.5 MHz in a valley in the Harz mountains, Germany, 90 km from Hanover. The radar controller, which is programmed by a 16-bit computer holds 1024 program steps in core and controls, via 8 channels, the whole radar system: in particular the master oscillator, the transmitter, the transmit-receive-switch, the receiver, the analog to digital converter, and the hardware adder. The high-sensitivity receiver has a dynamic range of 70 dB and a video bandwidth of 1 MHz. Phase coding schemes are applied, in particular for investigations at mesospheric heights, in order to carry out measurements with the maximum duty cycle and the maximum height resolution. The computer takes the data from the adder to store it in magnetic tape or disc. The radar controller is programmed by the computer using simple FORTRAN IV statements. After the program has been loaded and the computer has started the radar controller, it runs automatically, stopping at the program end. In case of errors or failures occurring during the radar operation, the radar controller is shut off caused either by a safety circuit or by a power failure circuit or by a parity check system.

  1. Frequency Reuse, Cell Separation, and Capacity Analysis of VHF Digital Link Mode 3 TDMA

    Science.gov (United States)

    Shamma, Mohammed A.; Nguyen, Thanh C.; Apaza, Rafael D.

    2003-01-01

    The most recent studies by the Federal Aviation Administration (FAA) and the aviation industry have indicated that it has become increasingly difficult to make new VHF frequency or channel assignments to meet the aviation needs for air-ground communications. FAA has planned for several aggressive improvement measures to the existing systems, but these measures would not meet the projected voice communications needs beyond 2009. FAA found that since 1974 there has been, on the average, a 4 percent annual increase in the number of channel assignments needed to satisfy the air-ground communication traffic (approximately 300 new channel assignments per year). With the planned improvement measures, the channel assignments are expected to reach a maximum number of 16615 channels by about 2010. Hence, the FAA proposed the use of VDL Mode 3 as a new integrated digital voice and data communications systems to meet the future air traffic demand. This paper presents analytical results of frequency reuse; cell separation and capacity estimation of VDL Mode 3 TDMA systems that FAA has planned to implement the future VHF air-ground communications system by the year 2010. For TDMA, it is well understood that the frequency reuse factor is a crucial parameter for capacity estimation. Formulation of this frequency reuse factor is shown, taking into account the limitation imposed by the requirement to have a sufficient Signal to Co-Channel Interference Ratio. Several different values for the Signal to Co-Channel Interference Ratio were utilized corresponding to the current analog VHF DSB-AM systems, and the future digital VDL Mode 3. The required separation of Co-Channel cells is computed for most of the Frequency Protected Service Volumes (FPSV's) currently in use by the FAA. Additionally, the ideal cell capacity for each FPSV is presented. Also, using actual traffic for the Detroit air space, a FPSV traffic distribution model is used to generate a typical cell for channel capacity

  2. Layered Polar Mesospheric Summer Echoes Observed with the Tri-Static Eiscat VHF

    Science.gov (United States)

    Mann, I.; Anyairo, C.; Häggström, I.; Tjulin, A.

    2014-12-01

    Polar mesospheric summer echoes (PMSE) are strong radar echoes that are typically observed at 50 to 500 MHz. They are often discussed in the context of dusty plasma studies and linked to e.g. the existence of charged ice particles, neutral atmospheric turbulence and atmospheric stratification. The PMSE are observed at mesospheric temperature minimum when ice particles form, though the exact path of formation is still a topic for research. Mesospheric smoke particles that are assumed to form after or during the meteor ablation process possibly contribute to the formation of the ice particles. For understanding the formation of the radar echoes their variation with scattering angle is an important parameter. We analyze PMSE observations with the tri-static EISCAT VHF radar (224 MHz) during one day in June when PMSE were observed almost continuously from 7:00 to 13:00 UT. The radar signal was transmitted and received in zenith direction with the EISCAT VHF antenna near Tromsø. The receivers in Kiruna and Sodankylä were pointed at typical PMSE heights above the Tromsø transmitter and detected radar reflections at the same time and altitude as the Tromsø radar. The altitude of the PMSE changed with time and the extension of the echoes in altitude was smaller toward the end of the observation. These observations are among the first tri-static observations of PMSE. The observations suggest that the scattering process underlying the PMSE occurs over a broad range of scattering angles. Based on the observations we will show that the spectral width of the received echoes is most likely determined by the variations within the observed volume rather than by the scattering process. The observed frequency shifts suggest a layer structure and horizontal motions that vary with altitude. UHF (933 MHz) radar observations were carried out in parallel, they display predominantly incoherent scatter and an electron density typical for the altitude. Some other studies, have in

  3. Quantifying the TV White Spaces Spectrum Opportunity for Cognitive Radio Access

    Science.gov (United States)

    Nekovee, Maziar

    Cognitive radio is being intensively researched for opportunistic access to the so-called TV White Spaces (TVWS): large portions of the VHF/UHF TV bands which become available on a geographical basis after the digital switchover. In this paper we take a step back from the excitement surrounding TVWS, and quantitatively examine the real spectrum opportunity associated with this form of access. Using accurate digital TV (DTV) coverage maps together with a database of DTV transmitters, we develop a methodology for identifying TVWS frequencies at any given location in the United Kingdom. We use our methodology to investigate variations in TVWS as a function of the location and transmit power of cognitive radios, and examine how constraints on adjacent channel interference imposed by regulators may affect the results. Our analysis provides a realistic view on the spectrum opportunity associated with cognitive devices, and presents the first quantitative study of the availability and frequency composition of TWVS outside the United States.

  4. AURORA BOREALIS: a polar-dedicated European Research Platform

    Science.gov (United States)

    Wolff-Boenisch, Bonnie; Egerton, Paul; Thiede, Joern; Roberto, Azzolini; Lembke-Jene, Lester

    2010-05-01

    Polar research and in particular the properties of northern and southern high latitude oceans are currently a subject of intense scientific debate and investigations, because they are subject to rapid and dramatic climatic variations. Polar regions react more rapidly and intensively to global change than other regions of the earth. A shrinking of the Arctic sea-ice cover, potentially leading to an opening of sea passages to the north of North America and Eurasia, on the long to a "blue" Arctic Ocean would additionally have a strong impact on transport, commerce and tourism bearing potential risk for humans and complex ecosystems in the future. In spite of their critical role processes and feedbacks, especially in winter but not exclusively, are virtually unknown: The Arctic Ocean for example, it is the only basin of the world's oceans that has essentially not been sampled by the drill ships of the Deep-Sea Drilling Project (DSDP) or the Ocean Drilling Program (ODP) and its long-term environmental history and tectonic structure is therefore poorly known. Exceptions are the ODP Leg 151 and the more recent very successful ACEX-expedition of the Integrated Ocean Drilling Program (IODP) in 2004. To help to address the most pressing questions regarding climate change and related processes, a Pan-European initiative in the field of Earth system science has been put in place: AURORA BOREALIS is the largest environmental research infrastructure on the ESFRI roadmap of the European Community. AURORA BOREALIS is a very powerful research icebreaker, which will enable year-round operations in the Arctic and the Antarctic as well as in the adjacent ocean basins. Equipped with its drilling rig, the vessel is also capable to explore the presently completely unknown Arctic deep-sea floor. Last but not least, the ship is a floating observatory and mobile monitoring platform that permits to measure on a long-term basis comprehensive time series in all research fields relevant to

  5. Disturbance-induced responses of VHF and satellite tagged harbour seals

    DEFF Research Database (Denmark)

    Andersen, Signe May; Teilmann, Jonas; Dietz, Rune

    2014-01-01

    ABSTRACT 1. The response of individual harbour seals (Phoca vitulina) to controlled and sporadic disturbances when hauled out in the Anholt seal reserve, Denmark, was studied. Sporadic disturbances from pedestrians, boats, low-flying aeroplanes and grey seals (Halichoerus grypus) were observed...... in or near the reserve. VHF and satellite transmitters were attached to eight harbour seals to determine post-disturbance and undisturbed behaviour during the pre-breeding period (25 April to 21 May 2008). 2. Both disturbed and undisturbed seals mostly returned to the haul-out site from dusk and throughout...... within 40 km from the haul-out site. The maximum extent of post-disturbance trips, however, varied among individuals and disturbance types, and was strongly correlated with the duration of trips. 3. Disturbed and undisturbed seals used the same areas, suggesting that these areas represent normal foraging...

  6. Graphene-based tunable non-foster circuit for VHF applications

    Directory of Open Access Journals (Sweden)

    Jing Tian

    2016-06-01

    Full Text Available This paper presents a negative impedance converter (NIC based on graphene field effect transistors (GFETs for VHF applications. The NIC is designed following Linvill’s open circuit stable (OCS topology. The DC modelling parameters of GFET are extracted from a device measured by Meric et al. [IEEE Electron Devices Meeting, 23.2.1 (2010] Estimated parasitics are also taken into account. Simulation results from Keysight Advanced Design System (ADS show good NIC performance up to 200 MHz and the value of negative capacitance is directly proportional to the capacitive load. In addition, it has been shown that by varying the supply voltage the value of negative capacitance can also be tuned. The NIC stability has been tested up to 2 GHz (10 times the maximum operation frequency using Nyquist stability criterion to ensure there are no oscillation issues.

  7. Recent Comparisons of VHF Lightning Mapping Using Interferometry and Time-of-Arrival Techniques

    Science.gov (United States)

    Lojou, J.; Cummins, K. L.

    2005-12-01

    As part of Vaisala's technology and applications test bed in the Dallas-Fort Worth area in Texas, we have been operating two overlapping Total Lightning detection networks. One network employs VHF Interferometry (both 2- and 3-timensional instrumentation) and the other employs VHF 3-dimensional Time-Of-Arrival (TOA) techniques. For the first time, these two technologies can be compared and contrasted in a common region where they both exhibit good performance. The aim of the work presented is to evaluate the spatial and temporal "description" of lightning flashes provided by these two techniques, and to compare and contrast the relative strengths of these two approaches for Total Lightning mapping. This study employs data acquired during the summer of 2005. The analysis set includes data obtained by these two networks, as well as cloud-to-ground location data from the U.S. National Lightning Detection Network (NLDN). The spatial extent and vertical profile of sources from individual in-cloud and cloud-to-ground flashes are compared for various storm conditions, with both technologies clearly contributing supplemental information not provided by the other. Leader propagation velocities show a substantially unimodal distribution centered at about 105 m/s for TOA-derived sources, whereas the velocity distribution for sources detected using interferometry exhibit a bimodal distribution with the second mode at about 107 m/s. The most-probable interval-between-sources for TOA-derived sources seems to be a few milliseconds, whereas interferometry produces large populations with intervals near 100 microseconds and 100 milliseconds.

  8. Impact of cognitive radio on radio astronomy

    NARCIS (Netherlands)

    Bentum, Marinus Jan; Boonstra, A.J.; Baan, W.A.

    2010-01-01

    The introduction of new communication techniques requires an increase in the efficiency of spectrum usage. Cognitive radio is one of the new techniques that fosters spectrum efficiency by using unoccupied frequency spectrum for communications. However, cognitive radio will increase the transmission

  9. Indomethacin promotes apoptosis in gastric cancer cells through concomitant degradation of Survivin and Aurora B kinase proteins.

    Science.gov (United States)

    Chiou, Shiun-Kwei; Hoa, Neil; Hodges, Amy; Ge, Lishen; Jadus, Martin R

    2014-09-01

    Regular usage of nonsteroidal anti-inflammatory drugs (NSAIDs) is associated with reduced incidence of a variety of cancers. The molecular mechanisms underlying these chemopreventive effects remain poorly understood. This current investigation showed that in gastric cancer cells: (1) Indomethacin treatment enhanced the degradation of chromosomal passenger proteins, Survivin and Aurora B kinase; (2) Indomethacin treatment down-regulated Aurora B kinase activity in a cell cycle-independent fashion; (3) siRNA knockdown of Survivin level promoted Aurora B kinase protein degradation, and vice versa; (4) ectopic overexpression of Survivin blocked reduction of Aurora B kinase level and activity by indomethacin treatment, and vice versa; (5) siRNA knockdown of Aurora B kinase level and AZD1152 inhibition of its activity induced apoptosis, and overexpression of Aurora B kinase inhibited indomethacin-induced apoptosis; (6) indomethacin treatment reduced Aurora B kinase level, coinciding with reduction of Survivin level and induction of apoptosis, in KATO III and HT-29 cells, and in mouse gastric mucosa. A role for Aurora B kinase function in NSAID-induced apoptosis was not previously explored. Thus this report provides better understanding of the molecular mechanisms underlying the anti-cancer effect of NSAIDs by elucidating a significant role for Aurora B kinase in indomethacin-induced apoptosis.

  10. Radio Stalin as an example of the Czech pirate radio

    OpenAIRE

    Prágrová, Šárka

    2017-01-01

    Diploma thesis "Radio Stalin as an example of Czech piracy radio broadcast" is aimed to complexly present radio station Radio Stalin which was broadcasting in October 1990 in Prague. Radio Stalin is presented in the context of events of that time and related changes in politics, economy, society and media and in the context of piracy radio broadcast. First of all the emphasis is put on media transformation and changes in legislative framework of radio broadcasting after 1989. Radio Stalin is ...

  11. Leaving home [radio drama

    OpenAIRE

    Lawrence, Conan

    2014-01-01

    A 50 minute Radio Drama tracing the stories of Amy, Edie and Barnard Beechey as they prepare for the First World War and the changes it brings to their lives. Broadcast on BBC Radio Lincolnshire, 4th August, 2014.

  12. Fast Radio Bursts

    Indian Academy of Sciences (India)

    28

    FRBs) which were first discovered a decade ago. Following an introduction to radio transients in general, including pulsars and Rotating Radio. Transients, we discuss the discovery of FRBs. We then discuss FRB follow-up observations in the ...

  13. MARS PATHFINDER RADIO TRACKING

    Data.gov (United States)

    National Aeronautics and Space Administration — The Mars Pathfinder (MPF) Radio Science (RS) data archive contains both raw radio tracking data collected during the surface lifetime of the MPF Lander and results...

  14. Aurora-A affects radiosenstivity in cervical squamous cell carcinoma and predicts poor prognosis

    Science.gov (United States)

    Ma, Yuhua; Yang, Jie; Wang, Ruozheng; Zhang, Zegao; Qi, Xiaoli; Liu, Chunhua; Ma, Miaomiao

    2017-01-01

    Background Definitive radiation therapy (RT) (with or without cisplatin-based chemotherapy) is one of the most effective treatments for cervical squamous cell carcinoma (CSCC), but efficacy is limited due to resistance. In the present study, we investigated the relationship between the expression of Aurora kinase A (Aurora-A, AURKA)and response to RT in patients with CSCC. Methods The expression of Aurora-A in biopsy specimens of untreated primary tumors in 129 Uyghur patients with CSCC was investigated immunohistochemically. Primary treatment in these patients was definitive radical RT, which consisted of pelvic RT plus brachytherapy (total point A dose:70–85 Gy) (with or without cisplatin-based chemotherapy). The prognostic value of tumoral Aurora-A expression and patients’ clinical outcomes were evaluated. Results Aurora-A expression was significantly associated with lymph node metastasis (P<0.001), large tumor size (P<0.001), low hemoglobin (Hb) level (P=0.011) and recurrence (P<0.001), but not other clinicopathological factors. Definitive RT was unfavorable in patients with high Aurora-A expression (P < 0.001). In 129 enrolled patients, lymph node metastasis, large tumor size, low Hb level, and AURKA overexpression were prognostic factors for both recurrent free survival (RFS) and overall survival (OS) in univariate analysis. However, only high AURKA expression was an adverse independent risk factor for both RFS (hazard ratio, 3.953; 95% CI, 1.473-10.638; P = 0.006) and OS (hazard ratio 9.091; 95%CI 2.597-32.258; P<0.001) in multivariate analyses. Conclusions Aurora-A may serve as a predictive biomarker of radiation response and a therapeutic target to reverse radiation therapy resistance. PMID:28404933

  15. Scale size-dependent characteristics of the nightside aurora

    Science.gov (United States)

    Humberset, B. K.; Gjerloev, J. W.; Samara, M.; Michell, R. G.

    2017-02-01

    We have determined the spatiotemporal characteristics of the magnetosphere-ionosphere (M-I) coupling using auroral imaging. Observations at fixed positions for an extended period of time are provided by a ground-based all-sky imager measuring the 557.7 nm auroral emissions. We report on a single event of nightside aurora (˜22 magnetic local time) preceding a substorm onset. To determine the spatiotemporal characteristics, we perform an innovative analysis of an all-sky imager movie (19 min duration, images at 3.31 Hz) that combines a two-dimensional spatial fast Fourier transform with a temporal correlation. We find a scale size-dependent variability where the largest scale sizes are stable on timescales of minutes while the small scale sizes are more variable. When comparing two smaller time intervals of different types of auroral displays, we find a variation in their characteristics. The characteristics averaged over the event are in remarkable agreement with the spatiotemporal characteristics of the nightside field-aligned currents during moderately disturbed times. Thus, two different electrodynamical parameters of the M-I coupling show similar behavior. This gives independent support to the claim of a system behavior that uses repeatable solutions to transfer energy and momentum from the magnetosphere to the ionosphere.

  16. Parallel electric fields inferred during a pulsating aurora

    Directory of Open Access Journals (Sweden)

    J. D. Williams

    2006-08-01

    Full Text Available A sounding rocket, equipped to study pulsating aurora launched from Poker Flat, Alaska on 13 March 1997 at 10:20:31 UT, measured electron precipitation over the range ~10 eV to 500 keV covering pitch-angles from 0 to 180°. Data show electrons with energies <1 keV are mostly secondaries produced below the rocket altitude by the higher energy precipitated electrons. We observed nearly equal fluxes of up and down going electrons for energies <1 keV at altitudes from 265 to 380 km. Electron transport simulation results indicate the secondaries produced by the more energetic electrons will have two times higher flux in the upward direction as compared to the downward direction. Our observations of nearly equal fluxes of up and downgoing electrons over a large range of altitudes is consistent with the presence of an electric potential above the rocket that reflects the upgoing electrons back toward the rocket where they are detected as downward going electrons. The strength of the potential is estimated to be 1.5±0.5 kV and its location is no greater than 5000km above the rocket. Finally, the inferred potential drop exists independently of the presence of pulsations.

  17. Characterization of cadmium uptake by the water lily Nymphaea aurora.

    Science.gov (United States)

    Schor-Fumbarov, Tamar; Keilin, Zvika; Tel-Or, Elisha

    2003-01-01

    This study characterizes cadmium (Cd) uptake by the waterlily Nymphaea aurora, (Nymphaeaceae) in two systems: a model hydroponic Cd solution and heavily polluted sludge from two sites in Israel. The uptake of Cd from hydroponic solution resulted in Cd storage in petioles and laminae of Nymphaea, as well as in the roots. The pH of the solution affected Cd solubility and availability, with pH 5.5 yielding maximum Cd content in the plant (140 mg Cd per g DW). Cd uptake was reduced by the addition of EDTA to the hydroponic growth medium, although EDTA enhanced heavy metal uptake by terrestrial plants. Nymphaea efficiently reduced the concentration of Cd in heavy metal polluted urban and industrial sludge and the amount of Cd uptake was enhanced by the addition of KCl to the sludge and by adjustment of the pH to 5.5. The inherent growth patterns of Nymphaea plants allowed Cd uptake by the shoot and root, and resulted in maximum contact between the various plant parts and the growth media. Thus, Nymphaea has potential as an optimal, highly effective phytoremediation tool for the removal of Cd from polluted waste sources.

  18. Aurora 7 the Mercury space flight of M. Scott Carpenter

    CERN Document Server

    Burgess, Colin

    2016-01-01

    TO A NATION enthralled by the heroic exploits of the Mercury astronauts, the launch of Lt. Cmdr. Scott Carpenter on NASA’s second orbital space flight was a renewed cause for pride, jubilation and celebration. Within hours, that excitement had given way to stunned disbelief and anxiety as shaken broadcasters began preparing the American public for the very real possibility that an American astronaut and his spacecraft may have been lost at sea. In fact, it had been a very close call. Completely out of fuel and forced to manually guide Aurora 7 through the frightening inferno of re-entry, Carpenter brought the Mercury spacecraft down to a safe splashdown in the ocean. In doing so, he controversially overshot the intended landing zone. Despite his efforts, Carpenter’s performance on the MA-7 mission was later derided by powerful figures within NASA. He would never fly into space again. Taking temporary leave of NASA, Carpenter participated in the U.S. Navy’s pioneering Sealab program. For a record 30 days...

  19. Ezekiel and the Northern Lights: Biblical aurora seems plausible

    Science.gov (United States)

    Siscoe, George L.; Silverman, Samuel M.; Siebert, Keith D.

    Auroral specialists have suggested that in the Bible's Old Testament book of Ezekiel, the opening vision of a "storm cloud out of the north" depicts imagery inspired by a low-latitude auroral display [Link, 1967; Eather, 1980; Silverman, 1998]. Naturally, other interpretations have been suggested, including a true epiphany, a sandstorm, a thunderstorm, a tornado, a solar halo, a hallucination, and a UFO. Biblical scholars place the site of the Ezekiel's vision about 100 km south of Babylon near Nippur, latitude ˜32°, longitude ˜45°, and the date is within a year or two of 593 B.C., or about 2600 years ago.An auroral interpretation of the vision is subject to possible refutation due to several geophysical considerations. Can auroras be seen at Ezekiel's latitude? More important, can they reach a coronal stage of development, which is what the vision requires? Was the tilt of the dipole axis favorable? Was the general level of solar activity favorable? And finally, What effect does a larger dipole moment in Ezekiel's time have on the question? All but the last question could have been answered on the basis of geophysical data a decade ago or earlier.

  20. Flow, Aurora and PI2 Associations Observed by Themis

    Science.gov (United States)

    Kepko, E. I.

    2010-01-01

    It has been known for decades that auroral substorm onset occurs on (or at least near) the most equatorward auroral arc, which is thought to map to the near geosynchronous region. The lack of auroral signatures poleward of this arc prior to onset has been a major criticism of flow-burst driven models of sub storm onset. The combined THEMIS 5 spacecraft in-situ and ground array measurements provide an unprecedented opportunity to examine the causal relationship between midtail plasma flows, aurora, and ground magnetic signatures. I first present an event from 2008 using multi-spectral all sky imager data from Gillam and in-situ data from THEMIS. The multispectral data indicate an equatorward moving auroral form prior to sub storm onset. When this forms reaches the most equatorward arc, the arc brightens and an auroral substorm begins. The THEMIS data show fast Earthward flows prior to onset as well. I suggest that the results strongly support flow-burst driven models of magnetospheric activity. I discuss further the association of flow bursts and Pi2 pulsations, and discuss the possibility of using Pi2 waveforms to infer midtail reconnection dynamics

  1. Spatial scaling of optical fluctuations during substorm-time aurora

    Directory of Open Access Journals (Sweden)

    B. V. Kozelov

    2007-05-01

    Full Text Available A study of statistical features of auroras during substorm activity is presented, emphasizing characteristics which are commonly applied to turbulent flows. Data from all-sky television (TV observations from the Barentsburg observatory (Svalbard have been used. Features of the probability density function (PDF of auroral fluctuations have been examined at different spatial scales. We find that the observed PDFs generally have a non-Gaussian, heavy-tailed shape. The generalized structure function (GSF for the auroral luminosity fluctuations has been analyzed to determine the scaling properties of the higher (up to 6 order moments, and the evolution of the scaling indices during the actual substorm event has been determined. The scaling features obtained can be interpreted as signatures of turbulent motion of the magnetosphere-ionosphere plasma. Relations to previously obtained results of avalanche analysis of the same event, as well as possible implications for the validity of self-organized criticality models and turbulence models of the substorm activity, are discussed.

  2. Spectrum of the Jovian aurora 1150--1700 A

    Energy Technology Data Exchange (ETDEWEB)

    Durrance, S.T.; Feldman, P.D.; Moos, H.W.

    1982-06-01

    A series of observations of the Northern hemisphere of Jupiter was made in January 1981 using the International Ultraviolet Explorer short-wavelength spectrograph. Exposures of 15 minutes each were made at regular intervals of about 45 minutes around the time when Jupiter's north magnetic pole was tilted toward the Earth. The auroral emissions of H Lyman-..cap alpha.., and the H/sub 2/ Lyman- and Werner-bands are seen to emanate from a localized region near the north pole. Their intensity increases and decreases in a periodic way as the planet rotates with the maximum occurring at lambda/sub III/approx.185/sup 0/. Using the three observations nearest the observed maximum, a composite spectrum of the aurora is obtained with about 8 A resolution and high signal-to-noise ratio, and many of the H/sub 2/ Lyman- and Werner-bands in this spectral region (1150--1700 A) are identified. This spectrum is compared with a laboratory H/sub 2/ spectrum and with photoabsorption cross sections for CH/sub 4/ and C/sub 2/H/sub 6/ An upper limit to the slant column density of these hydrocarbons above the auroral emissions is found to be approx.2 x 10/sup 17/ cm/sup -2/.

  3. The spectrum of the Jovian Aurora 1150-1700 A

    Science.gov (United States)

    Durrance, S. T.; Feldman, P. D.; Moos, H. W.

    1982-01-01

    A series of observations of the northern hemisphere of Jupiter was made in January 1981 using the International Ultraviolet Explorer short-wavelength spectrograph. Exposures of 15 minutes each were made at regular intervals of about 45 minutes around the time when Jupiter's north magnetic pole was tilted toward the earth. The auroral emissions of H Lyman-alpha, and the H2 Lyman- and Werner-bands are seen to emanate from a localized region near the north pole. Their intensity increases and decreases in a periodic way as the planet rotates with the maximum occurring at lambda sub III approximately equal to 185 deg. Using the three observations nearest the observed maximum, a composite spectrum of the aurora is obtained with about 8 A resolution and high signal-to-noise ratio, and many of the H2 Lyman- and Werner-bands in this spectral region (1150-1700 A) are identified. This spectrum is compared with a laboratory H2 spectrum and with photoabsorption cross sections for CH4 and C2H6. An upper limit to the slant column density of these hydrocarbons above the auroral emissions is found to be approximately 2 x 10 to the 17th/sq cm.

  4. Juno‐UVS approach observations of Jupiter's auroras

    Science.gov (United States)

    Versteeg, M. H.; Greathouse, T. K.; Hue, V.; Davis, M. W.; Gérard, J.‐C.; Grodent, D. C.; Bonfond, B.; Nichols, J. D.; Wilson, R. J.; Hospodarsky, G. B.; Bolton, S. J.; Levin, S. M.; Connerney, J. E. P.; Adriani, A.; Kurth, W. S.; Mauk, B. H.; Valek, P.; McComas, D. J.; Orton, G. S.; Bagenal, F.

    2017-01-01

    Abstract Juno ultraviolet spectrograph (UVS) observations of Jupiter's aurora obtained during approach are presented. Prior to the bow shock crossing on 24 June 2016, the Juno approach provided a rare opportunity to correlate local solar wind conditions with Jovian auroral emissions. Some of Jupiter's auroral emissions are expected to be controlled or modified by local solar wind conditions. Here we compare synoptic Juno‐UVS observations of Jupiter's auroral emissions, acquired during 3–29 June 2016, with in situ solar wind observations, and related Jupiter observations from Earth. Four large auroral brightening events are evident in the synoptic data, in which the total emitted auroral power increases by a factor of 3–4 for a few hours. Only one of these brightening events correlates well with large transient increases in solar wind ram pressure. The brightening events which are not associated with the solar wind generally have a risetime of ~2 h and a decay time of ~5 h. PMID:28989207

  5. Chandra HRC Observations of X-rays from Jupiter's Aurora

    Science.gov (United States)

    Gladstone, G. R.; Majeed, T.; Lewis, W. S.; Jahn, J.-M.; Waite, J. H., Jr.; Grodent, D. C.; Crary, F. J.; Clarke, J. T.; Young, D. T.; Elsner, R. F.

    2001-01-01

    In support of the Cassini flyby of Jupiter, the Chandra HRC was used to observe the Jovian system for 10 hours on December 18, 2000, from 10-20 UT. Analysis of the data has yielded the following results: 1) a strong, high-latitude northern auroral "hot spot." which is relatively fixed near 60-70 degrees north latitude and 160-180 degrees system III longitude, and which pulsates with a period of about 40 minutes and has an average emitted power of about 2 GW; 2) relatively uniform low-latitude emissions, with a total power output of about 5 GW; 3) a southern aurora which shows both high latitude emissions and lower-latitude emissions originating in the L=8-12 region just outside the Io Plasma Torus, with an emitted power of about 1 GW. These power estimates are based on an assumed emission wavelength of 574 eV (corresponding to a bright emission line of OVII ions), and are subject to revision as Chandra ACIS spectra of Jupiter are analyzed further. We will present these and other results from this unique data set.

  6. Jovian Northern Ethane Aurora and the Solar Cycle

    Science.gov (United States)

    Kostiuk,T.; Livengood, T.; Fast, K.; Buhl, D.; Goldstein, J.; Hewagama, T.

    1999-01-01

    Thermal infrared auroral spectra from Jupiter's North polar region have been collected from 1979 to 1998 in a continuing study of long-term variability in the northern thermal IR aurora, using C2H6 emission lines near 12 microns as a probe. Data from Voyager I and 2 IRIS measurements and ground based spectral measurements were analyzed using the same model atmosphere to provide a consistent relative comparison. A retrieved equivalent mole fraction was used to compare the observed integrated emission. Short term (days), medium term (months) and long term (years) variability in the ethane emission was observed. The variability Of C2H6 emission intensities was compared to Jupiter's seasonal cycle and the solar activity cycle. A positive correlation appears to exist, with significantly greater emission and short term variability during solar maxima. Observations on 60 N latitude during increased solar activity in 1979, 1989, and most recently in 1998 show up to 5 times brighter integrated line emission of C2H6 near the north polar "hot spot" (150-210 latitude) than from the north quiescent region. Significantly lower enhancement was observed during periods of lower solar activity in 1982, 1983, 1993, and 1995. Possible sources and mechanisms for the enhancement and variability will be discussed.

  7. Juno-UVS approach observations of Jupiter's auroras.

    Science.gov (United States)

    Gladstone, G R; Versteeg, M H; Greathouse, T K; Hue, V; Davis, M W; Gérard, J-C; Grodent, D C; Bonfond, B; Nichols, J D; Wilson, R J; Hospodarsky, G B; Bolton, S J; Levin, S M; Connerney, J E P; Adriani, A; Kurth, W S; Mauk, B H; Valek, P; McComas, D J; Orton, G S; Bagenal, F

    2017-08-16

    Juno ultraviolet spectrograph (UVS) observations of Jupiter's aurora obtained during approach are presented. Prior to the bow shock crossing on 24 June 2016, the Juno approach provided a rare opportunity to correlate local solar wind conditions with Jovian auroral emissions. Some of Jupiter's auroral emissions are expected to be controlled or modified by local solar wind conditions. Here we compare synoptic Juno-UVS observations of Jupiter's auroral emissions, acquired during 3-29 June 2016, with in situ solar wind observations, and related Jupiter observations from Earth. Four large auroral brightening events are evident in the synoptic data, in which the total emitted auroral power increases by a factor of 3-4 for a few hours. Only one of these brightening events correlates well with large transient increases in solar wind ram pressure. The brightening events which are not associated with the solar wind generally have a risetime of ~2 h and a decay time of ~5 h.

  8. Selective disruption of aurora C kinase reveals distinct functions from aurora B kinase during meiosis in mouse oocytes.

    Directory of Open Access Journals (Sweden)

    Ahmed Z Balboula

    2014-02-01

    Full Text Available Aurora B kinase (AURKB is the catalytic subunit of the chromosomal passenger complex (CPC, an essential regulator of chromosome segregation. In mitosis, the CPC is required to regulate kinetochore microtubule (K-MT attachments, the spindle assembly checkpoint, and cytokinesis. Germ cells express an AURKB homolog, AURKC, which can also function in the CPC. Separation of AURKB and AURKC function during meiosis in oocytes by conventional approaches has not been successful. Therefore, the meiotic function of AURKC is still not fully understood. Here, we describe an ATP-binding-pocket-AURKC mutant, that when expressed in mouse oocytes specifically perturbs AURKC-CPC and not AURKB-CPC function. Using this mutant we show for the first time that AURKC has functions that do not overlap with AURKB. These functions include regulating localized CPC activity and regulating chromosome alignment and K-MT attachments at metaphase of meiosis I (Met I. We find that AURKC-CPC is not the sole CPC complex that regulates the spindle assembly checkpoint in meiosis, and as a result most AURKC-perturbed oocytes arrest at Met I. A small subset of oocytes do proceed through cytokinesis normally, suggesting that AURKC-CPC is not the sole CPC complex during telophase I. But, the resulting eggs are aneuploid, indicating that AURKC is a critical regulator of meiotic chromosome segregation in female gametes. Taken together, these data suggest that mammalian oocytes contain AURKC to efficiently execute meiosis I and ensure high-quality eggs necessary for sexual reproduction.

  9. Ham radio for dummies

    CERN Document Server

    Silver, H Ward

    2013-01-01

    An ideal first step for learning about ham radio Beyond operating wirelessly, today's ham radio operators can transmit data and pictures; use the Internet, laser, and microwave transmitters; and travel to places high and low to make contact. This hands-on beginner guide reflects the operational and technical changes to amateur radio over the past decade and provides you with updated licensing requirements and information, changes in digital communication (such as the Internet, social media, and GPS), and how to use e-mail via radio. Addresses the critical use of ham radio for replacing downe

  10. Validation of Aurora Solar Inc.'s Envision Software Capabilities

    Energy Technology Data Exchange (ETDEWEB)

    2017-04-03

    As part of the Department of Energy's SunShot Incubator program, Aurora has worked to develop a web-based application that quickly and precisely calculates the solar potential of a building's roof. The Aurora Envision platform utilizes Google StreetView photos as a basis for measuring roof slope and linear measurements of determining the proper inputs into an eventual shade model. The stated accuracy by Aurora Solar to be tested is lengths within 1.5 feet and slope measurements within 5 degrees. The National Renewable Energy Laboratory (NREL), in partnership with Aurora and supported by the U.S. Department of Energy's (DOE) SunShot Technology to Market Incubator program, independently verified the accuracy of Aurora's Envision measurements on 15 unique roofs throughout the Denver, Colorado region. NREL measured 60 measurements: 27 of 28 slope measurements were within the stated accuracy, 32 of 32 distance measurements were within the stated accuracy.

  11. The role of external triggers in flow shear arcs in the dayside aurora

    Directory of Open Access Journals (Sweden)

    P. E. Sandholt

    2008-08-01

    Full Text Available In case studies we relate dayside auroral transients to IMF By-distorted plasma convection cells based on high-resolution observations from the ground. We selected three days representing positive and negative IMF By conditions when SuperDARN returned reliable dayside convection patterns in the sector of our optical observations from Ny Ålesund, Svalbard (76° MLAT. We combine two perspectives on the dayside aurora, the local and the global. In the first we derive the fine-structure of dayside precipitation/convection as a function of magnetic latitude (MLAT and magnetic local time (MLT, which is necessary to understand the local M-I coupling processes (Birkeland current structure. The larger perspective (quasi-global dayside aurora may be used to shed light on the solar wind-magnetosphere interconnection topology. The auroral morphology consists of brightening events and poleward moving auroral forms (PMAFs in the pre- and postnoon sectors longitudinally separated by a band of strongly attenuated aurora near noon. We find that the MLT-dependent spatial structure in the dayside aurora (PMAFs/prenoon – "midday gap aurora" – PMAFs/postnoon which is present during stable IMF conditions is altered by temporal structure during intervals of IMF/solar wind plasma transients. The focus is on the PMAF substructure (so-called "rebrightening forms" which we identify as dynamical plasma flow shear arcs (FSAs in By-distorted dawn- and dusk-centered convection cells in the close vicinity of the cusp.

  12. A comprehensive review on Aurora kinase: Small molecule inhibitors and clinical trial studies.

    Science.gov (United States)

    Borisa, Ankit C; Bhatt, Hardik G

    2017-11-10

    Aurora kinase belongs to serine/threonine kinase family which controls cell division. Therapeutic inhibition of Aurora kinase showed great promise as probable anticancer regime because of its important role during cell division. Here, in this review, we have carried out exhaustive study of various synthetic molecules reported as Aurora kinase inhibitors and developed as lead molecule at various stages of clinical trials from its discovery in 1995 to till date. We reported details of small molecules, specifically inhibiting all 3 types of Aurora kinases, which includes extensive literature search in various database like various scientific journals, patents, scifinder and PubMed database, internet resources, books, etc. IC50 values of tumor growth inhibition, in-vitro and in-vivo activity along with clinical trial data. Here, we took efforts to describe essence of Aurora kinase and its inhibition which could be used to develop anti-mitotic drug for the treatment of cancer. In conclusion, we also discuss future perspectives for development of novel inhibitors and their scope in drug development process. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  13. Aurora A phosphorylates MCAK to control ran-dependent spindle bipolarity.

    Science.gov (United States)

    Zhang, Xin; Ems-McClung, Stephanie C; Walczak, Claire E

    2008-07-01

    During mitosis, mitotic centromere-associated kinesin (MCAK) localizes to chromatin/kinetochores, a cytoplasmic pool, and spindle poles. Its localization and activity in the chromatin region are regulated by Aurora B kinase; however, how the cytoplasmic- and pole-localized MCAK are regulated is currently not clear. In this study, we used Xenopus egg extracts to form spindles in the absence of chromatin and centrosomes and found that MCAK localization and activity are tightly regulated by Aurora A. This regulation is important to focus microtubules at aster centers and to facilitate the transition from asters to bipolar spindles. In particular, we found that MCAK colocalized with NuMA and XMAP215 at the center of Ran asters where its activity is regulated by Aurora A-dependent phosphorylation of S196, which contributes to proper pole focusing. In addition, we found that MCAK localization at spindle poles was regulated through another Aurora A phosphorylation site (S719), which positively enhances bipolar spindle formation. This is the first study that clearly defines a role for MCAK at the spindle poles as well as identifies another key Aurora A substrate that contributes to spindle bipolarity.

  14. Radiography of Spanish Radio

    Directory of Open Access Journals (Sweden)

    Dra. Emma Rodero Antón

    2007-01-01

    Full Text Available In its eighty years of existence, radio has been always characterized to adapt to the social, cultural and technological transformations. Thus it has been until this moment. Nevertheless, some years ago, the authors and professionals of this medium have been detecting a stagnation that affects to its structure. At a time in continuous technological evolution, radio demands a deep transformation. For that reason, from the conviction of which the future radio, public and commercial, will necessarily have to renew itself, in this paper we establish ten problems and their possible solutions to the radio crisis in order to draw an x-ray of radio in Spain. Radio has future, but it is necessary to work actively by it. That the radio continues being part of sound of our life, it will depend on the work of all: companies, advertisers, professionals, students, investigators and listeners.

  15. VHF volume-imaging radar observation of aspect-sensitive scatterers tilted in mountain waves above a convective boundary layer

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    2005-06-01

    Full Text Available Thin stable atmospheric layers cause VHF radars to receive increased echo power from near zenith. Layers can be tilted from horizontal, for instance by gravity waves, and the direction of VHF "glinting" is measurable by spatial domain interferometry or many-beam Doppler beam swinging (DBS. This paper uses the Middle and Upper atmosphere (MU radar, Shigaraki, Japan as a volume-imaging radar with 64-beam DBS, to show tilting of layers and air flow in mountain waves. Tilt of aspect-sensitive echo power from horizontal is nearly parallel to air flow, as assumed in earlier measurements of mountain-wave alignment. Vertical-wind measurements are self-consistent from different beam zenith angles, despite the combined effects of aspect sensitivity and horizontal-wind gradients.

  16. Project Aether Aurora: STEM outreach near the arctic circle

    Science.gov (United States)

    Longmier, B. W.; Bering, E. A.

    2012-12-01

    Project Aether is a program designed to immerse high-school through graduate students to field research in some of the fields of STEM. The program leaders launch high altitude weather balloons in collaboration with schools and students to teach physics concepts, experimental research skills, and to make space exploration accessible to students. A weather balloon lifts a specially designed payload package that is composed of HD cameras, GPS tracking devices, and other science equipment. The payload is constructed and attached to the balloon by the students with low-cost materials. The balloon and payload are launched with FAA clearance from a site chosen based on wind patterns and predicted landing locations. The balloon ascends over 2 hours to a maximum altitude of 100,000 feet where it bursts and allows the payload to slowly descend using a built-in parachute. The balloon's location is monitored during its flight by GPS-satellite relay. Most of the science and video data are recorded on SD cards using an Arduino digitizer. The payload is located using the GPS device. The science data are recovered from the payload and shared with the students. In April 2012, Project Aether leaders conducted a field campaign near Fairbanks Alaska, sending several student-built experiments to an altitude of 30km, underneath several strong auroral displays. Auroral physics experiments that can be done on ultra small balloons (5 cubic meters) include electric field and magnetic fluctuation observations, full spectrum and narrow band optical imaging, GPS monitoring of the total electron content of the ionosphere, x-ray detection and infrared and UV spectroscopy. The actual undergraduate student experiments will be reviewed and some data presented.; Balloon deployment underneath aurora, Fairbanks Alaska, 2012.

  17. Double layers in the downward current region of the aurora

    Directory of Open Access Journals (Sweden)

    R. E. Ergun

    2003-01-01

    Full Text Available Direct observations of magnetic-field-aligned (parallel electric fields in the downward current region of the aurora provide decisive evidence of naturally occurring double layers. We report measurements of parallel electric fields, electron fluxes and ion fluxes related to double layers that are responsible for particle acceleration. The observations suggest that parallel electric fields organize into a structure of three distinct, narrowly-confined regions along the magnetic field (B. In the "ramp" region, the measured parallel electric field forms a nearly-monotonic potential ramp that is localized to ~ 10 Debye lengths along B. The ramp is moving parallel to B at the ion acoustic speed (vs and in the same direction as the accelerated electrons. On the high-potential side of the ramp, in the "beam" region, an unstable electron beam is seen for roughly another 10 Debye lengths along B. The electron beam is rapidly stabilized by intense electrostatic waves and nonlinear structures interpreted as electron phase-space holes. The "wave" region is physically separated from the ramp by the beam region. Numerical simulations reproduce a similar ramp structure, beam region, electrostatic turbulence region and plasma characteristics as seen in the observations. These results suggest that large double layers can account for the parallel electric field in the downward current region and that intense electrostatic turbulence rapidly stabilizes the accelerated electron distributions. These results also demonstrate that parallel electric fields are directly associated with the generation of large-amplitude electron phase-space holes and plasma waves.

  18. Aurora B regulates spindle bipolarity in meiosis in vertebrate oocytes.

    Science.gov (United States)

    Shao, Hua; Ma, Chunqi; Zhang, Xuan; Li, Ruizhen; Miller, Ann L; Bement, William M; Liu, X Johné

    2012-07-15

    Aurora B (Aur-B) plays multiple roles in mitosis, of which the best known are to ensure bi-orientation of sister chromatids by destabilizing incorrectly attached kinetochore microtubules and to participate in cytokinesis. Studies in Xenopus egg extracts, however, have indicated that Aur-B and the chromosome passenger complex play an important role in stabilizing chromosome-associated spindle microtubules. Aur-B stabilizes spindle microtubules in the egg extracts by inhibiting the catastrophe kinesin MCAK. Whether or not Aur-B plays a similar role in intact oocytes remains unknown. Here we have employed a dominant-negative Aur-B mutant (Aur-B122R, in which the ATP-binding lysine(122) is replaced with arginine) to investigate the function of Aur-B in spindle assembly in Xenopus oocytes undergoing meiosis. Overexpression of Aur-B122R results in short bipolar spindles or monopolar spindles, with higher concentrations of Aur-B122R producing mostly the latter. Simultaneous inhibition of MCAK translation in oocytes overexpressing Aur-B122R results in suppression of monopolar phenotype, suggesting that Aur-B regulates spindle bipolarity by inhibiting MCAK. Furthermore, recombinant MCAK-4A protein, which lacks all four Aur-B phosphoryaltion sites and is therefore insensitive to Aur-B inhibition but not wild-type MCAK, recapitulated the monopolar phenotype in the oocytes. These results suggest that in vertebrate oocytes that lack centrosomes, one major function of Aur-B is to stabilize chromosome-associated spindle microtubules to ensure spindle bipolarity.

  19. Diffuse Jovian aurora influenced by plasma injection from IO

    Energy Technology Data Exchange (ETDEWEB)

    Thorne, R.M.; Tsurutani, B.T.

    1979-08-01

    Cyclotron resonant instability of Jovian energetic electrons is dramatically enhanced as a consequence of the lower resonant electron energy (E/sub res/proportionalB/sup 2//8..pi..N) within the equatorial high density plasma torus surrounding the orbit of Io. This mechanism accounts adequately for the continuous broad band whistler mode waves observed within the Io torus on Voyager I. The higher energy resonant electrons (approx.100 keV to 1 MeV) can be scattered by the observed low frequency waves (< or approx. =1 kHz) at a rate as high as 10 percent of the limit attainable under strong pitch-angle diffusion; the corresponding energetic electron lifetimes are comparable to a day. This is much shorter than any realistic estimates for radial diffusion transport near Io. Thus an efficient local acceleration process is required to continually replenish the precipitating relativistic electrons. Concomitant energy deposition into the Jovian atmosphere is estimated to be approx.5 to 15 ergs cm/sup -2/ sec/sup -1/ over a broad invariant latitude range mapping from the Io plasma torus (65/sup 0/< or approx. =..lambda..< or approx. =75/sup 0/). This intense precipitation should both provide a dominant source of middle atmospheric ionization and excite a continuous band of diffuse auroral emission. In the absence of significant extinction, H Ly..cap alpha.. intensity is estimated to be 30 to 100 kR in approximate agreement with the Voyager Extreme Ultraviolet observations. Total power dissipation over the diffuse auroral zone should be at least 10/sup 13/ watts. Because the cyclotron resonant scattering process is strongly influenced by the ambient equatorial thermal plasma density we suggest that the diffuse Jovian aurora should be influenced by the variable volcanic activity on Io which is thought to be an important source of plasma.

  20. Urochordate ascidians possess a single isoform of Aurora kinase that localizes to the midbody via TPX2 in eggs and cleavage stage embryos.

    Directory of Open Access Journals (Sweden)

    Celine Hebras

    Full Text Available Aurora kinases are key proteins found throughout the eukaryotes that control mitotic progression. Vertebrate Aurora-A and B kinases are thought to have evolved from a single Aurora-kinase isoform closest to that found in present day urochordates. In urochordate ascidians Aurora binds both TPX2 (a vertebrate AURKA partner and INCENP (a vertebrate AURKB partner and localizes to centrosomes and spindle microtubules as well as chromosomes and midbody during both meiosis and mitosis. Ascidian Aurora also displays this localization pattern during mitosis in echinoderms, strengthening the idea that non-vertebrate deuterostomes such as the urochordates and echinoderms possess a single form of Aurora kinase that has properties of vertebrate Aurora-kinase A and B. In the ascidian, TPX2 localizes to the centrosome and the spindle poles also as in vertebrates. However, we were surprised to find that TPX2 also localized strongly to the midbody in ascidian eggs and embryos. We thus examined more closely Aurora localization to the midbody by creating two separate point mutations of ascidian Aurora predicted to perturb binding to TPX2. Both forms of mutated Aurora behaved as predicted: neither localized to spindle poles where TPX2 is enriched. Interestingly, neither form of mutated Aurora localized to the midbody where TPX2 is also enriched, suggesting that ascidian Aurora midbody localization required TPX2 binding in ascidians. Functional analysis revealed that inhibition of Aurora kinase with a pharmacological inhibitor or with a dominant negative kinase dead form of Aurora caused cytokinesis failure and perturbed midbody formation during polar body extrusion. Our data support the view that vertebrate Aurora-A and B kinases evolved from a single non-vertebrate deuterostome ancestor. Moreover, since TPX2 localizes to the midbody in ascidian eggs and cleavage stage embryos it may be worthwhile re-assessing whether Aurora A kinase or TPX2 localize to the midbody

  1. Aurora Flight Sciences' Perseus B Remotely Piloted Aircraft in Flight

    Science.gov (United States)

    1998-01-01

    A long, slender wing and a pusher propeller at the rear characterize the Perseus B remotely piloted research aircraft, seen here during a test flight in June 1998. Perseus B is a remotely piloted aircraft developed as a design-performance testbed under NASA's Environmental Research Aircraft and Sensor Technology (ERAST) project. Perseus is one of several flight vehicles involved in the ERAST project. A piston engine, propeller-powered aircraft, Perseus was designed and built by Aurora Flight Sciences Corporation, Manassas, Virginia. The objectives of Perseus B's ERAST flight tests have been to reach and maintain horizontal flight above altitudes of 60,000 feet and demonstrate the capability to fly missions lasting from 8 to 24 hours, depending on payload and altitude requirements. The Perseus B aircraft established an unofficial altitude record for a single-engine, propeller-driven, remotely piloted aircraft on June 27, 1998. It reached an altitude of 60,280 feet. In 1999, several modifications were made to the Perseus aircraft including engine, avionics, and flight-control-system improvements. These improvements were evaluated in a series of operational readiness and test missions at the Dryden Flight Research Center, Edwards, California. Perseus is a high-wing monoplane with a conventional tail design. Its narrow, straight, high-aspect-ratio wing is mounted atop the fuselage. The aircraft is pusher-designed with the propeller mounted in the rear. This design allows for interchangeable scientific-instrument payloads to be placed in the forward fuselage. The design also allows for unobstructed airflow to the sensors and other devices mounted in the payload compartment. The Perseus B that underwent test and development in 1999 was the third generation of the Perseus design, which began with the Perseus Proof-Of-Concept aircraft. Perseus was initially developed as part of NASA's Small High-Altitude Science Aircraft (SHASA) program, which later evolved into the ERAST

  2. VHF digital ultrasound three-dimensional scanning in the diagnosis of myopic regression after corneal refractive surgery.

    Science.gov (United States)

    Reinstein, Dan Z; Ameline, Barbara; Puech, Michel; Montefiore, Guy; Laroche, Laurent

    2005-01-01

    To perform VHF digital ultrasound scanning and analysis of a case of high-myopic undercorrection in an eye that had undergone multiple surgical interventions for the correction of an initial refraction of -12.00 diopters (D). A 49-year-old woman was evaluated after undergoing three surgical interventions for correction of an initial refraction of -12.00 D in the left eye. Automated lamellar keratoplasty (ALK) was followed by arcuate keratotomy (for induced astigmatism) and surface photorefractive keratectomy (PRK). The residual ametropia on presentation was -6.75 -3.50 x 95 degrees. VHF digital ultrasound scanning and analysis was performed. On ultrasound, the ALK interface was clearly visible. Residual stromal thickness beneath the cap was at least 275 microm. The absence of Bowman's layer indicated the region of PRK. New stroma and nascent stromal layers were differentiated within the flap. Neo stromal deposition and central epithelial hyperplasia were determined to be responsible for the myopic shift, as opposed to biomechanical changes. In this case, refraction, slit-lamp examination, and topography were unable to provide a diagnosis for regression following multiple corneal refractive procedures. By providing layered anatomical mapping, VHF digital ultrasound scanning was able to exclude a diagnosis of ectasia and provide anatomical diagnostic information to explain the clinical observations.

  3. Ubiquitin receptor protein UBASH3B drives Aurora B recruitment to mitotic microtubules

    Science.gov (United States)

    Krupina, Ksenia; Kleiss, Charlotte; Metzger, Thibaud; Fournane, Sadek; Schmucker, Stephane; Hofmann, Kay; Fischer, Benoit; Paul, Nicodeme; Porter, Iain Malcolm; Raffelsberger, Wolfgang; Poch, Olivier; Swedlow, Jason Reese; Brino, Laurent; Sumara, Izabela

    2017-01-01

    Summary Mitosis ensures equal segregation of the genome and is controlled by a variety of ubiquitylation signals on substrate proteins. However, it remains unexplored how the versatile ubiquitin code is read out during mitotic progression. Here, we identify the ubiquitin receptor protein UBASH3B as an important regulator of mitosis. UBASH3B interacts with ubiquitylated Aurora B, one of the main kinases regulating chromosome segregation, and controls its subcellular localization but not protein levels. UBASH3B is a limiting factor in this pathway, and is sufficient to drive Aurora B to microtubules prior to anaphase. Importantly, targeting Aurora B to microtubules by UBASH3B is necessary for the timing and fidelity of chromosome segregation in human cells. Our findings uncover an important mechanism defining how ubiquitin attachment to a substrate protein is decoded during mitosis. PMID:26766443

  4. Historical Auroras in the 990s: Evidence of Great Magnetic Storms

    Science.gov (United States)

    Hayakawa, Hisashi; Tamazawa, Harufumi; Uchiyama, Yurina; Ebihara, Yusuke; Miyahara, Hiroko; Kosaka, Shunsuke; Iwahashi, Kiyomi; Isobe, Hiroaki

    2017-01-01

    A significant carbon-14 enhancement has recently been found in tree rings for the year 994, suggesting an extremely strong and brief cosmic ray flux event. The origin of this particular cosmic ray event has not been confirmed, but one possibility is that it might be of solar origin. Contemporary historical records of low-latitude auroras can be used as supporting evidence of intense solar activity around that time. We investigate previously reported as well as new records that have been found in contemporary observations from the 990s to determine potential auroras. Records of potential red auroras in late 992 and early 993 were found around the world, i.e. in the Korean Peninsula, Saxonian cities in modern Germany, and the Island of Ireland, suggesting the occurrence of an intense geomagnetic storm driven by solar activity.

  5. Giant cell glioblastoma is associated with altered aurora b expression and concomitant p53 mutation.

    Science.gov (United States)

    Temme, Achim; Geiger, Kathrin D; Wiedemuth, Ralf; Conseur, Katharina; Pietsch, Torsten; Felsberg, Jörg; Reifenberger, Guido; Tatsuka, Masaaki; Hagel, Christian; Westphal, Manfred; Berger, Hilmar; Simon, Matthias; Weller, Michael; Schackert, Gabriele

    2010-06-01

    Giant cell glioblastoma (gcGB), a subtype of GB, is characterized by the presence of numerous multinucleated giant cells. The prognosis for gcGB is poor, but it may have a better clinical outcome compared with classic GB. The molecular alterations that lead to the multinucleated cell phenotype of gcGB have not been elucidated. Giant cell GB has a higher frequency of the tumor suppressor protein p53 mutations than GB, however, and a role for the mitotic Aurora B kinase has been suggested. We analyzed Aurora B expression in gcGB (n = 28) and GB (n = 54) patient tumor samples by immunohistochemistry; 17 gcGB and 22 GB samples were analyzed at the DNA and mRNA levels. No mutations in the Aurora B gene (AURKB) were found, but its mRNA and protein levels were significantly higher in gcGB than in GB. Fifty-nine percent of gcGB samples but only 18% of the GB samples showed p53 mutations. Ectopic overexpression of Aurora B induced a significant increase inthe proportion of multinucleated cells in p53 mutant U373-MG, but not in p53 wild-type U87-MG, glioma cells. RNAi of p53 in U87-MG cells led to an increase in the fraction of multinucleated cells that was further augmented by ectopic overexpression of Aurora B. These results suggest that loss of p53 function and dysregulated Aurora B protein levels might represent factors that drive the development of multinucleated cells in gcGB.

  6. Heart rate variability (HRV) analysis in radio and TV broadcasting stations workers.

    Science.gov (United States)

    Bortkiewicz, Alicja; Gadzicka, Elżbieta; Szymczak, Wiesław; Zmyślony, Marek

    2012-09-01

    The aim of the study was to assess the mechanism of cardiovascular impairments in workers exposed to UHF-VHF radio frequency electromagnetic fields (EMF). Heart rate variability (HRV) was analysed using 512 normal heart beats registered at rest. The analysis concerned time-domain (STD R-R) and frequency-domain (VLF, LF, HF) parameters of HRV. Fifty nine workers (group I) with low-level and 12 workers (group II) with high-level exposure were examined. The mean age of the subjects was 47 ± 9 years and 41 ± 14 years, and mean exposure duration 19.1 ± 8.8 years and 13 ± 4 years, in groups I and II, respectively. The groups were divided according to: E(max), E(dose), E(mean) for frequencies UHF, VHF and UHF+VHF: The control group consisted of 42 non-exposed subjects, aged 49 ± 8 years. Statistical analysis comprised one-way analysis of variance, covariance analysis and logistic regression models. In the exposed groups, the heart rate was higher than in the control one. Standard deviation of R-R intervals (STD R-R) was found to be significantly (p = 0.0285) lower in group I (42.5 ± 24.7 ms) compared to the control group (62.9 ± 53.5 ms). The risk of lowered STD R-R was significantly increased (OR = 2.37, p = 0.023) in group II. Both exposed groups presented significantly higher VLF and LF values than the control group (p = 0.005 and p = 0.0025, respectively). The EMF-exposed groups were characterised by the dominance of the sympathetic system (LF/HF 1.3 ± 0.35). The results indicate that exposure to radiofrequency EMF may affect the neurovegetative regulation.

  7. First results from an iron lidar and a VHF radar at Davis, Antarctica

    Science.gov (United States)

    Luebken, F.; Morris, R. J.; Hoeffner, J.; Kaifler, B.; Viehl, T.

    2012-12-01

    We present temperature measurements at Davis, Antarctica (69°S, 78°E), and compare with simultaneous and co-located radar measurements of polar mesosphere summer echoes (PMSE). The mobile scanning iron lidar of the IAP in Kuehlungsborn was installed at Davis in December 2010. It measures iron densities, vertical winds, and temperatures in the iron layer, i. e. from approximately 80 to 100 km. It is based on probing the Doppler broadened resonance line of iron atoms at 386 nm and can operate under daylight conditions. Typical values for temperature uncertainty, altitude and time resolution are 3-5 K, 1 km, and 1 hour, respectively. The lidar also measures neutral air densities and temperatures in the stratosphere and lower mesosphere. At Davis the lidar has up to now achieved approximately 2700 hours of data which is presumably the largest nearly continuous data set in Antarctica. The mesopause altitude changes throughout the summer season by several kilometers, significantly different from the northern hemisphere summer. Depending on altitude, temperatures can be warmer or colder compared to the NH summer. Temperatures at Davis near 86 km are rather similar to the NH, but they are much colder at higher altitudes. The thermal structure around the mesopause at Davis is closely related to the general circulation in the stratosphere, namely to the transition from winter to summer conditions. Different from expectations we sometimes find the mesopause significantly higher and colder(!) compared to the NH. Furthermore, we find large thermal tides in the summer months with amplitudes of up to 6-7~K, which is much larger than expected from models. The Australien Antarctic Division operates a 55 MHz VHF radar at Davis since February 2003. We report first simultaneous measurements of PMSE and temperatures by the Fe lidar. PMSE are strong radar echoes related to ice particles and therefore require atmospheric temperatures being lower than the frost point temperature

  8. ANCHR mediates Aurora-B-dependent abscission checkpoint control through retention of VPS4

    DEFF Research Database (Denmark)

    Thoresen, Sigrid B; Campsteijn, Coen; Vietri, Marina

    2014-01-01

    of the ESCRT machinery, the ATPase VPS4. In concert with CHMP4C, ANCHR associates with VPS4 at the midbody ring following DNA segregation defects to control abscission timing and prevent multinucleation in an Aurora-B-dependent manner. This association prevents VPS4 relocalization to the abscission zone...... and is relieved following inactivation of Aurora B to allow abscission. We propose that the abscission checkpoint is mediated by ANCHR and CHMP4C through retention of VPS4 at the midbody ring....

  9. MATHEMATICAL MODEL OF AUTOMATIC FLIGHT OF POLIKOPTER UAV NAU PKF "AURORA"

    OpenAIRE

    Wang Bo; Volodymyr Kharchenko; Alexandr Nakhaba

    2016-01-01

    Purpose: Development of mathematical and experimental models of polikopter UAV NAU PKF "Aurora" of oktakopter scheme for experimental flights in manual, semi-automatic and unmanned mode.                  Methods: 14/03/2016 - 21/03/2016 held a serіe of experiental flights (10 flights) of 10 rats on altitude 700 meters on polіkopter (oktakopter) NAU PKF "Aurora" in germetic kabіn with the study of his somatic,  nevrologіcal status after the flight. Flights also carried out with experimental a...

  10. Aurora-A overexpression enhances cell-aggregation of Ha-ras transformants through the MEK/ERK signaling pathway

    Directory of Open Access Journals (Sweden)

    Huang Chi-Ying F

    2009-12-01

    Full Text Available Abstract Background Overexpression of Aurora-A and mutant Ras (RasV12 together has been detected in human bladder cancer tissue. However, it is not clear whether this phenomenon is a general event or not. Although crosstalk between Aurora-A and Ras signaling pathways has been reported, the role of these two genes acting together in tumorigenesis remains unclear. Methods Real-time PCR and sequence analysis were utilized to identify Ha- and Ki-ras mutation (Gly -> Val. Immunohistochemistry staining was used to measure the level of Aurora-A expression in bladder and colon cancer specimens. To reveal the effect of overexpression of the above two genes on cellular responses, mouse NIH3T3 fibroblast derived cell lines over-expressing either RasV12and wild-type Aurora-A (designated WT or RasV12 and kinase-inactivated Aurora-A (KD were established. MTT and focus formation assays were conducted to measure proliferation rate and focus formation capability of the cells. Small interfering RNA, pharmacological inhibitors and dominant negative genes were used to dissect the signaling pathways involved. Results Overexpression of wild-type Aurora-A and mutation of RasV12 were detected in human bladder and colon cancer tissues. Wild-type Aurora-A induces focus formation and aggregation of the RasV12 transformants. Aurora-A activates Ral A and the phosphorylation of AKT as well as enhances the phosphorylation of MEK, ERK of WT cells. Finally, the Ras/MEK/ERK signaling pathway is responsible for Aurora-A induced aggregation of the RasV12 transformants. Conclusion Wild-type-Aurora-A enhances focus formation and aggregation of the RasV12 transformants and the latter occurs through modulating the Ras/MEK/ERK signaling pathway.

  11. The radio structure of radio-quiet quasars

    NARCIS (Netherlands)

    Leipski, C.; Falcke, H.D.E.; Bennert, N.; Hüttemeister, S.

    2006-01-01

    Aims.We investigate the radio emitting structures of radio-quiet active galactic nuclei with an emphasis on radio-quiet quasars to study their connection to Seyfert galaxies.
    Methods: .We present and analyse high-sensitivity VLA radio continuum images of 14 radio-quiet quasars and six Seyfert

  12. Senior radio listeners

    DEFF Research Database (Denmark)

    Blaakilde, Anne Leonora

    media platforms, not the least when listening to radio. The elder generation is no exception from this. Recently, for instance, the Danish public broadcast DR has carried out an exodus of programmes targeted for the senior segment. These programmes are removed from regular FM and sent to DAB receivers......Radiobroadcasting and the hardware materialization of radio have during the 20th century changed significantly, which means that senior radio listeners have travelled along with this evolution from large, impressive radio furnitures to DAB and small, wireless, mobile devices, and from grave...... and solemn radio voices to lightharted, laughing and chatting speakers. Senior radio listerners have experienced the development and refinements of technique, content and genres. It is now expected of all media users that they are capable of crossing media, combining, juggling and jumping between various...

  13. STEM on the radio

    Science.gov (United States)

    Showstack, Randy

    2011-10-01

    Looking for an Internet radio station focusing on programing about science, technology, engineering, and math (STEM)? The U.S. National Science Foundation (NSF) announced on 26 September the launch of Science360 Radio, which it says is the first Internet radio stream dedicated to STEM programing. Science360 includes more than 100 radio shows and podcasts that are available on the Web as well as on iPhone and Android devices. The shows originate from a variety of sources, including NSF, other U.S. government agencies, science organizations, universities, and media outlets. For more information, see http://science360.gov/files/.

  14. A Zynq-based Cluster Cognitive Radio

    OpenAIRE

    Rooks, Kurtis M.

    2014-01-01

    Traditional hardware radios provide very rigid solutions to radio problems. Intelligent software defined radios, also known as cognitive radios, provide flexibility and agility compared to hardware radio systems. Cognitive radios are well suited for radio applications in a changing radio frequency environment, such as dynamic spectrum access. In this thesis, a cognitive radio is demonstrated where the system self reconfigures to dem...

  15. Long-period unstable gravity-waves and associated VHF radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    Full Text Available VHF atmospheric radar is used to measure the wind velocity and radar echo power related to long-period wind perturbations, including gravity waves, which are observed commonly in the lower stratosphere and tropopause region, and sometimes in the troposphere. These wind structures have been identified previously as either inertia-gravity waves, often associated with jet streams, or mountain waves. At heights of peak wind shear, imbalances are found between the echo powers of a symmetric pair of radar beams, which are expected to be equal. The largest of these power differences are found for conditions of simultaneous high wind shear and high aspect sensitivity. It is suggested that the effect might arise from tilted specular reflectors or anisotropic turbulent scatterers, a result of, for example, Kelvin-Helmholtz instabilities generated by the strong wind shears. This radar power-difference effect could offer information about the onset of saturation in long-period waves, and the formation of thin layers of turbulence.

  16. Anisotropy of Doppler spectral parameters in the VHF radar observations at MU and White Sands

    Directory of Open Access Journals (Sweden)

    G. D. Nastrom

    2001-08-01

    Full Text Available Significant differences are found between the mean spectral widths from beams in the meridional plane and in the zonal plane at both the MU and the White Sands VHF radars. The spectral width in the beam directed perpendicular to the prevailing wind is greater than that in the beam parallel to the wind. The magnitudes of the differences in spectral width show a linear relationship with wind speed, with the greatest differences at the greatest wind speeds. The differences in spectral width show a positive correlation with the differences in backscattered power. The anisotropy in backscattered power is well-known and is usually attributed to aspect sensitivity effects. However, the anisotropy in spectral width does not appear to be due to the same mechanism, and while several hypotheses to account for this are considered, including finite range-volume effects, effects from the tilting of isentropic layers, and anisotropic turbulence effects, it is seen that each of these suggestions has its shortcomings.Key words. Meteorology and atmospheric dynamics (turbulence; instruments and techniques

  17. Anisotropy of Doppler spectral parameters in the VHF radar observations at MU and White Sands

    Directory of Open Access Journals (Sweden)

    G. D. Nastrom

    Full Text Available Significant differences are found between the mean spectral widths from beams in the meridional plane and in the zonal plane at both the MU and the White Sands VHF radars. The spectral width in the beam directed perpendicular to the prevailing wind is greater than that in the beam parallel to the wind. The magnitudes of the differences in spectral width show a linear relationship with wind speed, with the greatest differences at the greatest wind speeds. The differences in spectral width show a positive correlation with the differences in backscattered power. The anisotropy in backscattered power is well-known and is usually attributed to aspect sensitivity effects. However, the anisotropy in spectral width does not appear to be due to the same mechanism, and while several hypotheses to account for this are considered, including finite range-volume effects, effects from the tilting of isentropic layers, and anisotropic turbulence effects, it is seen that each of these suggestions has its shortcomings.

    Key words. Meteorology and atmospheric dynamics (turbulence; instruments and techniques

  18. Range imaging observations of PMSE using the EISCAT VHF radar: Phase calibration and first results

    Directory of Open Access Journals (Sweden)

    J. R. Fernandez

    2005-01-01

    Full Text Available A novel phase calibration technique for use with the multiple-frequency Range IMaging (RIM technique is introduced based on genetic algorithms. The method is used on data collected with the European Incoherent SCATter (EISCAT VHF radar during a 2002 experiment with the goal of characterizing the vertical structure of Polar Mesosphere Summer Echoes (PMSE over northern Norway. For typical Doppler measurements, the initial phases of the transmitter and receiver are not required to be the same. The EISCAT receiver systems exploit this fact, allowing a multi-static configuration. However, the RIM method relies on the small phase differences between closely spaced frequencies. As a result, the high-resolution images produced by the RIM method can be significantly degraded if not properly calibrated. Using an enhanced numerical radar simulator, in which data from multiple sampling volumes are simultaneously generated, the proposed calibration method is validated. Subsequently, the method is applied to preliminary data from the EISCAT radar, providing first results of RIM images of PMSE. Data using conventional analysis techniques, and confirmed by RIM, reveal an often-observed double-layer structure with higher stability in the lower layer. Moreover, vertical velocity oscillations exhibit a clear correlation with the apparent motion of the layers shown in the echo power plots.

  19. Study of CNT growth using nanocatalyst Ag precursor by HWC-VHF-PECVD

    Energy Technology Data Exchange (ETDEWEB)

    Eliyana, Ajeng; Rosikin, Ahmad; Winata, Toto, E-mail: toto@fi.itb.ac.id [Physics of Electronics Material Research Division, Physics Programme, Faculty of Mathematics and Natural Sciences, Institut Teknologi Bandung, Jl. Ganesha 10, Bandung 40132, West Java (Indonesia)

    2015-04-16

    The study of CNT growth has been done by using silver (Ag) nanocatalyst as a guide precursor on corning glass 7059 substrate. The silver catalyst was prepared by the evaporation method by varying deposition time for 50, 25, and 14 seconds. The silver films were then annealed at temperature of 400°C for 4 hours. From Scanning Electron Microscope (SEM) and Energy Dispersive X-ray Spectroscopy (EDX) results the grain sizes are 65 nm, 57 nm, and 33 nm, and also the atomic compositions are 6,06%, 4,52%, and 3,73% for 14, 25 and 50 seconds samples, respectively. The 33 nm samples were then used for CNT growth by using Hot Wire Cell (HWC) – Very High Frequency (VHF) – Plasma Enhanced Chemical Vapor Deposition (PECVD) at 275 ° C deposition temperature and pressure of 300 mTorr. The rf power was varied from 8 to 20 watts, with deposition time for 60 minutes. The methane (CH4) 99.999% was used as Carbon sources. Hydrogen gas (H2) was used to etch the oxide layer formed during the pre-deposition process. The diameter and length for the CNT are 125 nm and 1.650 to 2.989 nm respectively.

  20. Multiple Excitation Regimes in Jupiter’s Polar Aurorae

    Science.gov (United States)

    Trafton, Laurence M.

    2017-10-01

    simultaneously, suggesting at least three distinct excitation processes operating within Jupiter's polar aurorae. The emission morphology cannot be explained by the observing geometry nor viewing aspect.

  1. Aurora Flight Sciences' Perseus B Remotely Piloted Aircraft in Flight

    Science.gov (United States)

    1998-01-01

    A long, slender wing and a pusher propeller at the rear characterize the Perseus B remotely piloted research aircraft, seen here during a test flight in June 1998. Perseus B is a remotely piloted aircraft developed as a design-performance testbed under NASA's Environmental Research Aircraft and Sensor Technology (ERAST) project. Perseus is one of several flight vehicles involved in the ERAST project. A piston engine, propeller-powered aircraft, Perseus was designed and built by Aurora Flight Sciences Corporation, Manassas, Virginia. The objectives of Perseus B's ERAST flight tests have been to reach and maintain horizontal flight above altitudes of 60,000 feet and demonstrate the capability to fly missions lasting from 8 to 24 hours, depending on payload and altitude requirements. The Perseus B aircraft established an unofficial altitude record for a single-engine, propeller-driven, remotely piloted aircraft on June 27, 1998. It reached an altitude of 60,280 feet. In 1999, several modifications were made to the Perseus aircraft including engine, avionics, and flight-control-system improvements. These improvements were evaluated in a series of operational readiness and test missions at the Dryden Flight Research Center, Edwards, California. Perseus is a high-wing monoplane with a conventional tail design. Its narrow, straight, high-aspect-ratio wing is mounted atop the fuselage. The aircraft is pusher-designed with the propeller mounted in the rear. This design allows for interchangeable scientific-instrument payloads to be placed in the forward fuselage. The design also allows for unobstructed airflow to the sensors and other devices mounted in the payload compartment. The Perseus B that underwent test and development in 1999 was the third generation of the Perseus design, which began with the Perseus Proof-Of-Concept aircraft. Perseus was initially developed as part of NASA's Small High-Altitude Science Aircraft (SHASA) program, which later evolved into the ERAST

  2. Arctic and Antarctic polar mesosphere summer echoes observed with oblique incidence HF radars: analysis using simultaneous MF and VHF radar data

    Directory of Open Access Journals (Sweden)

    T. Ogawa

    2004-12-01

    Full Text Available Polar mesosphere summer echoes (PMSEs have been well studied using vertical incidence VHF radars at northern high-latitudes. In this paper, two PMSE events detected with the oblique incidence SuperDARN HF radars at Hankasalmi, Finland (62.3° N and Syowa Station, Antarctica (69.0° S, are analyzed, together with simultaneous VHF and medium-frequency (MF radar data. Altitude resolutions of the HF radars in the mesosphere and the lower thermosphere are too poor to know exact PMSE altitudes. However, a comparison of Doppler velocity from the HF radar and neutral wind velocity from the MF radar shows that PMSEs at the HF band appeared at altitudes within 80-90km, which are consistent with those from previous vertical incidence HF-VHF radar results. The HF-VHF PMSE occurrences exhibit a semidiurnal behavior, as observed by other researchers. It is found that in one event, PMSEs occurred when westward semidiurnal winds with large amplitude at 85-88km altitudes attained a maximum. When the HF-VHF PMSEs were observed at distances beyond 180km from MF radar sites, the MF radars detected no appreciable signatures of echo enhancement. Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; thermospheric dynamics; waves and tides

  3. Arctic and Antarctic polar mesosphere summer echoes observed with oblique incidence HF radars: analysis using simultaneous MF and VHF radar data

    Directory of Open Access Journals (Sweden)

    T. Ogawa

    2004-12-01

    Full Text Available Polar mesosphere summer echoes (PMSEs have been well studied using vertical incidence VHF radars at northern high-latitudes. In this paper, two PMSE events detected with the oblique incidence SuperDARN HF radars at Hankasalmi, Finland (62.3° N and Syowa Station, Antarctica (69.0° S, are analyzed, together with simultaneous VHF and medium-frequency (MF radar data. Altitude resolutions of the HF radars in the mesosphere and the lower thermosphere are too poor to know exact PMSE altitudes. However, a comparison of Doppler velocity from the HF radar and neutral wind velocity from the MF radar shows that PMSEs at the HF band appeared at altitudes within 80-90km, which are consistent with those from previous vertical incidence HF-VHF radar results. The HF-VHF PMSE occurrences exhibit a semidiurnal behavior, as observed by other researchers. It is found that in one event, PMSEs occurred when westward semidiurnal winds with large amplitude at 85-88km altitudes attained a maximum. When the HF-VHF PMSEs were observed at distances beyond 180km from MF radar sites, the MF radars detected no appreciable signatures of echo enhancement.

    Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; thermospheric dynamics; waves and tides

  4. Aurora Flash X-Ray Facility as a Source-Region EMP Simulator,

    Science.gov (United States)

    1981-01-01

    displacemeni- current can be neglected, but consideration of the two extre-mes is useful for a cualitative understanding.) When "local effects dominate...Use of the AURORA Machine as a Source-Region Simulator an Antenna CouL Lng Analysis Facility, Proceedings of NATO D_-fense Rer- ch Groui Seminar

  5. Cancer Cell Resistance to Aurora Kinase Inhibitors: Identification of Novel Targets for Cancer Therapy

    Czech Academy of Sciences Publication Activity Database

    Hrabáková, Rita; Kollaredy, M.; Tylečková, Jiřina; Halada, Petr; Hajdúch, M.; Gadher, S. J.; Kovářová, Hana

    2013-01-01

    Roč. 12, č. 1 (2013), s. 455-469 ISSN 1535-3893 R&D Projects: GA MŠk LC07017 Institutional support: RVO:67985904 ; RVO:61388971 Keywords : Aurora kinase inhibitors * resistance * p53 * apoptosis Subject RIV: CE - Biochemistry Impact factor: 5.001, year: 2013

  6. Polo-like kinase-1 controls Aurora A destruction by activating APC/C-Cdh1.

    Directory of Open Access Journals (Sweden)

    Renske van Leuken

    Full Text Available Polo-like kinase-1 (Plk1 is activated before mitosis by Aurora A and its cofactor Bora. In mitosis, Bora is degraded in a manner dependent on Plk1 kinase activity and the E3 ubiquitin ligase SCF-betaTrCP. Here, we show that Plk1 is also required for the timely destruction of its activator Aurora A in late anaphase. It has been shown that Aurora A destruction is controlled by the auxiliary subunit Cdh1 of the Anaphase-Promoting Complex/Cyclosome (APC/C. Remarkably, we found that Plk1-depletion prevented the efficient dephosphorylation of Cdh1 during mitotic exit. Plk1 mediated its effect on Cdh1, at least in part, through direct phosphorylation of the human phosphatase Cdc14A, controlling the phosphorylation state of Cdh1. We conclude that Plk1 facilitates efficient Aurora A degradation through APC/C-Cdh1 activation after mitosis, with a potential role for hCdc14A.

  7. GATEWAY Demonstrations: OLED Lighting in the Offices of Aurora Lighting Design, Inc.

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Naomi J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2016-03-31

    At the offices of Aurora Lighting Design, Inc., in Grayslake, IL, the GATEWAY program conducted its first investigation involving OLED lighting. The project experienced several challenges, but also highlighted a number of promising attributes – which indicate that with continued improvements in efficacy, longevity, size, and flexibility, OLEDs could provide a new tool for creative and effective lighting.

  8. Discovery of Salamandra atra aurorae (Trevisan, 1982 on the Altopiano di Vezzena, Trentino (Northeastern Italy

    Directory of Open Access Journals (Sweden)

    Wouter Beukema

    2008-05-01

    Full Text Available Aurora’s Alpine Salamander is a limited distributed subspecies endemic to the Altopiano di Asiago, Veneto. In the current paper the occurrence of Salamandra atra aurorae is described for the Altopiano di Vezzena, Trentino. The aim of this paper is to review the distribution as well as to comment on the conservational status of the subspecies in Trentino.

  9. Phase separation of BuGZ promotes Aurora A activation and spindle assembly.

    Science.gov (United States)

    Woodruff, Jeffrey B

    2018-01-02

    The spindle matrix has been proposed to facilitate mitotic spindle assembly. In this issue, Huang et al. (2018. J. Cell Biol. https://doi.org/10.1083/jcb.201706103) show that the spindle matrix protein BuGZ is sufficient to form micron-scale compartments that recruit and activate Aurora A, a critical kinase for spindle assembly. © 2018 Woodruff.

  10. Preliminary Results from a Coordinated Hisaki/Chandra/XMM-Newton Study of the Jovian Aurora and Io Plasma Torus

    Science.gov (United States)

    Kraft, Ralph; Kimura, Tomoki; Elsner, Ronald; Branduardi-Raymont, Graziella; Gladstone, Randy; Badman, Sarah Victoria; Ezoe, Yuichiro; Murakami, Go; Murray, Stephen S.; Roediger, Elke; hide

    2014-01-01

    We present preliminary results from a coordinated Hisaki/Chandra/XMM-Newton observational campaign of the Jovian aurora and Io plasma torus. The data were taken over a three week period in April, 2014. Jupiter was observed continuously with Hisaki, six times with the Chandra/HRC instrument for roughly 12 hours per observation, and twice by XMM-Newton. The goal of this observational campaign was to understand how energy and matter are exchanged between the Jovian aurora, the IPT, and the Solar wind. X-ray observations provide key diagnostics on highly stripped ions and keV electrons in the Jovian magnetosphere. We use the temporal, spatial, and spectral capabilities of the three instruments to search for correlated variability between the Solar wind, the EUV-emitting plasma of the IPT and UV aurora, and the ions responsible for the X-ray aurora. Preliminary analysis suggests a strong 45 min periodicity in the EUV emission from the electron aurora. There is some evidence for complex variability of the X-ray auroras on scales of tens of minutes. There is also clear morphological changes in the X-ray aurora that do not appear to be correlated with either variations in the IPT or Solar wind.

  11. Boom Booom Net Radio

    DEFF Research Database (Denmark)

    Grimshaw, Mark Nicholas; Yong, Louisa; Dobie, Ian

    1999-01-01

    of an existing Internet radio station; Boom Booom Net Radio. Whilst necessity dictates some use of technology-related terminology, wherever possible we have endeavoured to keep such jargon to a minimum and to either explain it in the text or to provide further explanation in the appended glossary....

  12. The LOFAR radio environment

    NARCIS (Netherlands)

    Offringa, A. R.; de Bruyn, A. G.; Zaroubi, S.; van Diepen, G.; Martinez-Ruby, O.; Labropoulos, P.; Brentjens, M. A.; Ciardi, B.; Daiboo, S.; Harker, G.; Jelic, V.; Kazemi, S.; Koopmans, L. V. E.; Pandey, V. N.; Pizzo, R. F.; Schaye, J.; Vedantham, H.; Veligatla, V.; Wijnholds, S. J.; Yatawatta, S.; Zarka, P.; Alexov, A.; Anderson, J.; Asgekar, A.; Avruch, M.; Beck, R.; Bell, M.; Bell, M. R.; Bentum, M.; Bernardi, G.; Best, P.; Birzan, L.; Bonafede, A.; Breitling, F.; Broderick, J. W.; Brueggen, M.; Butcher, H.; Conway, J.; de Vos, M.; Dettmar, R. J.; Eisloeffel, J.; Falcke, H.; Fender, R.; Frieswijk, W.; Gerbers, M.; Griessmeier, J. M.; Gunst, A. W.; Hassall, T. E.; Heald, G.; Hessels, J.; Hoeft, M.; Horneffer, A.; Karastergiou, A.; Kondratiev, V.; Koopman, Y.; Kuniyoshi, M.; Kuper, G.; Maat, P.; Mann, G.; McKean, J.; Meulman, H.; Mevius, M.; Mol, J.D.; Nijboer, R.; Noordam, J.; Norden, M.; Paas, H.; Pandey, M.; Pizzo, R.; Polatidis, A.; Rafferty, D.; Rawlings, S.; Reich, W.; Roettgering, H. J. A.; Schoenmakers, A. P.; Sluman, J.; Smirnov, O.; Sobey, C.; Stappers, B.; Steinmetz, M.; Swinbank, J.; Tagger, M.; Tang, Y.; Tasse, C.; van Ardenne, A.; van Cappellen, W.; van Duin, A. P.; van Haarlem, M.; van Leeuwen, J.; van Weeren, R. J.; Vermeulen, R.; Vocks, C.; Wijers, R. A. M. J.; Wise, M.; Wucknitz, O.; Mellema, G.

    Aims. This paper discusses the spectral occupancy for performing radio astronomy with the Low-Frequency Array (LOFAR), with a focus on imaging observations. Methods. We have analysed the radio-frequency interference (RFI) situation in two 24-h surveys with Dutch LOFAR stations, covering 30-78 MHz

  13. Radio Graceful Hamming Graphs

    Directory of Open Access Journals (Sweden)

    Niedzialomski Amanda

    2016-11-01

    Full Text Available For k ∈ ℤ+ and G a simple, connected graph, a k-radio labeling f : V (G → ℤ+ of G requires all pairs of distinct vertices u and v to satisfy |f(u − f(v| ≥ k + 1 − d(u, v. We consider k-radio labelings of G when k = diam(G. In this setting, f is injective; if f is also surjective onto {1, 2, . . . , |V (G|}, then f is a consecutive radio labeling. Graphs that can be labeled with such a labeling are called radio graceful. In this paper, we give two results on the existence of radio graceful Hamming graphs. The main result shows that the Cartesian product of t copies of a complete graph is radio graceful for certain t. Graphs of this form provide infinitely many examples of radio graceful graphs of arbitrary diameter. We also show that these graphs are not radio graceful for large t.

  14. Writing for Radio.

    Science.gov (United States)

    Tupper, Marianna S.

    1995-01-01

    Describes a 24-hour commercial radio station simulation class project for eighth-grade language arts. Students wrote their own scripts, chose music and were disc jockeys on their own music and talk shows, and prepared news and traffic reports. Guest speakers from actual commercial radio came in to discuss issues such as advertising, censorship,…

  15. Uranus radio emissions

    Science.gov (United States)

    Kaiser, Michael L.

    An overview of the Voyager 2 Planetary Radio Astronomy instrument observations of the planet Uranus is presented. From these observations, a number of inferences have been made including the rotation period of the interior of the planet and the source locations of several of the radio components.

  16. Radio Surveys: an Overview

    NARCIS (Netherlands)

    Morganti, Raffaella

    Radio astronomy has provided important surveys that have made possible key (and sometimes serendipitous) discoveries. I will briefly mention some of the past continuum and line (HI) radio surveys as well as new, on-going surveys and surveys planned for the near future. This new generation of large

  17. Ionosphere and Radio Communication

    Indian Academy of Sciences (India)

    The upperionosphere is used for radio communication and navigationas it reflects long, medium, as well as short radio waves. Sincesolar radiation is the main cause of the existence of ionosphere,any variation in the radiations can affect the entireradio communication system. This article attempts to brieflyintroduce the ...

  18. Valuing commercial radio licences

    NARCIS (Netherlands)

    Kerste, M.; Poort, J.; van Eijk, N.

    2015-01-01

    Within the EU regulatory framework, licensees for commercial radio broadcasting may be charged a fee to ensure optimal allocation of scarce resources but not to maximize public revenues. While radio licence renewal occurs in many EU countries, an objective, model-based approach for setting licence

  19. Antiparallel magnetic merging signatures during IMF BY>>0: longitudinal and latitudinal cusp aurora bifurcations

    Directory of Open Access Journals (Sweden)

    S. Massetti

    2006-09-01

    Full Text Available A prominent dayside auroral event, occurred during an IMF BY-dominated time interval, and characterized by the contemporaneous longitudinal and latitudinal cusp bifurcations, is reported. The event was recorded the 19 December 2002, between about 09:30–10:45 UT, by the ITACA2 twin auroral monitors system, in the Greenland-Svalbard zone. The splitting of the ionospheric footprint of the geomagnetic cusp, traced by the dayside auroral activity, was recently identified with the signatures of antiparallel reconnection episodes ongoing at different magnetopause locations, during large IMF BY periods. The first part of the event showed a broad longitudinal bifurcation of the red-dominated cusp aurora, displaced in the prenoon and postnoon, with a separation up to ~1800 km, during northeast directed IMF (clock-angle rotating from 45° to 90°. This observation widens the range of IMF regimes that are known to drive a longitudinal bifurcation of the cusp, since previous case-studies reported these events to occur during southeast/southwest oriented IMF (clock-angle ≈135°. The second part of the event, developed when the IMF turned to a nearly horizontal orientation (BY>>0, BZ~0, clock-angle ~90°, and exhibited the simultaneous activation of the cusp auroras in three distinct areas: i two of them associated to the above-mentioned longitudinally bifurcated cusp (~73°–75° CGM latitude, type 1 cusp aurora, and linked to (nearantiparallel magnetic reconnection patches equatorward the northern and the southern cusp, ii the other one characterized by isolated high-latitude (~76°–77° CGM latitude, type 2 cusp aurora rayed arc(s with intense green emission, and triggered by (nearantiparallel merging at the northern lobe (usually observed during positive IMF BZ, poleward the local cusp. During this phase, the longitudinal separation of the low-latitude type~1 cusp aurora was about 1000 km wide, with a 500 km gap, while the latitudinal separation

  20. Ashwagandha derived withanone targets TPX2-Aurora A complex: computational and experimental evidence to its anticancer activity.

    Directory of Open Access Journals (Sweden)

    Abhinav Grover

    Full Text Available Cancer is largely marked by genetic instability. Specific inhibition of individual proteins or signalling pathways that regulate genetic stability during cell division thus hold a great potential for cancer therapy. The Aurora A kinase is a Ser/Thr kinase that plays a critical role during mitosis and cytokinesis and is found upregulated in several cancer types. It is functionally regulated by its interactions with TPX2, a candidate oncogene. Aurora A inhibitors have been proposed as anticancer drugs that work by blocking its ATP binding site. This site is common to other kinases and hence these inhibitors lack specificity for Aurora A inhibition in particular, thus advocating the need of some alternative inhibition route. Previously, we identified TPX2 as a cellular target for withanone that selectively kill cancer cells. By computational approach, we found here that withanone binds to TPX2-Aurora A complex. In experiment, withanone treatment to cancer cells indeed resulted in dissociation of TPX2-Aurora A complex and disruption of mitotic spindle apparatus proposing this as a mechanism of the anticancer activity of withanone. From docking analysis, non-formation/disruption of the active TPX2-Aurora A association complex could be discerned. Our MD simulation results suggesting the thermodynamic and structural stability of TPX2-Aurora A in complex with withanone further substantiates the binding. We report a computational rationale of the ability of naturally occurring withanone to alter the kinase signalling pathway in an ATP-independent manner and experimental evidence in which withanone cause inactivation of the TPX2-Aurora A complex. The study demonstrated that TPX2-Aurora A complex is a target of withanone, a potential natural anticancer drug.

  1. Ashwagandha derived withanone targets TPX2-Aurora A complex: computational and experimental evidence to its anticancer activity.

    Science.gov (United States)

    Grover, Abhinav; Singh, Rumani; Shandilya, Ashutosh; Priyandoko, Didik; Agrawal, Vibhuti; Bisaria, Virendra S; Wadhwa, Renu; Kaul, Sunil C; Sundar, Durai

    2012-01-01

    Cancer is largely marked by genetic instability. Specific inhibition of individual proteins or signalling pathways that regulate genetic stability during cell division thus hold a great potential for cancer therapy. The Aurora A kinase is a Ser/Thr kinase that plays a critical role during mitosis and cytokinesis and is found upregulated in several cancer types. It is functionally regulated by its interactions with TPX2, a candidate oncogene. Aurora A inhibitors have been proposed as anticancer drugs that work by blocking its ATP binding site. This site is common to other kinases and hence these inhibitors lack specificity for Aurora A inhibition in particular, thus advocating the need of some alternative inhibition route. Previously, we identified TPX2 as a cellular target for withanone that selectively kill cancer cells. By computational approach, we found here that withanone binds to TPX2-Aurora A complex. In experiment, withanone treatment to cancer cells indeed resulted in dissociation of TPX2-Aurora A complex and disruption of mitotic spindle apparatus proposing this as a mechanism of the anticancer activity of withanone. From docking analysis, non-formation/disruption of the active TPX2-Aurora A association complex could be discerned. Our MD simulation results suggesting the thermodynamic and structural stability of TPX2-Aurora A in complex with withanone further substantiates the binding. We report a computational rationale of the ability of naturally occurring withanone to alter the kinase signalling pathway in an ATP-independent manner and experimental evidence in which withanone cause inactivation of the TPX2-Aurora A complex. The study demonstrated that TPX2-Aurora A complex is a target of withanone, a potential natural anticancer drug.

  2. RADIO REFRACTIVITY RADIO REFRACTIVITY STUDY IN AKURE ...

    African Journals Online (AJOL)

    eobe

    The basic parameters that describe the troposphere region are pressure, temperature and relative humidity. Variations in these conditions within the troposphere cause changes in the refractive index of air and large scale changes of refractive index with height cause radio waves to be refracted and the effect can be quite.

  3. Spectral characteristics of ionospheric scintillations of VHF radiosignal near magnetic zenith

    Science.gov (United States)

    Vasilyev, Roman; Globa, Mariia; Kushnarev, Dmitry; Medvedev, Andrey; Ratovsky, Konstantin

    2017-07-01

    We present the results of observing the Cygnus-A radio source scintillation in the Earth's ionosphere under quiet and disturbed geomagnetic conditions by using the Irkutsk incoherent scattering radar (IISR). The scintillation method applied for ionosphere testing at IISR confidently determines the Fresnel frequency and power cutoff, the spectral characteristics usually related to the velocities and spatial spectra of ionospheric plasma irregularities. We also use the IGRF magnetic field model to show the relation between the shape of discrete radio source scintillation spectra and the direction to the radio source with respect to the geomagnetic field. The S4 index increase within the magnetic zenith is observed to be conditioned by the scintillation spectrum widening. We also evaluate the zonal velocity of observed ionospheric irregularities as ∼10 m/sec assuming the irregularity height to be equal to the F2-layer maximum height in the ionosphere.

  4. Effect of solar and magnetic activity on VHF scintillations near the equatorial anomaly crest

    Directory of Open Access Journals (Sweden)

    R. P. Singh

    2004-09-01

    Full Text Available The VHF amplitude scintillation recorded during the period January 1991 to December 1993 in the declining phase of a solar cycle and April 1998 to December 1999 in the ascending phase of the next solar cycle at Varanasi (geogr. lat.=25.3°, long.=83.0°, dip=37°N have been analyzed to study the behavior of ionospheric irregularities during active solar periods and magnetic storms. It is shown that irregularities occur at arbitrary times and may last for <30min. A rise in solar activity increases scintillations during winter (November-February and near equinoxes (March-April; September-October, whereas it depresses the scintillations during the summer (May-July. In general, the role of magnetic activity is to suppress scintillations in the pre-midnight period and to increase it in the post-midnight period during equinox and winter seasons, whilst during summer months the effect is reversed. The pre-midnight scintillation is sometimes observed when the main phase of Dst corresponds to the pre-midnight period. The annual variation shows suppression of scintillations on disturbed days, both during pre-midnight and post-midnight period, which becomes more effective during years of high solar activity. It is observed that for magnetic storms for which the recovery phase starts post-midnight, the probability of occurrence of irregularities is enhanced during this time. If the magnetic storm occurred during daytime, then the probability of occurrence of scintillations during the night hours is decreased. The penetration of magnetospheric electric fields to the magnetic equator affects the evolution of low-latitude irregularities. A delayed disturbance dynamo electric field also affects the development of irregularities.

  5. Seasonal and diurnal changes in wind variability from Flatland VHF profiler observations

    Energy Technology Data Exchange (ETDEWEB)

    Nastrom, G.D. [Saint Cloud State Univ., MN (United States). Dept. of Earth Sci.; Clark, W.L. [National Oceanic and Atmospheric Administration, Boulder, CO (United States). Aeronomy Lab.; Zandt, T.E. van [National Oceanic and Atmospheric Administration, Boulder, CO (United States). Aeronomy Lab.; Warnock, J.M. [National Oceanic and Atmospheric Administration, Boulder, CO (United States). Aeronomy Lab.

    1996-02-01

    Climatological results are presented on the hourly variance of the wind observed in the mid-troposphere (3 to 9 km MSL). This quantity roughly indicates the energy in the atmospheric wind field for variations with periods roughly less than 1 hour. Observations are from the Flatland VHF research wind profiler, located near Champaign/Urbana, Illinois, well away from significant orographic features. The period of record covers two years, September 1990 through August 1992. The values of the variance of the winds along vertical and oblique (15 degrees from zenith in the cardinal directions) beams are presented versus height, season, time-of-day, and beam pointing direction. It is found that the hourly variance values have approximately lognormal frequency distribution. The mean hourly variance is significantly larger for the oblique wind observations than for the vertical. Mean wind variances also tend to be larger in the east/west steering plane than in the north/south plane. The mean variance generally increases with height, but faster than would be expected if it were due solely to the decrease in atmospheric density, implying the presence of local source/sinks of wind energy. The rate of change with height is noticeably different for the vertical and oblique beams, being much less for the vertical beam, in some seasons even decreasing with height. With respect to season, the mean hourly variance is smallest in the summer and largest in the winter. With respect to diurnal changes, the variance is maximum during the afternoon for spring, summer, and autumn, with the maximum up to a factor of two larger than the minimum. In winter, the diurnal change is much smaller, with little indication of an afternoon maximum. (orig.)

  6. VHF radar observations of turbulent structures in the polar mesopause region

    Directory of Open Access Journals (Sweden)

    P. Czechowsky

    Full Text Available The mobile SOUSY VHF Radar was operated in the summer of 1987 during the MAC/SINE campaign in northern Norway to study the polar mesosphere summer echoes (PMSE. Measurements of the spectral width indicate that two types of structures occur. In general mesospheric layers are bifurcated exhibiting a narrow spectral width and a well-defined aspect sensitivity. However, for about 10% of the observation time cells of enhanced turbulence characterized by extremely broad spectral widths appear predominantly in the upper sublayer above 86 km. Identification and separation of beam and shear broadening allows a determination of the turbulence-induced component of the spectral width. This case study reveals that during several events these cloud-like structures of enhanced turbulence move with an apparent velocity of several tens of meters per second which is almost identical with the phase trace velocity of simultaneously observed waves. Since, at that time, the Richardson number was less than a quarter, it was concluded that these turbulent cells were generated by a Kelvin-Helmholtz mechanism. The horizontal extent of these structures was calculated to be less than 40 km. A general relation between spectral width and echo power was not detected. The turbulent component of the spectral width was used to calculate typical values of the energy dissipation rate at times where narrow spectral width dominates and during periods of enhanced turbulence. In addition, the outer scale of the inertial subrange (buoyancy scale was estimated. For the first time the occurrence and motion of this type of structures of enhanced spectral width is analyzed and discussed in detail.

  7. VHF radar observations of turbulent structures in the polar mesopause region

    Directory of Open Access Journals (Sweden)

    P. Czechowsky

    1997-08-01

    Full Text Available The mobile SOUSY VHF Radar was operated in the summer of 1987 during the MAC/SINE campaign in northern Norway to study the polar mesosphere summer echoes (PMSE. Measurements of the spectral width indicate that two types of structures occur. In general mesospheric layers are bifurcated exhibiting a narrow spectral width and a well-defined aspect sensitivity. However, for about 10% of the observation time cells of enhanced turbulence characterized by extremely broad spectral widths appear predominantly in the upper sublayer above 86 km. Identification and separation of beam and shear broadening allows a determination of the turbulence-induced component of the spectral width. This case study reveals that during several events these cloud-like structures of enhanced turbulence move with an apparent velocity of several tens of meters per second which is almost identical with the phase trace velocity of simultaneously observed waves. Since, at that time, the Richardson number was less than a quarter, it was concluded that these turbulent cells were generated by a Kelvin-Helmholtz mechanism. The horizontal extent of these structures was calculated to be less than 40 km. A general relation between spectral width and echo power was not detected. The turbulent component of the spectral width was used to calculate typical values of the energy dissipation rate at times where narrow spectral width dominates and during periods of enhanced turbulence. In addition, the outer scale of the inertial subrange (buoyancy scale was estimated. For the first time the occurrence and motion of this type of structures of enhanced spectral width is analyzed and discussed in detail.

  8. The relationship between VHF radar auroral backscatter amplitude and Doppler velocity: a statistical study

    Directory of Open Access Journals (Sweden)

    B. A. Shand

    1996-08-01

    Full Text Available A statistical investigation of the relationship between VHF radar auroral backscatter intensity and Doppler velocity has been undertaken with data collected from 8 years operation of the Wick site of the Sweden And Britain Radar-auroral Experiment (SABRE. The results indicate three different regimes within the statistical data set; firstly, for Doppler velocities <200 m s–1, the backscatter intensity (measured in decibels remains relatively constant. Secondly, a linear relationship is observed between the backscatter intensity (in decibels and Doppler velocity for velocities between 200 m s–1 and 700 m s–1. At velocities greater than 700 m s–1 the backscatter intensity saturates at a maximum value as the Doppler velocity increases. There are three possible geophysical mechanisms for the saturation in the backscatter intensity at high phase speeds: a saturation in the irregularity turbulence level, a maximisation of the scattering volume, and a modification of the local ambient electron density. There is also a difference in the dependence of the backscatter intensity on Doppler velocity for the flow towards and away from the radar. The results for flow towards the radar exhibit a consistent relationship between backscatter intensity and measured velocities throughout the solar cycle. For flow away from the radar, however, the relationship between backscatter intensity and Doppler velocity varies during the solar cycle. The geometry of the SABRE system ensures that flow towards the radar is predominantly associated with the eastward electrojet, and flow away is associated with the westward electrojet. The difference in the backscatter intensity variation as a function of Doppler velocity is attributed to asymmetries between the eastward and westward electrojets and the geophysical parameters controlling the backscatter amplitude.

  9. The relationship between VHF radar auroral backscatter amplitude and Doppler velocity: a statistical study

    Directory of Open Access Journals (Sweden)

    B. A. Shand

    Full Text Available A statistical investigation of the relationship between VHF radar auroral backscatter intensity and Doppler velocity has been undertaken with data collected from 8 years operation of the Wick site of the Sweden And Britain Radar-auroral Experiment (SABRE. The results indicate three different regimes within the statistical data set; firstly, for Doppler velocities <200 m s–1, the backscatter intensity (measured in decibels remains relatively constant. Secondly, a linear relationship is observed between the backscatter intensity (in decibels and Doppler velocity for velocities between 200 m s–1 and 700 m s–1. At velocities greater than 700 m s–1 the backscatter intensity saturates at a maximum value as the Doppler velocity increases. There are three possible geophysical mechanisms for the saturation in the backscatter intensity at high phase speeds: a saturation in the irregularity turbulence level, a maximisation of the scattering volume, and a modification of the local ambient electron density. There is also a difference in the dependence of the backscatter intensity on Doppler velocity for the flow towards and away from the radar. The results for flow towards the radar exhibit a consistent relationship between backscatter intensity and measured velocities throughout the solar cycle. For flow away from the radar, however, the relationship between backscatter intensity and Doppler velocity varies during the solar cycle. The geometry of the SABRE system ensures that flow towards the radar is predominantly associated with the eastward electrojet, and flow away is associated with the westward electrojet. The difference in the backscatter intensity variation as a function of Doppler velocity is attributed to asymmetries between the eastward and westward electrojets and the geophysical parameters controlling the backscatter amplitude.

  10. Cut-off low monitoring by the French VHF-ST-radar network during the ESTIME campaign

    Science.gov (United States)

    Caccia, J.-L.; Bertin, F.; Campistron, B.; Klaus, V.; Pointin, Y.; van Baelen, J.; Wilson, R.

    2000-05-01

    In order to investigate mesoscale strato-tropospheric exchanges, the field campaign `Echanges Stratosphère-Troposphère: Investigations à Moyenne Echelle' was conducted in France from late 1993 to mid 1995 and focused on cut-off low events. It involved the French research network of five VHF (Very High Frequency) ST (Strato-Tropospheric) radars deployed in southern France. Observations corresponding to three Intensive Observing Periods are reported here. The radar data analyzed and discussed are time-height diagrams of the aspect ratio (AR), that is, the vertical to oblique beam-returned power ratio, used for monitoring three cut-off low events. In order to discuss the validity of the method, 506 h of radar AR data were compared with time-height diagrams of the static stability and the humidity obtained from synoptic European Center for Medium-range Weather Forecasts model analyses. A dataset corresponding to 297 h of observations is analyzed and discussed here. It is concluded that the AR is a good tracer to document cut-off low events, including tropopause folding identification and the detection of tropospheric air masses of enhanced stability, in dry or weakly humid cases. On the other hand, although the effects of the specific humidity and its gradients on VHF radar echo power could not be extensively investigated, our results suggest that the same parameter cannot be used at mid- and lower-tropospheric levels when the effects of specific humidity significantly reinforce the moist static stability. It is important to take into account these insights in the context of future observing campaigns in which a network of VHF-ST-radars will be involved, and where their role will be to observe and to document the evolution of upper-level features or potential vorticity streamers, or more generally stratospheric-tropospheric exchanges.

  11. Radio broadcasting via satellite

    Science.gov (United States)

    Helm, Neil R.; Pritchard, Wilbur L.

    1990-10-01

    Market areas offering potential for future narrowband broadcast satellites are examined, including international public diplomacy, government- and advertising-supported, and business-application usages. Technical issues such as frequency allocation, spacecraft types, transmission parameters, and radio receiver characteristics are outlined. Service and system requirements, advertising revenue, and business communications services are among the economic issues discussed. The institutional framework required to provide an operational radio broadcast service is studied, and new initiatives in direct broadcast audio radio systems, encompassing studies, tests, in-orbit demonstrations of, and proposals for national and international commercial broadcast services are considered.

  12. Unlocking radio broadcasts

    DEFF Research Database (Denmark)

    Lykke, Marianne; Skov, Mette

    2012-01-01

    This poster reports the preliminary results of a user study uncovering the information seeking behaviour of humanities scholars dedicated to radio research. The study is part of an interdisciplinary research project on radio culture and auditory resources. The purpose of the study is to inform...... the design of information architecture and interaction design of a research infrastructure that will enable future radio and audio based research. Results from a questionnaire survey on humanities scholars’ research interest and information needs, preferred access points, and indexing levels are reported...

  13. Shoestring Budget Radio Astronomy

    Science.gov (United States)

    Hoot, John E.

    2017-06-01

    The commercial exploitation of microwave frequencies for cellular, WiFi, Bluetooth, HDTV, and satellite digital media transmission has brought down the cost of the components required to build an effective radio telescope to the point where, for the cost of a good eyepiece, you can construct and operate a radio telescope. This paper sets forth a family of designs for 1421 MHz telescopes. It also proposes a method by which operators of such instruments can aggregate and archive data via the Internet. With 90 or so instruments it will be possible to survey the entire radio sky for transients with a 24 hour cadence.

  14. Cryocooled wideband digital channelizing radio-frequency receiver based on low-pass ADC

    Energy Technology Data Exchange (ETDEWEB)

    Vernik, Igor V; Kirichenko, Dmitri E; Dotsenko, Vladimir V; Miller, Robert; Webber, Robert J; Shevchenko, Pavel; Talalaevskii, Andrei; Gupta, Deepnarayan; Mukhanov, Oleg A [HYPRES, Inc., 175 Clearbrook Road, Elmsford, NY 10523 (United States)

    2007-11-15

    We have demonstrated a digital receiver performing direct digitization of radio-frequency signals over a wide frequency range from kilohertz to gigahertz. The complete system, consisting of a cryopackaged superconductor all-digital receiver (ADR) chip followed by room-temperature interface electronics and a field programmable gate array (FPGA) based post-processing module, has been developed. The ADR chip comprises a low-pass analog-to-digital converter (ADC) delta modulator with phase modulation-demodulation architecture together with digital in-phase and quadrature mixer and a pair of digital decimation filters. The chip is fabricated using a 4.5 kA cm{sup -2} process and is cryopackaged using a commercial-off-the-shelf cryocooler. Experimental results in HF, VHF, UHF and L bands and their analysis, proving consistent operation of the cryopackaged ADR chip up to 24.32 GHz clock frequency, are presented and discussed.

  15. Spectrum Measurement and Analysis of TV Band in Support of Cognitive Radio Operation in India

    DEFF Research Database (Denmark)

    Patil, Kishor P.; Skouby, Knud Erik; Prasad, Ramjee

    2013-01-01

    ) Cognitive Radio operation in TV band. Also we have stressed on the need of quantitative analysis of TVWSs availability and compatibility studies for protection of incumbent services for CR access of TVWSs in India. Also this paper reviews the state-of-the-art in standardization of cognitive access to TVWS.......TV White Spaces constitutes the major portion of the VHF and UHF TV band which is geographically unused after digital switchover. The most important regulatory trend in the context of Dynamic Spectrum Access (DSA) is the Cognitive access of TV white Spaces. Through spectrum measurement campaign we...... have estimated the spectrum utilization of TV band in Pune, India. We have designed the measurement set up and methodology for the measurement campaign. Our spectrum occupancy analysis provides the realistic view on the spectrum opportunities in India for (i) spectrum refarming of TV band; (ii...

  16. Variations of Synchrotron Radio Emissions from Jupiter's Inner Radiation Belt

    Science.gov (United States)

    Lou, Y.-Q.

    2017-09-01

    Variations of Synchrotron Radio Emissions from Jupiter's Inner Radiation Belt Yu-Qing Lou* Physics Department, Tsinghua Centre for Astrophysics (THCA), Tsinghua-National Astronomical Observatories of China (NAOC) joint Research Centre for Astrophysics, Tsinghua University, Beijing 100084, China We describe the basic phenommenology of quasi-periodic 40 minute (QP-40) polar burst activities of Jupiter and their close correlation with the solar wind speed variations at the Jovian magnetosphere. Physically, relativistic electrons of QP-40 bursts most likely come from the circumpolar regions of the inner radiation belt (IRB) which gives off intense synchroton radio emissions in a wide wavelength range. Such relativistic electron bursts also give rise to beamed low-frequency radio bursts along polar magnetic field lines with distinct polarizations from Jupiter's two polar regions. Jovian aurora activities are expected to be also affected by such QP-40 burst activities. We present evidence of short-term (typical timescales shorter than an hour) variabilities of the IRB at 6cm wavelength and describe recent joint radio telescope observation campaign to monitor Jupiter in coordination with JUNO spacecraft. Except for low-frequency polarization features, we anticipate JUNO to detect QP-40 activities from both polar regions during the arrival of high-speed solar wind with intermittency. References 1. Y.-Q. Lou, The Astrophysical Journal, 548, 460 (2001). 2. Y.-Q. Lou, and C. Zheng, Mon. Not. Roy. Astron. Soc. Letters, 344, L1 (2003). 3. Y.-Q. Lou, H. G. Song, Y.Y. Liu, and M. Yang, Mon. Not. Roy. Astron. Soc. Letters, 421, L62 (2012). 4. Y.-Q. Lou, Geophysical Research Letters, 23, 609 (1996). 5. Y.-Q. Lou, Journal of Geophysical Research, 99, 14747 (1994). 6. G. R. Gladstone, et al., Nature, 415, 1000 (2002).

  17. Identification of critical chemical features for Aurora kinase-B inhibitors using Hip-Hop, virtual screening and molecular docking

    Science.gov (United States)

    Sakkiah, Sugunadevi; Thangapandian, Sundarapandian; John, Shalini; Lee, Keun Woo

    2011-01-01

    This study was performed to find the selective chemical features for Aurora kinase-B inhibitors using the potent methods like Hip-Hop, virtual screening, homology modeling, molecular dynamics and docking. The best hypothesis, Hypo1 was validated toward a wide range of test set containing the selective inhibitors of Aurora kinase-B. Homology modeling and molecular dynamics studies were carried out to perform the molecular docking studies. The best hypothesis Hypo1 was used as a 3D query to screen the chemical databases. The screened molecules from the databases were sorted based on ADME and drug like properties. The selective hit compounds were docked and the hydrogen bond interactions with the critical amino acids present in Aurora kinase-B were compared with the chemical features present in the Hypo1. Finally, we suggest that the chemical features present in the Hypo1 are vital for a molecule to inhibit the Aurora kinase-B activity.

  18. The dynamic cusp aurora on 30 November 1997: response to southward turning of the IMF

    Directory of Open Access Journals (Sweden)

    P. E. Sandholt

    Full Text Available We document the detailed dynamics of the dayside aurora in the sim1200-1600 MLT sector in response to a sharp southward turning of the interplanetary magnetic field (IMF under negative IMF By conditions. Features not documented in previous work are elucidated by using two meridan scanning photometers (separated by 2 h and an all-sky auroral imager in Ny Ålesund, Svalbard (75.5°MLAT in combination with magnetograms from stations on Svalbard, covering the latitude range 71°75°MLAT. The initial auroral response may be divided into three phases consisting of: (1 intensification of both the red (630.0 nm and green (557.7 nm line emissions in the cusp aurora near 1200 MLT and ~100 km equatorward shift of its equatorward boundary, at ~75°MLAT, (2 eastward and poleward expansions of the cusp aurora, reaching the 1430 MLT meridian after 5-6 min, and (3 east-west expansion of the higher-latitude aurora (at ~77°78°MLAT in the postnoon sector. The associated magnetic disturbance is characterized by an initial positive deflection of the X-component at stations located 100-400 km south of the aurora, corresponding to enhanced Sunward return flow associated with the merging convection cell in the post-noon sector. The sequence of partly overlapping poleward moving auroral forms (PMAFs during the first 15 min, accompanied by corresponding pulsations in the convection current, was followed by a strong westward contraction of the cusp aurora when the ground magnetograms indicated a temporary return to the pre-onset level. These observations are discussed in relation to the Cowley-Lockwood model of ionospheric response to pulsed magnetopause reconnection.

    Key words. Mangetospheric physics (magnetopause · cusp and boundary layers; solar wind-magnetosphere interactions; auroral phenomena

  19. THE RELATIONSHIP BETWEEN THE SEPTEMBER 2017 MARS GLOBAL AURORA EVENT AND CRUSTAL MAGNETIC FIELDS

    Science.gov (United States)

    Nasr, Camella-Rosa; Schneider, Nick; Connour, Kyle; Jain, Sonal; Deighan, Justin; Jakosky, Bruce; MAVEN/IUVS Team

    2018-01-01

    In September 2017, the Imaging UltraViolet Spectrograph (IUVS) on the MAVEN spacecraft observed global aurora on Mars caused by a surprisingly strong solar energetic particle event. Widespread “diffuse aurora” have previously been detected on Mars through more limited observations (Schneider et al., Science 350, (2015); DOI: 10.1126/science.aad0313), but recent observations established complete coverage of the observable portion of Mars’ nightside. The aurora was global due to Mars’s lack of a global magnetic field, which allowed energetic electrons from the Sun to directly precipitate into the atmosphere. On September 11th, IUVS detected aurora more than 25 times brighter than any prior IUVS observation, with high SNR detections of aurora at the limb and against the disk of the planet. Fainter auroral emission was seen around the nightside limb over 13 orbits spanning nearly 3 days.On September 14th, during the declining phase of the event, faint linear features and patches were detected by the spacecraft, which were higher than the noise floor, with a similar spatial distribution to “discrete aurora” patches observed on Mars by the SPICAM instrument on the Mars Express spacecraft (Bertaux et al., Nature 435, doi :10.1038/nature03603). Discrete aurora occur near areas of the crust affected by the magnetism left over from Mars’ once-strong dipole field. Emission is limited to regions of the crustal magnetic field where the field lines are likely to be open to solar wind interactions. Those regions are concentrated in Mars’ southern hemisphere centered on 180 degrees east longitude.We studied the localized emissions on 14 September to determine whether there might be a connection between the observed diffuse aurora event and discrete auroral processes. First, we investigated the localized emissions to confirm that the observed signal was consistent with expected auroral spectra. Second, their locations were projected on a map of the crustal magnetic

  20. New historical records and relationships among 14C production rates, abundance and color of low latitude auroras and sunspot abundance

    Science.gov (United States)

    Abbott, Dallas; Juhl, Robert

    2016-12-01

    Incursions of high-energy particles from space, specifically solar energetic particles and galactic cosmic rays, have significant effects on the Earth, including disruption of the Earth's magnetic field, generation of electric fields strong enough to damage electronic devices as well as the production of auroras at low-latitudes, within 45° of the magnetic equator. We examine the relationships among 14C production, auroral abundance, auroral color and sunspot abundance using existing data supplemented by a new dataset. The new dataset, based on Chinese and Korean records from A.D. 1100-1700, includes 46 new or revised records of sunspots and 279 records of low-latitude auroras. Low-latitude auroras are predominantly red (66%, 835 events) with lesser proportions of white (20%, 253 events) and black auroras (6%, 67 events). All other auroral colors (green, yellow, multicolored, blue and purple) aggregate to a total of 100 events (8%). Overall, white auroras are more frequent during times of higher 14C production. We use two empirical methods of evaluating the flux of high-energy particles: modeled peaks and lows in 14C production and peaks and lows in the 14C calibration curve. We find that comparison to modeled 14C production gives significant results. White auroras are significantly more abundant (98% probability) at times of high production of 14C. Red auroras are somewhat more abundant (88% probability) at times of low production of 14C. The abundances of black, multicolored, green, yellow, and blue auroras between times of low and high 14C production are not significantly different. Violet/purple auroras are significantly more abundant (98% probability) at times of low 14C production. The positive correlation of violet/purple auroras with times of low14C production rate and the lack of correlation of blue auroras with times of high14C production is surprising, for this portion of the visible spectrum contains strong emission lines and some lines with high

  1. Music, radio and mediatization

    DEFF Research Database (Denmark)

    Michelsen, Morten; Krogh, Mads

    2016-01-01

    Mediatization has become a key concept for understanding the relations between media and other cultural and social fields. Contributing to the discussions related to the concept of mediatization, this article discusses how practices of radio and music(al life) influence each other. We follow Deacon......’s and Stanyer’s advice to supplement the concept of mediatization with ‘a series of additional concepts at lower levels of abstraction’ and suggest, in this respect, the notion of heterogeneous milieus of music–radio. Hereby, we turn away from the all-encompassing perspectives related to the concept...... of mediatization where media as such seem to be ascribed agency. Instead, we consider historical accounts of music–radio in order to address the complex nonlinearity of concrete processes of mediatization as they take place in the multiple meetings between a decentred notion of radio and musical life....

  2. The digital sport radio.

    Directory of Open Access Journals (Sweden)

    Hilario José ROMERO BEJARANO

    2014-07-01

    Full Text Available Radio has been immersed in recent years in a phase of technological integration and business of multimedia, as well as diversification of systems and channels for broadcasting. In addition, Internet has been consolidated as the platform of digital radio that more has evolved as a result of its continued expansion. However, the merger radio-Internet must be understood as a new form of communication, and not solely as a new complementary medium. In this context, it is of great interest to analyze that transformations in the way of reception, contents, languages, programs and schedules, has brought with it for the radio that integration. To this end is taken as main reference the sports areas, a key aspect and broadly representative of the current broadcasting landscape.

  3. Social cognitive radio networks

    CERN Document Server

    Chen, Xu

    2015-01-01

    This brief presents research results on social cognitive radio networks, a transformational and innovative networking paradigm that promotes the nexus between social interactions and cognitive radio networks. Along with a review of the research literature, the text examines the key motivation and challenges of social cognitive radio network design. Three socially inspired distributed spectrum sharing mechanisms are introduced: adaptive channel recommendation mechanism, imitation-based social spectrum sharing mechanism, and evolutionarily stable spectrum access mechanism. The brief concludes with a discussion of future research directions which ascertains that exploiting social interactions for distributed spectrum sharing will advance the state-of-the-art of cognitive radio network design, spur a new line of thinking for future wireless networks, and enable novel wireless service and applications.

  4. Eratosthenes via Ham Radio

    Science.gov (United States)

    Koser, John F.

    1975-01-01

    A secondary geology class used Eratosthenes' method for measuring the circumference of the earth by comparing their measurements of the shadow of a vertical rod to the measurements made by another person contacted by ham radio. (MLH)

  5. Everyday Radio Telescope

    CERN Document Server

    Mandal, Pranshu; Kumar, Pratik; Yelikar, Anjali; Soni, Kanchan; T, Vineeth Krishna

    2016-01-01

    We have developed an affordable, portable college level radio telescope for amateur radio astronomy which can be used to provide hands-on experience with the fundamentals of a radio telescope and an insight into the realm of radio astronomy. With our set-up one can measure brightness temperature and flux of the Sun at 11.2 GHz and calculate the beam width of the antenna. The set-up uses commercially available satellite television receiving system and parabolic dish antenna. We report the detection of point sources like Saturn and extended sources like the galactic arm of the Milky way. We have also developed python pipeline, which are available for free download, for data acquisition and visualization.

  6. Repeated Aurora-A siRNA Transfection Results in Effective Apoptosis of A549 Cells Compared to Single Transfection.

    Science.gov (United States)

    Wang, Zhonghua; Sun, Wenwu; Cao, Jianping; Cui, Haiyang; Ma, Zhuang

    2016-01-01

    Suppression of Aurora kinase A (Aurora-A, AURKA) by Aurora-A siRNA has been proposed for lung tumor treatment. However, protocols using single administration have shown little benefit in some types of lung tumor. Given that transfection efficiency of Aurora-A siRNA is low due to tightly packed cells in the tumor, we hypothesized that repeated administration would result in efficient cell apoptosis. We compared single vs. repeated transfection (thrice) in A549 cells by transfecting Aurora-A siRNA (siA) on the 1st or 1st, 2nd and 3rd day after cell seeding. A random sequence was used as the negative siRNA control (siC). Cells in the single transfection group received only transfection reagent without siRNAs on the 2nd and 3rd day. Two days after the third transfection, both single and repeated siA administration decreased mRNA expression of Aurora-A and cell viability compared to no administration and siC single administration. However, the decrease in these two indices with repeated transfection was more obvious than that following single administration: cell viability decreased to 72.8 ± 3.05% (p transfection and to 64.2 ± 1.99% (p transfection, compared with normal control cells, respectively. Gene expression decreased to 17 ± 16.6% (p transfection and to 43.2 ± 13.0% (p transfection. Compared to single transfection, repeated Aurora-A siRNA transfection decreased Aurora-A, which, in turn, resulted in effective apoptosis of A549 cells.

  7. Wireless radio a history

    CERN Document Server

    Coe, Lewis

    2006-01-01

    ""Informative...recommended""--Choice; ""interesting...a good read...well worth reading""--Contact Magazine. This history first looks at Marconi's wireless communications system and then explores its many applications, including marine radio, cellular telephones, police and military uses, television and radar. Radio collecting is also discussed, and brief biographies are provided for the major figures in the development and use of the wireless.

  8. Classics in radio astronomy

    CERN Document Server

    Sullivan, Woodruff Turner

    1982-01-01

    Radio techniques were the nrst to lead astronomy away from the quiescent and limited Universe revealed by traditional observations at optical wave­ lengths. In the earliest days of radio astronomy, a handful of radio physicists and engineers made one startling discovery after another as they opened up the radio sky. With this collection of classic papers and the extensive intro­ ductory material, the reader can experience these exciting discoveries, as well as understand the developing techniques and follow the motivations which prompted the various lines of inquiry. For instance he or she will follow in detail the several attempts to detect radio waves from the sun at the turn of the century; the unravelling by Jansky of a "steady hiss type static"; the incredible story of Reber who built a 9 meter dish in his backyard in 1937 and then mapped the Milky Way; the vital discoveries by Hey and colleagues of radio bursts from the Sun and of a discrete source in the constellation of Cygnus; the development of re...

  9. Sistema de adquisición de datos para la medición de parámetros radioeléctricos en antenas lineales en la banda de TV de VHF y UHF System of acquisition of information for measurement of radioelectric parameters in linear antennas in the band of VHF and UHF’s television

    Directory of Open Access Journals (Sweden)

    María del Pilar Celemín

    2007-06-01

    Full Text Available Este proyecto desarrolla un sistema de adquisición y procesamiento de datos para la medición y ajuste de parámetros radioeléctricos de antenas lineales en las bandas de VHF y UHF. Como señal de prueba se utilizan algunas de las señales de televisión que se encuentran en el espectro radioeléctrico, provenientes de los transmisores que radian señales de canales nacionales. El receptor implementado incluye un sintonizador comercial de televisión que toma como muestra la señal portadora de video. Esta señal es amplificada, filtrada, almacenada y acondicionada, para ser leída por el puerto serial de un computador personal y procesada empleando un programa en Visual Basic, con una interfaz gráfica que permite una interacción amigable con el usuario. Desde acá se interactúa con un microcontrolador que controla el mecanismo de posicionamiento de la antena receptora por medio de una estructura electromecánica, que le permite ejecutar movimientos en dos grados de libertad: en azimut y en elevación. Con esto se logra un sistema capaz de determinar automáticamente el apuntamiento óptimo de la antena de acuerdo al máximo nivel de recepción de señal. Así mismo, se determinan parámetros propios de la antena tales como: el patrón de radiación (tanto en el plano horizontal como vertical, la ganancia directiva de la antena, la ganancia en cada uno de los puntos que conforman el plano principal, y otros parámetros de interés para el análisis de las características reales de antenas lineales.This project develops a data acquisition and processing system for measuring and adjusting lineal-antenna radioelectric parameters in VHF and UHF. Television signals are used as test signal. They can be found in radio electric spectrum, as they come from commercial transmitters that broadcast signals of national channels. The achieved receptor includes a television commercial tuner for obtaining video signal. Later, this signal is conditioning to

  10. Aurora A mediates cross-talk between N- and C-terminal post-translational modifications of p53

    Science.gov (United States)

    Raines, Sally Anne; Milner, Jo

    2011-01-01

    The serine/threonine protein kinase Aurora A is known to interact with and phosphorylate tumor suppressor p53 at Serine 215 (S215), inhibiting the transcriptional activity of p53. We show that Aurora A positively regulates human p53 protein levels and, using isogenic p53 wild-type and p53-null colorectal carcinoma cells, further show that p53 regulates human Aurora A protein expression. S215 is located in the DNA-binding core of p53 and at the center of the cryptic epitope for PAb240 antibody, which is used to detect mutant and denatured p53. Following denaturing SDS PAGE, the PAb240 epitope was detectable by immunoblotting in only two out of eight cell lines. The efficacy of novel p53-targeted anticancer therapies may be influenced by the conformational state of p53, therefore, the initial determination of p53 status may be relevant. We found no correlation between phosphorylation of p53 at S215 and PAb240 antibody recognition. However, phosphorylation at S37 was positively associated with PAb240 reactivity. More importantly, we provide the first evidence of Aurora A-mediated cross-talk between N- and C-terminal p53 post-translational modifications. As p53 and Aurora A are targets for anticancer therapy the impact of their reciprocal relationship and Aurora A-induced post-translational modification of p53 should be considered. PMID:22157150

  11. Inhibition of Aurora-B kinase activity by poly(ADP-ribosyl)ation in response to DNA damage

    Science.gov (United States)

    Monaco, Lucia; Kolthur-Seetharam, Ullas; Loury, Romain; Murcia, Josiane Ménissier-de; de Murcia, Gilbert; Sassone-Corsi, Paolo

    2005-01-01

    The cell cycle-regulated Aurora-B kinase is a chromosomal passenger protein that is implicated in fundamental mitotic events, including chromosome alignment and segregation and spindle checkpoint function. Aurora-B phosphorylates serine 10 of histone H3, a function that has been associated with mitotic chromatin condensation. We find that activation of poly(ADP-ribose) polymerase (PARP) 1 by DNA damage results in a rapid block of H3 phosphorylation. PARP-1 is a NAD+-dependent enzyme that plays a multifunctional role in DNA damage detection and repair and maintenance of genomic stability. Here, we show that Aurora-B physically and specifically associates with the BRCT (BRCA-1 C-terminal) domain of PARP-1. Aurora-B becomes highly poly(ADP-ribosyl)ated in response to DNA damage, a modification that leads to a striking inhibition of its kinase activity. The highly similar Aurora-A kinase is not regulated by PARP-1. We propose that the specific inhibition of Aurora-B kinase activity by PARP-1 contributes to the physiological response to DNA damage. PMID:16179389

  12. Lightning VHF radiation location system based on short-baseline TDOA technique — Validation in rocket-triggered lightning

    Science.gov (United States)

    Sun, Zhuling; Qie, Xiushu; Liu, Mingyuan; Cao, Dongjie; Wang, Dongfang

    2013-07-01

    A lightning VHF radiation location system based on short-baseline time-difference of arrival (TDOA) technology is newly developed. Based on the orthogonal 10 m-baseline antenna array with four identical broadband flat plane antennas, this system receives the lightning broadband VHF radiation signals and calculates TDOA between antennas in order to determine the location of lightning radiation sources in two dimensions (elevation and azimuth). To reduce noise and improve estimation accuracy of time delay, a general correlation time delay estimation algorithm based on direct correlation method and wavelet transform is proposed. Moreover, parabolic interpolation algorithm is used in the fractional delay estimation to improve the time resolution of the positioning system. In this paper, a rocket-triggered lightning discharge and a cloud lightning discharge are analyzed respectively, combining with simultaneous observations of high-speed camera and fast/slow electric field changes. The results indicate that the TDOA location system could effectively map the lightning radiation sources in 2 dimensions and are in a good agreement with the high-speed video camera images.

  13. Radar efficiency and the calculation of decade-long PMSE backscatter cross-section for the Resolute Bay VHF radar

    Directory of Open Access Journals (Sweden)

    N. Swarnalingam

    2009-04-01

    Full Text Available The Resolute Bay VHF radar, located in Nunavut, Canada (75.0° N, 95.0° W and operating at 51.5 MHz, has been used to investigate Polar Mesosphere Summer Echoes (PMSE since 1997. PMSE are a unique form of strong coherent radar echoes, and their understanding has been a challenge to the scientific community since their discovery more than three decades ago. While other high latitude radars have recorded strong levels of PMSE activities, the Resolute Bay radar has observed relatively lower levels of PMSE strengths. In order to derive absolute measurements of PMSE strength at this site, a technique is developed to determine the radar efficiency using cosmic (sky noise variations along with the help of a calibrated noise source. VHF radars are only rarely calibrated, but determination of efficiency is even less common. Here we emphasize the importance of efficiency for determination of cross-section measurements. The significant advantage of this method is that it can be directly applied to any MST radar system anywhere in the world as long as the sky noise variations are known. The radar efficiencies for two on-site radars at Resolute Bay are determined. PMSE backscatter cross-section is estimated, and decade-long PMSE strength variations at this location are investigated. It was noticed that the median of the backscatter cross-section distribution remains relatively unchanged, but over the years a great level of variability occurs in the high power tail of the distribution.

  14. Meteoroid Fragmentation as Revealed in Head- and Trail-Echoes Observed with the Arecibo UHF and VHF Radars

    Science.gov (United States)

    Mathews, J. D.; Malhorta, A.

    2011-01-01

    We report recent 46.8/430 MHz (VHF/UHF) radar meteor observations at Arecibo Observatory (AO) that reveal many previously unreported features in the radar meteor return - including flare-trails at both UHF and VHF - that are consistent with meteoroid fragmentation. Signature features of fragmentation include strong intra-pulse and pulse-to-pulse fading as the result of interference between or among multiple meteor head-echo returns and between head-echo and impulsive flare or "point" trail-echoes. That strong interference fading occurs implies that these scatterers exhibit well defined phase centers and are thus small compared with the wavelength. These results are consistent with and offer advances beyond a long history of optical and radar meteoroid fragmentation studies. Further, at AO, fragmenting and flare events are found to be a large fraction of the total events even though these meteoroids are likely the smallest observed by the major radars. Fragmentation is found to be a major though not dominate component of the meteors observed at other HPLA radars that are sensitive to larger meteoroids.

  15. Did Aboriginal Australians record a simultaneous eclipse and aurora in their oral traditions?

    Science.gov (United States)

    Fuller, Robert S.; Hamacher, Duane W.

    2017-12-01

    We investigate an Australian Aboriginal cultural story that seems to describe an extraordinary series of astronomical events occurring at the same time. We hypothesise that this was a witnessed natural event and explore natural phenomena that could account for the description. We select a thunderstorm, total solar eclipse, and strong Aurora Australis as the most likely candidates, then conclude a plausible date of 764 CE. We evaluate the different factors that would determine whether all these events could have been visible, include meteorological data, alternative total solar eclipse dates, solar activity cycles, aurorae appearances, and sky brightness during total solar eclipses. We conduct this study as a test-case for rigorously and systematically examining descriptions of rare natural phenomena in oral traditions, highlighting the difficulties and challenges with interpreting this type of hypothesis.

  16. Mechanisms of Saturn's Near-Noon Transient Aurora: In Situ Evidence From Cassini Measurements

    Science.gov (United States)

    Yao, Z. H.; Radioti, A.; Rae, I. J.; Liu, J.; Grodent, D.; Ray, L. C.; Badman, S. V.; Coates, A. J.; Gérard, J.-C.; Waite, J. H.; Yates, J. N.; Shi, Q. Q.; Wei, Y.; Bonfond, B.; Dougherty, M. K.; Roussos, E.; Sergis, N.; Palmaerts, B.

    2017-11-01

    Although auroral emissions at giant planets have been observed for decades, the physical mechanisms of aurorae at giant planets remain unclear. One key reason is the lack of simultaneous measurements in the magnetosphere while remote sensing of the aurora. We report a dynamic auroral event identified with the Cassini Ultraviolet Imaging Spectrograph (UVIS) at Saturn on 13 July 2008 with coordinated measurements of the magnetic field and plasma in the magnetosphere. The auroral intensification was transient, only lasting for ˜30 min. The magnetic field and plasma are perturbed during the auroral intensification period. We suggest that this intensification was caused by wave mode conversion generated field-aligned currents, and we propose two potential mechanisms for the generation of this plasma wave and the transient auroral intensification. A survey of the Cassini UVIS database reveals that this type of transient auroral intensification is very common (10/11 time sequences, and ˜10% of the total images).

  17. D region HF radar echoes associated with energetic particle precipitation and pulsating aurora

    Directory of Open Access Journals (Sweden)

    S. E. Milan

    2008-07-01

    Full Text Available Milan et al. (2001 identified a class of narrow, slow-moving HF radar backscatter echoes which originate between altitudes of 80 and 100 km, the ionospheric D- and lower E-regions. These echoes appeared to be associated with the occurrence of pulsating aurora, which are known to be created by energetic electrons capable of penetrating to D region altitudes. In this study we show that these echoes are observed in tandem with enhancements in cosmic noise absorption (auroral absorption, additional evidence that energetic (>30 keV particle precipitation is responsible for generating the irregularities from which a radar can scatter. In addition, we show that the D region backscatter echoes occur predominantly in the post-midnight sector during substorm recovery phase, in common with auroral absorption events and pulsating aurora.

  18. Radiative transfer with partial frequency redistribution in inhomogeneous atmospheres - Application to the Jovian aurora

    Science.gov (United States)

    Gladstone, G. R.

    1982-01-01

    A direct finite difference numerical solution for the equation of radiative transfer by the Feautrier method is developed for use in planetary atmospheres. The procedure described here uses a plane-parallel atmosphere, and can treat partial frequency redistribution, inhomogeneity, external or internal sources, and various boundary conditions. Isotropic scattering is assumed, but in the case of no frequency redistribution, Rayleigh scattering can also be handled. A program utilizing this method is tested in a variety of situations against more powerful and elaborate methods. The case of the Lyman alpha aurora on Jupiter is then considered, where the effects of partial frequency redistribution are shown to be of great importance. New results for the detailed line profiles for Lyman alpha in the Jovian aurora are presented. The method is quite versatile, and should be especially useful in studying a wide range of problems related to auroral or dayglow emissions in planetary atmospheres.

  19. Radio-tomographic images of postmidnight equatorial plasma depletions

    Science.gov (United States)

    Hei, Matthew A.; Bernhardt, Paul A.; Siefring, Carl L.; Wilkens, Matthew R.; Huba, Joseph D.; Krall, Jonathan F.; Valladares, Cesar E.; Heelis, Roderick A.; Hairston, Marc R.; Coley, W. Robin; Chau, Jorge L.; De La Jara, Cesar

    2014-01-01

    the first time, equatorial plasma depletions (EPDs) have been imaged in the longitude-altitude plane using radiotomography. High-resolution (~10 km) reconstructions of electron density were derived from total electron content (TEC) measurements provided by a receiver array in Peru. TEC data were obtained from VHF/UHF signals transmitted by the Coherent Electromagnetic Radio Tomography (CERTO) beacon on the C/NOFS satellite. EPDs generated premidnight were observed near dawn. On one night, the bubble densities were highly reduced, 100-1000 km wide, and embedded within a layerlike ionosphere. Three nights later, the EPDs exhibited similar features but were embedded in a locally uplifted ionosphere. The C/NOFS in situ instruments detected a dawn depletion where the reconstruction showed lifted EPDs, implying that the postmidnight electric fields raised sections of ionosphere to altitudes where embedded/reactivated fossil EPDs were detected as dawn depletions. Satellites flying under domelike distortions of the ionosphere may observe these distortions as broad plasma decreases (BPDs).

  20. GATEWAY Report Brief: OLED Lighting in the Offices of Aurora Lighting Design, Inc.

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2016-05-31

    Summary of a GATEWAY report evaluation at the offices of Aurora Lighting Design, Inc., in Grayslake, IL, where the GATEWAY program conducted its first investigation involving OLED lighting. The project experienced several challenges, but also highlighted a number of promising attributes – which indicate that with continued improvements in efficacy, longevity, size, and flexibility, OLEDs could provide a new tool for creative and effective lighting.

  1. Magnetospheric source region of discrete auroras inferred from their relationship with isotropy boundaries of energetic particles

    Directory of Open Access Journals (Sweden)

    A. G. Yahnin

    1997-08-01

    Full Text Available According to observations, the discrete auroral arcs can sometimes be found, either deep inside the auroral oval or at the poleward border of the wide (so-called double auroral oval, which map to very different regions of the magnetotail. To find common physical conditions for the auroral-arc generation in these magnetotail regions, we study the spatial relationship between the diffuse and discrete auroras and the isotropic boundaries (IBs of the precipitating energetic particles which can be used to characterise locally the equatorial magnetic field in the tail. From comparison of ground observation of auroral forms with meridional profiles of particle flux measured simultaneously by the low-altitude NOAA satellites above the ground observation region, we found that (1 discrete auroral arcs are always situated polewards from (or very close to the IB of >30-keV electrons, whereas (2 the IB of the >30-keV protons is often seen inside the diffuse aurora. These relationships hold true for both quiet and active (substorm conditions in the premidnight-nightside (18-01-h MLT sector considered. In some events the auroral arcs occupy a wide latitudinal range. The most equatorial of these arcs was found at the poleward edge of the diffuse auroras (but anyway in the vicinity of the electron IB, the most poleward arcs were simultaneously observed on the closed field lines near the polar-cap boundary. These observations disagree with the notion that the discrete aurora originate exclusively in the near-Earth portion of plasma sheet or exclusively on the PSBL field lines. Result (1 may imply a fundamental feature of auroral-arc formation: they originate in the current-sheet regions having very curved and tailward-stretched magnetic field lines.

  2. Aurora A Phosphorylates MCAK to Control Ran-dependent Spindle Bipolarity

    OpenAIRE

    Zhang, Xin; Ems-McClung, Stephanie C.; Walczak, Claire E.

    2008-01-01

    During mitosis, mitotic centromere-associated kinesin (MCAK) localizes to chromatin/kinetochores, a cytoplasmic pool, and spindle poles. Its localization and activity in the chromatin region are regulated by Aurora B kinase; however, how the cytoplasmic- and pole-localized MCAK are regulated is currently not clear. In this study, we used Xenopus egg extracts to form spindles in the absence of chromatin and centrosomes and found that MCAK localization and activity are tightly regulated by Auro...

  3. The budding yeast Ipl1/Aurora protein kinase regulates mitotic spindle disassembly

    OpenAIRE

    Buvelot, Stéphanie; Tatsutani, Sean Y.; Vermaak, Danielle; Biggins, Sue

    2003-01-01

    Ipl1p is the budding yeast member of the Aurora family of protein kinases, critical regulators of genomic stability that are required for chromosome segregation, the spindle checkpoint, and cytokinesis. Using time-lapse microscopy, we found that Ipl1p also has a function in mitotic spindle disassembly that is separable from its previously identified roles. Ipl1–GFP localizes to kinetochores from G1 to metaphase, transfers to the spindle after metaphase, and accumulates at the spindle midzone ...

  4. Integrating Felting in Elementary Science Classrooms to Facilitate Understanding of the Polar Auroras

    Directory of Open Access Journals (Sweden)

    Brandy Terrill

    2017-10-01

    Full Text Available The Next Generation Science Standards (NGSS emphasize conceptual science instruction that draws on students’ ability to make observations, explain natural phenomena, and examine concept relationships. This paper explores integrating the arts, in the form of felting, in elementary science classrooms as a way for students to model and demonstrate understanding of the complex scientific processes that cause the polar auroras. The steps for creating felting, and using the felting artwork students create for assessing science learning, are described.

  5. Discovery of novel inhibitors of Aurora kinases with indazole scaffold: In silico fragment-based and knowledge-based drug design.

    Science.gov (United States)

    Chang, Chun-Feng; Lin, Wen-Hsing; Ke, Yi-Yu; Lin, Yih-Shyan; Wang, Wen-Chieh; Chen, Chun-Hwa; Kuo, Po-Chu; Hsu, John T A; Uang, Biing-Jiun; Hsieh, Hsing-Pang

    2016-11-29

    Aurora kinases have emerged as important anticancer targets so that there are several inhibitors have advanced into clinical study. Herein, we identified novel indazole derivatives as potent Aurora kinases inhibitors by utilizing in silico fragment-based approach and knowledge-based drug design. After intensive hit-to-lead optimization, compounds 17 (dual Aurora A and B), 21 (Aurora B selective) and 30 (Aurora A selective) possessed indazole privileged scaffold with different substituents, which provide sub-type kinase selectivity. Computational modeling helps in understanding that the isoform selectivity could be targeted specific residue in the Aurora kinase binding pocket in particular targeting residues Arg220, Thr217 or Glu177. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  6. Sgo1 regulates both condensin and Ipl1/Aurora B to promote chromosome biorientation.

    Directory of Open Access Journals (Sweden)

    Karolina Peplowska

    2014-06-01

    Full Text Available Correct chromosome segregation is essential in order to prevent aneuploidy. To segregate sister chromatids equally to daughter cells, the sisters must attach to microtubules emanating from opposite spindle poles. This so-called biorientation manifests itself by increased tension and conformational changes across kinetochores and pericentric chromatin. Tensionless attachments are dissolved by the activity of the conserved mitotic kinase Aurora B/Ipl1, thereby promoting the formation of correctly attached chromosomes. Recruitment of the conserved centromeric protein shugoshin is essential for biorientation, but its exact role has been enigmatic. Here, we identify a novel function of shugoshin (Sgo1 in budding yeast that together with the protein phosphatase PP2A-Rts1 ensures localization of condensin to the centromeric chromatin in yeast Saccharomyces cerevisiae. Failure to recruit condensin results in an abnormal conformation of the pericentric region and impairs the correction of tensionless chromosome attachments. Moreover, we found that shugoshin is required for maintaining Aurora B/Ipl1 localization on kinetochores during metaphase. Thus, shugoshin has a dual function in promoting biorientation in budding yeast: first, by its ability to facilitate condensin recruitment it modulates the conformation of the pericentric chromatin. Second, shugoshin contributes to the maintenance of Aurora B/Ipl1 at the kinetochore during gradual establishment of bipolarity in budding yeast mitosis. Our findings identify shugoshin as a versatile molecular adaptor that governs chromosome biorientation.

  7. Phosphorylation of CPAP by Aurora-A Maintains Spindle Pole Integrity during Mitosis.

    Science.gov (United States)

    Chou, En-Ju; Hung, Liang-Yi; Tang, Chieh-Ju C; Hsu, Wen-Bin; Wu, Hsin-Yi; Liao, Pao-Chi; Tang, Tang K

    2016-03-29

    CPAP is required for centriole elongation during S/G2 phase, but the role of CPAP in mitosis is incompletely understood. Here, we show that CPAP maintains spindle pole integrity through its phosphorylation by Aurora-A during mitosis. Depletion of CPAP induced a prolonged delay in mitosis, pericentriolar material (PCM) dispersion, and multiple mitotic abnormalities. Further studies demonstrated that CPAP directly interacts with and is phosphorylated by Aurora-A at serine 467 during mitosis. Interestingly, the dispersal of the PCM was effectively rescued by ectopic expression of wild-type CPAP or a phospho-mimic CPAP-S467D mutant, but not a non-phosphorylated CPAP-S467A mutant. Finally, we found that CPAP-S467D has a low affinity for microtubule binding but a high affinity for PCM proteins. Together, our results support a model wherein CPAP is required for proper mitotic progression, and phosphorylation of CPAP by Aurora-A is essential for maintaining spindle pole integrity. Copyright © 2016 The Authors. Published by Elsevier Inc. All rights reserved.

  8. Jupiter's auroras during the Juno approach phase as observed by the Hubble Space Telescope

    Science.gov (United States)

    Nichols, J. D.; Clarke, J. T.; Orton, G. S.; Cowley, S. W. H.; Bunce, E. J.; Stallard, T.; Badman, S. V.; Grodent, D. C.; Bonfond, B.; Radioti, K.; Gerard, J. C. M. C.; Gladstone, R.; Bagenal, F.; Connerney, J. E. P.; Valek, P. W.; Ebert, R. W.; McComas, D. J.; Mauk, B.; Clark, G. B.; Kurth, W. S.; Yoshikawa, I.; Kimura, T.; Fujimoto, M.; Tao, C.; Bolton, S. J.

    2016-12-01

    We present movies of the Hubble Space Telescope (HST) observations of Jupiter's FUV auroras observed during the Juno approach phase and first capture orbit, and compare with Juno observations of the interplanetary medium near Jupiter and inside the magnetosphere. Jupiter's FUV auroras indicate the nature of the dynamic processes occurring in Jupiter's magnetosphere, and the approach phase provided a unique opportunity to obtain a full set of interplanetary data near to Jupiter at the time of a program of HST observations, along with the first simultaneous with Juno observations inside the magnetosphere. The overall goal was to determine the nature of the solar wind effect on Jupiter's magnetosphere. HST observations were obtained with typically 1 orbit per day over three intervals: 16 May - 7 June, 22-30 June and 11-18 July, i.e. while Juno was in the solar wind, around the bow shock and magnetosphere crossings, and in the mid-latitude middle-outer magnetospheres. We show that these intervals are characterised by particularly dynamic polar auroras, and significant variations in the auroral power output caused by e.g. dawn storms, intense main emission and poleward forms. We compare the variation of these features with Juno observations of interplanetary compression regions and the magnetospheric environment during the intervals of these observations.

  9. Phosphorylation of CPAP by Aurora-A Maintains Spindle Pole Integrity during Mitosis

    Directory of Open Access Journals (Sweden)

    En-Ju Chou

    2016-03-01

    Full Text Available CPAP is required for centriole elongation during S/G2 phase, but the role of CPAP in mitosis is incompletely understood. Here, we show that CPAP maintains spindle pole integrity through its phosphorylation by Aurora-A during mitosis. Depletion of CPAP induced a prolonged delay in mitosis, pericentriolar material (PCM dispersion, and multiple mitotic abnormalities. Further studies demonstrated that CPAP directly interacts with and is phosphorylated by Aurora-A at serine 467 during mitosis. Interestingly, the dispersal of the PCM was effectively rescued by ectopic expression of wild-type CPAP or a phospho-mimic CPAP-S467D mutant, but not a non-phosphorylated CPAP-S467A mutant. Finally, we found that CPAP-S467D has a low affinity for microtubule binding but a high affinity for PCM proteins. Together, our results support a model wherein CPAP is required for proper mitotic progression, and phosphorylation of CPAP by Aurora-A is essential for maintaining spindle pole integrity.

  10. Presumable European aurorae in the mid AD 770s were halo displays

    CERN Document Server

    Neuhaeuser, Dagmar

    2015-01-01

    The interpretation of the strong 14-C variation around AD 775 as one (or several) solar super-flare(s) by, e.g., Usoskin et al. (2013) is based on alleged aurora sightings in the mid AD 770s in Europe: A "red cross/crucifix" in AD 773/4/6 from the Anglo-Saxon Chronicle, "inflamed shields" in AD 776 (both listed in the aurora catalogue of Link 1962), and "riders on white horses" in AD 773 (newly proposed as aurora in Usoskin et al. 2013), the two latter from the Royal Frankish Annals. We discuss the reports about these three sightings in detail here. We can show that all three were halo displays: The "red cross" or "crucifix" is formed by the horizontal arc and a vertical pillar of light (either with the Sun during sunset or with the moon after sunset); the "inflamed shields" and the "riders on white horses" were both two mock suns, especially the latter narrated in form of a Christian adaptation of the antique dioscuri motive. While the latter event took place early in AD 774 (dated AD 773 in Usoskin et al. 2...

  11. On scientific utility inspired by collecting real-time reports of the aurora

    Science.gov (United States)

    MacDonald, E.; Kosar, B.; Heavner, M.; Case, N.; Michael, C. R.; Edwardson, A.; Patel, K.; Hall, M.

    2016-12-01

    Aurorasaurus is a new source of global, real-time data on the visibility of the aurora. Citizen science observations have been collected via a website, social media, and apps for over two years during active aurora times. In the data-starved field of space physics thousands of such reports are scientifically useful to test and extend coarse models predicting the extent of aurora. Accuracy improvements to the leading model based on case and statistical studies have been developed and these improvements implemented in better real time tools. Our project also uses Twitter data in novel ways, showing that it can robustly indicate geomagnetic activity in real-time, that locations can be extracted from tweets at significantly higher than usual rates, that the real-time veracity of reports can be verified, and that the efficacy of such a system can be tested. Through the project, enthusiasts and credentialed scientists have collaborated to investigate and make discoveries of rare auroral phenomena as well. We will discuss the scientific results in 5 papers to date, as well as aspects of these results that have similarities to other citizen science projects. We will discuss elements of the project particularly well suited for scientific inquiry as well as those aspects that have presented challenges.

  12. Properties of non-segregating tailings produced from the Aurora Oil Sands Mine tailings

    Energy Technology Data Exchange (ETDEWEB)

    Donahue, R.; Jeeravipoolvarn, S.; Scott, J.D. [Alberta Univ., Edmonton, AB (Canada). Dept. of Civil and Environmental Engineering; Ozum, B. [Apex Engineering Inc., Edmonton, AB (Canada)

    2008-07-01

    The properties of non-segregating tailings (NST) produced from the Aurora Oil Sands Mine tailings were discussed in this presentation. The purpose of the experimental program was to demonstrate the performance of calcium oxide (CaO) additive to produce NST from Syncrude Canada Ltd.'s Aurora Mine tailings. Several experiments were performed to determine the segregation boundary of the NST mix with an SFR of 5; the effect of the CaO dosage on the segregation boundary of the NST mix with an SFR of 5; and, the effect of the CaO dosage on the release water chemistry. The materials used and NST mix designs were discussed. The presentation also provided results in graphical format related to: effect of CaO amendments; sedimentation behaviour; release water chemistry; geochemical reactions; pH and alkalinity; and cation exchange reactions. It was concluded that the NST production process with CaO additive could produce non-segregating tailings from the blend of Aurora Mine's cyclone underflow and thickener underflow tailings. tabs., figs.

  13. An Isolated, Bright Cusp Aurora Associated with Dayside Reconnection at Saturn

    Science.gov (United States)

    Kinrade, J.; Badman, S. V.; Arridge, C. S.; Tao, C.; Provan, G.; Dougherty, M. K.; Grocott, A.

    2016-12-01

    Saturn's dayside aurorae display a number of morphological features polewards of the main emission region. We present an unusual morphology captured by the Hubble Space Telescope on 14 June 2014, where, for two hours, Saturn's FUV aurorae disappeared almost entirely, with the exception of a distinct emission spot at high latitude. The spot remained fixed in local time between 11-15 LT, and moved polewards to a maximum latitude of 85°, close to the magnetic dipole and planetary rotation axis. It was bright and persistent, displaying intensities of up to 49 kR over a lifetime of two hours. The formation of the spot coincided with the decay of Saturn's characteristic dawn arc, the complete absence of which is rarely observed. Solar wind parameters from propagation models, together with a Cassini magnetopause crossing, indicated a period of rarefaction and an uncompressed magnetosphere. We infer that the spot was sustained by repeated reconnection either poleward of the cusp, or at low-latitudes under a strong transverse component in the IMF. The poleward motion could then arise from either reconfiguration of successive open field lines across the polar cap, or convection of newly opened field lines. We also consider the influence of planetary period modulation of the feature by rotating current systems. This case study poses interesting questions about the driving of Saturn's aurorae ahead of the upcoming proximal Cassini orbits.

  14. Saturn's UV aurora: the (high latitude) point of view of Cassini (Invited)

    Science.gov (United States)

    Grodent, D. C.; Bonfond, B.; Gustin, J.; Radioti, A.; Gerard, J. M.; Pryor, W. R.

    2013-12-01

    The high latitude vantage point of Cassini and its short distance to Saturn give rise to a unique opportunity for obtaining exceptional spectral images of the aurorae, along with in situ observations of the associated particles and magnetic field. Cassini's T83 flyby of Titan significantly changed the inclination of the spacecraft's orbit and marked the beginning of the XXM inclined phase 1 which will last until March 16, 2015. We will give an overview of the auroral emissions observed so far with the UVIS camera on board Cassini. In particular we will link the morphology of the aurora with specific magnetospheric processes, such as dayside reconnection and auroral bifurcations, nightside reconnection, hot plasma injections. We will also take advantage of the view from nearly above the poles to describe the overall shape and size of the aurora, which are expected to respond to the solar wind conditions. Moreover, this presentation will focus on small-scale features, which can only be observed by an instrument close enough to the planet. We will also present movies of these observations, allowing us to explore the auroral dynamics at various timescales. This information will be used to identify the various mechanisms at play in Saturn's magnetosphere.

  15. TPXL-1 activates Aurora A to clear contractile ring components from the polar cortex during cytokinesis.

    Science.gov (United States)

    Mangal, Sriyash; Sacher, Jennifer; Kim, Taekyung; Osório, Daniel Sampaio; Motegi, Fumio; Carvalho, Ana Xavier; Oegema, Karen; Zanin, Esther

    2018-01-08

    During cytokinesis, a signal from the central spindle that forms between the separating anaphase chromosomes promotes the accumulation of contractile ring components at the cell equator, while a signal from the centrosomal microtubule asters inhibits accumulation of contractile ring components at the cell poles. However, the molecular identity of the inhibitory signal has remained unknown. To identify molecular components of the aster-based inhibitory signal, we developed a means to monitor the removal of contractile ring proteins from the polar cortex after anaphase onset. Using this assay, we show that polar clearing is an active process that requires activation of Aurora A kinase by TPXL-1. TPXL-1 concentrates on astral microtubules coincident with polar clearing in anaphase, and its ability to recruit Aurora A and activate its kinase activity are essential for clearing. In summary, our data identify Aurora A kinase as an aster-based inhibitory signal that restricts contractile ring components to the cell equator during cytokinesis. © 2018 Mangal et al.

  16. High-Rate Fabrication of a-Si-Based Thin-Film Solar Cells Using Large-Area VHF PECVD Processes

    Energy Technology Data Exchange (ETDEWEB)

    Deng, Xunming [University of Toledo; Fan, Qi Hua

    2011-12-31

    The University of Toledo (UT), working in concert with it’s a-Si-based PV industry partner Xunlight Corporation (Xunlight), has conducted a comprehensive study to develop a large-area (3ft x 3ft) VHF PECVD system for high rate uniform fabrication of silicon absorber layers, and the large-area VHF PECVD processes to achieve high performance a-Si/a-SiGe or a-Si/nc-Si tandem junction solar cells during the period of July 1, 2008 to Dec. 31, 2011, under DOE Award No. DE-FG36-08GO18073. The project had two primary goals: (i) to develop and improve a large area (3 ft × 3 ft) VHF PECVD system for high rate fabrication of > = 8 Å/s a-Si and >= 20 Å/s nc-Si or 4 Å/s a-SiGe absorber layers with high uniformity in film thicknesses and in material structures. (ii) to develop and optimize the large-area VHF PECVD processes to achieve high-performance a-Si/nc-Si or a-Si/a-SiGe tandem-junction solar cells with >= 10% stable efficiency. Our work has met the goals and is summarized in “Accomplishments versus goals and objectives”.

  17. Analisis interferensi T-DAB dan TV Analog pada pita Very High Frequency (VHF

    Directory of Open Access Journals (Sweden)

    Kasmad Ariansyah

    2014-09-01

    Full Text Available Kehadiran teknologi digital telah membawa perubahan di dalam berbagai aspek kehidupan, tak terkecuali di dunia penyiaran. Digitalisasi dibidang penyiaran diyakini dapat memberikan manfaat dalam hal efisiensi spektrum frekuensi radio. Berkaitan dengan penyiaran radio, Menteri  Komunikasi  dan  Informatika telah menetapkan DAB family sebagai standard penyiaran radio digital di Indonesia. Kajian dilakukan untuk mendapatkan jarak minimum yang diperlukan  antara sistem T-DAB dan TV analog sebagai solusi terhadap kemungkinan interferensi. Analisis dilakukan dengan bantuan SEAMCAT. Berdasarkan hasil analisis disimpulkan bahwa  kanal  A  T-DAB  merupakan  kanal yang paling rentan terhadap interferensi; Untuk mencapai probabilitas interferensi maksimum 5%, separasi geograpis minimum antara cakupan terluar TV analog kanal n dan transmitter terluar pada jaringan SFN T-DAB untuk kanal (n- 1D, nA, nB, nC berturut-turut adalah 220 Km, 290 Km, 145 Km dan  40  Km.  Sedangkan  untuk  kanal  nD  dan  (n+1A  dapat dioperasikan tanpa separasi geograpis dengan TV analog.

  18. Tools of radio astronomy

    CERN Document Server

    Wilson, Thomas L; Hüttemeister, Susanne

    2013-01-01

    This 6th edition of “Tools of Radio Astronomy”, the most used introductory text in radio astronomy, has been revised to reflect the current state of this important branch of astronomy. This includes the use of satellites, low radio frequencies, the millimeter/sub-mm universe, the Cosmic Microwave Background and the increased importance of mm/sub-mm dust emission. Several derivations and presentations of technical aspects of radio astronomy and receivers, such as receiver noise, the Hertz dipole and  beam forming have been updated, expanded, re-worked or complemented by alternative derivations. These reflect advances in technology. The wider bandwidths of the Jansky-VLA and long wave arrays such as LOFAR and mm/sub-mm arrays such as ALMA required an expansion of the discussion of interferometers and aperture synthesis. Developments in data reduction algorithms have been included. As a result of the large amount of data collected in the past 20 years, the discussion of solar system radio astronomy, dust em...

  19. Radio Galaxy Zoo: A Search for Hybrid Morphology Radio Galaxies

    Science.gov (United States)

    Kapińska, A. D.; Terentev, I.; Wong, O. I.; Shabala, S. S.; Andernach, H.; Rudnick, L.; Storer, L.; Banfield, J. K.; Willett, K. W.; de Gasperin, F.; Lintott, C. J.; López-Sánchez, Á. R.; Middelberg, E.; Norris, R. P.; Schawinski, K.; Seymour, N.; Simmons, B.

    2017-12-01

    Hybrid morphology radio sources (HyMoRS) are a rare type of radio galaxy that display different Fanaroff-Riley classes on opposite sides of their nuclei. To enhance the statistical analysis of HyMoRS, we embarked on a large-scale search of these sources within the international citizen science project, Radio Galaxy Zoo (RGZ). Here, we present 25 new candidate hybrid morphology radio galaxies. Our selected candidates are moderate power radio galaxies ({L}{median}=4.7× {10}24 W Hz-1 sr-1) at redshifts 0.14 1 Mpc) radio galaxies, one resides at the center of a galaxy cluster, and one is hosted by a rare green bean galaxy. Although the origin of the hybrid morphology radio galaxies is still unclear, this type of radio source starts depicting itself as a rather diverse class. We discuss hybrid radio morphology formation in terms of the radio source environment (nurture) and intrinsically occurring phenomena (nature; activity cessation and amplification), showing that these peculiar radio galaxies can be formed by both mechanisms. While high angular resolution follow-up observations are still necessary to confirm our candidates, we demonstrate the efficacy of the RGZ in the pre-selection of these sources from all-sky radio surveys, and report the reliability of citizen scientists in identifying and classifying complex radio sources.

  20. Desenvolvimento dos frutos de pêssego 'Aurora' e nectarina 'Sunraycer' no sul de Santa Catarina

    Directory of Open Access Journals (Sweden)

    Emilio Della Bruna

    2011-10-01

    Full Text Available O desenvolvimento do fruto de pessegueiro é resultado da diferenciação e do crescimento das paredes do ovário após a fecundação. A persistência e o crescimento do fruto na planta dependem das relações exatas entre os hormônios auxina, giberelina e citocinina que condicionam o desenvolvimento dos frutos, caracterizado por uma curva dupla sigmoide, com três estádios distintos. O presente trabalho teve por objetivo conhecer o comportamento dos frutos e das sementes do pêssego Aurora e da Nectarina Sunraycer durante todo o seu ciclo de desenvolvimento. O crescimento dos frutos e das sementes durante o ciclo foi determinado semanalmente, coletando-se 30 frutos de dez diferentes plantas em ramos previamente identificados. As sementes foram separadas do fruto para a determinação do peso fresco (PF e do peso seco (PS. O crescimento dos frutos da variedade Sunraycer dá-se de forma contínua e acelerada desde a floração até a maturação, sugerindo um curto período ou a inexistência do Estágio II de crescimento. Para a variedade Aurora, a curva de crescimento é diferenciada nos três estádios (I, II e III. O raleio dos frutos deve ser feito até o início do estádio II, para a variedade Aurora e Sunraycer. As sementes das variedades Aurora e Sunraycer atingem seu tamanho máximo no estágio I de crescimento do fruto. O aumento de peso seco na semente, para a variedade Sunraycer, é praticamente inexistente no estádio III, enquanto para a variedade Aurora ocorre o maior aumento de peso seco que vai até a maturação do fruto.

  1. Auroras and Space Weather Celebrating the International Heliophysics Year in Classroom

    Science.gov (United States)

    Craig, N.; Peticolas, L. M.; Angelopoulos, V.; Thompson, B.

    2007-05-01

    2007 Celebrates the International Heliophysics year and its outreach has a primary objective, to "demonstrate the beauty, relevance and significance of Space and Earth Science to the world." NASA's first five-satellite mission, THEMIS (Time History of Events and Macroscale Interactions during Substorms), was launched on February 17, 2007 and is to investigate a key mystery surrounding the dynamics of the auroras- when, where, and how are they triggered? When the five probes align perfectly over the North American continent- every four days - and with 20 ground stations in Northern Canada and Alaska with automated, all-sky cameras will document the auroras from Earth. To monitor the large-scale local effects of the currents in space, THEMIS Education and Outreach program has installed 10 ground magnetometers, instruments that measure Earth's magnetic field, in competitively selected rural schools around the country and receive data. The THEMIS Education and Outreach Program shares the IHY objective by bringing in this live local space weather data in the classrooms and engaging the teachers and students on authentic research in the classroom. The data are displayed on the school computer monitors as well as on the THEMIS E/PO website providing the local data to the science mission as well as schools. Teachers use the data to teach about the aurora not only in math and science, but also in Earth science, history and art. These students and their teachers are our ambassadors to rural America and share the excitement of learning and teaching with their regional teachers. We will share how authentic space science data related to Earth's magnetic field and auroras can be understood, researched, predicted and shared via the internet to any school around the globe that wished to be part of tracking solar storms. Complimenting IHY, World Space Week will take place from October 4-10th and this year. World Space week is "an international celebration of science and technology

  2. Galactic radio astronomy

    CERN Document Server

    Sofue, Yoshiaki

    2017-01-01

    This book is a concise primer on galactic radio astronomy for undergraduate and graduate students, and provides wide coverage of galactic astronomy and astrophysics such as the physics of interstellar matter and the dynamics and structure of the Milky Way Galaxy and galaxies. Radio astronomy and its technological development have led to significant progress in galactic astronomy and contributed to understanding interstellar matter and galactic structures. The book begins with the fundamental physics of radio-wave radiation, i.e., black body radiation, thermal emission, synchrotron radiation, and HI and molecular line emissions. The author then gives overviews of ingredients of galactic physics, including interstellar matter such as the neutral (HI), molecular hydrogen, and ionized gases, as well as magnetic fields in galaxies. In addition, more advanced topics relevant to the Galaxy and galaxies are also contained here: star formation, supernova remnants, the Galactic Center and black holes, galactic dynamics...

  3. Radio frequency spectrum management

    Science.gov (United States)

    Sujdak, E. J., Jr.

    1980-03-01

    This thesis is a study of radio frequency spectrum management as practiced by agencies and departments of the Federal Government. After a brief introduction to the international agency involved in radio frequency spectrum management, the author concentrates on Federal agencies engaged in frequency management. These agencies include the National Telecommunications and Information Administration (NTIA), the Interdepartment Radio Advisory Committee (IRAC), and the Department of Defense (DoD). Based on an analysis of Department of Defense frequency assignment procedures, recommendations are given concerning decentralizing military frequency assignment by delegating broader authority to unified commanders. This proposal includes a recommendation to colocate the individual Service frequency management offices at the Washington level. This would result in reduced travel costs, lower manpower requirements, and a common tri-Service frequency management data base.

  4. Aurora Kinase Inhibitor PHA-739358 Suppresses Growth of Hepatocellular Carcinoma In Vitro and in a Xenograft Mouse Model

    Directory of Open Access Journals (Sweden)

    Daniel Benten

    2009-09-01

    Full Text Available Patients with advanced stages of hepatocellular carcinoma (HCC face a poor prognosis. Although encouraging clinical results have been obtained with multikinase inhibitor sorafenib, the development of improved therapeutic strategies for HCC remains an urgent goal. Aurora kinases are key regulators of the cell cycle, and their uncontrolled expression promotes aneuploidy and tumor development. In tissue microarray analyses, we detected aurora-A kinase expression in all of the examined 93 human HCC samples, whereas aurora-B kinase expression levels significantly correlated with the proliferation index of HCCs. In addition, two human HCC cell lines (Huh-7 and HepG2 were tested positive for aurora-A and -B and revealed Ser10 phosphorylation of histone H3, indicating an increased aurora-B kinase activity. The antiproliferative features of a novel aurora kinase inhibitor, PHA-739358, currently under investigation in phase 2 clinical trials for other solid tumors, were examined in vitro and in vivo. At concentrations exceeding 50nM, PHA-739358 completely suppressed tumor cell proliferation in cell culture experiments and strongly decreased histone H3 phosphorylation. Cell cycle inhibition and endoreduplication were observed at 50 nM, whereas higher concentrations led to a complete G2/M-phase arrest. In vivo, administration of PHA-739358 resulted in significant tumor growth inhibition at a well-tolerated dose. In combination with sorafenib, additive effects were observed. Remarkably, when tumors restarted to grow under sorafenib monotherapy, subsequent treatment with PHA-739358 induced tumor shrinkage by up to 81%. Thus, targeting aurora kinases with PHA-739358 is a promising therapeutic strategy administered alone or in combination with sorafenib for patients with advanced stages of HCC.

  5. A reconfigurable radio architecture for Cognitive Radio in emergency networks

    NARCIS (Netherlands)

    Zhang, Q.; Kokkeler, Andre B.J.; Smit, Gerardus Johannes Maria

    2006-01-01

    Cognitive Radio has been proposed as a promising technology to solve today’s spectrum scarcity problem. Cognitive Radio is able to sense the spectrum to find the free spectrum, which can be optimally used by Cognitive Radio without causing interference to the licensed user. In the scope of the

  6. Radio spectra of Gigahertz Peaked Spectrum radio sources

    NARCIS (Netherlands)

    deVries, WH; Barthel, PD; ODea, CP

    A well defined sample of 72 Gigahertz Peaked Spectrum radio sources is compiled, having turnover frequencies in the range of 0.5 - 10 GHz. Using this sample, the canonical GPS radio spectrum is constructed, which is found to have a constant shape, independent of AGN type, redshift or radio

  7. Spectrum management and radio resource management considering cognitive radio systems

    NARCIS (Netherlands)

    Haartsen, J.C.; Wieweg, Lasse; Huschke, Jörg

    2005-01-01

    International fora and some national administrations define a cognitive radio (CR) as a pioneering radio communication system that would be capable of altering and adapting its transmitter and receiver parameters based on communication and the exchange of information with related detectable radio

  8. 75 FR 10439 - Cognitive Radio Technologies and Software Defined Radios

    Science.gov (United States)

    2010-03-08

    ... COMMISSION 47 CFR Part 2 Cognitive Radio Technologies and Software Defined Radios AGENCY: Federal... of Engineering and Technology, (202) 418-7506, e-mail: [email protected] . SUPPLEMENTARY... Order 1. On March 17, 2005, the Commission adopted the Cognitive Radio Report and Order, 70 FR 23032...

  9. Low VHF Channel Measurements and Simulations in Indoor and Outdoor Scenarios

    Science.gov (United States)

    2015-05-01

    S11 and radiation pattern of the λ/6 antenna ......................8 Fig. 5 The USRP integrated on a PackBot mobile platform...comparison, whereas in Fig. 3a the signal is only received via an antenna. 3.1 System Hardware 3.1.1 Radio and Daughtercards We use the USRP model N210 SDR for...our tests.46 The USRP N210 provides an Ethernet interface that allows us to use software control for transmission and reception. The USRP is

  10. CLUSTERED RADIO INTERFEROMETRIC CALIBRATION

    NARCIS (Netherlands)

    Kazemi, S.; Yatawatta, S.; Zaroubi, S.

    2011-01-01

    This paper introduces an amendment to radio interferometric calibration of sources below the noise level. The main idea is to employ the information of the stronger sources' measured signals as a plug-in criterion to solve for the weaker ones. For this purpose, we construct a number of source

  11. Educational Broadcasting--Radio.

    Science.gov (United States)

    Ahamed, Uvais; Grimmett, George

    This manual is intended for those who must conduct educational radio broadcasting training courses in Asia-Pacific countries without the resources of experienced personnel, as well as for individuals to use in self-learning situations. The selection of material has been influenced by the need to use broadcasting resources effectively in programs…

  12. Radio Broadcast Technology

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 7; Issue 1. Radio Broadcast Technology. Harsh Vardhan. General Article Volume 7 Issue 1 January 2002 pp 53-63. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/007/01/0053-0063. Keywords. Hertzian ...

  13. Division x: Radio Astronomy

    NARCIS (Netherlands)

    Taylor, Russ; Chapman, Jessica; Rendong, Nan; Carilli, Christopher; Giovannini, Gabriele; Hills, Richard; Hirabayashi, Hisashi; Jonas, Justin; Lazio, Joseph; Morganti, Raffaella; Rubio, Monica; Shastri, Prajval

    This triennium has seen a phenomenal investment in development of observational radio astronomy facilities in all parts of the globe at a scale that significantly impacts the international community. This includes both major enhancements such as the transition from the VLA to the EVLA in North

  14. Torun Radio Astronomy Observatory

    Science.gov (United States)

    Murdin, P.

    2000-11-01

    Torun Center for Astronomy is located at Piwnice, 15 km north of Torun, Poland. A part of the Faculty of Physics and Astronomy of the Nicolaus Copernicus University, it was created by the union of Torun Radio Astronomy Observatory (TRAO) and the Institute of Astronomy on 1 January 1997....

  15. Valuing commercial radio licences

    NARCIS (Netherlands)

    Kerste, M.; Poort, J.; van Eijk, N.

    2011-01-01

    Within the EU Regulatory Framework, licensees for commercial radio broadcasting may be charged a fee to ensure optimal allocation of scarce resources but not to maximize public revenues. In this paper, it is described how such a fee can be determined for the purpose of licence renewal or extension.

  16. Digital Low Frequency Radio Camera

    Science.gov (United States)

    Fullekrug, M.; Mezentsev, A.; Soula, S.; van der Velde, O.; Poupeney, J.; Sudre, C.; Gaffet, S.; Pincon, J.

    2012-04-01

    This contribution reports the design, realization and operation of a novel digital low frequency radio camera towards an exploration of the Earth's electromagnetic environment with particular emphasis on lightning discharges and subsequent atmospheric effects such as transient luminous events. The design of the digital low frequency radio camera is based on the idea of radio interferometry with a network of radio receivers which are separated by spatial baselines comparable to the wavelength of the observed radio waves, i.e., ~1-100 km which corresponds to a frequency range from ~3-300 kHz. The key parameter towards the realization of the radio interferometer is the frequency dependent slowness of the radio waves within the Earth's atmosphere with respect to the speed of light in vacuum. This slowness is measured with the radio interferometer by using well documented radio transmitters. The digital low frequency radio camera can be operated in different modes. In the imaging mode, still photographs show maps of the low frequency radio sky. In the video mode, movies show the dynamics of the low frequency radio sky. The exposure time of the photograhps, the frame rate of the video, and the radio frequency of interest can be adjusted by the observer. Alternatively, the digital radio camera can be used in the monitoring mode, where a particular area of the sky is observed continuously. The first application of the digital low frequency radio camera is to characterize the electromagnetic energy emanating from sprite producing lightning discharges, but it is expected that it can also be used to identify and investigate numerous other radio sources of the Earth's electromagnetic environment.

  17. The real-time state of the aurora -- a research to operations need with a citizen science solution?

    Science.gov (United States)

    Heavner, M.; MacDonald, E.; Case, N.; McCloat, S.

    2015-12-01

    A prototype citizen science application called Aurorasaurus has been developed and launched in 2014. The goal of this platform is crowdsourcing observations of the aurora in real-time in order to assess global visibility of the aurora for the public. Users can submit observations, verify relevant social media observations, learn about the aurora, and receive location-based alerts based on verified reports, all in near real-time. The size and distribution of the citizen scientist community around the world has tremendous potential both for documenting the visible manifestations of global space weather impacts as well as providing quality control on the reported sightings. Information with high spatial and temporal resolution of the largest, most dynamic and mysterious space weather events is made possible by this solution, and this data can be integrated with other ground and space based measures of auroral activity. We will present initial results during the large geomagnetic events of 2015 and comparison to other measures of auroral activity. Our findings indicate the prototype application can be a valuable tool for real-time aurora knowledge and should be included in discussions of real-time aurora nowcasting needs. We will discuss those needs and assess the feasibility of available systems for meeting them.

  18. Benzimidazole-Based Quinazolines: In Vitro Evaluation, Quantitative Structure-Activity Relationship, and Molecular Modeling as Aurora Kinase Inhibitors.

    Science.gov (United States)

    Sharma, Alka; Luxami, Vijay; Saxena, Sanjai; Paul, Kamaldeep

    2016-03-01

    A series of benzimidazole-based quinazoline derivatives with different substitutions of primary and secondary amines at the C2 position (1-12) were evaluated for their Aurora kinase inhibitory activities. All compounds except for 3 and 6 showed good activity against Aurora kinase inhibitors, with IC50 values in the range of 0.035-0.532 μM. The ligand efficiency (LE) of the compounds with Aurora A kinase was also determined. The structure-activity relationship and the quantitative structure-activity relationship revealed that the Aurora inhibitory activities of these derivatives primarily depend on the different substitutions of the amine present at the C2 position of the quinazoline core. Molecular docking studies in the active binding site also provided theoretical support for the experimental biological data acquired. The current study identifies a novel class of Aurora kinase inhibitors, which can further be used for the treatment of cancer. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  19. Ham Radio is Mir Magic.

    Science.gov (United States)

    Evans, Gary

    1997-01-01

    Presents a classroom activity in which students communicated with U.S. and Russian astronauts via ham radio while they were in orbit on the space station Mir. Gives suggestions for other ham radio classroom activities as well as names of organizations, publications, and grant programs that teachers can access to help in bring ham radio into their…

  20. Extragalactic radio continuum surveys and the transformation of radio astronomy

    Science.gov (United States)

    Norris, Ray P.

    2017-10-01

    Next-generation radio surveys are about to transform radio astronomy by discovering and studying tens of millions of previously unknown radio sources. These surveys will provide fresh insights for understanding the evolution of galaxies, measuring the evolution of the cosmic star-formation rate, and rivalling traditional techniques in the measurement of fundamental cosmological parameters. By observing a new volume of observational parameter space, they are also likely to discover unexpected phenomena. This Review traces the evolution of extragalactic radio continuum surveys from the earliest days of radio astronomy to the present, and identifies the challenges that must be overcome to achieve this transformational change.

  1. R. B. Cunninghame Graham’s “Aurora La Cujiñi” (1898 : An Exploration / Aurora La Cujiñi” (1898 de R. B. Cunninghame Graham - Una indagación

    Directory of Open Access Journals (Sweden)

    John C. Mc Intyre

    2011-06-01

    Full Text Available Abstract: In Aurora La Cujiñi-A realistic sketch in Seville, published by the Scottish writer R. B. Cunninghame Graham in 1898, the frontispiece showed the sepia image of a female flamenco dancer. What might ‘La Cujiñi’ mean? Charles Davillier and Gustave Doré in 1862-63 note the existence of a Sevillan dancer with this name. In 2011 the present writer was gifted an old lithograph, in colour, published in Seville ‘c. 1850’ and entitled ‘Aurora La Cujiñí’ - with ñ and í. The two images are supplied. ‘Aurora La Cujiñi’ really existed. Graham’s sketch has five phases: Seville; the bullfight; the crowd’s return to town; a low-quality flamenco show; and the highly stirring performance by an initially anonymous female dancer - the dead Aurora brought back to life. Graham emphasises the Seville blend of blood and sensuality in a realist style also capable of mockery and criticism. Graham’s writing includes a good variety of well-controlled Spanish vocabulary, his empathy with horses and a deep nostalgia for times past. W. H. Hudson, writer and friend of Graham, in 1894 recommended that Graham should read the Argentine sketches published by Alfred Ébélot in 1890. In Aurora La Cujiñi Graham in 1898 is beginning to show mastery of the literary sketch. Question: Might Lorca have read Aurora La Cujiñi before drafting “Teoría y juego del duende”? Resumen: En Aurora La Cujiñi-A realistic sketch in Seville (1898 del escritor escocés R. B. Cunninghame Graham, el frontispicio llevaba la imagen en sepia de una bailadora de flamenco. ¿Qué podría significar ‘La Cujiñi’? Charles Davillier y Gustave Doré en 1862-1863 apuntan la existencia de una bailaora sevillana con este nombre. En 2011 al que esto escribe le regalaron una litografía antigua, en color, publicada en Sevilla ‘hacia 1850’ e intitulada ‘Aurora la Cujiñí’ - con ñ y con í. Se incluyen las dos imágenes. ‘Aurora La Cujiñi’ realmente

  2. INOVASI RADIO KAMPUS (RANCANG BANGUN RADIO UDINUS DENGAN INOVASI TEKNOLOGI @RADIO

    Directory of Open Access Journals (Sweden)

    Wellia Shinta Sari

    2014-08-01

    Full Text Available Perkembangan Teknologi Informasi dan Komunikasi (TIK memaksa industri penyiaran untuk ikut menyesuaikan diri. Radio konvensional bisa jadi akan tertinggal jika tidak melakukan inovasi teknologi yang ada. Begitu juga dengan radio kampus, yang keberadaannya sangat dibutuhkan sebagai wadah kreativitas dan sarana pembelajaran di sebuah universitas, apalagi yang memiliki program studi penyiaran. Radio kampus Suara Dian yang masih konvensional sehingga hampir kehilangan eksistensinya harus segera dibenahi dan dihidupkan kembali dengan mengikuti perkembangan teknologi di era konvergensi. Metode Inovasi teknologi yang bisa dilakukan adalah dengan menggunakan teknologi @Radio Streaming, yang bukan sekedar streaming, tapi juga optimalisasi teknologi yang terintegrasi dinamis melalui RISE (Radio Broadcasting Integrated System. Dengan berbagai fitur unggul dari inovasi teknologi tersebut, maka diharapkan Radio kampus Udinus ”Suara Dian” dapat kembali hidup, berkembang dan lebih kompetitif ditengah industri penyiaran Radio. Kata kunci : radio, kampus, konvergensi, streaming.

  3. MODELING OF PATTERN FORMING PROCESS OF AUTOMATIC RADIO DIRECTION FINDER OF PHASE VHF IN THE DEVELOPMENT ENVIRONMENT OF LabVIEW APPLIED PROGRAMS

    Directory of Open Access Journals (Sweden)

    G. K. Aslanov

    2015-01-01

    Full Text Available In the article is developed the model demonstrating the forming process of pattern of antenna system of aerodrome quasidopler automatic radiodirection-finder station in the development environment of LabVIEW applied programs of National Instrument company. 

  4. Configurable SDR Operation for Cognitive Radio Applications using GNU Radio and the Universal Software Radio Peripheral

    OpenAIRE

    Scaperoth, David Alan

    2007-01-01

    With interoperability issues plaguing emergency responders throughout the country, Cognitive Radio (CR) offers a unique solution to streamline communication between police, Emergency Medical Technicians (EMT), and military officers. Using Software Defined Radio (SDR) technology, a flexible radio platform can be potentially configured using a Cognitive Engine (CE) to transmit and receive many different incompatible radio standards. In this thesis, an interface between a Cognitive Engine and...

  5. Ultraviolet aurora on outer planets: morphology and remote sensing of electron precipitation

    Science.gov (United States)

    Gerard, Jean-Claude; Bisikalo, Dmitry; Shematovich, Valery; Soret, Lauriane

    2016-07-01

    The aurora is the result of the interaction between energetic particles and the upper atmosphere of a planet. Generally, energetic particles from the magnetosphere penetrate the atmosphere, partly deposit their energy and are partly reflected. Their collisional interactions with the atmospheric atoms and molecules heat the atmosphere and produce auroral emissions. Consequently, the aurora then bears the signature of both the acceleration mechanism and the atmospheric structure and composition. Jupiter's UV auroral H2 and H emissions are generally divided into several components. The main auroral emission at Jupiter is associated with the giant current loop connecting the region of co-rotation breakdown in the middle magnetosphere with the ionosphere. The polar emissions observed inside the main emission are very variable over short timescales. The observed diffuse emission equatorward of the main emission is most likely related to precipitation resulting from wave-particle interactions. Finally, the satellite magnetic footprints are created by accelerated electrons resulting from the interaction between the Galilean moons and the plasma in the Jovian magnetosphere. Saturn's magnetosphere and its aurorae appear to be both solar wind driven as the terrestrial magnetosphere and rotationally dominated, similarly to Jupiter. In addition to the main auroral ring, transient features have been recently identified. Uranus displays aurorae quite different from the other two with faint small-size structures appearing following solar storm activity. These different processes are probably associated with different energy spectra of the precipitated electrons. We present an overview of recent results concerning the relation between morphology, variability and remote sensing of the auroral electron energy in the different components. We show that mapping the UV color ratio is a powerful tool to globally characterize the electron precipitation and the flux-energy relation

  6. Overexpression of Aurora-A in primary cells interferes with S-phase entry by diminishing Cyclin D1 dependent activities

    Directory of Open Access Journals (Sweden)

    Mayer Christoph-Erik

    2011-03-01

    Full Text Available Abstract Background Aurora-A is a bona-fide oncogene whose expression is associated with genomic instability and malignant transformation. In several types of cancer, gene amplification and/or increased protein levels of Aurora-A are a common feature. Results In this report, we describe that inhibition of cell proliferation is the main effect observed after transient overexpression of Aurora-A in primary human cells. In addition to the known cell cycle block at the G2/M transition, Aurora-A overexpressing cells fail to overcome the restriction point at the G1/S transition due to diminished RB phosphorylation caused by reduced Cyclin D1 expression. Consequently, overexpression of Cyclin D1 protein is able to override the Aurora-A mediated G1 block. The Aurora-A mediated cell cycle arrest in G2 is not influenced by Cyclin D1 and as a consequence cells accumulate in G2. Upon deactivation of p53 part of the cells evade this premitotic arrest to become aneuploid. Conclusion Our studies describe that an increase of Aurora-A expression levels on its own has a tumor suppressing function, but in combination with the appropriate altered intracellular setting it might exert its oncogenic potential. The presented data indicate that deactivation of the tumor suppressor RB is one of the requirements for overriding a cell cycle checkpoint triggered by increased Aurora-A levels.

  7. The Mars diffuse aurora: A model of ultraviolet and visible emissions

    Science.gov (United States)

    Gérard, J.-C.; Soret, L.; Shematovich, V. I.; Bisikalo, D. V.; Bougher, S. W.

    2017-05-01

    A new type of Martian aurora, characterized by an extended spatial distribution, an altitude lower than the discrete aurora and electron precipitation up to 200 keV has been observed following solar activity on several occasions from the MAVEN spacecraft. We describe the results of Monte Carlo simulations of the production of several ultraviolet and violet auroral emissions for initial electron energies extending from 0.25 to 200 keV. These include the CO2+ ultraviolet doublet (UVD) at 288.3 and 289.6 nm and the Fox-Duffendack-Barker (FDB) bands, CO Cameron and Fourth Positive bands, OI 130.4 and 297.2 nm and CI 156.1 nm and 165.7 nm multiplets. We calculate the nadir and limb production rates of several of these emissions for a unit precipitated energy flux. Our results indicate that electrons in the range 50-200 keV produce maximum CO2+ UVD emission below 75 km, in agreement with the MAVEN observations. We calculate the efficiency of photon production per unit precipitated electron power. The strongest emissions are the CO2+ FDB, UVD and CO Cameron bands and the oxygen emission at 297.2 nm. The metastable a 3Π state which radiates the Cameron bands is deactivated by collisions below about 110 km. As a consequence, we show that the Cameron band emission is expected to peak at a higher altitude than the CO2+ UVD and FDB bands. Collisional quenching also causes the intensity ratio of the CO2+ UVD to CO Cameron bands to increase below ∼100 km in the energetic diffuse aurora.

  8. Search for Potent and Selective Aurora A Inhibitors Based on General Ser/Thr Kinase Pharmacophore Model.

    Science.gov (United States)

    Vasilevich, Natalya I; Tatarskiy, Victor V; Aksenova, Elena A; Kazyulkin, Denis N; Afanasyev, Ilya I

    2016-04-13

    Based on the data for compounds known from the literature to be active against various types of Ser/Thr kinases, a general pharmachophore model for these types of kinases was developed. The search for the molecules fitting to this pharmacophore among the ASINEX proprietary library revealed a number of compounds, which were tested and appeared to possess some activity against Ser/Thr kinases such as Aurora A, Aurora B and Haspin. Our work on the optimization of these molecules against Aurora A kinase allowed us to achieve several hits in a 3-5 nM range of activity with rather good selectivity and Absorption, Distribution, Metabolism, and Excretion (ADME) properties, and cytotoxicity against 16 cancer cell lines. Thus, we showed the possibility to fine-tune the general Ser/Thr pharmacophore to design active and selective compounds against desired types of kinases.

  9. Optical imaging of airglow structure in equatorial plasma bubbles at radio scintillation scales

    Science.gov (United States)

    Holmes, J. M.; Pedersen, T.; Parris, R. T.; Stephens, B.; Caton, R. G.; Dao, E. V.; Kratochvil, S.; Morton, Y.; Xu, D.; Jiao, Y.; Taylor, S.; Carrano, C. S.

    2015-12-01

    Imagery of optical emissions from F-region plasma is one of the few means available todetermine plasma density structure in two dimensions. However, the smallest spatial scalesobservable with this technique are typically limited not by magnification of the lens or resolutionof the detector but rather by the optical throughput of the system, which drives the integrationtime, which in turn causes smearing of the features that are typically moving at speeds of 100m/s or more. In this paper we present high spatio-temporal imagery of equatorial plasma bubbles(EPBs) from an imaging system called the Large Aperture Ionospheric Structure Imager(LAISI), which was specifically designed to capture short-integration, high-resolution images ofF-region recombination airglow at λ557.7 nm. The imager features 8-inch diameter entranceoptics comprised of a unique F/0.87 lens, combined with a monolithic 8-inch diameterinterference filter and a 2x2-inch CCD detector. The LAISI field of view is approximately 30degrees. Filtered all-sky images at common airglow wavelengths are combined with magneticfield-aligned LAISI images, GNSS scintillation, and VHF scintillation data obtained atAscension Island (7.98S, 14.41W geographic). A custom-built, multi-constellation GNSS datacollection system was employed that sampled GPS L1, L2C, L5, GLONASS L1 and L2, BeidouB1, and Galileo E1 and E5a signals. Sophisticated processing software was able to maintainlock of all signals during strong scintillation, providing unprecedented spatial observability ofL band scintillation. The smallest-resolvable scale sizes above the noise floor in the EPBs, as viewed byLAISI, are illustrated for integration times of 1, 5 and 10 seconds, with concurrentzonal irregularity drift speeds from both spaced-receiver VHF measurements and single-stationGNSS measurements of S4 and σφ. These observable optical scale sizes are placed in thecontext of those that give rise to radio scintillation in VHF and L band signals.

  10. Indole Alkaloids from the Sea Anemone Heteractis aurora and Homarine from Octopus cyanea.

    Science.gov (United States)

    Shaker, Kamel H; Göhl, Matthias; Müller, Tobias; Seifert, Karlheinz

    2015-11-01

    The two new indole alkaloids 2-amino-1,5-dihydro-5-(1H-indol-3-ylmethyl)-4H-imidazol-4-one (1), 2-amino-5-[(6-bromo-1H-indol-3-yl)methyl]-3,5-dihydro-3-methyl-4H-imidazol-4-one (2), and auramine (3) have been isolated from the sea anemone Heteractis aurora. Both indole alkaloids were synthesized for the confirmation of the structures. Homarine (4), along with uracil (5), hypoxanthine (6), and inosine (7) have been obtained from Octopus cyanea. Copyright © 2015 Verlag Helvetica Chimica Acta AG, Zürich.

  11. Sensitivity studies of the E region neutral response to the postmidnight diffuse aurora

    Directory of Open Access Journals (Sweden)

    H. F. Parish

    2006-07-01

    Full Text Available Measurements of the neutral thermosphere within the postmidnight substorm recovery phase diffuse aurora show very large horizontal winds, and strong vertical structure. Rocket, satellite, and ground based observations during the ARIA (Atmospheric Response in Aurora campaigns, and earlier dawn side rocket observations, indicate neutral winds of up to 200 m/s, and a characteristic jet-like wind maximum around 110 to 120-km altitude, with strong shears above and below. The observed wind magnitudes are found to have a dependence on geomagnetic activity level, but recent modeling studies suggest that tides which propagate up from the troposphere and stratosphere may play an important role in generating the strong vertical variations in the neutral winds. The relative importance of auroral and tidal forcing in producing the measured wind structure is not known, however. Simulations have been performed using a three dimensional (3-D high resolution limited area thermosphere model to understand the processes which generate the observed neutral structure within the postmidnight diffuse aurora. Parameters measured during the ARIA I observational campaign have been used to provide auroral forcing inputs for the model. Global background winds and tides have been provided by the CTIP (Coupled Thermosphere Ionosphere Plasmasphere model. The sensitivity of the response of the neutral atmosphere to changes in different parameters has been examined. Variations in the amplitudes and phases of the propagating tides in the background winds are found to have significant effects on the neutral structure in the E region, and the wind structure below around 110km is found to be mainly produced by tidal forcing. Changes in the electric field and ion density affect the winds above around 120 km, and the importance of auroral forcing is found to depend on background winds. Variations in the orientation of the aurora relative to the background field, which may be caused

  12. Applications of the Aurora parallel Prolog system to computational molecular biology

    Energy Technology Data Exchange (ETDEWEB)

    Lusk, E.L.; Overbeek, R. [Argonne National Lab., IL (United States); Mudambi, S. [Knox Coll., Galesburg, IL (United States); Szeredi, P. [IQSOFT, Budapest (Hungary)

    1993-09-01

    We describe an investigation into the use of the Aurora parallel Prolog system in two applications within the area of computational molecular biology. The computational requirements were large, due to the nature of the applications, and were large, due to the nature of the applications, and were carried out on a scalable parallel computer the BBN ``Butterfly`` TC-2000. Results include both a demonstration that logic programming can be effective in the context of demanding applications on large-scale parallel machines, and some insights into parallel programming in Prolog.

  13. The Concept of 'Radio Music'

    DEFF Research Database (Denmark)

    Fjeldsøe, Michael

    2016-01-01

    , educational and didactic effort which would enlighten all of society. For a while it seemed that radio music was considered a genre of its own. To fulfil its function, radio music had to consider technical limitations as well as the educational level and listening modes of the new mass audience. Public radio......, as discussed by Kurt Weill and Paul Hindemith, was at first greeted with great expectations, but soon a more realistic attitude prevailed. Weill, himself a radio critic as well, composed Der Lindberghflug (1929) as a piece of ‘radio music theatre’, but then changed some of its features in order to turn...... it into a didactical play for amateurs, a so-called Lehrstück. The article will present the concept of ‘radio music’ developed within German Neue Sachlichkeit and discuss the relevance of such a concept for current research in the field of radio and music....

  14. Low-cost detection of RC-IED activation signals in VHF band

    Science.gov (United States)

    Camargo Suarez, Victor Hugo; Marulanda B., Jose Ignacio

    2014-05-01

    The proliferation of Radio Controlled Improvised Explosive Devices (RC-IED) is a growing threat around the world. The ease of construction and low cost of these devices are transforming common things in lethal tramps. The fight against this threats normally involves the use of sophisticated and expensive equipment of Electronic Warfare based on high speed DSP systems, just to detect the presence of detonation signals. In this work is showed how to find activation signals based on the characteristic of the power in a specific band and the previous knowledge about the detonation signals. As proof of concept we have taken the information about the RC-IEDs used in the Colombian conflict and develop an algorithm to find detonation signals based on the measured power in frequencies between 136 MHz and 174 MHz (2 meter civil band)

  15. Tools of radio astronomy

    CERN Document Server

    Wilson, Thomas L; Hüttemeister, Susanne

    2009-01-01

    The recent years have seen breathtaking progress in technology, especially in the receiver and digital technologies relevant for radio astronomy, which has at the same time advanced to shorter wavelengths. This is the updated and completely revised 5th edition of the most used introductory text in radio astronomy. It presents a unified treatment of the entire field from centimeter to sub-millimeter wavelengths. Topics covered include instruments, sensitivity considerations, observational methods and interpretations of the data recorded with both single dishes and interferometers. This text is useful to both students and experienced practicing astronomers. Besides making major updates and additions throughout the book, the authors have re-organized a number of chapters to more clearly separate basic theory from rapidly evolving practical aspects. Further, problem sets have been added at the end of each chapter.

  16. Inhibition of Aurora-B kinase activity by poly(ADP-ribosyl)ation in response to DNA damage

    OpenAIRE

    Monaco, Lucia; Kolthur-Seetharam, Ullas; Loury, Romain; Murcia, Josiane Ménissier-de; de Murcia, Gilbert; Sassone-Corsi, Paolo

    2005-01-01

    The cell cycle-regulated Aurora-B kinase is a chromosomal passenger protein that is implicated in fundamental mitotic events, including chromosome alignment and segregation and spindle checkpoint function. Aurora-B phosphorylates serine 10 of histone H3, a function that has been associated with mitotic chromatin condensation. We find that activation of poly(ADP-ribose) polymerase (PARP) 1 by DNA damage results in a rapid block of H3 phosphorylation. PARP-1 is a NAD+-dependent enzyme that play...

  17. Aurora-B Mediated ATM Serine 1403 Phosphorylation Is Required For Mitotic ATM Activation and the Spindle Checkpoint

    OpenAIRE

    Yang, Chunying; Tang, Xi; Guo, Xiaojing; Niikura, Yohei; Kitagawa, Katsumi; Cui, Kemi; Wong, Stephen T.C.; Fu, Li; Xu, Bo

    2011-01-01

    The ATM kinase plays a critical role in the maintenance of genetic stability. ATM is activated in response to DNA damage and is essential for cell cycle checkpoints. Here, we report that ATM is activated in mitosis in the absence of DNA damage. We demonstrate that mitotic ATM activation is dependent on the Aurora-B kinase and that Aurora-B phosphorylates ATM on serine 1403. This phosphorylation event is required for mitotic ATM activation. Further, we show that loss of ATM function results in...

  18. First Hubble Space Telescope Movies of Jupiter’s Ultraviolet Aurora During the NASA Juno Prime Mission

    OpenAIRE

    Grodent, Denis; Gladstone, G. Randall; Clarke, John T.; Bonfond, Bertrand; Gérard, Jean-Claude; Radioti, Aikaterini; Nichols, John D.; Bunce, Emma J.; Roth, Lorenz; Saur, Joachim; Kimura, Tomoki; Orton, Glenn S.; Badman, Sarah V.; Mauk, Barry; Connerney, John E P

    2016-01-01

    The primary goal of this HST campaign is to complement Juno-UVS (Ultraviolet Spectrograph) observations. This complementarity is four-fold as HST observes Jupiter’s aurora when: 1) Juno-UVS is turned off, that is about 98% of Juno’s 14-day orbit, and Juno’s in situ instruments are in operation. 2) Juno-UVS is operating, but observes the opposite hemisphere of Jupiter. 3) UVS is on in the same hemisphere, but too close to Jupiter to have a global, contextual, view of the aurora and/or UVS is a...

  19. Radio Frequency Spectrum Management

    Science.gov (United States)

    1980-03-01

    limits, emmission standards, etc., cover many pages. Other available non-technical policy statements are of the motherhood-and-apple-pie ilk. Further...and 2) by allowing the onscene commander who is acutely aware of the radio frequency emmission environment in his area to make assignments. The author...need for investment in specific human capi- tal vice on the job experience, it will never eliminate it. Rather vice education and training in

  20. Programme driven music radio

    OpenAIRE

    Hayes, Conor; Cunningham, Padraig; Clerkin, Patrick; Grimaldi, Marco

    2002-01-01

    This paper describes the operation of and research behind a networked application for the delivery of personalised streams of music at Trinity College Dublin. Smart Radio is a web based client-server application that uses streaming audio technology and recommendation techniques to allow users build, manage and share music programmes. While it is generally acknowledged that music distribution over the web will dramatically change how the music industry operates, there are ...

  1. Radio Telescope Reflectors

    Science.gov (United States)

    Baars, Jacob W. M.; Kärcher, Hans J.

    2017-11-01

    This book demonstrates how progress in radio astronomy is intimately linked to the development of reflector antennas of increasing size and precision. The authors describe the design and construction of major radio telescopes as those in Dwingeloo, Jodrell Bank, Parkes, Effelsberg and Green Bank since 1950 up to the present as well as millimeter wavelength telescopes as the 30m MRT of IRAM in Spain, the 50m LMT in Mexico and the ALMA submillimeter instrument. The advances in methods of structural design and coping with environmental influences (wind, temperature, gravity) as well as application of new materials are explained in a non-mathematical, descriptive and graphical way along with the story of the telescopes. Emphasis is placed on the interplay between astronomical and electromagnetic requirements and structural, mechanical and control solutions. A chapter on management aspects of large telescope projects closes the book. The authors address a readership with interest in the progress of engineering solutions applied to the development of radio telescope reflectors and ground station antennas for satellite communication and space research. The book will also be of interest to historians of science and engineering with an inclination to astronomy.

  2. Danmarks Radios stemmer

    DEFF Research Database (Denmark)

    Lawaetz, Anna

    kanalspeakerne kändisser, hvis fortalelser i æteren såvel som private gøren og laden blev fulgt nøje i dagspressen. Anna Lawaetz har med ph.d.-afhandlingen Danmarks Radios stemmer med udgangspunkt i kanalspeakerne på P1 i perioden 1925-2012 gennem empiriske studier kortlagt fortællingen om institutionens stemmer...... – nøje udvalgte ikke-fiktionsstemmer i Danmarks Radio igennem tiden. Samtidig har hun lavet en konkret analyse af stemmerne baseret på både akustiske målinger og kategorisering af oplevelsen af stemmerne. Fx taler kanalspeakerne på P1 i dag ikke hurtigere end tidligere, men pauserne er blevet kortere...... datamængder kræver udvikling af nye metoder. Den metodiske udvikling har her været baseret på optagelser af stemmer for at undersøge hvordan man videnskabeligt kan arbejde med optagelser af stemmer som mere end teksttransskriptioner inden for det kulturvidenskabelige felt med afsæt i Danmarks Radios...

  3. Precipitation of relativistic electrons of the Van Allen belts into the proton aurora

    Energy Technology Data Exchange (ETDEWEB)

    Jordanova, Vania K [Los Alamos National Laboratory; Miyoshi, Y [NAGOYA UNIV; Sakaguchi, K [NAGOYA UNIV; Shiokawa, K [NAGOYA UNIV; Evans, D S [SEC/NOAA; Albert, Jay [AFRL; Connors, M [UNIV OF ATHABASCA

    2008-01-01

    The Van Allen electron belts consist of two regions encircling the earth in which relativistic electrons are trapped in the earth's magnetic field. Populations of relativistic electrons in the Van Allen belts vary greatly with geomagnetic disturbance and they are a major source of damage to space vehicles. In order to know when and by how much these populations of relativistic electrons increase, it is important to elucidate not only the cause of acceleration of relativistic electrons but also the cause of their loss from the Van Allen belts. Here we show the first evidence that left-hand polarized electromagnetic ion cyclotron (EMIC) plasma waves can cause the loss of relativistic electrons into the atmosphere, on the basis of results of an excellent set of ground and satellite observations showing coincident precipitation of ions with energies of tens of keV and of relativistic electrons into an isolated proton aurora. The proton aurora was produced by precipitation of ions with energies of tens of keV due to EMIC waves near the plasma pause, which is a manifestation of wave-particle interactions. These observations clarify that ions with energies of tens of keV affect the evolution of relativistic electrons in the Van Allen belts via parasitic resonance with EMIC waves, an effect that was first theoretically predicted in the early 1970's.

  4. Auroral streamer and its role in driving wave-like pre-onset aurora

    Science.gov (United States)

    Yao, Zhonghua; Pu, Z. Y.; Rae, I. J.; Radioti, A.; Kubyshkina, M. V.

    2017-12-01

    The time scales of reconnection outflow, substorm expansion, and development of instabilities in the terrestrial magnetosphere are comparable, i.e., from several to tens of minutes, and their existence is related. In this paper, we investigate the physical relations among those phenomena with measurements during a substorm event on January 29, 2008. We present conjugate measurements from ground-based high-temporal resolution all-sky imagers and in situ THEMIS measurements. An auroral streamer (north-south aligned thin auroral layer) was formed and propagated equatorward, which usually implies an earthward propagating plasma flow in the magnetotail. At the most equatorward part of the auroral streamer, a wave-like auroral band was formed aligning in the east-west direction. The wave-like auroral structure is usually explained as a consequence of instability development. Using AM03 model, we trace the auroral structure to magnetotail and estimate a wavelength of 0.5 R E. The scale is comparable to the drift mode wavelength determined by the in situ measurements from THEMIS-A, whose footpoint is on the wave-like auroral arc. We also present similar wave-like aurora observations from Cassini ultraviolet imaging spectrograph at Saturn and from Hubble space telescope at Jupiter, suggesting that the wave-like aurora structure is likely a result of fundamental plasma dynamics in the solar system planetary magnetospheres.

  5. Phenotypic screening approaches to develop Aurora kinase inhibitors: Drug Discovery perspectives

    Directory of Open Access Journals (Sweden)

    Carlos eMarugán

    2016-01-01

    Full Text Available Targeting mitotic regulators as a strategy to fight cancer implies the development of drugs against key proteins such as Aurora A and B. Current drugs which target mitosis through a general mechanism of action (stabilization/destabilization of microtubules, have several side effects (neutropenia, alopecia, emesis. Pharmaceutical companies aim at avoiding these unwanted effects by generating improved and selective drugs that increase the quality of life of the patients. However, the development of these drugs is an ambitious task that involves testing thousands of compounds through biochemical and cell-based assays. In addition, molecules usually target complex biological processes, involving several proteins and different molecular pathways, further emphasizing the need for high-throughput screening techniques and multiplexing technologies in order to identify drugs with the desired phenotype.We will briefly describe two multiplexing technologies (high-content imaging, microarrays and flow cytometry and two key processes for drug discovery research (assay development and validation following our own published industry quality standards. We will further focus on high-content imaging as a useful tool for phenotypic screening and will provide a concrete example of high-content imaging assay to detect Aurora A or B selective inhibitors discriminating the off-target effects related to inhibition of other cell cycle or non-cell cycle key regulators. Finally, we will describe other assays that can help to characterize the in vitro pharmacology of the inhibitors.

  6. The morphology of the north Jovian ultraviolet aurora observed with the Hubble Space Telescope

    Science.gov (United States)

    Gerard, Jean-Claude; Dols, Vincent; Prange, Renee; Paresce, Francesco

    1994-01-01

    A series of six images covering a complete rotation of the north polar region of Jupiter were obtained in February 1993 with the Faint Object Camera on board the Hubble Space Telescope (HST). These images provide the first global picture of the morphology of the Jovian ultraviolet aurora observed from Earth orbit. The camera passband was centered near 153 nm, a region dominated by the H2 Lyman bands and continuum. The successive exposures, taken approximately 90 min apart, are used to construct a polar view of the auroral zone. It is found that the auroral emissions do not exactly follow the footprint of a constant L-shell although the size of the oval and its location agree best with the footprints of the approximately equal to 30 R(sub J) field line in the GSFC O6 model of the Jovian magnetic field. The displacement between the observed auroral zone and the theoretical oval may indicate a possible distortion of the Jovian magnetic field lines near the surface. A comparison with two images at the same wavelength obtained 8 months earlier shows that the main morphological features are persistent, in spite of changes in the detailed emission distribution. Small scale features with characteristic sizes of approximately 1000 km are observed along the auroral oval. The change of morphology observed as a function of the System 3 longitude appears as a persistent characteristic of the morphology of the north polar aurora.

  7. Spatial and spectral characteristics of the near-infrared aurorae of Jupiter

    Science.gov (United States)

    Kim, Sang J.; Glenar, David A.; Joyce, Richard R.; Kostiuk, Theodor

    1993-01-01

    Data are presented which show the power of a long-slit IR spectrograph to yield spectral and spatial coverage of the Jovian auroral zones in an efficient manner. Strong 3 micron H3(+) lines are observed on the eastern bright spot and moderately strong 3 micron H3(+) lines in the central meridian and western region of the northern aurora. Higher temperatures are found in the central meridian and western region of the northern aurora compared with a temperature of 1000 K +/- K on the eastern bright spot, suggesting an enhanced abundance of H3(+) on the bright spot compared to other auroral regions. The H2 quadrupole lines of Q1(1), Q1(3), S1(1), and several H3(+) lines between 2 and 2.5 microns are identified in the northern auroral region. The eastern bright spot as seen in the 2 micron H2 and H3(+) emission lines is at nearly the same position as the eastern bright spot due to the 3 micron H3(+) fundamental band lines.

  8. The Epi Info Viral Hemorrhagic Fever (VHF) Application: A Resource for Outbreak Data Management and Contact Tracing in the 2014-2016 West Africa Ebola Epidemic.

    Science.gov (United States)

    Schafer, Ilana J; Knudsen, Erik; McNamara, Lucy A; Agnihotri, Sachin; Rollin, Pierre E; Islam, Asad

    2016-10-15

    The Epi Info Viral Hemorrhagic Fever application (Epi Info VHF) was developed in response to challenges managing outbreak data during four 2012 filovirus outbreaks. Development goals included combining case and contact data in a relational database, facilitating data-driven contact tracing, and improving outbreak data consistency and use. The application was first deployed in Guinea, when the West Africa Ebola epidemic was detected, in March 2014, and has been used in 7 African countries and 2 US states. Epi Info VHF enabled reporting of compatible data from multiple countries, contributing to international Ebola knowledge. However, challenges were encountered in accommodating the epidemic's unexpectedly large magnitude, addressing country-specific needs within 1 software product, and using the application in settings with limited Internet access and information technology support. Use of Epi Info VHF in the West Africa Ebola epidemic highlighted the fundamental importance of good data management for effective outbreak response, regardless of the software used. Published by Oxford University Press for the Infectious Diseases Society of America 2016. This work is written by (a) US Government employee(s) and is in the public domain in the US.

  9. Spectral Interpretation of Radio Sounder-Stimulated Magnetospheric Plasma Resonances in Terms of Kappa Distributions

    Science.gov (United States)

    Benson, Robert F.; Vinas, Adolfo, F.; Fainberg, Joseph; Osherovich, Vladimir A.; Purser, Carola M.; Galkin, Ivan A.; Reinisch, Bodo W.

    2011-01-01

    Magnetosphere sounders stimulate plasma resonances between the harmonics of the electron cyclotron frequency and above the upper-hybrid frequency. More than three decades ago they were recognized as equivalent to ionospheric topside-sounder-stimulated resonances, designated as Qn resonances a decade earlier, with one important difference: the magnetospheric Qn frequencies often indicated that the background electron-velocity distribution was non-Maxwellian. Interpretations based on bi-Maxwellian and kappa distributions have been proposed. Here we expand on the latter, which requires fewer free parameters, by comparing kappa-derived Qn frequencies with observations from the Radio Plasma Imager on the Imager for Magnetopause-to-Aurora Global Exploration (IMAGE) satellite.

  10. Survey of man-made electrical noise affecting radio broadcasting

    Science.gov (United States)

    Bisignani, W. T.; Garner, W. B.

    1969-01-01

    Survey, consisting of limited noise measurements, was made to augment and verify existing data at HF and VHF and to obtain basic data at UHF. Exact frequencies were determined by the absence of intentionally generated signals around three selected frequencies.

  11. Statistical characteristics of low-latitude ionospheric field-aligned irregularities obtained with the Piura VHF radar

    Directory of Open Access Journals (Sweden)

    J. L. Chau

    2002-08-01

    Full Text Available We present a summary of the statistical characteristics of echoes from ionospheric (E- and F-region field-aligned irregularities obtained with the Piura VHF radar. This radar is located at ~ 7.0° dip latitude, just outside the equatorial electrojet (EEJ region. Our results are based on (1 intermittent observations made between 1991 and 1999 just few days a year, and (2 continuous observations made between January 2000 and June 2001. During most of the intermittent observations, simultaneous measurements of EEJ and equatorial spread F (ESF irregularities were performed with the Jicamarca VHF radar. From the continuous measurements, we have obtained the diurnal and seasonal characteristics of a variety of parameters (percentage of occurrence, signal-to-noise ratio and/or Doppler velocities from the lower and upper E-region irregularities and also from F-region irregularities over Piura. For example, we have found that (1 the E-region echoes are stronger and occur more frequently during local summer (i.e. between December and March; (2 between May and June, the E-region echoes are weaker and occur less frequently; moreover, during these months, a semidiurnal wave with large amplitudes is observed in the meridional wind (> 100 ms- 1; (3 there is vertical wavelength of about 20 km in the Doppler velocity, particularly after midnight; (4 the lower (upper E-region Doppler velocities are influenced mainly by meridional winds (equatorial F-region vertical drifts. In addition, we have observed that the seasonal and daily occurrences of Piura F-region irregularities are similar to the occurrence of topside ESF irregularities over Jicamarca. The likelihood of occurrence of F-region irregularities over Piura and, therefore, topside ESF over Jicamarca is greater when there are no E-region irregularities over Piura. On the other hand, there is more probability of observing bottomtype/bottomside ESF irregularities over Jicamarca when E-region irregularities

  12. PMSE observations with the EISCAT VHF- and UHF-radars: Ice particles and their effect on ambient electron densities

    Science.gov (United States)

    Li, Qiang; Rapp, Markus

    2013-11-01

    It is now well understood that the occurrence of PMSE is closely connected to the presence of ice particles. These ice particles modify the ambient electron density by electron attachment which occasionally leads to large electron density depletions which have also been called ‘biteouts’. There has been some debate in the literature regarding the relative depth of such depletions which is usually expressed by the parameter Λ=|ZA|NA/ne. Here, |ZA|NA is the charge number density of ice particles and ne is the electron density. In this paper, we present, for the first time, the statistical distribution of Λ using measurements with the EISCAT VHF- and UHF-radars. Based on 25 h of simultaneous observations, we derived a total of 757 Λ values based on 15 min of data each. In each of these cases, PMSE were observed with the EISCAT VHF-radar but not with the UHF-radar and the UHF-measurement were hence used to determine the electron density profile. From these 757 cases, there are 699 cases with Λ⪡1, and only 33 cases with Λ>0.5 (21 cases with Λ>1). A correlation analysis of Λ versus PMSE volume reflectivities further reveals that there is no strong dependence between the two parameters. This is in accordance with current PMSE-theory based on turbulence in combination with a large Schmidt-number. The maxima of Λ from each profile show a negative relationship with the undisturbed electron densities deduced at the same altitudes. This reveals that the variability of Λ mainly depends on the variability of the electron densities. In addition, variations of aerosol number densities may also play a role. Although part of the observations were conducted during the HF heating experiments, the so-called overshoot effects did not significantly bias our statistical results. In order to avoid missing biteouts because of a superposition of coherent and incoherent scatter in the UHF-data, we finally calculated spectral parameters n by applying a simple fit to auto

  13. VHF SoOp (Signal of Opportunity) Technology Demonstration for Soil Moisture Measurement Using Microwave Hydraulic Boom Truck Platform

    Science.gov (United States)

    Joseph, Alicia; Deshpande, Manohar; O'Neill, Peggy; Miles, Lynn

    2017-04-01

    A goal of this research is to test deployable VHF antennas for 6U Cubesat platforms to enable validation of root zone soil moisture (RZSM) estimation algorithms for signal of opportunity (SoOp) remote sensing over the 240-270 MHz frequency band. The proposed work provides a strong foundation for establishing a technology development path for maturing a global direct surface soil moisture (SM) and RZSM measurement system over a variety of land covers. Knowledge of RZSM up to a depth of 1 meter and surface SM up to a depth of 0.05 meter on a global scale, at a spatial resolution of 1-10 km through moderate-to-heavy vegetation, is critical to understanding global water resources and the vertical moisture gradient in the Earth's surface layer which controls moisture interactions between the soil, vegetation, and atmosphere. Current observations of surface SM from space by L-band radiometers (1.4 GHz) and radars (1.26 GHz) are limited to measurements of surface SM up to a depth of 0.05 meter through moderate amounts of vegetation. This limitation is mainly due to the inability of L-band signals to penetrate through dense vegetation and deep into the soil column. Satellite observations of the surface moisture conditions are coupled to sophisticated models which extrapolate the surface SM into the root zone, thus providing an indirect estimate rather than a direct measurement of RZSM. To overcome this limitation, low-frequency airborne radars operating at 435 MHz and 118 MHz have been investigated, since these lower frequencies should penetrate denser vegetation and respond to conditions deeper in the soil. This presentation describes a new and less expensive technique for SM as well as RZSM direct measurement using Signal of Opportunity transmitters. Being less expensive and needing only passive simple RF receiver, the SoOp concept has the potential for being used for space borne applications, thus providing global SM and RZSM measurements. This study will describe

  14. Flexible Adaptation in Cognitive Radios

    CERN Document Server

    Li, Shujun

    2013-01-01

    This book provides an introduction to software-defined radio and cognitive radio, along with methodologies for applying knowledge representation, semantic web, logic reasoning and artificial intelligence to cognitive radio, enabling autonomous adaptation and flexible signaling. Readers from the wireless communications and software-defined radio communities will use this book as a reference to extend software-defined radio to cognitive radio, using the semantic technology described. Readers with a background in semantic web and artificial intelligence will find in this book the application of semantic web and artificial intelligence technologies to wireless communications. For readers in networks and network management, this book presents a new approach to enable interoperability, collaborative optimization and flexible adaptation of network components. Provides a comprehensive ontology covering the core concepts of wireless communications using a formal language; Presents the technical realization of using a ...

  15. Electron Acceleration by High Power Radio Waves in the Ionosphere

    Science.gov (United States)

    Bernhardt, Paul

    2012-10-01

    At the highest ERP of the High Altitude Auroral Research Program (HAARP) facility in Alaska, high frequency (HF) electromagnetic (EM) waves in the ionosphere produce artificial aurora and electron-ion plasma layers. Using HAARP, electrons are accelerated by high power electrostatic (ES) waves to energies >100 times the thermal temperature of the ambient plasma. These ES waves are driven by decay of the pump EM wave tuned to plasma resonances. The most efficient acceleration process occurs near the harmonics of the electron cyclotron frequency in earth's magnetic field. Mode conversion plays a role in transforming the ES waves into EM signals that are recorded with ground receivers. These diagnostic waves, called stimulated EM emissions (SEE), show unique resonant signatures of the strongest electron acceleration. This SEE also provides clues about the ES waves responsible for electron acceleration. The electron gas is accelerated by high frequency modes including Langmuir (electron plasma), upper hybrid, and electron Bernstein waves. All of these waves have been identified in the scattered EM spectra as downshifted sidebands of the EM pump frequency. Parametric decay is responsible low frequency companion modes such as ion acoustic, lower hybrid, and ion Bernstein waves. The temporal evolution of the scattered EM spectrum indicates development of field aligned irregularities that aid the mode conversion process. The onset of certain spectral features is strongly correlated with glow plasma discharge structures that are both visible with the unaided eye and detectable using radio backscatter techniques at HF and UHF frequencies. The primary goals are to understand natural plasma layers, to study basic plasma physics in a unique ``laboratory with walls,'' and to create artificial plasma structures that can aid radio communications.

  16. Software defined radio architectures evaluation

    OpenAIRE

    Palomo, Alvaro; Villing, Rudi; Farrell, Ronan

    2008-01-01

    This paper presents an performance evaluation of GNU Radio and OSSIE, two open source Software Defined Radio (SDR) architectures. The two architectures were compared by running implementations of a BPSK waveform utilising a software loopback channel on each. The upper bound full duplex throughput was found to be around 700kbps in both cases, though OSSIE was slightly faster than GNU Radio. CPU and memory loads did not differ significantly.

  17. Uzaybimer Radio Telescope Control System

    Science.gov (United States)

    Balbay, R.; Öz, G. K.; Arslan, Ö.; Özeren, F. F.; Küçük, İ.

    2016-12-01

    A 13 meters former NATO radar is being converted into a radio telescope. The radio telescope is controlled by a system which has been developed at UZAYBİMER. The Telescope Control System(TCS) has been designed using modern industrial systems. TCS has been developed in LabView platform in which works Windows embedded OS. The position feedback used on radio telescopes is an industrial EtherCAT standard. ASCOM library is used for astronomical calculations.

  18. Evaluation of the Impact of the 2003 Aurora Leadership Institute--"The Gift That Keeps on Giving"

    Science.gov (United States)

    Barney, Kay

    2004-01-01

    As a generation of library leaders in Australia and New Zealand is approaching retirement, the question is "who will take their place?" Leadership programs have become increasingly popular as a way to "grow" future leaders for the profession. This study looks at the impact of the 2003 Aurora Leadership Institute [A6] on…

  19. Aurora kinase A as a possible marker for endocrine resistance in early estrogen receptor positive breast cancer

    DEFF Research Database (Denmark)

    Lykkesfeldt, Anne E; Iversen, Benedikte R; Jensen, Maj-Britt

    2018-01-01

    BACKGROUND: Cell culture studies have disclosed that the mitotic Aurora kinase A is causally involved in both tamoxifen and aromatase inhibitor resistant cell growth and thus may be a potential new marker for endocrine resistance in the clinical setting. MATERIAL AND METHODS: Archival tumor tissue...

  20. 78 FR 52758 - Foreign-Trade Zone 123-Denver, Colorado; Application for Subzone, Pillow Kingdom, Inc., Aurora...

    Science.gov (United States)

    2013-08-26

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF COMMERCE Foreign-Trade Zones Board Foreign-Trade Zone 123--Denver, Colorado; Application for Subzone, Pillow... Pillow Kingdom, Inc. (Pillow Kingdom), located in Aurora, Colorado. The application was submitted...

  1. Shugoshin-1 balances Aurora B kinase activity via PP2A to promote chromosome bi-orientation

    NARCIS (Netherlands)

    Meppelink, Amanda; Kabeche, Lilian; Vromans, Martijn J M; Compton, Duane A; Lens, Susanne M A

    2015-01-01

    Correction of faulty kinetochore-microtubule attachments is essential for faithful chromosome segregation and dictated by the opposing activities of Aurora B kinase and PP1 and PP2A phosphatases. How kinase and phosphatase activities are appropriately balanced is less clear. Here, we show that a

  2. Pluralismo, radio e Internet

    Directory of Open Access Journals (Sweden)

    Bruce Girard

    2015-01-01

    Full Text Available En muchas ocasiones de ha oído hablar que internet y las nuevas tecnologías de la comunicación llevarán a la humanidad a un mundo homogeneizado en donde todos compartirán la misa cultura del “ciberespacio” y hablarán el mismo lenguaje. Nuevas iniciativas en América Latina combinan la tecnología de punta y la radio para poner fin a este mito y contribuir a una comunicación más democrática.

  3. Internet Resources for Radio Astronomy

    Science.gov (United States)

    Andernach, H.

    A subjective overview of Internet resources for radio-astronomical information is presented. Basic observing techniques and their implications for the interpretation of publicly available radio data are described, followed by a discussion of existing radio surveys, their level of optical identification, and nomenclature of radio sources. Various collections of source catalogues and databases for integrated radio source parameters are reviewed and compared, as well as the web interfaces to interrogate the current and ongoing large-area surveys. Links to radio observatories with archives of raw (uv-) data are presented, as well as services providing images, both of individual objects or extracts (``cutouts'') from large-scale surveys. While the emphasis is on radio continuum data, a brief list of sites providing spectral line data, and atomic or molecular information is included. The major radio telescopes and surveys under construction or planning are outlined. A summary is given of a search for previously unknown optically bright radio sources, as performed by the students as an exercise, using Internet resources only. Over 200 different links are mentioned and were verified, but despite the attempt to make this report up-to-date, it can only provide a snapshot of the situation as of mid-1998.

  4. Radio Frequency Anechoic Chamber Facility

    Data.gov (United States)

    Federal Laboratory Consortium — FUNCTION: Supports the design, manufacture, and test of antenna systems. The facility is also used as an electromagnetic compatibility/radio frequency interference...

  5. Radio-induced brain lesions

    Directory of Open Access Journals (Sweden)

    Gorgan Mircea Radu

    2014-03-01

    Full Text Available Introduction : Radiotherapy, an important tool in multimodal oncologic treatment, can cause radio-induced brain lesion development after a long period of time following irradiation.

  6. High expression of nuclear survivin and Aurora B predicts poor overall survival in patients with head and neck squamous cell cancer

    Energy Technology Data Exchange (ETDEWEB)

    Erpolat, O.P.; Akmansu, M. [Medical School of Gazi Univ., Besevler-Ankara (Turkey). Dept. of Radiation Oncology; Gocun, P.U.; Karakus, E.; Akyol, G. [Medical School of Gazi Univ., Besevler-Ankara (Turkey). Dept. of Pathology

    2012-03-15

    Survivin is one of the apoptosis inhibitor proteins. Together with Aurora B, it also plays a role in regulating several aspects of mitosis. High expression of these markers is correlated with malignant behavior of various cancers and resistance to therapy. Our aim was to evaluate the prognostic role of these markers in head and neck cancers. We evaluated the expression of Aurora B and survivin in tissue specimens of 58 patients with head and neck squamous cell carcinoma using immunohistochemistry. Patients who showed high expression of cytoplasmic and nuclear survivin and Aurora B had significantly shorter overall survival (p = 0.036, p < 0.000, p = 0.032, respectively). In multivariate analysis, high expression of nuclear survivin was the only independent negative prognostic factor (p = 0.024). Moreover, it was found that high co-expression of nuclear survivin and Aurora B had a negative effect on survival in univariate (p < 0.000) and multivariate (p < 0.000) analyses. The negative prognostic values of high expression of Aurora B and high co-expression of nuclear survivin and Aurora B on survival were shown. These findings suggest that co-expression of nuclear survivin and Aurora B can be useful diagnostic markers and therapeutic targets for head and neck squamous cell carcinoma. However, further studies with a larger number of patients in a more homogeneous disease group are needed to confirm the conclusion.

  7. Drilling Polar Oceans with the European Research Icebreaker AURORA BOREALIS: the IODP Context

    Science.gov (United States)

    Lembke-Jene, Lester; Wolff-Boenisch, Bonnie; Azzolini, Roberto; Thiede, Joern; Biebow, Nicole; Eldholm, Olav; Egerton, Paul

    2010-05-01

    Polar oceans are characterized by extreme environmental conditions for humans and materials, and have remained the least accessible regions to scientists of the IODP. DSDP and ODP have for long faced specific technical and logistical problems when attempting to drill in ice-covered polar deep-sea basins. The Arctic Ocean and large areas of the high-latitude Southern Ocean remained largely un-sampled by ODP and remain one of the major scientific and technological challenges for IODP. Drilling in these regions has been discussed and anticipated for decades and the scientific rationales are reflected in the science plans of the international Nansen Arctic Drilling Program (NAD) or the Arctic Program Planning Group (APPG) of ODP/IODP, amongst others. More recently, the rationale to investigate the polar oceans in a holistic approach has been outlined by workshops, leading to strategic assessments of the scientific potential and new drilling proposals. The European Polar Board took the initiative to develop a plan for a novel and dedicated research icebreaker with technical capabilities hitherto unrealised. This research icebreaker will enable autonomous operations in the central Arctic Ocean and the Southern Ocean, even during the severest ice conditions in the deep winter, serving all marine disciplines of polar research including scientific drilling: The European Research Icebreaker and Deep-Sea Drilling Vessel AURORA BOREALIS. AURORA BOREALIS is presently planned as a multi-purpose vessel. The ship can be deployed as a research icebreaker in all polar waters during any season of the year, as it shall meet the specifications of the highest ice-class attainable (IACS Polar Code 1) for icebreakers. During the times when it is not employed for drilling, it will operate as the most technically advanced multi-disciplinary research vessel in the Arctic or polar Southern Ocean. AURORA BOREALIS will be a "European scientific flagship facility" (fully open to non

  8. Radio Jove: Citizen Science for Jupiter Radio Astronomy

    Science.gov (United States)

    Higgins, C. A.; Thieman, J.; Reyes, F. J.; Typinski, D.; Flagg, R. F.; Greenman, W.; Brown, J.; Ashcraft, T.; Sky, J.; Cecconi, B.; Garcia, L. N.

    2016-12-01

    The Radio Jove Project (http://radiojove.gsfc.nasa.gov) has been operating as an educational activity for 18 years to introduce radio astronomy activities to students, teachers, and the general public. Participants may build a simple radio telescope kit, make scientific observations, and interact with radio observatories in real-time over the Internet. Recently some of our dedicated citizen science observers have upgraded their systems to better study radio emission from Jupiter and the Sun by adding dual-polarization spectrographs and wide-band antennas in the frequency range of 15-30 MHz. Some of these observations are being used in conjunction with professional telescopes such as the Long Wavelength Array (LWA), the Nancay Decametric Array, and the Ukrainian URAN2 Radio Telescope. In particular, there is an effort to support the Juno Mission radio waves instrument at Jupiter by using citizen science ground-based data for comparison and polarization verification. These data will be archived through a Virtual European Solar and Planetary Access (VESPA) archive (https://voparis-radiojove.obspm.fr/radiojove/welcome) for use by the amateur and professional radio science community. We overview the program and display recent observations that will be of interest to the science community.

  9. The coexistence of cognitive radio and radio astronomy

    NARCIS (Netherlands)

    Bentum, Marinus Jan; Boonstra, A.J.; Baan, W.A.

    2009-01-01

    An increase of the efficiency of spectrum usage requires the development of new communication techniques. Cognitive radio may be one of those new technique, which uses unoccupied frequency bands for communications. This will lead to more power in the bands and therefore an increasing level of Radio

  10. Evaluation of GNU Radio Platform Enhanced for Hardware Accelerated Radio Design

    OpenAIRE

    Karve, Mrudula Prabhakar

    2010-01-01

    The advent of software radio technology has enabled radio developers to design and imple- ment radios with great ease and flexibility. Software radios are effective in experimentation and development of radio designs. However, they have limitations when it comes to high- speed, high-throughput designs. This limitation can be overcome by introducing a hardware element to the software radio platform. Enhancing GNU Radio for Hardware Accelerated Radio Design project implements suc...

  11. Species boundaries, phylogeography, and conservation genetics of the red-legged frog (Rana aurora/draytonii) complex

    Science.gov (United States)

    Shaffer, H. Bradley; Fellers, Gary M.; Voss, S. Randal; Oliver, J. C.; Pauly, Gregory B.

    2004-01-01

    The red-legged frog, Rana aurora, has been recognized as both a single, polytypic species and as two distinct species since its original description 150 years ago. It is currently recognized as one species with two geographically contiguous subspecies, aurora and draytonii; the latter is protected under the US Endangered Species Act. We present the results of a survey of 50 populations of red-legged frogs from across their range plus four outgroup species for variation in a phylogenetically informative, ∼400 base pairs (bp) fragment of the mitochondrial cytochromeb gene. Our mtDNA analysis points to several major results. (1) In accord with several other lines of independent evidence, aurora and draytonii are each diagnosably distinct, evolutionary lineages; the mtDNA data indicate that they do not constitute a monophyletic group, but rather that aurora and R. cascadae from the Pacific northwest are sister taxa; (2) the range of thedraytonii mtDNA clade extends about 100 km further north in coastal California than was previously suspected, and corresponds closely with the range limits or phylogeographical breaks of several codistributed taxa; (3) a narrow zone of overlap exists in southern Mendocino County between aurora and draytonii haplotypes, rather than a broad intergradation zone; and (4) the critically endangered population of draytonii in Riverside County, CA forms a distinct clade with frogs from Baja California, Mexico. The currently available evidence favours recognition of auroraand draytonii as separate species with a narrow zone of overlap in northern California.

  12. Discourse segmentation and the management of multiple tasks in single episodes of air traffic controller-pilot spoken radio communication

    Directory of Open Access Journals (Sweden)

    Paul A. Falzon

    2009-06-01

    Full Text Available Episodes of VHF radio-mediated pilot-controller spoken communication in which multiple tasks are conducted are engendered in and through the skilful deployment and combination, by the parties to the talk, of multiple orders of discourse segmentation. These orders of segmentation are manifest at the levels of transmission design and sequential organisation. Both of these features are analysed from a Conversation Analytic standpoint in order to track their segment by segment genesis, development and completion. From the analysis it emerges that in addition to the serial type of sequential organisations described by Schegloff (1986, there exists an alternative form of organisation that enables tasks to be managed in a quasi-parallel manner, and which affords controllers and pilots a number of practical advantages in the conduct of their radio-mediated service encounters.Cet article présente des extraits d’échanges oraux entre pilots et contrôleurs du ciel via la radio VHF. On peut y voir comment le déploiement et la combinaison habile de plusieurs ordres de segmentation discursive, engageant les deux coénonciateurs de la conversation, leur permet d’accomplir des tâches multiples. Ces ordres de segmentation se manifestent aux niveaux du plan de la transmission et de l’organisation séquentielle. Ces deux niveaux sont envisagées du point de vue de l’analyse conversationnelle dans le but d’examiner, segment après segment, comment ils se mettent en place, se développent puis prennent fin. Notre étude montre que, outre le type sériel d’organisations séquentielles décrit par Schegloff (1986, il existe une forme alternative d’organisation qui permet de gérer les tâches de manière quasi parallèle, et qui fournit aux contrôleurs aériens ainsi qu’aux pilotes de nombreux avantages pratiques dans la conduite de leurs radio.

  13. Dramatugi Penyiar Radio

    Directory of Open Access Journals (Sweden)

    Hastika Yanti Nora

    2009-07-01

    Full Text Available Dramaturgy is the work of Erving Goffman. He wrote "Presentation of Self in Everyday Life" in '1959. Following the theatrical analogy, Goffman spoke of a front stage and back stage. The front stage is that part of the performance that generally functions in rather fixed and general ways to define the situation for those who observed the performance. The back stage is situation where facts suppressed in the front or various kinds of informal actions may appear. A back stage is usually adjacent to the front stage, but it also cut off from it. Everyone in this world have to run his role in their everyday life. It also a radio announcer. As an actor, they have to be a nice and friendy person when they perform to make air personality, that is  a good  impression, from their audience. But before their perform in the front stage, there so much to do to prepare in the backstage. The front and back stage is radio announcer dramaturgy.

  14. Breaking the Ice: Strategies for Future European Research in the Polar Oceans - The AURORA BOREALIS Concept

    Science.gov (United States)

    Lembke-Jene, L.; Biebow, N.; Wolff-Boenisch, B.; Thiede, J.; European Research Icebreaker Consortium

    2011-12-01

    Research vessels dedicated to work in polar ice-covered waters have only rarely been built. Their history began with Fritjof Nansen's FRAM, which he used for his famous first crossing of the Arctic Ocean 1893-1896. She served as example for the first generation of polar research vessels, at their time being modern instruments planned with foresight. Ice breaker technology has developed substantially since then. However, it took almost 80 years until this technical advance also reached polar research, when the Russian AKADEMIK FEDEROV, the German POLARSTERN, the Swedish ODEN and the USCG Cutter HEALY were built. All of these house modern laboratories, are ice-breakers capable to move into the deep-Arctic during the summer time and represent the second generation of dedicated polar research vessels. Still, the increasing demand in polar marine research capacities by societies that call for action to better understand climate change, especially in the high latitudes is not matched by adequate facilities and resources. Today, no icebreaker platform exists that is permanently available to the international science community for year-round expeditions into the central Arctic Ocean or heavily ice-infested waters of the polar Southern Ocean around Antarctica. The AURORA BOREALIS concept plans for a heavy research icebreaker, which will enable polar scientists around the world to launch international research expeditions into the central Arctic Ocean and the Antarctic continental shelf seas autonomously during all seasons of the year. The European Research Icebreaker Consortium - AURORA BOREALIS (ERICON-AB) was established in 2008 to plan the scientific, governance, financial, and legal frameworks needed for the construction and operation of this first multi-nationally owned and operated research icebreaker and polar scientific drilling platform. By collaborating together and sharing common infrastructures it is envisioned that European nations make a major contribution to

  15. Comparison of wind measurements in the troposphere and mesosphere by VHF/MF radars and in-situ techniques

    Directory of Open Access Journals (Sweden)

    N. Engler

    2008-11-01

    Full Text Available Radar wind observations at frequencies between 1.98 and 53.5 MHz obtained at polar latitudes were compared to in-situ wind measurements by radiosondes at tropospheric altitudes and to winds from falling spheres at mesospheric altitudes. Comparisons are shown for several campaigns of radiosonde and falling sphere observations. The radar wind directions agree well to the radiosonde and falling sphere observations and are highly correlated. The winds estimated from radar measurements are less than the radiosonde data by about 15% for spaced antenna observations and by about 10% for the Doppler beam swinging experiment. At mesospheric altitudes the spaced antenna winds obtained from the wide-beam Andenes MF radar are underestimated in the order of 35% and winds from the narrow-beam Saura MF radar are underestimated by about 20% compared to falling sphere winds at altitudes between 70 and 80 km. Furthermore, the relation between wind measurements using narrow-beam and wide-beam antenna arrangements for the MF radars is discussed and VHF radar observations are compared to the wide-beam MF radar.

  16. Comparison of wind measurements in the troposphere and mesosphere by VHF/MF radars and in-situ techniques

    Science.gov (United States)

    Engler, N.; Singer, W.; Latteck, R.; Strelnikov, B.

    2008-11-01

    Radar wind observations at frequencies between 1.98 and 53.5 MHz obtained at polar latitudes were compared to in-situ wind measurements by radiosondes at tropospheric altitudes and to winds from falling spheres at mesospheric altitudes. Comparisons are shown for several campaigns of radiosonde and falling sphere observations. The radar wind directions agree well to the radiosonde and falling sphere observations and are highly correlated. The winds estimated from radar measurements are less than the radiosonde data by about 15% for spaced antenna observations and by about 10% for the Doppler beam swinging experiment. At mesospheric altitudes the spaced antenna winds obtained from the wide-beam Andenes MF radar are underestimated in the order of 35% and winds from the narrow-beam Saura MF radar are underestimated by about 20% compared to falling sphere winds at altitudes between 70 and 80 km. Furthermore, the relation between wind measurements using narrow-beam and wide-beam antenna arrangements for the MF radars is discussed and VHF radar observations are compared to the wide-beam MF radar.

  17. Observation of polar mesosphere summer echoes with calibrated VHF radars at 69° in the Northern and Southern hemispheres

    Science.gov (United States)

    Latteck, R.; Singer, W.; Morris, R. J.; Holdsworth, D. A.; Murphy, D. J.

    2007-07-01

    Polar Mesosphere Summer Echoes (PMSE) observed in the northern and southern hemisphere were studied using continuous measurements obtained by calibrated VHF radars located at Andenes (69.3°N) and Davis (68.6°S) during the boreal summer 2004 and the austral summer 2004/2005. The PMSE observed at Davis have a lower peak volume reflectivity of approximately 4 . 10-11 m-1 compared with their counterparts (7 . 10-10 m-1) observed at Andenes. The duration of the PMSE season is correlated with the dynamical and thermal state of the mesopause region supported by recent studies using meridional winds and temperatures. PMSE occurred less frequently but with greater variability above Davis. The diurnal variation of PMSE occurrence has a maximum around 11-16 LT in both hemispheres, and a minimum occurs during late evening with a longer duration in the southern hemisphere. The mean PMSE season at both sites started around 34 days before solstice, but the duration of the Davis PMSE season is about 9 days shorter than at Andenes. The maximum occurrence height of PMSE at Davis is 86 km which is about 1 km higher than at Andenes.

  18. Comparison of wind measurements in the troposphere and mesosphere by VHF/MF radars and in-situ techniques

    Energy Technology Data Exchange (ETDEWEB)

    Engler, N.; Singer, W.; Latteck, R.; Strelnikov, B. [Rostock Univ., Kuehlungsborn (Germany). Leibniz Inst. of Atmospheric Physics

    2008-07-01

    Radar wind observations at frequencies between 1.98 and 53.5 MHz obtained at polar latitudes were compared to in-situ wind measurements by radiosondes at tropospheric altitudes and to winds from falling spheres at mesospheric altitudes. Comparisons are shown for several campaigns of radiosonde and falling sphere observations. The radar wind directions agree well to the radiosonde and falling sphere observations and are highly correlated. The winds estimated from radar measurements are less than the radiosonde data by about 15% for spaced antenna observations and by about 10% for the Doppler beam swinging experiment. At mesospheric altitudes the spaced antenna winds obtained from the wide-beam Andenes MF radar are underestimated in the order of 35% and winds from the narrow-beam Saura MF radar are underestimated by about 20% compared to falling sphere winds at altitudes between 70 and 80 km. Furthermore, the relation between wind measurements using narrow-beam and wide-beam antenna arrangements for the MF radars is discussed and VHF radar observations are compared to the wide-beam MF radar. (orig.)

  19. Calculating the azimuth of mountain waves, using the effect of tilted fine-scale stable layers on VHF radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    1999-02-01

    Full Text Available A simple method is described, based on standard VHF wind-profiler data, where imbalances of echo power between four off-vertical radar beams, caused by mountain waves, can be used to calculate the orientation of the wave pattern. It is shown that the mountain wave azimuth (direction of the horizontal component of the wavevector, is given by the vector [ W (PE - P W ,W (PN - P S ]; PN, PS, PE, PW are radar echo powers, measured in dB, in beams pointed away from vertical by the same angle towards north, south, east and west respectively, and W is the vertical wind velocity. The method is applied to Aberystwyth MST radar data, and the calculated wave vector usually, but not always, points into the low-level wind direction. The mean vertical wind at Aberystwyth, which may also be affected by tilted aspect-sensitive layers, is investigated briefly using the entire radar output 1990-1997. The mean vertical-wind profile is inconsistent with existing theories, but a new mountain-wave interpretation is proposed.Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; waves and tides; instruments and techniques.

  20. Effect of power on growth of nanocrystalline silicon films deposited by VHF PECVD technique for solar cell applications

    Science.gov (United States)

    Juneja, Sucheta; Verma, Payal; Savelyev, Dmitry A.; Khonina, Svetlana N.; Sudhakar, S.; Kumar, Sushil

    2016-04-01

    An investigation of the effect of power on the deposition of nanocrystalline silicon thin films were carried out using a gaseous mixture of silane and hydrogen in the 60MHz assisted VHF plasma enhanced chemical vapor deposition (PECVD) technique. The power was varied from 10 to 50 watt maintaining all other parameters constant. Corresponding layer properties w.r.t. material microstructure, optical, hydrogen content and electrical transport are studied in detail. The structural properties have been studied by Raman spectroscopy and x-ray diffraction (XRD). The presence of nano-sized crystals and their morphology have been investigated using atomic force microscopy (AFM). The role of bonded hydrogen content in the films have been studied from the results of Fourier transform infrared spectroscopy. It was observed from the results that with increase in power, crystalline volume fraction increases and crystallite size changes from 4 to 9 nm. The optical band gap varies from 1.7 to 2.1eV due to quantum confinement effect and which further can be explained with reduced hydrogen content. These striking features of nc-Si films can be used to fabricate stable thin film solar cells.