WorldWideScience

Sample records for vhf omnidirectional radio

  1. VHF spectrum monitoring using Meraka cognitive radio platform

    CSIR Research Space (South Africa)

    Aderonmu, AI

    2012-11-01

    Full Text Available discuss the Meraka Cognitive Radio Platform (MCRP) developed using the second version of the Universal Serial Radio Peripheral (USRP2) hardware and the GNU Radio software. We also discussed how the spectrum monitoring system is being implemented...

  2. Collaborative Localization in Wireless Sensor Networks via Pattern Recognition in Radio Irregularity Using Omnidirectional Antennas

    Directory of Open Access Journals (Sweden)

    Tzu-Yun Lai

    2010-01-01

    Full Text Available In recent years, various received signal strength (RSS-based localization estimation approaches for wireless sensor networks (WSNs have been proposed. RSS-based localization is regarded as a low-cost solution for many location-aware applications in WSNs. In previous studies, the radiation patterns of all sensor nodes are assumed to be spherical, which is an oversimplification of the radio propagation model in practical applications. In this study, we present an RSS-based cooperative localization method that estimates unknown coordinates of sensor nodes in a network. Arrangement of two external low-cost omnidirectional dipole antennas is developed by using the distance-power gradient model. A modified robust regression is also proposed to determine the relative azimuth and distance between a sensor node and a fixed reference node. In addition, a cooperative localization scheme that incorporates estimations from multiple fixed reference nodes is presented to improve the accuracy of the localization. The proposed method is tested via computer-based analysis and field test. Experimental results demonstrate that the proposed low-cost method is a useful solution for localizing sensor nodes in unknown or changing environments.

  3. Antennas for VHF/UHF personal radio: A theoretical and experimental study of characteristics and performance

    DEFF Research Database (Denmark)

    Andersen, Jørgen Bach; Hansen, Flemming

    1977-01-01

    A theoretical analysis of the characteristics of small personal radio antennas for the 68- to 470-MHz frequency range is given. Representing the human body by a simplified lossy dielectric structure, the influence of the body on the performance of the antenna is investigated in detail...... to efficiency and radiation patterns at 80, 160, and 450 MHz, and it is demonstrated how the physical length of the antenna affects the antenna performance. The design of a very short and compact personal radio antenna is described....

  4. Development of a passive VHF radar system using software-defined radio for equatorial plasma instability studies

    Science.gov (United States)

    Tuysuz, B.; Urbina, J.; Lind, F. D.

    2013-07-01

    In this paper, a bistatic passive radar receiver system named "Coherent-scatter Atmospheric Passive Radar Imager (CAPRI)" is described. It is primarily designed to study the dynamics of the upper atmosphere by utilizing "transmitters of opportunity" as the RF target illuminators. CAPRI is constructed using the open source software-defined radio toolkit, GNU Radio, to meet the signal processing requirements in combination with the open source hardware, Universal Software Radio Peripheral 2, for data acquisition. The resultant system is highly flexible, and we present the details of the design as well as a performance analysis. CAPRI will be deployed in Peru, near the magnetic equator, for long-term operations in the area. FM stations near Lima, Peru, will be utilized with the targets of interest being the equatorial electrojet and the spread F. The results will then be compared to the Jicamarca Unattended Long-term investigations of the Ionosphere and Atmosphere (JULIA) radar data, and CAPRI will be used to improve the simultaneous time and spatial coverage in the region in a more cost-effective manner.

  5. An Autonomous Omnidirectional Robot

    Directory of Open Access Journals (Sweden)

    Yanfei Liu

    2010-01-01

    Full Text Available RoboCup is an international research and education initiative, which aims to foster artificial intelligence and robotics research by using competitive soccer as a standard problem. This paper presents a detailed engineering design process and the outcome for an omni-directional mobile robot platform for the Robocup Middle Size League competition. A prototype that can move omnidirectionally with kicking capability was designed, built, and tested by a group of senior students. The design included a mechanical base, pneumatic kicking mechanism, a DSP microcontroller-based control system, various sensor interfacing units, and the analysis of omnidirectional motions. The testing results showed that the system was able to move omnidirectionally with a speed of ∼2 m/s and able to kick a size 5 FIFA soccer ball for a distance of at least 5 meters.

  6. Omnidirectional antenna having constant phase

    Energy Technology Data Exchange (ETDEWEB)

    Sena, Matthew

    2017-04-04

    Various technologies presented herein relate to constructing and/or operating an antenna having an omnidirectional electrical field of constant phase. The antenna comprises an upper plate made up of multiple conductive rings, a lower ground-plane plate, a plurality of grounding posts, a conical feed, and a radio frequency (RF) feed connector. The upper plate has a multi-ring configuration comprising a large outer ring and several smaller rings of equal size located within the outer ring. The large outer ring and the four smaller rings have the same cross-section. The grounding posts ground the upper plate to the lower plate while maintaining a required spacing/parallelism therebetween.

  7. Visual odometry from omnidirectional camera

    OpenAIRE

    Jiří DIVIŠ

    2012-01-01

    We present a system that estimates the motion of a robot relying solely on images from onboard omnidirectional camera (visual odometry). Compared to other visual odometry hardware, ours is unusual in utilizing high resolution, low frame-rate (1 to 3 Hz) omnidirectional camera mounted on a robot that is propelled using continuous tracks. We focus on high precision estimates in scenes, where objects are far away from the camera. This is achieved by utilizing omnidirectional camera that is able ...

  8. Dicty_cDB: VHF264 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF264 (Link to dictyBase) - - - Contig-U16260-1 VHF264P (Link to Original site) VHF...264F 606 VHF264Z 693 VHF264P 1279 - - Show VHF264 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-C/VHF264Q.Seq.d/ Representative seq. ID VHF...264P (Link to Original site) Representative DNA sequence >VHF264 (VHF264Q) /CSM/VH/VHF2-C/VHF...DRRKNIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHFEMPKEDKLPAGCTS

  9. Dicty_cDB: VHF181 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF181 (Link to dictyBase) - - - Contig-U16260-1 VHF181P (Link to Original site) VHF...181F 610 VHF181Z 416 VHF181P 1006 - - Show VHF181 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-D/VHF181Q.Seq.d/ Representative seq. ID VHF...181P (Link to Original site) Representative DNA sequence >VHF181 (VHF181Q) /CSM/VH/VHF1-D/VHF...VKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKVSG DMRYMSCRADEQERGITIKSSSVSLHF

  10. Dicty_cDB: VHF777 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF777 (Link to dictyBase) - - - Contig-U16283-1 VHF777P (Link to Original site) VHF...777F 474 VHF777Z 669 VHF777P 1123 - - Show VHF777 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-D/VHF777Q.Seq.d/ Representative seq. ID VHF...777P (Link to Original site) Representative DNA sequence >VHF777 (VHF777Q) /CSM/VH/VHF7-D/VHF...PNIIGVEHYKVATDVQKILXRI*itsryychfryg*fi *rpksncipcs*dstflittirscprxhqygr*ir*tlrlyq

  11. Dicty_cDB: VHF354 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF354 (Link to dictyBase) - - - Contig-U16260-1 VHF354P (Link to Original site) VHF...354F 617 VHF354Z 721 VHF354P 1318 - - Show VHF354 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-C/VHF354Q.Seq.d/ Representative seq. ID VHF...354P (Link to Original site) Representative DNA sequence >VHF354 (VHF354Q) /CSM/VH/VHF3-C/VHF...no Acid sequence LSSAKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGD

  12. Dicty_cDB: VHF590 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF590 (Link to dictyBase) - - - Contig-U16306-1 VHF590P (Link to Original site) VHF...590F 115 VHF590Z 603 VHF590P 698 - - Show VHF590 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-D/VHF590Q.Seq.d/ Representative seq. ID VHF...590P (Link to Original site) Representative DNA sequence >VHF590 (VHF590Q) /CSM/VH/VHF5-D/VHF5...qlphvlrqlk*sqnfhkkylkkvqeqqq--- ---rwifhrwccfqsthdamyflyqxfgslsw*snlxrpkist*xfyhifghfw*rls*l ss*ipi*lqkwysyv

  13. Dicty_cDB: VHF536 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF536 (Link to dictyBase) - - - Contig-U16531-1 VHF536P (Link to Original site) VHF...536F 255 VHF536Z 685 VHF536P 920 - - Show VHF536 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-B/VHF536Q.Seq.d/ Representative seq. ID VHF...536P (Link to Original site) Representative DNA sequence >VHF536 (VHF536Q) /CSM/VH/VHF5-B/VHF5...ti*mlhliskvmtvh*mslslfyggyfl*lsi*llwnysig qvvvcliksikxerllkstmt--- ---*erlcl*ilxlvsichf

  14. Dicty_cDB: VHF730 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF730 (Link to dictyBase) - - - Contig-U15767-1 VHF730P (Link to Original site) VHF...730F 569 VHF730Z 718 VHF730P 1267 - - Show VHF730 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-B/VHF730Q.Seq.d/ Representative seq. ID VHF...730P (Link to Original site) Representative DNA sequence >VHF730 (VHF730Q) /CSM/VH/VHF7-B/VHF...QEKRIPVLNSMDANDSINKKA RISWPDGFKYFFVDNQAGDSESAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQXFN DVSYPV--- ---lhvvvvkxvhtlpvnvnqivhf

  15. Dicty_cDB: VHF649 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF649 (Link to dictyBase) - - - Contig-U11031-1 VHF649P (Link to Original site) VHF...649F 562 VHF649Z 671 VHF649P 1213 - - Show VHF649 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF6-C/VHF649Q.Seq.d/ Representative seq. ID VHF...649P (Link to Original site) Representative DNA sequence >VHF649 (VHF649Q) /CSM/VH/VHF6-C/VHF...PNTPPTIKIELPSQSILKPSGQLKK*x* Translated Amino Acid sequence (All Frames) Frame A: i*qlvchlsivlfhhqviyphvlklekhf

  16. Dicty_cDB: VHF527 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF527 (Link to dictyBase) - - - Contig-U16260-1 VHF527P (Link to Original site) VHF...527F 571 VHF527Z 456 VHF527P 1007 - - Show VHF527 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-B/VHF527Q.Seq.d/ Representative seq. ID VHF...527P (Link to Original site) Representative DNA sequence >VHF527 (VHF527Q) /CSM/VH/VHF5-B/VHF...AKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQXRGITIKSSSVSLHF

  17. Dicty_cDB: VHF294 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF294 (Link to dictyBase) - - - Contig-U16441-1 VHF294P (Link to Original site) VHF...294F 573 VHF294Z 215 VHF294P 768 - - Show VHF294 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-D/VHF294Q.Seq.d/ Representative seq. ID VHF...294P (Link to Original site) Representative DNA sequence >VHF294 (VHF294Q) /CSM/VH/VHF2-D/VHF2...ssfst*scisfttfry*gfsdctfr*fhfn**RFWFNMEQCII QWVMFYS--- ---DCHVSIKKFFKWWQRLDRWCCXXXSCXXXSWWFWFPTFLRIQISNXXY*k

  18. Dicty_cDB: VHF690 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF690 (Link to dictyBase) - - - Contig-U11064-1 VHF690P (Link to Original site) VHF...690F 199 VHF690Z 419 VHF690P 598 - - Show VHF690 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF6-D/VHF690Q.Seq.d/ Representative seq. ID VHF...690P (Link to Original site) Representative DNA sequence >VHF690 (VHF690Q) /CSM/VH/VHF6-D/VHF6...vllksqsknqyl*hlikslidfinif*hgmhqiyhqrkkn*nq *k--- ---rrwfpr*rernhhfqlc*sts*rgcryw

  19. Dicty_cDB: VHF273 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF273 (Link to dictyBase) - - - Contig-U11514-1 VHF273P (Link to Original site) VHF...273F 644 VHF273Z 678 VHF273P 1302 - - Show VHF273 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-D/VHF273Q.Seq.d/ Representative seq. ID VHF...273P (Link to Original site) Representative DNA sequence >VHF273 (VHF273Q) /CSM/VH/VHF2-D/VHF...ctr*ccnvkdwchyssrl*syrs*ts*nrsifidr*iftsh*kdw**s llwfsnetr*skmcchcnwckhflwscckfstrnrrtwssssys*kywslly*fhrhlg

  20. Dicty_cDB: VHF243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF243 (Link to dictyBase) - - - Contig-U16423-1 VHF243P (Link to Original site) VHF...243F 580 VHF243Z 334 VHF243P 894 - - Show VHF243 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-B/VHF243Q.Seq.d/ Representative seq. ID VHF...243P (Link to Original site) Representative DNA sequence >VHF243 (VHF243Q) /CSM/VH/VHF2-B/VHF2...AATCNAGATATTCCAGATTGGTTTGAAAAGATGG TACA sequence update 2002.10.25 Translated Amino Acid sequence ifihadkff*RISHF

  1. Dicty_cDB: VHF134 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF134 (Link to dictyBase) - - - Contig-U16260-1 VHF134P (Link to Original site) VHF...134F 533 VHF134Z 404 VHF134P 917 - - Show VHF134 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-B/VHF134Q.Seq.d/ Representative seq. ID VHF...134P (Link to Original site) Representative DNA sequence >VHF134 (VHF134Q) /CSM/VH/VHF1-B/VHF1...cid sequence LSSAKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHFEMPKE

  2. Dicty_cDB: VHF892 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF892 (Link to dictyBase) - - - Contig-U16260-1 VHF892P (Link to Original site) VHF...892F 140 VHF892Z 417 VHF892P 537 - - Show VHF892 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF8-D/VHF892Q.Seq.d/ Representative seq. ID VHF...892P (Link to Original site) Representative DNA sequence >VHF892 (VHF892Q) /CSM/VH/VHF8-D/VHF8... Translated Amino Acid sequence TIKSSSVSLHFEMPXEDKLPAGCTSHEFLINLIDSPSHVDFS--- ---ELTASPNILEPIYLVEITAPENAIGGI

  3. Dicty_cDB: VHF479 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF479 (Link to dictyBase) - - - Contig-U11426-1 VHF479P (Link to Original site) VHF...479F 629 VHF479Z 691 VHF479P 1300 - - Show VHF479 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF4-D/VHF479Q.Seq.d/ Representative seq. ID VHF...479P (Link to Original site) Representative DNA sequence >VHF479 (VHF479Q) /CSM/VH/VHF4-D/VHF...EKNPQEWRWSGGFFVDSISDYVVKSRNTERPDHDSLLF HVNIKEKQGTHFIRIPLSSKESPPYIIQNDTQFKISFFQRDSPENIDYIEPKEKLCYGWD EPSAEYVL

  4. Dicty_cDB: VHF754 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF754 (Link to dictyBase) - - - Contig-U16531-1 VHF754P (Link to Original site) VHF...754F 526 VHF754Z 624 VHF754P 1130 - - Show VHF754 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-C/VHF754Q.Seq.d/ Representative seq. ID VHF...754P (Link to Original site) Representative DNA sequence >VHF754 (VHF754Q) /CSM/VH/VHF7-C/VHF...ixnkmqwlkmlqvk*killk*ekvvslgiiftipf--- ---flvsichfnchc*itfccsrwnnlxllxfldsryllqw*

  5. Dicty_cDB: VHF461 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF461 (Link to dictyBase) - - - Contig-U11551-1 VHF461P (Link to Original site) VHF...461F 646 VHF461Z 261 VHF461P 887 - - Show VHF461 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF4-C/VHF461Q.Seq.d/ Representative seq. ID VHF...461P (Link to Original site) Representative DNA sequence >VHF461 (VHF461Q) /CSM/VH/VHF4-C/VHF4...TTAAATTATTAAAAATAGTAAATAAAAAAAA sequence update 2002.10.25 Translated Amino Acid sequence fyfifenfkthfhiiffl

  6. Dicty_cDB: VHF781 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF781 (Link to dictyBase) - - - Contig-U16440-1 VHF781P (Link to Original site) VHF...781F 452 VHF781Z 680 VHF781P 1112 - - Show VHF781 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-D/VHF781Q.Seq.d/ Representative seq. ID VHF...781P (Link to Original site) Representative DNA sequence >VHF781 (VHF781Q) /CSM/VH/VHF7-D/VHF...vlkmmmlkf*xixftr*r Frame C: glldinkleeiik*rfhlfylfl*rlllayhfhkilfqlisktaligsnfnhyiqikmim y*l*iqdqrmf*kdqqmvv

  7. Dicty_cDB: VHF435 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF435 (Link to dictyBase) - - - Contig-U16260-1 VHF435P (Link to Original site) VHF...435F 616 VHF435Z 703 VHF435P 1299 - - Show VHF435 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF4-B/VHF435Q.Seq.d/ Representative seq. ID VHF...435P (Link to Original site) Representative DNA sequence >VHF435 (VHF435Q) /CSM/VH/VHF4-B/VHF...AKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHF

  8. Dicty_cDB: VHF553 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF553 (Link to dictyBase) - - - Contig-U16433-1 VHF553P (Link to Original site) VHF...553F 122 VHF553Z 533 VHF553P 635 - - Show VHF553 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-C/VHF553Q.Seq.d/ Representative seq. ID VHF...553P (Link to Original site) Representative DNA sequence >VHF553 (VHF553Q) /CSM/VH/VHF5-C/VHF5...ed Amino Acid sequence syhfylfiy*IIIYLLNYYLLSCVNYLPINFNILYIY--- ---YVINLTLDGDNVNGFPKTVTVKPAPSXEQXYAEGEGLVKVF

  9. Dicty_cDB: VHF163 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF163 (Link to dictyBase) - - - Contig-U11129-1 VHF163P (Link to Original site) VHF1...63F 611 VHF163Z 654 VHF163P 1245 - - Show VHF163 Library VH (Link to library) Clone ID VHF1...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-C/VHF163Q.Seq.d/ Representative seq. ID VHF1...63P (Link to Original site) Representative DNA sequence >VHF163 (VHF163Q) /CSM/VH/VHF1-C/VHF1...nt alignments: (bits) Value VHF163 (VHF163Q) /CSM/VH/VHF1-C/VHF163Q.Seq.d/ 2357 0.0 VHM584 (VHM584Q) /CSM/VH

  10. Dicty_cDB: VHF444 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (Link to library) VHF444 (Link to dictyBase) - G20601 DDB0204337 Contig-U12392-1 VHF444P (Link to Original...site) VHF444F 579 VHF444Z 213 VHF444P 772 - - Show VHF444 Library VH (Link to library) Clone ID VHF444 (Link...tsukuba.ac.jp/CSM/VH/VHF4-B/VHF444Q.Seq.d/ Representative seq. ID VHF444P (Link to Original site) Representative...Representative DNA sequence >VHF444 (VHF444Q) /CSM/VH/VHF4-B/VHF444Q.Seq.d/ CAAAAGAAATAAATAATTATGCCATCA...significant alignments: (bits) Value VHF444 (VHF444Q) /CSM/VH/VHF4-B/VHF444Q.Seq.d/ 1479 0.0 VHA836 (VHA836Q)

  11. Dicty_cDB: VHF338 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF338 (Link to dictyBase) - - - Contig-U14303-1 VHF338P (Link to Original site) VHF3...38F 208 VHF338Z 685 VHF338P 873 - - Show VHF338 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF338Q.Seq.d/ Representative seq. ID VHF3...38P (Link to Original site) Representative DNA sequence >VHF338 (VHF338Q) /CSM/VH/VHF3-B/VHF3...significant alignments: (bits) Value VHF338 (VHF338Q) /CSM/VH/VHF3-B/VHF338Q.Seq.d/ 1296 0.0 VHK267 (VHK267Q

  12. Dicty_cDB: VHF394 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF394 (Link to dictyBase) - - - Contig-U16260-1 VHF394P (Link to Original site) VHF3...94F 563 VHF394Z 417 VHF394P 960 - - Show VHF394 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-D/VHF394Q.Seq.d/ Representative seq. ID VHF3...94P (Link to Original site) Representative DNA sequence >VHF394 (VHF394Q) /CSM/VH/VHF3-D/VHF3...nt alignments: (bits) Value VHF394 (VHF394Q) /CSM/VH/VHF3-D/VHF394Q.Seq.d/ 1776 0

  13. Dicty_cDB: VHF340 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF340 (Link to dictyBase) - - - Contig-U11939-1 VHF340P (Link to Original site) VHF3...40F 113 VHF340Z 506 VHF340P 599 - - Show VHF340 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF340Q.Seq.d/ Representative seq. ID VHF3...40P (Link to Original site) Representative DNA sequence >VHF340 (VHF340Q) /CSM/VH/VHF3-B/VHF3...Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF340 (VHF340Q) /CSM/VH/VHF3-B/VHF3

  14. Omnidirectional Analysis of Spatial Manipulator

    Directory of Open Access Journals (Sweden)

    Yuquan Leng

    2015-01-01

    Full Text Available Space manipulators are mainly used in the spatial loading task. According to problems of the spatial loading diversity, the testing loading installing position, and the utilization ratio of a test platform, the space manipulator is asked to evaluate the position and attitude of itself. This paper proposes the Point Omnidirectional Coefficient (POC with unit attitude sphere/circle to describe attitude of the end-effector, which evaluates any points in the attainable space of the manipulators, in combination with the manipulation’s position message, and get relationships between its position and attitude of all points in the attainable space. It represents the mapping between sphere surface and plane for mission attitude constraints and the method for calculating volume of points space including attainable space, Omnidirectional space, and mission attitude space. Furthermore, the Manipulator Omnidirectional Coefficient based on mission or not is proposed for evaluating manipulator performance. Through analysis and simulation about 3D and 2D manipulators, the results show that the above theoretical approach is feasible and the relationships about link lengths, joints angles, attainable space, and Manipulator Omnidirectional Coefficient are drawn for guiding design.

  15. Dicty_cDB: VHF329 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF329 (Link to dictyBase) - - - Contig-U16260-1 VHF329P (Link to Original site) VHF3...29F 618 VHF329Z 633 VHF329P 1231 - - Show VHF329 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF329Q.Seq.d/ Representative seq. ID VHF3...29P (Link to Original site) Representative DNA sequence >VHF329 (VHF329Q) /CSM/VH/VHF3-B/VHF3...s CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF329 (VHF329Q) /CSM/VH/VHF3

  16. VHF signal power suppression in stratiform and convective precipitation

    Directory of Open Access Journals (Sweden)

    A. J. McDonald

    2006-03-01

    Full Text Available Previous studies have indicated that VHF clear-air radar return strengths are reduced during periods of precipitation. This study aims to examine whether the type of precipitation, stratiform and convective precipitation types are identified, has any impact on the relationships previously observed and to examine the possible mechanisms which produce this phenomenon. This study uses a combination of UHF and VHF wind-profiler data to define periods associated with stratiform and convective precipitation. This identification is achieved using an algorithm which examines the range squared corrected signal to noise ratio of the UHF returns for a bright band signature for stratiform precipitation. Regions associated with convective rainfall have been defined by identifying regions of enhanced range corrected signal to noise ratio that do not display a bright band structure and that are relatively uniform until a region above the melting layer.

    This study uses a total of 68 days, which incorporated significant periods of surface rainfall, between 31 August 2000 and 28 February 2002 inclusive from Aberystwyth (52.4° N, 4.1° W. Examination suggests that both precipitation types produce similar magnitude reductions in VHF signal power on average. However, the frequency of occurrence of statistically significant reductions in VHF signal power are very different. In the altitude range 2-4 km stratiform precipitation is related to VHF signal suppression approximately 50% of the time while in convective precipitation suppression is observed only 27% of the time. This statistical result suggests that evaporation, which occurs more often in stratiform precipitation, is important in reducing the small-scale irregularities in humidity and thereby the radio refractive index. A detailed case study presented also suggests that evaporation reducing small-scale irregularities in humidity may contribute to the observed VHF signal

  17. VHF signal power suppression in stratiform and convective precipitation

    Directory of Open Access Journals (Sweden)

    A. J. McDonald

    2006-03-01

    Full Text Available Previous studies have indicated that VHF clear-air radar return strengths are reduced during periods of precipitation. This study aims to examine whether the type of precipitation, stratiform and convective precipitation types are identified, has any impact on the relationships previously observed and to examine the possible mechanisms which produce this phenomenon. This study uses a combination of UHF and VHF wind-profiler data to define periods associated with stratiform and convective precipitation. This identification is achieved using an algorithm which examines the range squared corrected signal to noise ratio of the UHF returns for a bright band signature for stratiform precipitation. Regions associated with convective rainfall have been defined by identifying regions of enhanced range corrected signal to noise ratio that do not display a bright band structure and that are relatively uniform until a region above the melting layer. This study uses a total of 68 days, which incorporated significant periods of surface rainfall, between 31 August 2000 and 28 February 2002 inclusive from Aberystwyth (52.4° N, 4.1° W. Examination suggests that both precipitation types produce similar magnitude reductions in VHF signal power on average. However, the frequency of occurrence of statistically significant reductions in VHF signal power are very different. In the altitude range 2-4 km stratiform precipitation is related to VHF signal suppression approximately 50% of the time while in convective precipitation suppression is observed only 27% of the time. This statistical result suggests that evaporation, which occurs more often in stratiform precipitation, is important in reducing the small-scale irregularities in humidity and thereby the radio refractive index. A detailed case study presented also suggests that evaporation reducing small-scale irregularities in humidity may contribute to the observed VHF signal suppression.

  18. Dicty_cDB: VHF187 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF187 (Link to dictyBase) - - - Contig-U16363-1 VHF187P (Link to Original site) VHF1...87F 549 VHF187Z 707 VHF187P 1236 - - Show VHF187 Library VH (Link to library) Clone ID VHF1...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-D/VHF187Q.Seq.d/ Representative seq. ID VHF1...87P (Link to Original site) Representative DNA sequence >VHF187 (VHF187Q) /CSM/VH/VHF1-D/VHF1...* Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF187 (VHF1

  19. Dicty_cDB: VHF368 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF368 (Link to dictyBase) - - - Contig-U12673-1 VHF368P (Link to Original site) VHF3...68F 597 VHF368Z 746 VHF368P 1323 - - Show VHF368 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-C/VHF368Q.Seq.d/ Representative seq. ID VHF3...68P (Link to Original site) Representative DNA sequence >VHF368 (VHF368Q) /CSM/VH/VHF3-C/VHF3...ikfpknkii*nki k*nkiky Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF368 (VHF3

  20. Omnidirectional antenna for radar applications

    Science.gov (United States)

    Vitiello, R.

    The development of an omnidirectional antenna for sidelobe blanking is described. The results of electrical measurements for an S-band and L-band configuration are given. The antenna architecture consists of eight printed radiating elements arranged in a biconical fashion. The single radiating element is a pseudo log periodic microstrip array fed by means of capacitive coupling. Modularity and flexibility are the outstanding characteristics of the design.

  1. Reconfigurable, Digital EVA Radio Project

    Data.gov (United States)

    National Aeronautics and Space Administration — AeroAstro proposes to develop a low-power, low-volume and lightweight, state-of-the-art digital radio capable of operating in a wide variety of bands, from VHF...

  2. Dicty_cDB: VHF348 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF348 (Link to dictyBase) - - - Contig-U13926-1 VHF348P (Link to Original site) VHF3...48F 539 VHF348Z 473 VHF348P 992 - - Show VHF348 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF348Q.Seq.d/ Representative seq. ID VHF3...48P (Link to Original site) Representative DNA sequence >VHF348 (VHF348Q) /CSM/VH/VHF3-B/VHF3...ksxvlmliltck Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF3

  3. Dicty_cDB: VHF312 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF312 (Link to dictyBase) - - - Contig-U15897-1 VHF312P (Link to Original site) VHF3...12F 543 VHF312Z 483 VHF312P 1006 - - Show VHF312 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF312Q.Seq.d/ Representative seq. ID VHF3...12P (Link to Original site) Representative DNA sequence >VHF312 (VHF312Q) /CSM/VH/VHF3-A/VHF3... 4.0 %: extracellular, including cell wall 4.0 %: plasma membrane 4.0 %: peroxisomal >> prediction for VHF31

  4. Dicty_cDB: VHF375 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF375 (Link to dictyBase) - - - Contig-U16260-1 VHF375P (Link to Original site) VHF3...75F 432 VHF375Z 670 VHF375P 1082 - - Show VHF375 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-D/VHF375Q.Seq.d/ Representative seq. ID VHF3...75P (Link to Original site) Representative DNA sequence >VHF375 (VHF375Q) /CSM/VH/VHF3-D/VHF3...pperekv*pqksqiltnstknskqfkshxsfqr*xsnlkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF3

  5. Dicty_cDB: VHF190 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available F0-ATPase putative regulatory protein IF1 (if1) mRNA, complete cds; nuclear gene for mitochondrial produc...VH (Link to library) VHF190 (Link to dictyBase) - - - Contig-U12594-1 - (Link to Original site) VHF1...90F 581 - - - - - - Show VHF190 Library VH (Link to library) Clone ID VHF190 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF1-D/VHF190Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF190 (VHF190Q) /CSM/VH/VHF1-D/VHF190Q.Seq.d/ ATTTTTCATTTTAAAAA

  6. Dicty_cDB: VHF331 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF331 (Link to dictyBase) - - - - - (Link to Original site) VHF3...31F 609 - - - - - - Show VHF331 Library VH (Link to library) Clone ID VHF331 (Link to dictyBase) Atlas ID... - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF3...31Q.Seq.d/ Representative seq. ID - (Link to Original site) Representative DNA sequence >VHF3...31 (VHF331Q) /CSM/VH/VHF3-B/VHF331Q.Seq.d/ AACTCTCGAGTGCAAAAAAAGTAAAGTACAAAATGGTTAATTTCA

  7. Dicty_cDB: VHF709 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF709 (Link to dictyBase) - - - Contig-U15897-1 - (Link to Original site) - - VHF...709Z 602 - - - - Show VHF709 Library VH (Link to library) Clone ID VHF709 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF7-A/VHF709Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF709 (VHF709Q) /CSM/VH/VHF7-A/VHF709Q.Seq.d/ XXXXXXXXXXCGTCCAA...vestir Frame B: ---sknfttrsrlqlccsfnglxpr**rw*tnrqhyhg*cksiwsssfnlsryyw*yrcs ilpqiq*kwchhsnlpiw*wsflyhf

  8. Dicty_cDB: VHF236 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF236 (Link to dictyBase) - - - Contig-U14303-1 - (Link to Original site) - - VHF...236Z 611 - - - - Show VHF236 Library VH (Link to library) Clone ID VHF236 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF2-B/VHF236Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF236 (VHF236Q) /CSM/VH/VHF2-B/VHF236Q.Seq.d/ XXXXXXXXXXTGCCATT...VQKISQELKHLT*tfvsylvlk Frame B: ---plvicc*ninvlhfveilsxhglay*xhcfplvlv*fqilsrmiqs

  9. Dicty_cDB: VHF140 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF140 (Link to dictyBase) - - - Contig-U15309-1 - (Link to Original site) - - VHF...140Z 518 - - - - Show VHF140 Library VH (Link to library) Clone ID VHF140 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF1-B/VHF140Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF140 (VHF140Q) /CSM/VH/VHF1-B/VHF140Q.Seq.d/ XXXXXXXXXXCCGATAA...EDYINMQIKQLENSENSQELIQKLNEHLSEYKASVEEIKHNVQNN Frame C: ---iixvtlmlflqngilhfigviil

  10. Dicty_cDB: VHF507 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF507 (Link to dictyBase) - - - Contig-U11594-1 - (Link to Original site) - - VHF...507Z 541 - - - - Show VHF507 Library VH (Link to library) Clone ID VHF507 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF5-A/VHF507Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF507 (VHF507Q) /CSM/VH/VHF5-A/VHF507Q.Seq.d/ XXXXXXXXXXTACCAAT...nvhsmiwihvglxlvigx*sncfvttsfikst mmvllcstftmllkpsixwivvsmkkyf*clemnxhfw*sviki*knv

  11. Dicty_cDB: VHF321 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF321 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) VHF...321F 617 - - - - - - Show VHF321 Library VH (Link to library) Clone ID VHF321 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF321Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF321 (VHF321Q) /CSM/VH/VHF3-A/VHF321Q.Seq.d/ AACTCTCGAGTGCAAAA...VIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHFEMPKEDKLPAGCTSHEFLINLIDSPGHVDFS SEVTAALRVTDGALVVIDC

  12. Dicty_cDB: VHF866 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF866 (Link to dictyBase) - - - Contig-U16600-1 - (Link to Original site) - - VHF...866Z 388 - - - - Show VHF866 Library VH (Link to library) Clone ID VHF866 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF8-C/VHF866Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF866 (VHF866Q) /CSM/VH/VHF8-C/VHF866Q.Seq.d/ XXXXXXXXXXAAGCAGC...Frame C: ---qhnnifklafptiknftgvpmxfvmtnegdnlgnftvkthfakffstyyscgeaghh yfdsccn*y*qkqgckfhs*h*xkssrr*lcfxqnwfi

  13. Dicty_cDB: VHF155 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF155 (Link to dictyBase) - - - - VHF155P (Link to Original site) VHF155F 587 VHF1...55Z 643 VHF155P 1210 - - Show VHF155 Library VH (Link to library) Clone ID VHF155 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1...-C/VHF155Q.Seq.d/ Representative seq. ID VHF155P (Link to... Original site) Representative DNA sequence >VHF155 (VHF155Q) /CSM/VH/VHF1-C/VHF155Q.Seq.d/ ATTCTCGATACTGGAA

  14. Dicty_cDB: VHF392 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF392 (Link to dictyBase) - - - - VHF392P (Link to Original site) VHF392F 568 VHF3...92Z 375 VHF392P 923 - - Show VHF392 Library VH (Link to library) Clone ID VHF392 (Link ...to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3...-D/VHF392Q.Seq.d/ Representative seq. ID VHF392P (Link to ...Original site) Representative DNA sequence >VHF392 (VHF392Q) /CSM/VH/VHF3-D/VHF392Q.Seq.d/ AACTCTCGAGTGCAAAA

  15. Dicty_cDB: VHF366 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF366 (Link to dictyBase) - - - Contig-U12131-1 | Contig-U13633-1 VHF3...66P (Link to Original site) VHF366F 590 VHF366Z 544 VHF366P 1114 - - Show VHF366 Library VH (Link to library) Clone ID VHF3...131-1 | Contig-U13633-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-C/VHF3...66Q.Seq.d/ Representative seq. ID VHF366P (Link to Original site) Representative DNA sequence >VHF366 (VHF3...66Q) /CSM/VH/VHF3-C/VHF366Q.Seq.d/ AATAATTTATTATTATTATTAATAAGTAATAGAAATAAAAGATGGAACCAATTCCAGATA

  16. Dicty_cDB: VHF310 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF310 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) - - VHF3...10Z 625 - - - - Show VHF310 Library VH (Link to library) Clone ID VHF310 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF310Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF310 (VHF310Q) /CSM/VH/VHF3-A/VHF310Q.Seq.d/ XXXXXXXXXXTCGTCAA...omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF310 (VHF310Q) /CSM/VH/VHF3-A/VHF3

  17. Dicty_cDB: VHF315 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF315 (Link to dictyBase) - G20600 DDB0169270 Contig-U12450-1 VHF3...15P (Link to Original site) VHF315F 216 VHF315Z 353 VHF315P 549 - - Show VHF315 Library VH (Link to library) Clone ID VHF3...ontig-U12450-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF3...15Q.Seq.d/ Representative seq. ID VHF315P (Link to Original site) Representative DNA sequence >VHF315 (VHF315Q) /CSM/VH/VHF3...-A/VHF315Q.Seq.d/ ATTAAAAAACTTCTTACTTGGACACCCCTTTTATATATATAAATAAAAACTTCTAAATAT AAATCCCA

  18. Dicty_cDB: VHF381 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF381 (Link to dictyBase) - - - Contig-U16508-1 - (Link to Original site) - - VHF3...81Z 645 - - - - Show VHF381 Library VH (Link to library) Clone ID VHF381 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF3-D/VHF381Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF381 (VHF381Q) /CSM/VH/VHF3-D/VHF381Q.Seq.d/ XXXXXXXXXXCAACCAA...ignments: (bits) Value VHF381 (VHF381Q) /CSM/VH/VHF3-D/VHF381Q.Seq.d/ 1223 0.0 VHP767 (VHP767Q) /CSM/VH/VHP7

  19. Dicty_cDB: VHF210 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF210 (Link to dictyBase) - - - Contig-U12400-1 | Contig-U16431-1 VHF...210P (Link to Original site) VHF210F 613 VHF210Z 636 VHF210P 1229 - - Show VHF210 Library VH (Link to library) Clone ID VHF...400-1 | Contig-U16431-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-A/VHF...210Q.Seq.d/ Representative seq. ID VHF210P (Link to Original site) Representative DNA sequence >VHF210 (VHF...210Q) /CSM/VH/VHF2-A/VHF210Q.Seq.d/ AATAAAATGATAAGATCATCAATAAAAAATAAAATAACAACAACAAAAAGTTTATCATGT

  20. Dicty_cDB: VHF575 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF575 (Link to dictyBase) - - - Contig-U15481-1 | Contig-U15981-1 VHF...575P (Link to Original site) VHF575F 586 VHF575Z 397 VHF575P 963 - - Show VHF575 Library VH (Link to library) Clone ID VHF...81-1 | Contig-U15981-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-D/VHF...575Q.Seq.d/ Representative seq. ID VHF575P (Link to Original site) Representative DNA sequence >VHF575 (VHF...575Q) /CSM/VH/VHF5-D/VHF575Q.Seq.d/ ATAATAATACAAAGAAGAAATGAAAAATATAAATAATAAAATTTTAAAGATTTTTATTCT

  1. Dicty_cDB: VHF296 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF296 (Link to dictyBase) - G23392 DDB0187414 Contig-U12449-1 VHF...296P (Link to Original site) VHF296F 241 VHF296Z 482 VHF296P 703 - - Show VHF296 Library VH (Link to library) Clone ID VHF...ontig-U12449-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-D/VHF...296Q.Seq.d/ Representative seq. ID VHF296P (Link to Original site) Representative DNA sequence >VHF296 (VHF296Q) /CSM/VH/VHF...2-D/VHF296Q.Seq.d/ GATTATCAGAAAGATTACATTATGAAATTATACCAGATTGTATTAAAATTATTGAAAGCT CAAAACAA

  2. Dicty_cDB: VHF436 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF436 (Link to dictyBase) - - - - VHF436P (Link to Original site) VHF436F 618 VHF...436Z 699 VHF436P 1297 - - Show VHF436 Library VH (Link to library) Clone ID VHF436 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF...4-B/VHF436Q.Seq.d/ Representative seq. ID VHF436P (Link to... Original site) Representative DNA sequence >VHF436 (VHF436Q) /CSM/VH/VHF4-B/VHF436Q.Seq.d/ AACTCTCGAGTGCAAA

  3. Dicty_cDB: VHF158 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF158 (Link to dictyBase) - - - - VHF158P (Link to Original site) VHF158F 608 VHF...158Z 693 VHF158P 1281 - - Show VHF158 Library VH (Link to library) Clone ID VHF158 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF...1-C/VHF158Q.Seq.d/ Representative seq. ID VHF158P (Link to... Original site) Representative DNA sequence >VHF158 (VHF158Q) /CSM/VH/VHF1-C/VHF158Q.Seq.d/ AACTCTCGAGTGCAAA

  4. Dicty_cDB: VHF847 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF847 (Link to dictyBase) - - - Contig-U15351-1 | Contig-U16514-1 VHF...847P (Link to Original site) VHF847F 478 VHF847Z 709 VHF847P 1167 - - Show VHF847 Library VH (Link to library) Clone ID VHF...351-1 | Contig-U16514-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF8-B/VHF...847Q.Seq.d/ Representative seq. ID VHF847P (Link to Original site) Representative DNA sequence >VHF847 (VHF...847Q) /CSM/VH/VHF8-B/VHF847Q.Seq.d/ TATGATGTTCCACTTATAATTCAAACGGTTGCCAATAATAAATCAACAAAACTCANTCTT

  5. Dicty_cDB: VHF272 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF272 (Link to dictyBase) - - - Contig-U15754-1 VHF272P (Link to Original site) VHF...272F 515 VHF272Z 603 VHF272P 1098 - - Show VHF272 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-C/VHF272Q.Seq.d/ Representative seq. ID VHF...272P (Link to Original site) Representative DNA sequence >VHF272 (VHF272Q) /CSM/VH/VHF2-C/VHF...id sequence (All Frames) Frame A: ixfssq**wnkkd*mihy*eiligrigvpm*vidngqlfvkimvvnhgptfhtimldhvh idgqrivlvdfvidfkifv*v*hf

  6. Study on Horizontally Polarized Omnidirectional Microstrip Antenna

    Directory of Open Access Journals (Sweden)

    Kun Wei

    2016-01-01

    Full Text Available A horizontally polarized omnidirectional microstrip antenna is proposed in this paper. The structure of designed antenna is with two back-to-back horizontally polarized microstrip antenna elements. Gain variation on main radiation plane of this new antenna is analyzed and radiation theory is deduced; formula of directivity on main radiation plane is given. Better omnidirectional characteristic of this antenna can be obtained by decreasing patch physical length. Both simulated and measured results verify the omnidirectional radiation patterns and input impedance characteristics. Good omnidirectional radiation patterns (gain variation in E-plane less than ±0.4 dBi and input impedance characteristics are obtained; moreover, cross polarization less than −20 dBi is achieved.

  7. Anechoic chamber for VHF and UHF bands

    Science.gov (United States)

    Morikawa, Takao; Sugiura, Akira; Harima, Katsushige; Masuzawa, Hiroshi

    1995-06-01

    Built in 1969, the anechoic chamber of CRL has been used to the fullest by researchers in many fields such as EMI, EMC, antenna design, standard of electric field intensity, and type approval testing. In particular, in the early days of space development in Japan, many satellite-born antennas were developed in this anechoic chamber. However, a quarter of a century has passed since its construction and deteriorated performance due to superannuation sometimes caused difficulties in experiments conducted in the chamber. In 1993, CRL constructed a Measuring Facility for Radio Research (MFRR) and the anechoic chamber for VHF-UHF bands was remodeled as one of the sub-facilities of MFRR. The remodeling work included full replacement of the electromagnetic shielding, absorbers and measurement system. Since the remodeled anechoic chamber is being used not only for EMI tests but also for other purposes, a full-anechoic chamber has been adopted. In addition the chamber has been designed for the frequency range between 30 MHz and 10 GHz. After the remodeling work, the performance of the chamber is greatly improved. The average shielding factor is better than 85 dB for all frequency ranges and the unwanted reflection characteristic is -30 dB for frequencies above 1 GHZ. This paper summarizes the remodeling work, and the specifications and performance of the remodeled anechoic chamber.

  8. A system for mapping sources of VHF and electric field pulses from in-cloud lightning at KSC

    Science.gov (United States)

    Thomson, Ewen M.; Medelius, Pedro J.

    1991-01-01

    The literature concerning VHF radiation and wideband electric fields from in-cloud lightning is reviewed. VHF location systems give impressive radio images of lightning in clouds with high spatial and temporal resolution. Using systems based on long and short baseline time-or-arrival and interferometry, workers have detected VHF sources that move at speeds of 10(exp 5) to 10(exp 8) m/s. The more slowly moving sources appear to be associated with channel formation but the physical basis for the higher speeds is not clear. In contrast, wideband electric fields are directly related to physical parameters such as current and tortuosity. A long baseline system is described to measure simultaneously VHF radiation and wideband electric fields at five stations at Kennedy Space Center. All signals are detected over remote, isolated ground planes with fiber optics for data transmission. The modification of this system to map rapidly varying dE/dt pulses is discussed.

  9. Human tracking with thermal omnidirectional vision

    Science.gov (United States)

    Tang, Y.; Li, Y. F.; Chen, H.

    2011-12-01

    In this paper, we explore a new tracking system for human tracking in thermal catadioptric omnidirectional vision. Due to very limited features can be adopted in thermal image except for contour information, we proposed to use Histogram of Oriented Gradient (HOG) feature to represent the contour information and employ Support Vector Machine (SVM) to classify the foreground and background. In this paper, there are three novel points. First, the classification posterior probability of SVM will be adopted to relate the observation likelihood of particle filter to guide the particles for tracking purpose instead of neglect in previous tracking method. Second, due to no existing thermal catadioptric omnidirectional vision database available in public, a thermal catadioptric omnidirectional video database and extracted human samples have been established for academic studies. Third, tracking window distribution of particle filter has been adjusted to fit the characteristic of catadioptric omnidirectional vision on account of the size of target in image is varying when the distance between target and omni-sensor changed in world coordinate. In addition, the catadioptric omnidirectional imaging is different with traditional imaging for inherent distortion, so the polar coordinate will be used. The experimental results show that the proposed tracking approach has a stable performance.

  10. Omnidirectional free-space optical receiver architecture

    Science.gov (United States)

    Murshid, Syed H.; Lovell, Gregory L.; Finch, Michael F.

    2013-05-01

    Free Space Optical (FSO) communication is the fusion of wireless technology and optical fiber communications systems. It has the potential of providing fiber optic data rates without the physical restraints of optical fiber cables. This endeavor presents a novel receiver structure with potential for omnidirectional free space optical communications. Interesting approaches for accomplishing omnidirectional free space lasercomm such as direct detection and solar blind non-line of sight UV scattering have been reported over the last few years. However, these technologies have resulted in limited distances of the order of 10 to 100 meters and data rates often limited to less than 1 Mb/s. This endeavor reports the architecture of an omnidirectional receiver setup by integrating an off the shelf detector and a fiber bundle, where the fiber bundle couples omnidirectional photons within its field of view and delivers these photons to the detector. The coupling of light from all directions into a detector is regulated by the cone of the acceptance angle of the fiber. Multiple fibers with overlapping acceptance angles provide the necessary coverage that may be needed to extract the optical signal from the free space optical channel. Simulated results showing the normalized power pattern of the system is presented to demonstrate omnidirectional potential of the structure. Theoretical power level versus distance plot for an FSO System employing On-O Keying (OOK) is also presented.

  11. Polarized radio emission and radio wavefront shape of extensive air showers

    NARCIS (Netherlands)

    Corstanje, A.; Buitink, S.; Enriquez, J. E.; Falcke, H.; Hörandel, J. R.; Nelles, A.; Rachen, J. P.; Rossetto, L.; Schellart, P.; Scholten, O.; Ter Veen, S.; Thoudam, S.; Trinh, T. N G

    2015-01-01

    The LOFAR radio telescope located in the north of the Netherlands offers a high density of omnidirectional radio antennas. The LOFAR key science project Cosmic Rays is therefore well suited for detailed studies of the radio signal from air showers, and has been measuring since mid-2011 at primary

  12. Big Crunch-based omnidirectional light concentrators

    CERN Document Server

    Smolyaninov, Igor I

    2014-01-01

    Omnidirectional light concentration remains an unsolved problem despite such important practical applications as design of efficient mobile photovoltaic cells. Optical black hole designs developed recently offer partial solution to this problem. However, even these solutions are not truly omnidirectional since they do not exhibit a horizon, and at large enough incidence angles light may be trapped into quasi-stationary orbits around such imperfect optical black holes. Here we propose and realize experimentally another gravity-inspired design of a broadband omnidirectional light concentrator based on the cosmological Big Crunch solutions. By mimicking the Big Crunch spacetime via corresponding effective optical metric we make sure that every photon world line terminates in a single point.

  13. Robust radial face detection for omnidirectional vision.

    Science.gov (United States)

    Dupuis, Yohan; Savatier, Xavier; Ertaud, Jean-Yves; Vasseur, Pascal

    2013-05-01

    Bio-inspired and non-conventional vision systems are highly researched topics. Among them, omnidirectional vision systems have demonstrated their ability to significantly improve the geometrical interpretation of scenes. However, few researchers have investigated how to perform object detection with such systems. The existing approaches require a geometrical transformation prior to the interpretation of the picture. In this paper, we investigate what must be taken into account and how to process omnidirectional images provided by the sensor. We focus our research on face detection and highlight the fact that particular attention should be paid to the descriptors in order to successfully perform face detection on omnidirectional images. We demonstrate that this choice is critical to obtaining high detection rates. Our results imply that the adaptation of existing object-detection frameworks, designed for perspective images, should be focused on the choice of appropriate image descriptors in the design of the object-detection pipeline.

  14. An omnidirectional camera simulation for the USARSim world

    NARCIS (Netherlands)

    Schmits, T.; Visser, A.

    2009-01-01

    Omnidirectional vision is currently an important sensor in robotic research. The catadioptric omnidirectional camera with a hyperbolic convex mirror is a common omnidirectional vision system in the robotics research field as it has many advantages over other vision systems. This paper describes the

  15. Vertically Polarized Omnidirectional Printed Slot Loop Antenna

    DEFF Research Database (Denmark)

    Kammersgaard, Nikolaj Peter Iversen; Kvist, Søren H.; Thaysen, Jesper

    2015-01-01

    A novel vertically polarized omnidirectional printed slot loop antenna has been designed, simulated, fabricated and measured. The slot loop works as a magnetic loop. The loop is loaded with inductors to insure uniform and in-phase fields in the slot in order to obtain an omnidirectional radiation...... pattern. The antenna is designed for the 2.45 GHz Industrial, Scientific and Medical band. Applications of the antenna are many. One is for on-body applications since it is ideal for launching a creeping waves due to the polarization....

  16. Omnidirectional Active Vision for Evolutionary Car Driving

    OpenAIRE

    Suzuki, Mototaka; van der Blij, Jacob; Floreano, Dario

    2006-01-01

    We describe a set of simulations to evolve omnidirectional active vision, an artificial retina scanning over images taken via an omnidirectional camera, being applied to a car driving task. While the retina can immediately access features in any direction, it is asked to select behaviorally-relevant features so as to drive the car on the road. Neural controllers which direct both the retinal movement and the system behavior, i.e., the speed and the steering angle of the car, are tested in thr...

  17. Miniaturization for ultrathin metamaterial perfect absorber in the VHF band

    Science.gov (United States)

    Khuyen, Bui Xuan; Tung, Bui Son; Yoo, Young Joon; Kim, Young Ju; Kim, Ki Won; Chen, Liang-Yao; Lam, Vu Dinh; Lee, Youngpak

    2017-03-01

    An efficient resolution for ultrathin metamaterial perfect absorber (MPA) is proposed and demonstrated in the VHF radio band (30-300 MHz). By adjusting the lumped capacitors and the through vertical interconnects, the absorber is miniaturized to be only λ/816 and λ/84 for its thickness and periodicity with respect to the operating wavelength (at 102 MHz), respectively. The detailed simulation and calculation show that the MPA can maintain an absorption rate over 90% in a certain range of incident angle and with a wide variation of capacitance. Additionally, we utilized the advantages of the initial single-band structure to realize a nearly perfect dual-band absorber in the same range. The results were confirmed by both simulation and experiment at oblique incidence angles up to 50°. Our work is expected to contribute to the actualization of future metamaterial-based devices working at radio frequency.

  18. Low Cost Antennas for Direct Broadcast Satellite Radio

    Science.gov (United States)

    Wu, T. K.; Huang, J.

    1994-01-01

    Two omni-directional and circularly polarized low gain antennas (the crossed drooping dipole and the TM(sub 21) mode circular patch antenna)are developed for direct broadcast satellite radio (DBSR) outdoor mobile terminal applications.

  19. Omnidirectional Structured Light in a Flexible Configuration

    Directory of Open Access Journals (Sweden)

    Luis Puig

    2013-10-01

    Full Text Available Structured light is a perception method that allows us to obtain 3D information from images of the scene by projecting synthetic features with a light emitter. Traditionally, this method considers a rigid configuration, where the position and orientation of the light emitter with respect to the camera are known and calibrated beforehand. In this paper we propose a new omnidirectional structured light system in flexible configuration, which overcomes the rigidness of the traditional structured light systems. We propose the use of an omnidirectional camera combined with a conic pattern light emitter. Since the light emitter is visible in the omnidirectional image, the computation of its location is possible. With this information and the projected conic in the omnidirectional image, we are able to compute the conic reconstruction, i.e., the 3D information of the conic in the space. This reconstruction considers the recovery of the depth and orientation of the scene surface where the conic pattern is projected. One application of our proposed structured light system in flexible configuration consists of a wearable omnicamera with a low-cost laser in hand for visual impaired personal assistance.

  20. Perfectly Reflectionless Omnidirectional Absorbers and Electromagnetic Horizons

    OpenAIRE

    Sainath, Kamalesh; Teixeira, Fernando L.

    2014-01-01

    We demonstrate the existence of metamaterial blueprints describing, and fundamental limitations concerning, perfectly reflectionless omnidirectional electromagnetic absorbers (PR-OEMA). Previous attempts to define PR-OEMA blueprints have led to active (gain), rather than passive, media. We explain this fact and unveil new, distinct limitations of true PR-OEMA devices, including the appearance of an "electromagnetic horizon" on physical solutions. As practical alternatives we introduce alterna...

  1. Dicty_cDB: VHF476 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uences producing significant alignments: (bits) Value VHF476 (VHF476Q) /CSM/VH/VHF4-D/VHF476Q.Seq.d/ 198 2e-...46 own update 2003.10.17 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value...e 2008.10.29 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value (Q54AX5) R

  2. Structure, optical properties and thermal stability of HfErO films deposited by simultaneous RF and VHF magnetron sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, H.Y. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Nanjing University of Posts and Telecommunications, School of Tongda, Nanjing (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); He, H.J.; Zhang, Z.; Jin, C.G.; Yang, Y.; Wang, Y.Y.; Ye, C. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Zhuge, L.J. [Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Soochow University, Analysis and Testing Center, Suzhou (China); Wu, X.M. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Chinese Academy of Sciences, State Key Laboratory of Functional Materials for Informatics, Shanghai Institute of Microsystem and Information Technology, Shanghai (China)

    2015-01-23

    HfErO films are deposited on Si substrates by simultaneous radio frequency (RF) and very high frequency (VHF) magnetron sputtering technique. The content of the doped ingredient of Er and the body composition of HfO{sub x} are, respectively, controlled through the VHF and RF powers. Low content of Er doping in the HfErO films can be achieved, because the VHF source of 27.12 MHz has higher ion energy and lower ion flux than the RF source resulting in low sputtering rate in the magnetron sputtering system. The structure, optical properties and thermal stability of the HfErO films are investigated in this work. Results show that the doped content of Er is independently controlled by the VHF power. The oxygen vacancies are created by the Er incorporation. The hafnium in the HfErO films forms mixed valence of Hf{sup 2+} and Hf{sup 4+}. The HfErO films are composed with the structures of HfO{sub 2}, HfO and ErO{sub x}, which can be optimized through the VHF power. At high VHF power, the Hf-Er-O bonds are formed, which demonstrates that the Er atoms are doped into the lattice of HfO{sub 2} in the HfErO films. The HfErO films have bad thermal stability as the crystallization temperature decreases from 900 to 800 C. After thermal annealing, cubic phase of HfO{sub 2} are stabilized, which is ascribed to the oxygen vacancies creation by the Er incorporation. The optical properties such as the refractive index and the optical band gap of the HfErO films are optimized by the VHF power. (orig.)

  3. Testing VHF/GPS collar design and safety in the study of free-roaming horses.

    Directory of Open Access Journals (Sweden)

    Gail H Collins

    Full Text Available Effective and safe monitoring techniques are needed by U.S. land managers to understand free-roaming horse behavior and habitat use and to aid in making informed management decisions. Global positioning system (GPS and very high frequency (VHF radio collars can be used to provide high spatial and temporal resolution information for detecting free-roaming horse movement. GPS and VHF collars are a common tool used in wildlife management, but have rarely been used for free-roaming horse research and monitoring in the United States. The purpose of this study was to evaluate the design, safety, and detachment device on GPS/VHF collars used to collect free-roaming horse location and movement data. Between 2009 and 2010, 28 domestic and feral horses were marked with commercial and custom designed VHF/GPS collars. Individual horses were evaluated for damage caused by the collar placement, and following initial observations, collar design was modified to reduce the potential for injury. After collar modifications, which included the addition of collar length adjustments to both sides of the collar allowing for better alignment of collar and neck shapes, adding foam padding to the custom collars to replicate the commercial collar foam padding, and repositioning the detachment device to reduce wear along the jowl, we observed little to no evidence of collar wear on horses. Neither custom-built nor commercial collars caused injury to study horses, however, most of the custom-built collars failed to collect data. During the evaluation of collar detachment devices, we had an 89% success rate of collar devices detaching correctly. This study showed that free-roaming horses can be safely marked with GPS and/or VHF collars with minimal risk of injury, and that these collars can be a useful tool for monitoring horses without creating a risk to horse health and wellness.

  4. A color based rangefinder for an omnidirectional camera

    NARCIS (Netherlands)

    Nguyen, Q.; Visser, A.; Balakirsky, S.; Carpin, S.; Lewis, M.

    2009-01-01

    This paper proposes a method to use the omnidirectional camera as a rangefinder by using color detection. The omnicam rangefinder has been tested in USARSim for its accuracy and for its practical use to build maps of the environment. The results of the test shows that an omnidirectional camera can

  5. Validation of Emulated Omnidirectional Antenna Output Using Directive Antenna Data

    DEFF Research Database (Denmark)

    Hejselbæk, Johannes; Karstensen, Anders; Nielsen, Jesper Ødum

    2017-01-01

    In this paper, we present validation of a method for constructing a virtual omnidirectional antenna in the azimuth plane. The virtual omnidirectional antenna utilizes a combination of data from directive horn antennas. The aim is to utilize the high gain of the horn antenna to improve the dynamic...... range of channel sounding measurements conducted in the centimeter and millimeter wave bands. The resulting complex impulse response from the virtual omnidirectional antenna is used to find the power-delay-profile (PDP). This is then compared to measurements conducted at the same time using a real...... omnidirectional antenna. The validation shows that the synthesized omnidirectional is capable of predicting main components and the slope of the PDP. Further, it is shown that by choosing angular sampling steps corresponding to the half power beam width (HPBW) of the used antenna similar power levels can...

  6. 47 CFR 80.911 - VHF transmitter.

    Science.gov (United States)

    2010-10-01

    ... MARITIME SERVICES Compulsory Radiotelephone Installations for Small Passenger Boats § 80.911 VHF..., measured at the power input terminals to the transmitter, and the output power of the transmitter, terminated in a matching artificial load, must be measured at the end of 10 minutes of continuous operation...

  7. An omnidirectional electromagnetic absorber made of metamaterials

    Energy Technology Data Exchange (ETDEWEB)

    Cheng Qiang; Cui Tiejun; Jiang Weixiang; Cai Bengeng, E-mail: tjcui@seu.edu.c [State Key Laboratory of Millimeter Waves, Department of Radio Engineering, Southeast University, Nanjing 210096 (China)

    2010-06-15

    In a recent theoretical work by Narimanov and Kildishev (2009 Appl. Phys. Lett. 95 041106) an optical omnidirectional light absorber based on metamaterials was proposed, in which theoretical analysis and numerical simulations showed that all optical waves hitting the absorber are trapped and absorbed. Here we report the first experimental demonstration of an omnidirectional electromagnetic absorber in the microwave frequency. The proposed device is composed of non-resonant and resonant metamaterial structures, which can trap and absorb electromagnetic waves coming from all directions spirally inwards without any reflections due to the local control of electromagnetic fields. It is shown that the absorption rate can reach 99 per cent in the microwave frequency. The all-directional full absorption property makes the device behave like an 'electromagnetic black body', and the wave trapping and absorbing properties simulate, to some extent, an 'electromagnetic black hole.' We expect that such a device could be used as a thermal emitting source and to harvest electromagnetic waves.

  8. Disturbances in VHF/UHF telemetry links as a possible effect of the 2003 Hokkaido Tokachi-oki earthquake

    Directory of Open Access Journals (Sweden)

    H. Nagamoto

    2008-08-01

    Full Text Available The data on radio telemetry links (for water information at VHF/UHF in Hokkaido are used to investigate the rate of disturbances on radio links (or connection failure and its association with a huge earthquake, Tokachi-oki earthquake on 26 September 2003. Especially, the telemetry links at the Tokachi region closest to the earthquake epicenter, showed a significant increase in disturbances on radio links two weeks to a few days before the earthquake on the basis of analysis during a long interval from 1 June 2002 to 3 November 2007 (over 5 years. We suggest that these severe disturbances in VHF/UHF telemetry links are attributed to the generation of seismogenic VHF/UHF radio noises (emissions. Based on this idea, we have estimated that the intensity of these seismogenic emissions is on the order of 10–19 dB μV/m. Finally, the present result was compared with other physical parameters already obtained for this earthquake.

  9. Discontinuity minimization for omnidirectional video projections

    Science.gov (United States)

    Alshina, Elena; Zakharchenko, Vladyslav

    2017-09-01

    Advances in display technologies both for head mounted devices and television panels demand resolution increase beyond 4K for source signal in virtual reality video streaming applications. This poses a problem of content delivery trough a bandwidth limited distribution networks. Considering a fact that source signal covers entire surrounding space investigation reviled that compression efficiency may fluctuate 40% in average depending on origin selection at the conversion stage from 3D space to 2D projection. Based on these knowledge the origin selection algorithm for video compression applications has been proposed. Using discontinuity entropy minimization function projection origin rotation may be defined to provide optimal compression results. Outcome of this research may be applied across various video compression solutions for omnidirectional content.

  10. Dicty_cDB: VHF729 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ences producing significant alignments: (bits) Value VHF729 (VHF729Q) /CSM/VH/VHF...4-A/CHC421Q.Seq.d/ 139 9e-33 own update 2002.12.27 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value... 139 2e-29 1 dna update 2008.10.31 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value

  11. From ultrafast spectroscopy to bidirectional molecular switches: DHA/VHF

    Science.gov (United States)

    Schmidhammer, U.; De Waele, V.; Buntinx, G.; Riedle, E.

    The photoconversion from dihydroazulene (DHA) to vinylheptafulvene (VHF) is governed by two mechanisms: The ring opening proceeds on the excited energy surface on the picosecond time scale. It is followed by an intemal conversion to the VHF ground state that is accelerated by the presence of a conical intersection in the case of cyclopenta-DHA. This conical intersection hinders the photoinduced back reaction from the final VHF products. However, we successfully photoconverted the cyanophenyl-VHF-cis back to the DHA with a second delayed pulse. This opens the route to the development of bistable DHAs.

  12. ULYSSES JUPITER EPAC OMNI-DIRECTIONAL ELECTRON FLUX

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set contains Ulysses Energetic Particle Composition Experiment (EPAC) 1 hour averaged omni-directional electron flux data from the Ulysses Jupiter...

  13. Forming and detection of digital watermarks in the System for Automatic Identification of VHF Transmissions

    Directory of Open Access Journals (Sweden)

    О. В. Шишкін

    2013-07-01

    Full Text Available Forming and detection algorithms for digital watermarks are designed for automatic identification of VHF radiotelephone transmissions in the maritime and aeronautical mobile services. An audible insensitivity and interference resistance of embedded digital data are provided by means of OFDM technology jointly with normalized distortions distribution and data packet detection by the hash-function. Experiments were carried out on the base of ship’s radio station RT-2048 Sailor and USB ADC-DAC module of type Е14-140M L-CARD in the off-line processing regime in Matlab medium

  14. Dicty_cDB: VHF823 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uences producing significant alignments: (bits) Value VHF823 (VHF823Q) /CSM/VH/VH...186Q.Seq.d/ 86 1e-16 own update 2009. 4. 4 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value...-13 1 dna update 2008.10.31 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value

  15. Lane Tracking with Omnidirectional Cameras: Algorithms and Evaluation

    Directory of Open Access Journals (Sweden)

    Cheng ShinkoYuanhsien

    2007-01-01

    Full Text Available With a panoramic view of the scene, a single omnidirectional camera can monitor the 360-degree surround of the vehicle or monitor the interior and exterior of the vehicle at the same time. We investigate problems associated with integrating driver assistance functionalities that have been designed for rectilinear cameras with a single omnidirectional camera instead. Specifically, omnidirectional cameras have been shown effective in determining head gaze orientation from within a vehicle. We examine the issues involved in integrating lane tracking functions using the same omnidirectional camera, which provide a view of both the driver and the road ahead of the vehicle. We present analysis on the impact of the omnidirectional camera's reduced image resolution on lane tracking accuracy, as a consequence of gaining the expansive view. And to do so, we present Omni-VioLET, a modified implementation of the vision-based lane estimation and tracking system (VioLET, and conduct a systematic performance evaluation of both lane-trackers operating on monocular rectilinear images and omnidirectional images. We are able to show a performance comparison of the lane tracking from Omni-VioLET and Recti-VioLET with ground truth using images captured along the same freeway road in a specified course. The results are surprising: with 1/10th the number of pixels representing the same space and about 1/3rd the horizontal image resolution as a rectilinear image of the same road, the omnidirectional camera implementation results in only three times the amount the mean absolute error in tracking the left lane boundary position.

  16. Lane Tracking with Omnidirectional Cameras: Algorithms and Evaluation

    Directory of Open Access Journals (Sweden)

    Shinko Yuanhsien Cheng

    2007-09-01

    Full Text Available With a panoramic view of the scene, a single omnidirectional camera can monitor the 360-degree surround of the vehicle or monitor the interior and exterior of the vehicle at the same time. We investigate problems associated with integrating driver assistance functionalities that have been designed for rectilinear cameras with a single omnidirectional camera instead. Specifically, omnidirectional cameras have been shown effective in determining head gaze orientation from within a vehicle. We examine the issues involved in integrating lane tracking functions using the same omnidirectional camera, which provide a view of both the driver and the road ahead of the vehicle. We present analysis on the impact of the omnidirectional camera's reduced image resolution on lane tracking accuracy, as a consequence of gaining the expansive view. And to do so, we present Omni-VioLET, a modified implementation of the vision-based lane estimation and tracking system (VioLET, and conduct a systematic performance evaluation of both lane-trackers operating on monocular rectilinear images and omnidirectional images. We are able to show a performance comparison of the lane tracking from Omni-VioLET and Recti-VioLET with ground truth using images captured along the same freeway road in a specified course. The results are surprising: with 1/10th the number of pixels representing the same space and about 1/3rd the horizontal image resolution as a rectilinear image of the same road, the omnidirectional camera implementation results in only three times the amount the mean absolute error in tracking the left lane boundary position.

  17. Kajian implementasi radio siaran digital di Indonesia [Study of digital radio broadcasting implementation in Indonesia

    Directory of Open Access Journals (Sweden)

    Amry Daulat Gultom

    2015-12-01

    Full Text Available Peraturan Menteri Komunikasi dan Informatika RI nomor 21 tahun 2009 tentang  Standar Penyiaran Digital Untuk Penyiaran Radio pada Pita VHF di Indonesia menyatakan bahwa dalam rangka mengatasi permasalahan penggunaan frekuensi VHF Band II untuk penyiaran radio FM yang tidak sesuai dengan rencana induk, serta tidak terpenuhinya permohonan untuk penggunaan kanal frekuensi dari masyarakat, maka perlu dicarikan saluran siaran alternatif dengan menggunakan sistem penyiaran radio digital standard DAB Family. Hingga saat ini belum ada perkembangan berarti terkait implementasinya, sehingga perlu dilakukan penelitian untuk mengetahui potensi radio siaran digital, kesiapan dari sisi pemerintah, operator, dan masyarakat, dan kendala yang dihadapi serta merumuskan strategi yang akan digunakan mengatasinya. Metode analisis yang digunakan adalah SWOT dan TOWS kualitatif dari data wawancara dan studi literatur. Hasil penelitian menunjukkan bahwa pihak stasiun radio sudah siap terhadap digitalisasi radio siaran, pihak pemerintah belum begitu siap karena belum adanya regulasi pendukung Permen Kominfo tentang standard radio digital, dan masyarakat juga belum siap karena kurangnya sosialisasi dan masih susah didapatkannya perangkat penerima siaran radio digital. Pengintegrasian penerima siaran radio digital pada kendaraan bermotor roda empat dan telepon genggam yang baru dapat meningkatkan keberadaan perangkat penerima siaran radio digital.*****The Minister of Communication and Information Regulation number 21 of 2009 on Digital Broadcasting Standards for VHF Band Radio Broadcasting in Indonesia stated that in order to overcome the problems of VHF Band II frequency utilization for FM radio broadcasting that is not in accordance with the master plan, as well as non-fulfillment of the request for frequency channels utilization of the society, neeed to find alternative broadcast channel by DAB Family digital radio broadcasting system. Until now there has no

  18. Omnidirectional Underwater Camera Design and Calibration

    Directory of Open Access Journals (Sweden)

    Josep Bosch

    2015-03-01

    Full Text Available This paper presents the development of an underwater omnidirectional multi-camera system (OMS based on a commercially available six-camera system, originally designed for land applications. A full calibration method is presented for the estimation of both the intrinsic and extrinsic parameters, which is able to cope with wide-angle lenses and non-overlapping cameras simultaneously. This method is valid for any OMS in both land or water applications. For underwater use, a customized housing is required, which often leads to strong image distortion due to refraction among the different media. This phenomena makes the basic pinhole camera model invalid for underwater cameras, especially when using wide-angle lenses, and requires the explicit modeling of the individual optical rays. To address this problem, a ray tracing approach has been adopted to create a field-of-view (FOV simulator for underwater cameras. The simulator allows for the testing of different housing geometries and optics for the cameras to ensure a complete hemisphere coverage in underwater operation. This paper describes the design and testing of a compact custom housing for a commercial off-the-shelf OMS camera (Ladybug 3 and presents the first results of its use. A proposed three-stage calibration process allows for the estimation of all of the relevant camera parameters. Experimental results are presented, which illustrate the performance of the calibration method and validate the approach.

  19. Material Testing for Robotic Omnidirectional Anchor

    Science.gov (United States)

    Witkoe, Kevin S.

    2012-01-01

    To successfully explore near-Earth Asteroids the question of mobility emerges as the key issue for any robotic mission. When small bodies have extremely low escape velocities, traditional methods, such as wheels, would send the robot hurtling off of the asteroid's surface. To solve this problem, JPL has developed an omni-directional anchoring mechanism for use in microgravity that utilizes microspine technology. These microspines are placed in circular arrays with 16 independent carriages biasing the surface of the rock. The asperities in the surface allow the gripper to hold nearly 150N in all directions. While the gripper has been proven successful on consolidated rocks, it had yet to be tested on a variety of other surfaces that are suspected to separate the large boulders on an asteroid. Since asteroid surfaces vary widely, from friable rocks to lose ponds of regolith, the gripper was tested in a large variety of materials such as, bonded pumice, sand, gravel, and loose rocks. The forces are applied tangent, at 45 degrees, and normal to the surface of the material. The immediate results from this experiment will give insight into the gripper's effectiveness across the wide spectrum of materials found on asteroids.

  20. Omnidirectional Underwater Camera Design and Calibration

    Science.gov (United States)

    Bosch, Josep; Gracias, Nuno; Ridao, Pere; Ribas, David

    2015-01-01

    This paper presents the development of an underwater omnidirectional multi-camera system (OMS) based on a commercially available six-camera system, originally designed for land applications. A full calibration method is presented for the estimation of both the intrinsic and extrinsic parameters, which is able to cope with wide-angle lenses and non-overlapping cameras simultaneously. This method is valid for any OMS in both land or water applications. For underwater use, a customized housing is required, which often leads to strong image distortion due to refraction among the different media. This phenomena makes the basic pinhole camera model invalid for underwater cameras, especially when using wide-angle lenses, and requires the explicit modeling of the individual optical rays. To address this problem, a ray tracing approach has been adopted to create a field-of-view (FOV) simulator for underwater cameras. The simulator allows for the testing of different housing geometries and optics for the cameras to ensure a complete hemisphere coverage in underwater operation. This paper describes the design and testing of a compact custom housing for a commercial off-the-shelf OMS camera (Ladybug 3) and presents the first results of its use. A proposed three-stage calibration process allows for the estimation of all of the relevant camera parameters. Experimental results are presented, which illustrate the performance of the calibration method and validate the approach. PMID:25774707

  1. A Reconfigurable Omnidirectional Soft Robot Based on Caterpillar Locomotion.

    Science.gov (United States)

    Zou, Jun; Lin, Yangqiao; Ji, Chen; Yang, Huayong

    2018-01-03

    A pneumatically powered, reconfigurable omnidirectional soft robot based on caterpillar locomotion is described. The robot is composed of nine modules arranged as a three by three matrix and the length of this matrix is 154 mm. The robot propagates a traveling wave inspired by caterpillar locomotion, and it has all three degrees of freedom on a plane (X, Y, and rotation). The speed of the robot is about 18.5 m/h (two body lengths per minute) and it can rotate at a speed of 1.63°/s. The modules have neodymium-iron-boron (NdFeB) magnets embedded and can be easily replaced or combined into other configurations. Two different configurations are presented to demonstrate the possibilities of the modular structure: (1) by removing some modules, the omnidirectional robot can be reassembled into a form that can crawl in a pipe and (2) two omnidirectional robots can crawl close to each other and be assembled automatically into a bigger omnidirectional robot. Omnidirectional motion is important for soft robots to explore unstructured environments. The modular structure gives the soft robot the ability to cope with the challenges of different environments and tasks.

  2. Helicopter blades running elevation measurement using omnidirectional vision

    Directory of Open Access Journals (Sweden)

    Chengtao CAI

    2017-12-01

    Full Text Available Omnidirectional dynamic space parameters of high-speed rotating helicopter blades are precise 3D vector description of the blades. In particular, the elevation difference is directly related to the aerodynamic performance and maneuverability of the helicopter. The state of the art detection techniques based on optics and common vision have several drawbacks, such as high demands on devices but poor extensibility, limited measurement range and fixed measurement position. In this paper, a novel approach of helicopter blades running elevation measurement is proposed based on omnidirectional vision. With the advantages of panoramic visual imaging integration, 360° field of view and rotation in-variance, high-resolution images of all rotating blades positions are obtained at one time. By studying the non-linear calibration and calculation model of omnidirectional vision system, aiming at solving the problem of inaccurate visual space mapping model, the omnidirectional and full-scale measurement of the elevation difference are finalized. Experiments are carried out on our multifunctional simulation blades test system and the practical blades test tower, respectively. The experimental results demonstrate the effectiveness of the proposed method and show that the proposed method can considerably reduce the complexity of measurement. Keywords: Full-scale measurement, Helicopter blades elevation, Non-linear calibration, Omnidirectional vision, Unified sphere model

  3. Analysis of the VHF-UHF electromagnetic radiation of lightning: Application to a model of the negative stepped leader propagation

    Science.gov (United States)

    Taudiere, Isabelle

    1991-03-01

    The space and time characteristics of the VHF-UHF radiation from lightning are analyzed on the bases of 300 MHz emission sources, localized in three dimensions by interferometric measurements. The main phases that contribute to the development of intracloud lightning are examined in detail, also using electric field measurements at the lower frequency. This research is complemented by an experimental and theoretical analysis of long discharge (8m) radio emissions generated with both polarities in the laboratory. These investigations revealed that the VHF radiation is associated with the channel reillumination phase accompanying each step in the negative spark. The outcome of this work is the creation of a simple model for the propagation of the negative leader. The current and the radiated field during this phase of the discharge are computed from an equivalent electric circuit using the physical laws governing the variation of resistance. The extrapolation of these results to the case of the stepped leader of natural lightning is discussed.

  4. Communications Tests with Tactical Radios in a Large Urban Area.

    Science.gov (United States)

    1981-07-01

    side if necesary and identify by block number) Military Operations in Built-Up Areas ( MOBA ) CH16S Communications Tactical Radios VHF 20. ADST14ACT...complete netting of tactical radios under MOBA conditions. These tests are planned for the spring of 1981. 4 COMMUNICATIONS TESTS WITH TkCTICAL RADIOS IN A...Areas ( MOBA ) was initi- ated by the US Army Human Engineering Laboratory (USAHEL) as part of their MOBA Lead Laboratory responsibility after a search of

  5. Dicty_cDB: VHF145 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF145 (Link to dictyBase) - - - Contig-U15430-1 VHF145E (Link...) Clone ID VHF145 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15430-1 Ori...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116984 |AC116984.2 Dictyos... theta DNA for complete sequence of nucleomorph chromosome 2. 48 2e-07 2 ES451909 | PREDICTED: similar to PI...al 16.0 %: nuclear 8.0 %: vacuolar 8.0 %: endoplasmic reticulum 4.0 %: cytoskeletal >> prediction for VHF145

  6. Broadband Grounded Vertical Antennas for 30-180 MHZ (VHF)

    Science.gov (United States)

    2013-10-18

    antennas are well known for their broadband gain (monocone, bicone ) but are never combined with a monopole. An eccentric combination of broadband...DATES COVERED 00-00-2014 to 00-00-2014 4. TITLE AND SUBTITLE Broadband Grounded Vertical Antennas For 30-180 MZH (VHF) 5a. CONTRACT NUMBER 5b...18 Attorney Docket No. 102536 1 of 17 BROADBAND GROUNDED VERTICAL ANTENNAS FOR 30-180 MHZ (VHF) STATEMENT OF GOVERNMENT INTEREST

  7. Stereo Calibration and Rectification for Omnidirectional Multi-Camera Systems

    Directory of Open Access Journals (Sweden)

    Yanchang Wang

    2012-10-01

    Full Text Available Stereo vision has been studied for decades as a fundamental problem in the field of computer vision. In recent years, computer vision and image processing with a large field of view, especially using omnidirectional vision and panoramic images, has been receiving increasing attention. An important problem for stereo vision is calibration. Although various kinds of calibration methods for omnidirectional cameras are proposed, most of them are limited to calibrate catadioptric cameras or fish-eye cameras and cannot be applied directly to multi-camera systems. In this work, we propose an easy calibration method with closed-form initialization and iterative optimization for omnidirectional multi-camera systems. The method only requires image pairs of the 2D target plane in a few different views. A method based on the spherical camera model is also proposed for rectifying omnidirectional stereo pairs. Using real data captured by Ladybug3, we carry out some experiments, including stereo calibration, rectification and 3D reconstruction. Statistical analyses and comparisons of the experimental results are also presented. As the experimental results show, the calibration results are precise and the effect of rectification is promising.

  8. An omnidirectional 3D sensor with line laser scanning

    Science.gov (United States)

    Xu, Jing; Gao, Bingtuan; Liu, Chuande; Wang, Peng; Gao, Shuanglei

    2016-09-01

    An active omnidirectional vision owns the advantages of the wide field of view (FOV) imaging, resulting in an entire 3D environment scene, which is promising in the field of robot navigation. However, the existing omnidirectional vision sensors based on line laser can measure points only located on the optical plane of the line laser beam, resulting in the low-resolution reconstruction. Whereas, to improve resolution, some other omnidirectional vision sensors with the capability of projecting 2D encode pattern from projector and curved mirror. However, the astigmatism property of curve mirror causes the low-accuracy reconstruction. To solve the above problems, a rotating polygon scanning mirror is used to scan the object in the vertical direction so that an entire profile of the observed scene can be obtained at high accuracy, without of astigmatism phenomenon. Then, the proposed method is calibrated by a conventional 2D checkerboard plate. The experimental results show that the measurement error of the 3D omnidirectional sensor is approximately 1 mm. Moreover, the reconstruction of objects with different shapes based on the developed sensor is also verified.

  9. Omnidirectional elastic band gap in finite lamellar structures

    Science.gov (United States)

    Bria, D.; Djafari-Rouhani, B.

    2002-11-01

    This paper presents a comprehensive theoretical analysis of the occurrence of omnidirectional reflection in one-dimensional phononic crystal structures. We discuss the conditions for a one-dimensional layered structure, made of elastic materials, to exhibit total reflection of acoustic incident waves in a given frequency range, for all incident angles and all polarizations. The property of omnidirectional reflection can be fulfilled with a simple finite superlattice if the substrate from which the incident waves are launched is made of a material with high acoustic velocities (this is very similar to the case of omnidirectional optical mirror where the incident light is generated in vacuum). However, if the substrate is made of a material with low acoustic velocities, we propose two solutions to obtain an omnidirectional band gap, namely, the cladding of a superlattice with a layer of high acoustic velocities, which acts like a barrier for the propagation of phonons, or the association in tandem of two different superlattices in such a way that the superposition of their band structures exhibits an absolute acoustic band gap. We discuss the appropriate choices of the material and geometrical properties to realize such structures. The behavior of the transmission coefficients are discussed in relation with the dispersion curves of the finite structure embedded between two substrates. Both transmission coefficients and densities of states (from which we derive the dispersion curves) are calculated in the framework of a Green's function method.

  10. Measurements and simulation of ionospheric scattering on VHF and UHF radar signals: Channel scattering function

    Science.gov (United States)

    Rogers, Neil C.; Cannon, Paul S.; Groves, Keith M.

    2009-02-01

    The design and operation of transionospheric VHF and UHF radars requires knowledge of amplitude and phase scintillation due to ionospheric scattering. Phase coherence is of particular importance where long coherent integration periods and large bandwidths are required. A thin phase screen, parabolic equation based, Trans-Ionospheric Radio Propagation Simulator (TIRPS) is described. Modeled channel scattering functions (CSFs) are compared to experimental VHF and UHF data derived from the Advanced Research Projects Agency Long-range Tracking and Instrumentation Radar on Kwajalein Island (9.4°N, 166.8°E). TIRPS quantitatively reproduces the experimental results, including the quasi-parabolic profile observed in the measured CSFs under strong turbulence conditions. Variations in the simulated CSF with ionospheric phase screen parameters are also presented. Under conditions of high integrated strength of turbulence (CkL), a low phase spectral index (p = 1), indicating relatively dense small-scale irregularities, produces pronounced range spreading. Conversely, when the spectral index is high (p = 4), indicative of strong focusing/defocusing by large-scale irregularities, there is increased Doppler spreading and, when the outer scale of irregularities is large, a greater likelihood of asymmetry of the CSF about the zero Doppler axis.

  11. VHF/UHF radar observations of tropical mesoscale convective systems over southern India

    Directory of Open Access Journals (Sweden)

    K. Kishore Kumar

    2005-07-01

    Full Text Available Several campaigns have been carried out to study the convective systems over Gadanki (13.5° N, 79.2° E, a tropical station in India, using VHF and UHF radars. The height-time sections of several convective systems are investigated in detail to study reflectivity, turbulence and vertical velocity structure. Structure and dynamics of the convective systems are the main objectives of these campaigns. The observed systems are classified into single- and multi-cell systems. It has been observed that most of the convective systems at this latitude are multi-cellular in nature. Simultaneous VHF and UHF radar observations are used to classify the observed precipitating systems as convective, intermediary and stratiform regions. Composite height profiles of vertical velocities in these regions were obtained and the same were compared with the profiles obtained at other geographical locations. These composite profiles of vertical velocity in the convective regions have shown their peaks in the mid troposphere, indicating that the maximum latent heat is being released at those heights. These profiles are very important for numerical simulations of the convective systems, which vary significantly from one geographical location to the other. Keywords. Meteorology and atmospheric dynamics (Mesoscale meteorology; Convective processes – Radio science (Remote sensing

  12. Meteor head echo altitude distributions and the height cutoff effect studied with the EISCAT HPLA UHF and VHF radars

    Directory of Open Access Journals (Sweden)

    A. Westman

    2004-04-01

    Full Text Available Meteor head echo altitude distributions have been derived from data collected with the EISCAT VHF (224MHz and UHF (930MHz high-power, large-aperture (HPLA radars. At the high-altitude end, the distributions cut off abruptly in a manner reminiscent of the trail echo height ceiling effect observed with classical meteor radars. The target dimensions are shown to be much smaller than both the VHF and the UHF probing wavelengths, but the cutoff heights for the two systems are still clearly different, the VHF cutoff being located several km above the UHF one. A single-collision meteor-atmosphere interaction model is used to demonstrate that meteors in the (1.3–7.2µg mass range will ionise such that critical electron density at 224MHz is first reached at or around the VHF cutoff altitude and critical density at 930MHz will be reached at the UHF cutoff altitude. The observed seasonal variation in the cutoff altitudes is shown to be a function of the seasonal variation of atmospheric density with altitude. Assuming that the electron density required for detection is in the order of the critical density, the abrupt altitude cutoffs can be explained as a consequence of the micrometeoroid joint size-speed distribution dropping off so fast at the large-mass, high-velocity end that above a certain altitude the number of detectable events becomes vanishingly small. Conversely, meteors at the low-mass end of the distribution will be gradually retarded such that the ionisation they generate never reaches critical density. These particles will remain unobservable.Key words. Radio science (instruments and techniques – Interplatery physics (interplanetary dust – General or miscellaneous (new fields

  13. Ultimate VHF Broadband Interferometer Zen KAWASAKI and Manabu AKITA

    Science.gov (United States)

    Kawasaki, Z.; Akita, M.

    2013-12-01

    Lightning Research Group of Osaka University (LRGOU) has been developing an interferometer for thunderstorm monitoring during these two decades. When LRGOU initiated this project, many related scientists claimed that LRGOU's system was a time of arrival and it must be a sophisticated TOA system. However the key technology of the system were broad band and digital data processing, and it is named the VHF broad band digital interferometer (BDITF), because the phase difference of Fourier components played the very important role. Then the BDITF finally has been realized as a quasi-real time lightning monitoring system, and LRGOU has been operating their BDITFs around Osaka area. Since the BDITF captures the VHF impulses associated with lightning discharges by amplitude triggering, it occasionally misses one of the bi-directional leader progressions because of relatively small amplitude VHF impulses mainly emitted by positive leader tips. All of high density of VHF pulses associated with recoil leaders may not be recorded. Then the ordinary BDITF is able to be accepted as the practical operational system, but from the aspect of science it has been sioriously expected to be improved its performance. To overcome the difficulty New Mexico Institute of Mining and Technology (NMIMT) and LRGOU have started the joint project, and a continuous recording system for digital signals is adopted [M. Stock et al, and M Akita et al,]. The field campaigns have been conducting in New Mexico and in Japan, and successful observations are accomplished. The algorithm to identify individual VHF pulses associated with lightning discharges from back ground noise and/or artificial noise, the dispersion of phase differences for all Fourier components is examined. In case by of small dispersion it is concluded that analyzed VHF pulse has high possibility to be emitted by lightning discharges. This interpretation means that the recorded VHF pulse shape might maintain without deformation during

  14. Final environmental assessment for vegetation control at VHF stations, microwave stations, electrical substations, and pole yards

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-10-13

    Southwestern Power Adm. operates very high frequency (VHF) and microwave radio stations, electrical substations, and pole yards for electric power transmission throughout AR, MO, and OK. Vegetation growth at the stations must be suppressed for safety of operation and personnel. Southwestern has been using a combination of mechanical/manual and herbicide control for this purpose; Federally- mandated reductions in staff and budgetary resources require Southwestern to evaluate all potentially efficient methods for vegetation control. Three alternatives were examined: no action, mechanical/manual control, and (proposed) a combination of mechanical/manual and herbicide control. Environmental impacts on air and water quality, wetlands, wildlife, endangered species, archaeological and other resources, farmland, human health, transportation, etc. were evaluated.

  15. Mid-sized omnidirectional robot with hydraulic drive and steering

    Science.gov (United States)

    Wood, Carl G.; Perry, Trent; Cook, Douglas; Maxfield, Russell; Davidson, Morgan E.

    2003-09-01

    Through funding from the US Army-Tank-Automotive and Armaments Command's (TACOM) Intelligent Mobility Program, Utah State University's (USU) Center for Self-Organizing and Intelligent Systems (CSOIS) has developed the T-series of omni-directional robots based on the USU omni-directional vehicle (ODV) technology. The ODV provides independent computer control of steering and drive in a single wheel assembly. By putting multiple omni-directional (OD) wheels on a chassis, a vehicle is capable of uncoupled translational and rotational motion. Previous robots in the series, the T1, T2, T3, ODIS, ODIS-T, and ODIS-S have all used OD wheels based on electric motors. The T4 weighs approximately 1400 lbs and features a 4-wheel drive wheel configuration. Each wheel assembly consists of a hydraulic drive motor and a hydraulic steering motor. A gasoline engine is used to power both the hydraulic and electrical systems. The paper presents an overview of the mechanical design of the vehicle as well as potential uses of this technology in fielded systems.

  16. Dandelion-shaped nanostructures for enhancing omnidirectional photovoltaic performance

    Science.gov (United States)

    Kuo, Shou-Yi; Hsieh, Ming-Yang; Han, Hau-Vei; Lai, Fang-I.; Tsai, Yu-Lin; Yang, Jui-Fu; Chuang, Tsung-Yeh; Kuo, Hao-Chung

    2013-05-01

    Broadband and omnidirectional light harvesting is important in photovoltaic technology because of its wide spectral range of radiation and the sun's movement. This study reports the fabrication and characterization of zinc oxide (ZnO) dandelions on Cu(In,Ga)Se2 (CIGS) solar cells. The fabrication of dandelions involves the combination of self-assembled polystyrene (PS) nanospheres and the hydrothermal method, which is one of the simplest and cheapest methods of fabricating a three-dimensional, closely packed periodic structure. This study also investigates the optimization on dimension of the PS nanospheres using the rigorous coupled-wave analysis (RCWA) method. This study uses an angle-resolved reflectance spectroscope and a homemade rotatable photo I-V measurement to investigate the omnidirectional and broadband antireflections of the proposed dandelion structure. Under a simulated one-sun condition and a light incident angle of up to 60°, cells with ZnO dandelions arrays enhanced the short-circuit current density by 31.87%. Consequently, ZnO dandelions are suitable for creating an omnidirectionally antireflective coating for photovoltaic devices.

  17. Omnigradient Based Total Variation Minimization for Enhanced Defocus Deblurring of Omnidirectional Images

    Directory of Open Access Journals (Sweden)

    Yongle Li

    2014-01-01

    Full Text Available We propose a new method of image restoration for catadioptric defocus blur using omnitotal variation (Omni-TV minimization based on omnigradient. Catadioptric omnidirectional imaging systems usually consist of conventional cameras and curved mirrors for capturing 360° field of view. The problem of catadioptric omnidirectional imaging defocus blur, which is caused by lens aperture and mirror curvature, becomes more severe when high resolution sensors and large apertures are used. In an omnidirectional image, two points near each other may not be close to one another in the 3D scene. Traditional gradient computation cannot be directly applied to omnidirectional image processing. Thus, omnigradient computing method combined with the characteristics of catadioptric omnidirectional imaging is proposed. Following this Omni-TV minimization is used as the constraint for deconvolution regularization, leading to the restoration of defocus blur in an omnidirectional image to obtain all sharp omnidirectional images. The proposed method is important for improving catadioptric omnidirectional imaging quality and promoting applications in related fields like omnidirectional video and image processing.

  18. Effects of implanted radio transmitters with percutaneous antennas on the behavior of Canada Geese

    Science.gov (United States)

    Hupp, Jerry W.; Ruhl, G.A.; Pearce, John M.; Mulcahy, Daniel M.; Tomeo, M.A.

    2003-01-01

    We examined whether surgically-implanted radio transmitters with percutaneous antennas affected behavior of Lesser Canada Geese (Branta canadensis parvipes) in Anchorage, Alaska. We implanted either a 26-g VHF radio transmitter or a larger VHF radio that was the same mass (35 g) and shape as a satellite transmitter in the coelom of adult females captured during molt in 2000. A control group of females was marked with leg bands. We simultaneously observed behavior of radio-marked and control females from 4-62 d following capture. We observed no differences in the proportion of time birds in different treatments allocated among grazing, resting, comfort, walking, and alert behavior. Females in different treatments spent a similar proportion of time in the water. Implantation of radio transmitters did not affect the frequency of agonistic interactions. We conclude that coelomic radio transmitters with percutaneous antennas had minimal effects on the behavior of Canada Geese.

  19. From VHF to UHF CMOS-MEMS Monolithically Integrated Resonators

    DEFF Research Database (Denmark)

    Teva, Jordi; Berini, Abadal Gabriel; Uranga, A.

    2008-01-01

    This paper presents the design, fabrication and characterization of microresonators exhibiting resonance frequencies in the VHF and UHF bands, fabricated using the available layers of the standard and commercial CMOS technology, AMS-0.35mum. The resonators are released in a post-CMOS process cons...

  20. Design of a robot for in-pipe inspection using omnidirectional wheels and active stabilization

    NARCIS (Netherlands)

    Dertien, Edwin Christian; Mozaffari Foumashi, M.; Pulles, Kees; Stramigioli, Stefano

    This paper discusses the design of a vehicle for in-pipe inspection using omnidirectional wheels and active stabilizing control. A novel propulsion mechanism is discussed using omnidirectional wheels (or omni-wheels) is presented which allows direct control of the orientation in the pipe. This paper

  1. Vertically Polarized Omnidirectional Printed Slot Loop AntennaPrinted Slot Loop Antenna (invited)

    DEFF Research Database (Denmark)

    Kammersgaard, Nikolaj Peter Iversen; Kvist, Søren Helstrup; Thaysen, Jesper

    2015-01-01

    A novel verticall A novel vertically polarized dpolarize , omnidirection omnidirectional l , printed slot loop antenna h sprinted slot loop antenna has been designed, simulated, fabricated, and measured. The slot loop works as a magnetic loop. The loop is loaded with inductors to insure uniform a...

  2. Measuring quality of omnidirectional high dynamic range content

    Science.gov (United States)

    Perrin, Anne-Flore; Bist, Cambodge; Cozot, Rémi; Ebrahimi, Touradj

    2017-09-01

    Although HDR content processing, coding and quality assessment have been largely addressed in the last few years, little to no work has been concentrating on how to assess quality in HDR for 360° or omnidirectional content. This paper is an attempt to answer to various questions in this direction. As a minimum, a new data set for 360° HDR content is proposed and a new methodology is designed to assess subjective quality of HDR 360° content when it is displayed on SDR HMD after applying various tone mapping operators. The results are then analyzed and conclusions are drawn.

  3. Omnidirectional Deformable Energy Textile for Human Joint Movement Compatible Energy Storage.

    Science.gov (United States)

    Lim, Joonwon; Choi, Dong Sung; Lee, Gil Yong; Lee, Ho Jin; Sasikala, Suchithra Padmajan; Lee, Kyung Eun; Kang, Seok Hun; Kim, Sang Ouk

    2017-11-29

    Omnidirectional deformability is an unavoidable basic requirement for wearable devices to accommodate human daily motion particularly at human joints. We demonstrate omnidirectionally bendable and stretchable textile-based electrochemical capacitor that retains high power performance under complex mechanical deformation. Judicious synergistic hybrid structure of woven elastic polymer yarns with carbon nanotubes and conductive polymers offers reliable electrical and electrochemical activity even under repeated cycles of severe complex deformation modes. The textile-based electrochemical capacitors exhibit omnidirectional stretchability with 93% of capacitance retention under repeated 50% omnidirectional stretching condition while demonstrating excellent specific capacitance (412 mF cm -2 ) and cycle stability (>2000 stretch). The wearable power source stably powers red LED under omnidirectional stretching that accompanies human elbow joint motion.

  4. Modeled and experimental results of an omnidirectional free-space optical receiver architecture

    Science.gov (United States)

    Murshid, Syed H.; Lovell, Gregory L.; Finch, Michael F.

    2017-03-01

    Free-space optical (FSO) communications provide point-to-point connectivity while offering many advantages in size, weight, and power as compared to radio frequency. It has the potential to provide fiber-optic data rates without the need for lengthy fiber cables. Omnidirectional FSO, also known as O-FSO systems, provide a non-line-of-sight option for data communications. They are gaining popularity in short-distance networks. Most existing O-FSO links range from 1 to 100 m and present experimental/simulated data rates ranging between 5 kb/s and 1 Mb/s. A 2.5-Gb/s O-FSO system was recently reported with a range of 25 cm. This paper employs a fiber bundle as an O-FSO receiver. The energy collected by the receiver is related to the acceptance cone of each fiber. The fiber bundle integrates the optical power gathered by the individual fibers and couples it to the photodetector. Experimental data rates approaching 100 kb/s over a meter long system are presented, whereas simulated results support a data rate up to 52 Mb/s for distances approaching a kilometer. Theoretical and experimental optical power versus range is also presented for the proposed O-FSO architecture, using on-off keying.

  5. Simultaneous observation of sporadic E with a rapid-run ionosonde and VHF coherent backscatter radar

    Directory of Open Access Journals (Sweden)

    T. Maruyama

    2006-03-01

    Full Text Available During the SEEK 2 rocket campaign, ionograms were recorded every minute at the Yamagawa Radio Observatory at about 90km west of the region monitored by a VHF (very high frequency coherent backscatter radar. Sporadic E-layer parameters, which include the critical (foEs and blanketing (fbEs frequencies, the layer height (h'Es, and the width of the range spread of sporadic E-traces, were compared with RTI (range-time-intensity plots of VHF quasi-periodic (QP and continuous coherent backscatter echoes. A close relationship was found between the appearance of QP echoes in the RTI plots and the level of spatial inhomogeneity in sporadic E plasma, signified here by the difference between foEs and fbEs. During QP echo events, foEs increased while fbEs decreased, so that the difference foEs-fbEs was enhanced, indicating the development of strong spatial structuring in electron density within a sporadic E-layer. On the other hand, increases in sporadic E range spreading also correlated with the occurrence of QP echoes but the degree of correlation varied from event to event. Continuous radar echoes were observed in association with low altitude sporadic E-layers, located well below 100 km and at times as low as 90 km. During the continuous echo events, both foEs and fbEs were less variable, and the difference foEs-fbEs was small and not as dynamic as in the QP echoes. On the other hand, the Es-layer spread intensified during continuous echoes, which means that some patchiness or corrugation in those low altitude layers is also necessary for the continuous backscatter echoes to take place.

  6. Simultaneous observation of sporadic E with a rapid-run ionosonde and VHF coherent backscatter radar

    Directory of Open Access Journals (Sweden)

    T. Maruyama

    2006-03-01

    Full Text Available During the SEEK 2 rocket campaign, ionograms were recorded every minute at the Yamagawa Radio Observatory at about 90km west of the region monitored by a VHF (very high frequency coherent backscatter radar. Sporadic E-layer parameters, which include the critical (foEs and blanketing (fbEs frequencies, the layer height (h'Es, and the width of the range spread of sporadic E-traces, were compared with RTI (range-time-intensity plots of VHF quasi-periodic (QP and continuous coherent backscatter echoes. A close relationship was found between the appearance of QP echoes in the RTI plots and the level of spatial inhomogeneity in sporadic E plasma, signified here by the difference between foEs and fbEs. During QP echo events, foEs increased while fbEs decreased, so that the difference foEs-fbEs was enhanced, indicating the development of strong spatial structuring in electron density within a sporadic E-layer. On the other hand, increases in sporadic E range spreading also correlated with the occurrence of QP echoes but the degree of correlation varied from event to event. Continuous radar echoes were observed in association with low altitude sporadic E-layers, located well below 100 km and at times as low as 90 km. During the continuous echo events, both foEs and fbEs were less variable, and the difference foEs-fbEs was small and not as dynamic as in the QP echoes. On the other hand, the Es-layer spread intensified during continuous echoes, which means that some patchiness or corrugation in those low altitude layers is also necessary for the continuous backscatter echoes to take place.

  7. Signal processing techniques for phase-coded HF-VHF radars

    Directory of Open Access Journals (Sweden)

    J. A. Baskaradas

    2003-06-01

    Full Text Available HF-VHF radar techniques are easy to employ and commonly used in geophysical applications. They include deep radio soundings, used for probing the ionosphere, stratosphere-mesosphere measurement, weather forecast and radio-glaciology. Fast algorithms and powerful processors facilitate the development of several kinds of low power radars, but the reduction of the transmitted power has to be compensated by on-line processing of an encoded signal to maintain a favorable signal-to-noise ratio suitable for detection. Moreover, radars have to reconstruct return echoes with different travel times due to various origins (multi-path, adjacent objects, etc.. Such needs can be accomplished by means of signal phase coding and one of the most attractive is the reversal phase code. The composite echo signal must be processed to extract the physical information useful for the measurement considered. In this paper some algorithms used for on-line processing of phase-coded signals will be described, both in time and frequency domain.

  8. Studies on omnidirectional enhancement of giga-hertz radiation by sub-wavelength plasma modulation

    Science.gov (United States)

    Fanrong, KONG; Qiuyue, NIE; Shu, LIN; Zhibin, WANG; Bowen, LI; Shulei, ZHENG; Binhao, JIANG

    2018-01-01

    The technology of radio frequency (RF) radiation intensification for radio compact antennas based on modulation and enhancement effects of sub-wavelength plasma structures represents an innovative developing strategy. It exhibits important scientific significance and promising potential of broad applications in various areas of national strategic demands, such as electrical information network and microwave communication, detection and control technology. In this paper, laboratory experiments and corresponding analyses have been carried out to investigate the modulation and enhancement technology of sub-wavelength plasma structure on the RF electromagnetic radiation. An application focused sub-wavelength plasma-added intensification up to ∼7 dB higher than the free-space radiation is observed experimentally in giga-hertz (GHz) RF band. The effective radiation enhancement bandwidth covers from 0.85 to 1.17 GHz, while the enhanced electromagnetic signals transmitted by sub-wavelength plasma structures maintain good communication quality. Particularly, differing from the traditional RF electromagnetic radiation enhancement method characterized by focusing the radiation field of antenna in a specific direction, the sub-wavelength plasma-added intensification of the antenna radiation presents an omnidirectional enhancement, which is reported experimentally for the first time. Corresponding performance characteristics and enhancement mechanism analyses are also conducted in this paper. The results have demonstrated the feasibility and promising potential of sub-wavelength plasma modulation in application focused RF communication, and provided the scientific basis for further research and development of sub-wavelength plasma enhanced compact antennas with wide-range requests and good quality for communication.

  9. Omnidirectional sensory and motor volumes in electric fish.

    Directory of Open Access Journals (Sweden)

    James B Snyder

    2007-11-01

    Full Text Available Active sensing organisms, such as bats, dolphins, and weakly electric fish, generate a 3-D space for active sensation by emitting self-generated energy into the environment. For a weakly electric fish, we demonstrate that the electrosensory space for prey detection has an unusual, omnidirectional shape. We compare this sensory volume with the animal's motor volume--the volume swept out by the body over selected time intervals and over the time it takes to come to a stop from typical hunting velocities. We find that the motor volume has a similar omnidirectional shape, which can be attributed to the fish's backward-swimming capabilities and body dynamics. We assessed the electrosensory space for prey detection by analyzing simulated changes in spiking activity of primary electrosensory afferents during empirically measured and synthetic prey capture trials. The animal's motor volume was reconstructed from video recordings of body motion during prey capture behavior. Our results suggest that in weakly electric fish, there is a close connection between the shape of the sensory and motor volumes. We consider three general spatial relationships between 3-D sensory and motor volumes in active and passive-sensing animals, and we examine hypotheses about these relationships in the context of the volumes we quantify for weakly electric fish. We propose that the ratio of the sensory volume to the motor volume provides insight into behavioral control strategies across all animals.

  10. An Omnidirectional Stereo Vision-Based Smart Wheelchair

    Directory of Open Access Journals (Sweden)

    Yutaka Satoh

    2007-06-01

    Full Text Available To support safe self-movement of the disabled and the aged, we developed an electric wheelchair that realizes the functions of detecting both the potential hazards in a moving environment and the postures and gestures of a user by equipping an electric wheelchair with the stereo omnidirectional system (SOS, which is capable of acquiring omnidirectional color image sequences and range data simultaneously in real time. The first half of this paper introduces the SOS and the basic technology behind it. To use the multicamera system SOS on an electric wheelchair, we developed an image synthesizing method of high speed and high quality and the method of recovering SOS attitude changes by using attitude sensors is also introduced. This method allows the SOS to be used without being affected by the mounting attitude of the SOS. The second half of this paper introduces the prototype electric wheelchair actually manufactured and experiments conducted using the prototype. The usability of the electric wheelchair is also discussed.

  11. Development of an Omnidirectional Walk Engine for Soccer Humanoid Robots

    Directory of Open Access Journals (Sweden)

    Nima Snafii

    2015-12-01

    Full Text Available Humanoid soccer robots must be able to carry out their tasks in a highly dynamic environment which requires responsive omnidirectional walking. This paper explains a new omnidirectional walking engine for a humanoid soccer robot that mainly consists of a foot planner, a zero moment point (ZMP trajectory generator, a centre of mass (CoM calculator and an active balance feedback loop. An analytical approach is presented for generating the CoM trajectory, in which the cart-table motion of the equations is solved using the Fourier approximation of the ZMP. With this approach, we propose using a new time segmentation approach in order to parametrize the double-support phase. An active balance method is also proposed which keeps the robot's trunk upright when faced with environmental disturbances. The walking engine is tested on both simulated and real NAO robots. Our results are encouraging given the fact that the robot performs favourably, walking quickly and in a stable manner in any direction in comparison with the best RoboCup 3D soccer simulation teams for which the same simulator is used. In addition, the proposed analytical Fourier-based approach is compared with the well-established numerical ZMP dynamics control method. Our results show that the presented analytical approach involves less time and complexity and better accuracy compared with the ZMP preview control method.

  12. Networked telepresence system using web browsers and omni-directional video streams

    Science.gov (United States)

    Ishikawa, Tomoya; Yamazawa, Kazumasa; Sato, Tomokazu; Ikeda, Sei; Nakamura, Yutaka; Fujikawa, Kazutoshi; Sunahara, Hideki; Yokoya, Naokazu

    2005-03-01

    In this paper, we describe a new telepresence system which enables a user to look around a virtualized real world easily in network environments. The proposed system includes omni-directional video viewers on web browsers and allows the user to look around the omni-directional video contents on the web browsers. The omni-directional video viewer is implemented as an Active-X program so that the user can install the viewer automatically only by opening the web site which contains the omni-directional video contents. The system allows many users at different sites to look around the scene just like an interactive TV using a multi-cast protocol without increasing the network traffic. This paper describes the implemented system and the experiments using live and stored video streams. In the experiment with stored video streams, the system uses an omni-directional multi-camera system for video capturing. We can look around high resolution and high quality video contents. In the experiment with live video streams, a car-mounted omni-directional camera acquires omni-directional video streams surrounding the car, running in an outdoor environment. The acquired video streams are transferred to the remote site through the wireless and wired network using multi-cast protocol. We can see the live video contents freely in arbitrary direction. In the both experiments, we have implemented a view-dependent presentation with a head-mounted display (HMD) and a gyro sensor for realizing more rich presence.

  13. Phase and coherence analysis of VHF scintillation over Christmas Island

    Directory of Open Access Journals (Sweden)

    E. B. Shume

    2014-03-01

    Full Text Available This short paper presents phase and coherence data from the cross-wavelet transform applied on longitudinally separated very high frequency (VHF equatorial ionospheric scintillation observations over Christmas Island. The phase and coherence analyses were employed on a pair of scintillation observations, namely, the east-looking and west-looking VHF scintillation monitors at Christmas Island. Our analysis includes 3 years of peak season scintillation data from 2008, 2009 (low solar activity, and 2011 (moderate solar activity. In statistically significant and high spectral coherence regions of the cross-wavelet transform, scintillation observations from the east-looking monitor lead those from the west-looking monitor by about 20 to 60 (40 ± 20 min (most frequent lead times. Using several years (seasons and solar cycle of lead (or lag and coherence information of the cross-wavelet transform, we envisage construction of a probability model for forecasting scintillation in the nighttime equatorial ionosphere.

  14. An omnidirectional retroreflector based on the transmutation of dielectric singularities.

    Science.gov (United States)

    Ma, Yun Gui; Ong, C K; Tyc, Tomás; Leonhardt, Ulf

    2009-08-01

    Transformation optics is a concept used in some metamaterials to guide light on a predetermined path. In this approach, the materials implement coordinate transformations on electromagnetic waves to create the illusion that the waves are propagating through a virtual space. Transforming space by appropriately designed materials makes devices possible that have been deemed impossible. In particular, transformation optics has led to the demonstration of invisibility cloaking for microwaves, surface plasmons and infrared light. Here, on the basis of transformation optics, we implement a microwave device that would normally require a dielectric singularity, an infinity in the refractive index. To fabricate such a device, we transmute a dielectric singularity in virtual space into a mere topological defect in a real metamaterial. In particular, we demonstrate an omnidirectional retroreflector, a device for faithfully reflecting images and for creating high visibility from all directions. Our method is robust, potentially broadband and could also be applied to visible light using similar techniques.

  15. Three-dimensional broadband omnidirectional acoustic ground cloak

    Science.gov (United States)

    Zigoneanu, Lucian; Popa, Bogdan-Ioan; Cummer, Steven A.

    2014-04-01

    The control of sound propagation and reflection has always been the goal of engineers involved in the design of acoustic systems. A recent design approach based on coordinate transformations, which is applicable to many physical systems, together with the development of a new class of engineered materials called metamaterials, has opened the road to the unconstrained control of sound. However, the ideal material parameters prescribed by this methodology are complex and challenging to obtain experimentally, even using metamaterial design approaches. Not surprisingly, experimental demonstration of devices obtained using transformation acoustics is difficult, and has been implemented only in two-dimensional configurations. Here, we demonstrate the design and experimental characterization of an almost perfect three-dimensional, broadband, and, most importantly, omnidirectional acoustic device that renders a region of space three wavelengths in diameter invisible to sound.

  16. An omnidirectional retroreflector based on the transmutation of dielectric singularities

    Science.gov (United States)

    Ma, Yun Gui; Ong, C. K.; Tyc, Tomáš; Leonhardt, Ulf

    2009-08-01

    Transformation optics is a concept used in some metamaterials to guide light on a predetermined path. In this approach, the materials implement coordinate transformations on electromagnetic waves to create the illusion that the waves are propagating through a virtual space. Transforming space by appropriately designed materials makes devices possible that have been deemed impossible. In particular, transformation optics has led to the demonstration of invisibility cloaking for microwaves, surface plasmons and infrared light. Here, on the basis of transformation optics, we implement a microwave device that would normally require a dielectric singularity, an infinity in the refractive index. To fabricate such a device, we transmute a dielectric singularity in virtual space into a mere topological defect in a real metamaterial. In particular, we demonstrate an omnidirectional retroreflector, a device for faithfully reflecting images and for creating high visibility from all directions. Our method is robust, potentially broadband and could also be applied to visible light using similar techniques.

  17. Passivity-based control of an omnidirectional mobile robot.

    Science.gov (United States)

    Ren, Chao; Sun, Yi; Ma, Shugen

    This paper studies passivity-based trajectory tracking control of an omnidirectional mobile robot. The proposed control design is simple to be implemented in practice, because of an effective exploitation of the structure of robot dynamics. First, the passivity property of the prototype robot is analyzed. Then the control system is designed based on the energy shaping plus damping approach. We find that the prototype robot itself has enough damping forces. As a result, only energy shaping is needed in our proposed controller, while the damping injection is unnecessary for our robot. In other words, the disadvantages of differential feedback, such as amplifying the measurement noise, can be avoided. Globally asymptotic stability is guaranteed. Both simulations and experimental results show the effectiveness of the proposed control design.

  18. A Novel Solar Tracker Based on Omnidirectional Computer Vision

    Directory of Open Access Journals (Sweden)

    Zakaria El Kadmiri

    2015-01-01

    Full Text Available This paper presents a novel solar tracker system based on omnidirectional vision technology. The analysis of acquired images with a catadioptric camera allows extracting accurate information about the sun position toward both elevation and azimuth. The main advantages of this system are its wide field of tracking of 360° horizontally and 200° vertically. The system has the ability to track the sun in real time independently of the spatiotemporal coordinates of the site. The extracted information is used to control the two DC motors of the dual-axis mechanism to achieve the optimal orientation of the photovoltaic panels with the aim of increasing the power generation. Several experimental studies have been conducted and the obtained results confirm the power generation efficiency of the proposed solar tracker.

  19. Omnidirectional broadband insulating device for flexural waves in thin plates

    CERN Document Server

    Climente, Alfonso; Sánchez-Dehesa, José

    2013-01-01

    This work presents a gradient index device for insulating from vibrations a circular area of a thin plate. The gradient of the refractive index is achieved by locally changing the thickness of the plate, exploiting in this way the thickness-dependence of the dispersion relation of flexural waves in thin plates. A well-like thickness profile in an annular region of the plate is used to mimic the combination of an attractive and repulsive potentials, focusing waves at its bottom and dissipating them by means of a properly designed absorptive layer placed on top of the plate. The central area is therefore isolated from vibrations while they are dissipated at the bottom of the well. Simulations have been done using the multilayer multiple scattering method and the results prove their broadband efficiency and omnidirectional properties.

  20. PMSE Observations With the Tri-Static EISCAT VHF Radars

    Science.gov (United States)

    Mann, I.; Tjulin, A.; Häggström, I.

    2013-12-01

    The polar mesospheric summer echoes (PMSE) are generated in the ionosphere at roughly 80 to 90 altitude by electron irregularities in the presence of charged solid particles and PMSE are most likely observed when ice particles form onto nanodust. PMSE formation is an important part in understanding mesospheric processes, but is also an interesting example for dusty plasma phenomena occurring in space. To investigate the phenomena that lead to formation of PMSE it is helpful to study the radar reflectivity of the mesosphere at different angles. PMSE were previously studied at different aspect angles in order to better understand the scattering process. Another way is observing PMSE from multiple sites simultaneously. During this summer the EISCAT radars that are located in Northern Scandinavia could for the first time be used for tri-static observations in the VHF band and we carried out observations during three subsequent days in June 2013. The radar signal was transmitted in zenith direction with the EISCAT VHF antenna near Tromsø (69.59 deg N, 19.23 deg E) and the scattered signal was measured from Tromsø, Kiruna (67.86 deg N, 20.44 deg E) and Sodankylä (67.36 deg N, 26.63 deg E). Zenith observations were simultaneously carried out with the Tromsø UHF radar (933 MHz). Other groups have previously reported the observations of PMSE simultaneously with the EISCAT VHF and UHF radars, but with a much lower occurrence rate for the UHF. UHF observations made during this campaign are dominated by incoherent scatter. The VHF system in Tromsø detected PMSE for a large fraction of the observation time. The VHF receivers in Kiruna and Sodankylä were pointed at typical PMSE heights above the Tromsø transmitter and detected radar reflections at the same time and altitude as the Tromsø radar. These observations are among the first tri-static observations of PMSE. Preliminary results from the campaign will be presented and discussed.

  1. Student Attitudes to Radio. I.E.T. Papers on Broadcasting: Number 108.

    Science.gov (United States)

    Brown, Duncan H.

    This report describes a study conducted by the Audio-Visual Media Research Group of the Open University to investigate student attitudes, over time, to the value of radio as a course component. Results of a January 1979 survey using a questionnaire are reported with tables and analyzed according to (1) whether a student had access to a VHF radio…

  2. The first operation and results of the Chung-Li VHF radar

    Science.gov (United States)

    Chao, J. K.; Kuo, F. S.; Chu, Y. S.; Fu, I. J.; Rottger, J.; Liu, C. H.

    1986-01-01

    The Chung-Li Very High Frequency (VHF) radar is used in the dual-mode operations, applying Doppler beam-swinging as well as the spaced-antenna-drift method. The design of the VHF radar is examined. Results of performance tests are discussed.

  3. ROAN Remote radio meteor detection sensor

    Science.gov (United States)

    Lesanu, C. E.

    2016-01-01

    Only few meteor enthusiasts across the world today, approaches systematically the radio meteor detection technique, one of the reasons being the difficulty to build and install proper permanent antennas, especially when low-VHF frequency opportunity transmitters are used as illuminators. Other reasons were in the past the relatively high cost of the entire system, receivers and computers, and not ultimately the high power consumption of the system in a 24/7 operation, when using regular personal computers. The situation changed in the recent years with the advent of the low cost software defined radio SDR receivers and low consumption/cost single board computers SBC. A commercial off-the-shelf hardware based remote radio meteor detection sensor is presented.

  4. Frequency domain interferometry mode observations of PMSE using the EISCAT VHF radar

    Directory of Open Access Journals (Sweden)

    P. B. Chilson

    2000-12-01

    Full Text Available During the summer of 1997 investigations into the nature of polar mesosphere summer echoes (PMSE were conducted using the European incoherent scatter (EISCAT VHF radar in Norway. The radar was operated in a frequency domain interferometry (FDI mode over a period of two weeks to study the frequency coherence of the returned radar signals. The operating frequencies of the radar were 224.0 and 224.6 MHz. We present the first results from the experiment by discussing two 4-h intervals of data collected over two consecutive nights. During the first of the two days an enhancement of the FDI coherence, which indicates the presence of distinct scattering layers, was found to follow the lower boundary of the PMSE. Indeed, it is not unusual to observe that the coherence values are peaked around the heights corresponding to both the lower- and upper-most boundaries of the PMSE layer and sublayers. A Kelvin-Helmholtz mechanism is offered as one possible explanation for the layering structure. Additionally, our analysis using range-time-pseudocolor plots of signal-to-noise ratios, spectrograms of Doppler velocity, and estimates of the positions of individual scattering layers is shown to be consistent with the proposition that upwardly propagating gravity waves can become steepened near the mesopause.Key words: Ionosphere (polar ionosphere · Meteorology and Atmospheric Dynamics (middle atmosphere dynamics · Radio Science (Interferometry

  5. Frequency domain interferometry mode observations of PMSE using the EISCAT VHF radar

    Directory of Open Access Journals (Sweden)

    P. B. Chilson

    Full Text Available During the summer of 1997 investigations into the nature of polar mesosphere summer echoes (PMSE were conducted using the European incoherent scatter (EISCAT VHF radar in Norway. The radar was operated in a frequency domain interferometry (FDI mode over a period of two weeks to study the frequency coherence of the returned radar signals. The operating frequencies of the radar were 224.0 and 224.6 MHz. We present the first results from the experiment by discussing two 4-h intervals of data collected over two consecutive nights. During the first of the two days an enhancement of the FDI coherence, which indicates the presence of distinct scattering layers, was found to follow the lower boundary of the PMSE. Indeed, it is not unusual to observe that the coherence values are peaked around the heights corresponding to both the lower- and upper-most boundaries of the PMSE layer and sublayers. A Kelvin-Helmholtz mechanism is offered as one possible explanation for the layering structure. Additionally, our analysis using range-time-pseudocolor plots of signal-to-noise ratios, spectrograms of Doppler velocity, and estimates of the positions of individual scattering layers is shown to be consistent with the proposition that upwardly propagating gravity waves can become steepened near the mesopause.

    Key words: Ionosphere (polar ionosphere · Meteorology and Atmospheric Dynamics (middle atmosphere dynamics · Radio Science (Interferometry

  6. On the VHF source retrieval errors associated with Lightning Mapping Arrays (LMAs)

    Science.gov (United States)

    Koshak, W. J.

    2016-12-01

    A common method for retrieving the lightning Very High Frequency (VHF) radio source (x, y, z, t) emission is to minimize a (reduced) chi-squared function that indicates how well the model arrival times associated with the model source represent the arrival time measurements at each Lightning Mapping Array (LMA) site. The Levenberg-Marquardt (LM) algorithm is usually employed to find the minimum of the chi-squared function, and the model source producing this minimum is considered to be the optimal source solution. Because the chi-squared mathematical surface is nonlinear, it is important to feed the LM algorithm an accurate initial guess (xo, yo, zo, to) in parameter space to avoid parameter searches that terminate at a relative minima of the chi-squared surface. Source initialization is commonly performed using a linear retrieval algorithm first introduced in Koshak and Solakiewicz (1996), and further applied in Koshak et al. (2004). Monte Carlo simulations and theoretical inferences both show that source retrieval errors (particularly source altitude errors) increase with horizontal source range. In the present study, the effect of modifying certain elements of the retrieval (i. e., the LMA site locations, the number of sites employed, and the retrieval algorithm characteristics) are examined to assess and quantify associated improvements in retrieval results.

  7. Radio Frequency Energy Harvesting for Long Lifetime Wireless Sensor Networks

    DEFF Research Database (Denmark)

    Han, Bo; Nielsen, Rasmus Hjorth; Prasad, Ramjee

    2014-01-01

    , harvesting energy from the radio frequency (RF) waves gives the lowest system design. Previous research on RF energy harvesting is based on the model that the radio energy is omnidirectional in the air. In this paper, a directional transmission/receiving model is proposed which can further overcome the path...... loss of the RF signals. On the node level, a virtual floating gate based CMOS biasing is used for the energy conversion circuit. With the proposed technique, the sensor node is able to harvest the energy from base station up to 30 meters....

  8. Very Compact and Broadband Active Antenna for VHF Band Applications

    Directory of Open Access Journals (Sweden)

    Y. Taachouche

    2012-01-01

    Full Text Available An active receiving antenna with small size consisting of a monopole loaded with a transistor bipolar is presented in this paper. A transistor is used in order to miniaturize the receiving active antenna size in VHF band. The vertical size of the structure is equal to λ/175, where λ is the wavelength at the lower frequency of the bandwidth. Despite the very small size of the antenna, the frequency bandwidth is very wide and the gain is suitable for FM application with sensitive receivers.

  9. DEVELOPMENT OF TRAJECTORY CONTROL SYSTEM FOR THE OMNIDIRECTIONAL MOBILE ROBOT

    Directory of Open Access Journals (Sweden)

    Y. A. Kapitanyuk

    2014-03-01

    Full Text Available The article deals with a trajectory control system development for the omnidirectional mobile robot. This kind of robots gives the possibility to control separately each degree of freedom due to special design of the wheels, which greatly facilitates the solution of the spatial control tasks and makes it possible to focus directly on the development of algorithms. Control law synthesis is based on kinematic model of a solid body on a plane. Desired trajectory is defined as a smooth implicit function in a fixed coordinate system. Procedure of control design is represented by using a differential-geometric method of nonlinear transformation of the original model to the task-oriented form, which describes the longitudinal motion along a trajectory and orthogonal deviation. Proportional controllers with direct compensation of nonlinear terms are synthesized for the transformed model. Main results are represented by nonlinear control algorithms and experimental data. Practical implementation of considered control laws for the Robotino mobile robot by Festo Didactics Company is done for illustration of this approach workability. The cases of straight line motion and movement along a circle are represented as desirable trajectories, and the majority of practical tasks for mobile robots control can be implemented by their combination.

  10. Radio Journalism.

    Science.gov (United States)

    Bittner, John R.; Bittner, Denise A.

    This book, a how-to-do-it guide for the novice and the professional alike, deals with several aspects of radio journalism: producing documentaries, preparing and announcing radio news, ethics and responsibility, regulation of radio journalism, and careers. It traces the history and growth of radio news, shows its impact on the public, and…

  11. Position Estimation and Local Mapping Using Omnidirectional Images and Global Appearance Descriptors

    Directory of Open Access Journals (Sweden)

    Yerai Berenguer

    2015-10-01

    Full Text Available This work presents some methods to create local maps and to estimate the position of a mobile robot, using the global appearance of omnidirectional images. We use a robot that carries an omnidirectional vision system on it. Every omnidirectional image acquired by the robot is described only with one global appearance descriptor, based on the Radon transform. In the work presented in this paper, two different possibilities have been considered. In the first one, we assume the existence of a map previously built composed of omnidirectional images that have been captured from previously-known positions. The purpose in this case consists of estimating the nearest position of the map to the current position of the robot, making use of the visual information acquired by the robot from its current (unknown position. In the second one, we assume that we have a model of the environment composed of omnidirectional images, but with no information about the location of where the images were acquired. The purpose in this case consists of building a local map and estimating the position of the robot within this map. Both methods are tested with different databases (including virtual and real images taking into consideration the changes of the position of different objects in the environment, different lighting conditions and occlusions. The results show the effectiveness and the robustness of both methods.

  12. Position Estimation and Local Mapping Using Omnidirectional Images and Global Appearance Descriptors

    Science.gov (United States)

    Berenguer, Yerai; Payá, Luis; Ballesta, Mónica; Reinoso, Oscar

    2015-01-01

    This work presents some methods to create local maps and to estimate the position of a mobile robot, using the global appearance of omnidirectional images. We use a robot that carries an omnidirectional vision system on it. Every omnidirectional image acquired by the robot is described only with one global appearance descriptor, based on the Radon transform. In the work presented in this paper, two different possibilities have been considered. In the first one, we assume the existence of a map previously built composed of omnidirectional images that have been captured from previously-known positions. The purpose in this case consists of estimating the nearest position of the map to the current position of the robot, making use of the visual information acquired by the robot from its current (unknown) position. In the second one, we assume that we have a model of the environment composed of omnidirectional images, but with no information about the location of where the images were acquired. The purpose in this case consists of building a local map and estimating the position of the robot within this map. Both methods are tested with different databases (including virtual and real images) taking into consideration the changes of the position of different objects in the environment, different lighting conditions and occlusions. The results show the effectiveness and the robustness of both methods. PMID:26501289

  13. An Omnidirectional Polarization Detector Based on a Metamaterial Absorber

    Science.gov (United States)

    Zhang, Binzhen; Zhang, Yong; Duan, Junping; Zhang, Wendong; Wang, Wanjun

    2016-01-01

    The theory, design, simulation, fabrication, and performance of an omnidirectional polarization detector (PD) with two resonances located in the X and Ka ranges based on a metamaterial absorber (MMA) are presented in this paper. The sandwich structure of PD is composed of 0.1 μm periodic “I” shaped patches on the metasurface, a dielectric of 200 μm FR-4 on the interlayer, and a 0.3 μm copper film on the substrate. PD absorptivity is first used to reflect and describe the polarization of the incident wave. The numerical results, derived from the standard full wave finite integration technology (FIT) of CST 2015, indicates that the designed PD shows polarization sensitivity at all incidence angles. The effects on absorptivity produced by the incidence angles, polarization angles, and materials are investigated. The amplitude of absorptivity change caused by polarization reaches 99.802%. A laser ablation process is adopted to prepare the designed PD on a FR-4 board coated with copper on the double plane with a thickness that was 1/93 and 1/48 of wavelength at a resonance frequency of 16.055 GHz and 30.9 GHz, respectively. The sample test results verify the designed PD excellent detectability on the polarization of the incident waves. The proposed PD, which greatly enriches the applications of metamaterials in bolometers, thermal images, stealth materials, microstructure measurements, and electromagnetic devices, is easy to mass produce and market because of its strong detectability, ultrathin thickness, effective cost, and convenient process. PMID:27455280

  14. An Omnidirectional Polarization Detector Based on a Metamaterial Absorber.

    Science.gov (United States)

    Zhang, Binzhen; Zhang, Yong; Duan, Junping; Zhang, Wendong; Wang, Wanjun

    2016-07-23

    The theory, design, simulation, fabrication, and performance of an omnidirectional polarization detector (PD) with two resonances located in the X and Ka ranges based on a metamaterial absorber (MMA) are presented in this paper. The sandwich structure of PD is composed of 0.1 μm periodic "I" shaped patches on the metasurface, a dielectric of 200 μm FR-4 on the interlayer, and a 0.3 μm copper film on the substrate. PD absorptivity is first used to reflect and describe the polarization of the incident wave. The numerical results, derived from the standard full wave finite integration technology (FIT) of CST 2015, indicates that the designed PD shows polarization sensitivity at all incidence angles. The effects on absorptivity produced by the incidence angles, polarization angles, and materials are investigated. The amplitude of absorptivity change caused by polarization reaches 99.802%. A laser ablation process is adopted to prepare the designed PD on a FR-4 board coated with copper on the double plane with a thickness that was 1/93 and 1/48 of wavelength at a resonance frequency of 16.055 GHz and 30.9 GHz, respectively. The sample test results verify the designed PD excellent detectability on the polarization of the incident waves. The proposed PD, which greatly enriches the applications of metamaterials in bolometers, thermal images, stealth materials, microstructure measurements, and electromagnetic devices, is easy to mass produce and market because of its strong detectability, ultrathin thickness, effective cost, and convenient process.

  15. An Omnidirectional Polarization Detector Based on a Metamaterial Absorber

    Directory of Open Access Journals (Sweden)

    Binzhen Zhang

    2016-07-01

    Full Text Available The theory, design, simulation, fabrication, and performance of an omnidirectional polarization detector (PD with two resonances located in the X and Ka ranges based on a metamaterial absorber (MMA are presented in this paper. The sandwich structure of PD is composed of 0.1 μm periodic “I” shaped patches on the metasurface, a dielectric of 200 μm FR-4 on the interlayer, and a 0.3 μm copper film on the substrate. PD absorptivity is first used to reflect and describe the polarization of the incident wave. The numerical results, derived from the standard full wave finite integration technology (FIT of CST 2015, indicates that the designed PD shows polarization sensitivity at all incidence angles. The effects on absorptivity produced by the incidence angles, polarization angles, and materials are investigated. The amplitude of absorptivity change caused by polarization reaches 99.802%. A laser ablation process is adopted to prepare the designed PD on a FR-4 board coated with copper on the double plane with a thickness that was 1/93 and 1/48 of wavelength at a resonance frequency of 16.055 GHz and 30.9 GHz, respectively. The sample test results verify the designed PD excellent detectability on the polarization of the incident waves. The proposed PD, which greatly enriches the applications of metamaterials in bolometers, thermal images, stealth materials, microstructure measurements, and electromagnetic devices, is easy to mass produce and market because of its strong detectability, ultrathin thickness, effective cost, and convenient process.

  16. Rotational Kinematics Model Based Adaptive Particle Filter for Robust Human Tracking in Thermal Omnidirectional Vision

    Directory of Open Access Journals (Sweden)

    Yazhe Tang

    2015-01-01

    Full Text Available This paper presents a novel surveillance system named thermal omnidirectional vision (TOV system which can work in total darkness with a wild field of view. Different to the conventional thermal vision sensor, the proposed vision system exhibits serious nonlinear distortion due to the effect of the quadratic mirror. To effectively model the inherent distortion of omnidirectional vision, an equivalent sphere projection is employed to adaptively calculate parameterized distorted neighborhood of an object in the image plane. With the equivalent projection based adaptive neighborhood calculation, a distortion-invariant gradient coding feature is proposed for thermal catadioptric vision. For robust tracking purpose, a rotational kinematic modeled adaptive particle filter is proposed based on the characteristic of omnidirectional vision, which can handle multiple movements effectively, including the rapid motions. Finally, the experiments are given to verify the performance of the proposed algorithm for human tracking in TOV system.

  17. Dual Circularly Polarized Omnidirectional Antenna with Slot Array on Coaxial Cylinder

    Directory of Open Access Journals (Sweden)

    Bin Zhou

    2015-01-01

    Full Text Available A dual circularly polarized (CP omnidirectional antenna based on slot array in coaxial cylinder structure is presented in this paper. It is constructed by perpendicular slot pairs around and along the axis of the coaxial cylinder to realize the omnidirectional CP property, and two ports are assigned in its two sides as left hand circularly polarized (LHCP port and right hand circularly polarized (RHCP port, respectively. The proposed antenna achieves a bandwidth of 16.4% ranging from 5.05 to 5.95 GHz with an isolation higher than 15 dB between the two CP ports, and the return loss (RL is higher than 10 dB within the bandwidth in both of the two ports. From the measured results, the average axial ratio (AR of the proposed antenna in omnidirectional plane is lower than 1.5 dB.

  18. Extraction of forest stand parameters from CARABAS VHF SAR images

    Energy Technology Data Exchange (ETDEWEB)

    Walter, Fredrik [Swedish Univ. of Agricultural Sciences, Uppsala (Sweden). Centre for Image Analysis

    1999-10-01

    Methods for extracting stand-wise forest parameters from CARABAS VHF SAR images have been developed and evaluated. CARABAS is a unique airborne synthetic aperture radar (SAR), developed by the Swedish Defence Research Establishment. It differs a lot from ordinary microwave radars by using wavelengths between 3.3 and 15 m, making the image intensity highly correlated to stem volume. Furthermore, by providing its own illumination source, the sensor operates independently of daylight and weather conditions. Empirical regression models have been developed for relating backscattering amplitude to stem volume, stem diameter, and tree height. To make comparison between CARABAS image data and forest parameters effective, a fully automatic geo-coding algorithm was developed. Image texture features have also been investigated. By using the variogram as a discriminating feature, CARABAS images and aerial images were segmented into homogeneous regions. Furthermore, a method for discriminating recently clear felled areas from forested areas, combining information from Almaz-1 SAR images and SPOT panchromatic data has also been developed, serving as a comparison to the main work of this thesis. For forest stands at near-horizontal ground, the results for estimating stem volume, stem diameter, and tree height from CARABAS image data are very satisfactory. The root mean square errors for the estimates are comparable to subjective ground-based inventories for dense forest stands. The methods and algorithms described in this thesis have been developed towards an operational remote sensing tool. Altogether, significant potential for mapping of forest characteristics exists using the CARABAS VHF SAR sensor 57 refs, 14 figs, 7 tabs

  19. Development of an omnidirectional Automated Guided Vehicle with MY3 wheels

    Directory of Open Access Journals (Sweden)

    Suyang Yu

    2016-03-01

    Full Text Available This paper presents an omnidirectional Automated Guided Vehicle (AGV with a novel omnidirectional wheel named MY3 wheel. Due to the special structure and material of the MY3 wheel, the AGV has full three DOFs in the motion plane and good capabilities of load carrying and slip resisting. In addition, the kinematic model of the AGV is derived, and the guiding method that can make the AGV to follow a specified path is established. Finally, experiments are performed to verify the kinematic model and guiding method.

  20. A combined object-tracking algorithm for omni-directional vision-based AGV navigation

    Science.gov (United States)

    Yuan, Wei; Sun, Jie; Cao, Zuo-Liang; Tian, Jing; Yang, Ming

    2010-03-01

    A combined object-tracking algorithm that realizes the realtime tracking of the selected object through the omni-directional vision with a fisheye lens is presented. The new method combines the modified continuously adaptive mean shift algorithm with the Kalman filter method. With the proposed method, the object-tracking problem when the object reappears after being sheltered completely or moving out of the field of view is solved. The experimental results perform well, and the algorithm proposed here improves the robustness and accuracy of the tracking in the omni-directional vision.

  1. Exposure of radio officers to radio frequency radiation on Danish merchant ships.

    Science.gov (United States)

    Skotte, J

    1984-12-01

    Exposure of radio officers to radio frequency radiation from telegraphy and telephony equipment on ships was investigated. Eighty-five measurements were made of 12 radio transmitters operating in the 400 kHz to 25 MHz range (power up to 1200 W) and three VHF telephony transmitters in the 150 MHz band. Field measurements were made at positions normally occupied by radio officers approximately 1 m, 0.5 m and 0.25 m from the antenna feed lines. The distance between the radio operator and the measurement location was at least 0.5 m. The ratio of the electric and magnetic field strength squared (MF and HF transmitters) to ANSI C95.1-1982 radio frequency protection guides ranged from 0.001 to 0.26 (geometric mean 0.02) at the location of the seated radio officer's head. A minimum distance of 0.5 m between antenna feed lines and personnel is recommended. This would normally ensure an exposure below the ANSI safety levels.

  2. Exposure of radio officers to radio frequency radiation on Danish merchant ships

    Energy Technology Data Exchange (ETDEWEB)

    Skotte, J.

    1984-12-01

    Exposure of radio officers to radio frequency radiation from telegraphy and telephony equipment on ships was investigated. Eighty-five measurements were made of 12 radio tranmitters operating in the 400 kHz to 25 MHz range (power up to 1200 W) and three VHF telephony transmitters in the 150 MHz band. Field measurments were made at positions normally occupied by radio officers approximately 1 m, 0.5 m and 0.25 m from the antenna feed lines. The distance between the radio operator and the measurement location was at least 0.5 m. The ratio of the electric and magnetic field strength squared (MF and HF transmitters) to ANSI C95.1-1982 radio frequency protection guides ranged from 0.001 to 0.26 (geometric mean 0.02) at the location of the seated radio officer's head. A minimum distance of 0.5 m between antenna feed lines and personnel is recommended. This would normally ensure an exposure below the ANSI safety levels.

  3. Simulation of Controller Pilot Data Link Communications over VHF Digital Link Mode 3

    Science.gov (United States)

    Bretmersky, Steven C.; Murawski, Robert; Nguyen, Thanh C.; Raghavan, Rajesh S.

    2004-01-01

    The Federal Aviation Administration (FAA) has established an operational plan for the future Air Traffic Management (ATM) system, in which the Controller Pilot Data Link Communications (CPDLC) is envisioned to evolve into digital messaging that will take on an ever increasing role in controller to pilot communications, significantly changing the way the National Airspace System (NAS) is operating. According to FAA, CPDLC represents the first phase of the transition from the current analog voice system to an International Civil Aviation Organization (ICAO) compliant system in which digital communication becomes the alternate and perhaps primary method of routine communication. The CPDLC application is an Air Traffic Service (ATS) application in which pilots and controllers exchange messages via an addressed data link. CPDLC includes a set of clearance, information, and request message elements that correspond to existing phraseology employed by current Air Traffic Control (ATC) procedures. These message elements encompass altitude assignments, crossing constraints, lateral deviations, route changes and clearances, speed assignments, radio frequency assignments, and various requests for information. The pilot is provided with the capability to respond to messages, to request clearances and information, to report information, and to declare/rescind an emergency. A 'free text' capability is also provided to exchange information not conforming to defined formats. This paper presents simulated results of the aeronautical telecommunication application Controller Pilot Data Link Communications over VHF Digital Link Mode 3 (VDL Mode 3). The objective of this simulation study was to determine the impact of CPDLC traffic loads, in terms of timely message delivery and capacity of the VDL Mode 3 subnetwork. The traffic model is based on and is used for generating air/ground messages with different priorities. Communication is modeled for the en route domain of the Cleveland

  4. Statistics of 150-km echoes over Jicamarca based on low-power VHF observations

    Directory of Open Access Journals (Sweden)

    J. L. Chau

    2006-07-01

    Full Text Available In this work we summarize the statistics of the so-called 150-km echoes obtained with a low-power VHF radar operation at the Jicamarca Radio Observatory (11.97 S, 76.87 W, and 1.3 dip angle at 150-km altitude in Peru. Our results are based on almost four years of observations between August 2001 and July 2005 (approximately 150 days per year. The majority of the observations have been conducted between 08:00 and 17:00 LT. We present the statistics of occurrence of the echoes for each of the four seasons as a function of time of day and altitude. The occurrence frequency of the echoes is ~75% around noon and start decreasing after 15:00 LT and disappear after 17:00 LT in all seasons. As shown in previous campaign observations, the 150-echoes appear at a higher altitude (>150 km in narrow layers in the morning, reaching lower altitudes (~135 km around noon, and disappear at higher altitudes (>150 km after 17:00 LT. We show that although 150-km echoes are observed all year long, they exhibit a clear seasonal variability on altitudinal coverage and the percentage of occurrence around noon and early in the morning. We also show that there is a strong day-to-day variability, and no correlation with magnetic activity. Although our results do not solve the 150-km riddle, they should be taken into account when a reasonable theory is proposed.

  5. Wideband VHF radio channel modelling and characterisation beyond line-or-sight.

    OpenAIRE

    Feramez, Michael

    2017-01-01

    The dawn of the information age brought to light technical and economic challenges in delivering broadband telecommunication services to subscribers in rural and remote areas; challenges created by tiny pockets of subscribers scattered over a vast network service area. Dealing with such challenges calls for an appropriate system engineering approach and the utilisation of suitable network building blocks, which could differ significantly from those of the urban areas. The aim of this thesis, ...

  6. Radio Mariackie

    OpenAIRE

    Tytko, Marek Mariusz

    1993-01-01

    Tekst dotyczy początków katolickiego Radia Mariackiego w Krakowie w 1993 r. The text concerns the begining of the Mariackie Radio [The Mariackie Broadcasting, the Maria's Radio Station, the Maria's Broadcasting, the Maria's Radio) in Cracow 1993.

  7. Design and Control of Omnidirectional Unmanned Ground Vehicles for Rough Terrain

    Science.gov (United States)

    2012-08-29

    result, the bevel gears connecting the motors to the drive shaft become misaligned and wear down. On the right side of Figure 34, another problem...omnidirectional unmanned ground vehicle. In IEEE/RSJ international conference on intelligent robots and systems, MO, USA, 2009. IEEE. [8] James Lacombe

  8. Research and development on embedded omnidirectional vision tracker for vision navigation

    Science.gov (United States)

    Zhu, Junchao; Feng, Weijia; Cao, Zuoliang; Zhang, Baofeng

    2009-11-01

    Omni-directional vision appears the definite significance since its advantage of acquiring all vision information simultaneously. In this paper, an integrated omni-directional vision tracker based on the configuration with CMOS, FPGA and DSP has been implemented. Fisheye lens is one of the most efficient ways to establish omni-directional vision systems, however, it appear with an unavoidable inherent distortion. An imaging system model which consists of fisheye-lens and the embedded tracker has been proposed. A novel beacon owning the feature of particular topology shape can be identified by the appropriative recognition processes. Particle filter has been programmed as an intersectional arithmetic structure which processes the same step of several particle filters simultaneously. We called it as Multiple Intersection Particle Filter. MIPF makes multi-targets tracking efficiently and successfully on embedded platform. A rectification technique based on equidistant projection theorem is used for correction some distorted image point. The localization method just employs the picture position of two objects to estimate the space position and orientation for AGV. After target recognition, vision tracking, rectification, and object positioning functions actualized on the embedded omni-directional vision tracker, autonomous navigation has been demonstrated on experimental AGV.

  9. Design of the Dual Offset Active Caster Wheel for Holonomic Omni-Directional Mobile Robots

    Directory of Open Access Journals (Sweden)

    Woojin Chung

    2010-12-01

    Full Text Available It is shown how a holonomic and omni-directional mobile robot is designed towards indoor public services. Dual offset steerable wheels with orthogonal velocity components are proposed. The proposed wheel provides precise positioning and reliable navigation performance as well as durability. A fabricated prototype is introduced, then, an experiment is carried out.

  10. Omnidirectional luminescence enhancement of fluorescent SiC via pseudoperiodic antireflective subwavelength structures

    DEFF Research Database (Denmark)

    Ou, Yiyu; Jokubavicius, Valdas; Yakimova, Rositza

    2012-01-01

    -785 nm is dramatically suppressed from 20.5% to 1.62%, and the hydrophobic surface with a large contact angle of 98° is also achieved. The angle-resolved photoluminescence study presents a considerable omnidirectional luminescence enhancement with an integral intensity enhancement of 66.3% and a fairly...

  11. Broadband and omnidirectional light harvesting enhancement of fluorescent SiC

    DEFF Research Database (Denmark)

    Ou, Yiyu; Jokubavicius, Valdas; Hens, Philip

    2012-01-01

    In the present work, antireflective sub-wavelength structures have been fabricated on fluorescent 6H-SiC to enhance the white light extraction efficiency by using the reactive-ion etching method. Broadband and omnidirectional antireflection characteristics show that 6H-SiC with antireflective sub...

  12. Optimization of a dielectric radome for a dual-reflector omnidirectional antenna

    DEFF Research Database (Denmark)

    Kim, Oleksiy S.

    2001-01-01

    In the millimetre-wave range, cylindrical dielectric insertions are employed to support a subreflector and, at the same time, as a radome of a dual-reflector omnidirectional antenna. Such a dielectric discontinuity can substantially degrade both matching and radiation characteristics of the anten...

  13. METHOD FOR CREATION OF SPHERICAL PANORAMAS FROM IMAGES OBTAINED BY OMNIDIRECTIONAL OPTOELECTRONIC SYSTEMS

    Directory of Open Access Journals (Sweden)

    V. P. Lazarenko

    2016-01-01

    Full Text Available Subject of Study. The key feature of spherical panoramas is the maximum possible angle of view (360 × 180 degrees. Omnidirectional optical-electronic systems are able to produce images that show most of this space, but these images are different from the canonical spherical panoramas. This paper proposes a method of converting the circular images obtained by omnidirectional optical systems, to canonical spherical panoramic images with the use ofcalibration procedure of omnidirectional optical-electronic system. Method. The process of spherical panoramas creation consists of three steps.The first step includesthe forming of virtual surface in the object space corresponding to a field of view of the spherical panorama. The surface is defined by the three-dimensional array of pixels.At the second step the coordinates of images of these points in the plane of the detectorare specified. At the third step pixel-by-pixel forming of the output imageisperformed from the original omnidirectional image with the use of coordinates obtained at the second step. Main Results. We have considered the geometric projectionmodel of spherical panoramas. The algorithm has been proposed calculating the three-dimensional array of pixels, characterizing the field of view of a spherical panorama and convenient for practical usage. The developed method is designed to work with omnidirectional optical-electronic systems both with catadioptric optical systems and with fisheye lens. Experimental results confirming the validity of this method are presented. The reprojection mean-square error was equal to 0.794 px. Practical Relevance. The proposed method can be applied in technologies of creating of virtual tours or panoramas of streets where spherical panoramic images are the standard for storing visual information. The method may also find its application in various fields of robotics, orientation and navigation of space vehicles and UAVs.

  14. Application of radio phase modes to modification and remote sensing of the atmosphere and space

    Science.gov (United States)

    Isham, B.; Mohammadi, S.; Chau, J.; Hysell, D. L.; Daldorff, L. K.; Thide, B.; Bergman, J.

    2009-12-01

    Radio phase modes are a low-frequency electromagnetic wave (radio) manifestation of photon orbital angular momentum (OAM) modes. At optical (laser) wavelengths OAM is an active area of theoretical and experimental research. Theory and modelling of radio phase modes show they may also easily be generated and, under certain conditions, detected with modern radio antenna arrays. Transimission of radio phase modes has been attempted using the HAARP HF transmitter in Alaska and the Jicamarca VHF radar in Peru. The HAARP experiment was designed to search for ionospheric modification effects of phase modes, while the Jicamarca experiment explored the possibility of using phase modes for remote sensing. Further work at Jicamarca will be aimed at verifying phase mode transmission and detection capabilities by using the moon as a reflector. Other potential applications of phase modes include the detection of radio OAM generated by astrophysical sources and their use in communications as a way of transmitting multiple signals at a single frequency.

  15. Letter to the Editor: Complete maps of the aspect sensitivity of VHF atmospheric radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    1999-08-01

    Full Text Available Using the MU radar at Shigaraki, Japan (34.85°N, 136.10°E, we measure the power distribution pattern of VHF radar echoes from the mid-troposphere. The large number of radar beam-pointing directions (320 allows the mapping of echo power from 0° to 40° from zenith, and also the dependence on azimuth, which has not been achieved before at VHF wavelengths. The results show how vertical shear of the horizontal wind is associated with a definite skewing of the VHF echo power distribution, for beam angles as far as 30° or more from zenith, so that aspect sensitivity cannot be assumed negligible at any beam-pointing angle that most existing VHF radars are able to use. Consequently, the use of VHF echo power to calculate intensity of atmospheric turbulence, which assumes only isotropic backscatter at large beam zenith angles, will sometimes not be valid.Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; turbulence; instruments and techniques

  16. Design and Development of VHF Antennas for Space Borne Signal of Opportunity Receivers for Cubesat Platforms

    Science.gov (United States)

    Deshpande, Manohar; Piepmeier, Jeffrey

    2015-01-01

    Design and Development of VHF Antennas for Space Borne Signal of Opportunity Receivers for Cubesat Platforms. Space borne microwave remote sensors at VHF/UHF frequencies are important instruments to observe reflective properties of land surfaces through thick and heavy forestation on a global scale. One of the most cost effective ways of measuring land reflectivity at VHF/UHF frequencies is to use signals transmitted by existing communication satellites (operating at VHF/UHF band) as a signal of opportunity (SoOp) signal and passive receivers integrated with airborne/space borne platforms operating in the Low Earth Orbit (LEO). One of the critical components of the passive receiver is two antennas (one to receive only direct signal and other to receive only reflected signal) which need to have ideally high (>30dB) isolation. However, because of small size of host platforms and broad beam width of dipole antennas, achieving adequate isolation between two channels is a challenging problem and need to be solved for successful implementation of space borne SoOp technology for remote sensing. In this presentation a novel enabling VHF antenna technology for Cubesat platforms is presented to receive direct as well as reflected signal with needed isolation. The novel scheme also allows enhancing the gain of individual channels by factor of 2 without use of reflecting ground plane

  17. 78 FR 52109 - Proposed Amendment of Class D and E Airspace, and Establishment of Class E Airspace; Salisbury, MD

    Science.gov (United States)

    2013-08-22

    ... Establishment of Class E Airspace; Salisbury, MD AGENCY: Federal Aviation Administration (FAA), DOT. ACTION..., and establish Class E airspace at Salisbury-Ocean City Wicomico Regional Airport, Salisbury, MD, due to the decommissioning of the Salisbury VHF Omnidirectional Radio Range Tactical Air Navigation Aid...

  18. 78 FR 78299 - Proposed Establishment of Class E Airspace; Truth or Consequences, NM

    Science.gov (United States)

    2013-12-26

    ... Federal Aviation Administration 14 CFR Part 71 Proposed Establishment of Class E Airspace; Truth or... Truth or Consequences VHF Omni-Directional Radio Range Tactical Air Navigation Aid (VORTAC), Truth or... feet above the surface at the Truth or Consequences VORTAC navigation aid, Truth or Consequences, NM...

  19. 78 FR 40381 - Establishment of Class E Airspace; Grand Canyon, AZ

    Science.gov (United States)

    2013-07-05

    ...This action establishes Class E airspace at the Grand Canyon VHF Omni-Directional Radio Range/Distance Measuring Equipment (VOR/DME) navigation aid, Grand Canyon, AZ, to facilitate vectoring of Instrument Flight Rules (IFR) aircraft under control of Los Angeles Air Route Traffic Control Center (ARTCC). This improves the safety and management of IFR operations within the National Airspace System.

  20. 75 FR 66344 - Amendment of Jet Route J-93; CA

    Science.gov (United States)

    2010-10-28

    ... Federal Aviation Administration 14 CFR Part 71 RIN 2120-AA66 Amendment of Jet Route J-93; CA AGENCY... action proposes to amend Jet Route J-93 in California between the Julian VHF Omnidirectional Radio Range... is necessary to realign Jet Route J-93 with the revised location of the Penasco VOR. The Proposal The...

  1. VHF/UHF/microwave LOS terrestrial propagation and system design

    Science.gov (United States)

    Fitzsimons, T. K.

    1986-10-01

    The telecommunication frequency range under discussion is from 30 MHz up to tens of GHz. For military communications this means the use of systems such as Combat Net Radio, Single-Channel Radio Access, Tactical and Fixed Radio Relay, Air-Ground-Air Systems, Common User Information Systems and Tactical Satellite. For civil communications the systems are not dissimilar - mobile radio, fixed radio relay systems, Air Traffic Control, etc. Of course there is a considerable amount of broadcasting and there are military and civil radar systems in these frequency bands. The spectrum range from 30 MHz to about 5 GHz is for the military in particular, prime spectrum; wide bandwidths (hence digital transmission) can be achieved, most propagation mechanisms are relatively stable and most of this part of the spectrum can be used by tactical systems either operating on the move or moving frequently to new sites. In addition to considerations of wanted performance and necessary characteristics such as ECM, the military systems are designed to meet requirements for rapid deployment in an environment which is difficult and unpredictable from the electromagnetic environment, topographic, and meteorological aspects.

  2. PENUMBUHAN LAPISAN TIPIS SILIKON MIKROKRISTAL TERHIDROGENASI DENGAN TEKNIK HWC-VHF-PECVD

    Directory of Open Access Journals (Sweden)

    Ida Usman

    2012-02-01

    Full Text Available Telah dikembangkan teknik HWC-VHF-PECVD (Hot Wire Cell Very High Frequency Plasma Enhanced Chemical Vapor Deposition untuk menumbuhkan lapisan tipis silikon mikrokristal terhidrogenasi (mc-Si:H. Dari hasil penumbuhan lapisan tipis yang dilakukan, teknik HWC-VHF-PECVD memperlihatkan laju deposisi yang lebih tinggi dibandingkan laju deposisi lapisan tipis yang diperoleh dari teknik PECVD maupun teknik VHF-PECVD konvensional. Berdasarkan hasil pengukuran XRD dan SEM, lapisan yang diperoleh pada temperatur filamen yang rendah masih berstruktur amorf. Indikasi yang mengarah pada pembentukan lapisan tipis berstruktur mikrokristalin mulai terlihat pada temperatur filamen ≥ 500oC, dimana puncak-puncak di fraksi spektrum XRD untuk orientasi kristalin tertentu mulai terbentu, sejalan dengan pembentukan butiran-butiran kristalin dari hasil foto SEM permukaan lapisan-lapisan tersebut.

  3. Radio pill antenna range test

    Science.gov (United States)

    Cummins, W. F.; Kane, R. J.

    1992-05-01

    In order to investigate the potential of a proposed 'radio pill' beacon transmitter, a range test experiment was devised and carried out in the VHF frequency range. Calculations and previous work indicated that optimum sensitivity and, thus, distance would be obtained in this frequency range provided body radio-frequency (RF) absorption was not too great. A ferrite-core loop antenna is compatible with a pill geometry and has better radiation efficiency than an air core loop. The ferrite core may be a hollow cylinder with the electronics and batteries placed inside. However, this range test was only concerned with experimentally developing test range data on the ferrite core antenna itself. A one turn strap loop was placed around a 9.5 mm diameter by 18.3 mm long stack of ferrite cores. This was coupled to a 50 Omega transmission line by 76 mm of twisted pair line and a capacitive matching section. This assembly was excited by a signal generator at output levels of -10 to +10 dBm. Signals were received on a VHF receiver and tape recorder coupled to a 14 element, circularly polarized Yagi antenna at a height of 2.5 m. Field strength measurements taken at ranges of 440, 1100, and 1714 m. Maximum field strengths referenced to 0 dBm transmitter level were -107 to -110 dB at 440 m, -124 to -127 dBm at 1100 m, and -116 to -119 dBm at 1714 m when the antenna cylinder was horizontal. Field strengths with a vertical antenna were about 6 dB below these values. The latter transmit site was elevated and had a clear line-of-site path to the receiving site. The performance of this test antenna was better than that expected from method-of-moment field calculations. When this performance data is scaled to a narrow bandwidth receiving system, ground level receiving ranges of a few to 10 km can be expected. Clear line-of-sight ranges where either or both the transmitter and receiver are elevated could vary from several km to 100 km.

  4. An Omnidirectional Mobile Millimeters Size Micro-Robot with Novel Duel-Wheels

    Directory of Open Access Journals (Sweden)

    Zhenbo Li

    2006-09-01

    Full Text Available A millimeters size omni-directional mobile micro-robot is presented in this paper. A unique duel-wheel structure is designed for no-slip motion during the steering, by turning the slip friction between the wheel and ground into rolling friction. The robot was driven by four electromagnetic micromotors with 2.1mm×2.1mm×1.3mm size. Three of them are for translation and the other one is for rotation. Kinematics model is analyzed to prove the omni-directional mobility. Virtual-Winding Approach (VWA and PWM-Based Vector-Synthesize Approach(PBVSA current control methods are presented to satisfy a requirement of higher positioning accuracy. Experimental results demonstrate the feasibility of this concept.

  5. Estimating Position of Mobile Robots From Omnidirectional Vision Using an Adaptive Algorithm.

    Science.gov (United States)

    Li, Luyang; Liu, Yun-Hui; Wang, Kai; Fang, Mu

    2015-08-01

    This paper presents a novel and simple adaptive algorithm for estimating the position of a mobile robot with high accuracy in an unknown and unstructured environment by fusing images of an omnidirectional vision system with measurements of odometry and inertial sensors. Based on a new derivation where the omnidirectional projection can be linearly parameterized by the positions of the robot and natural feature points, we propose a novel adaptive algorithm, which is similar to the Slotine-Li algorithm in model-based adaptive control, to estimate the robot's position by using the tracked feature points in image sequence, the robot's velocity, and orientation angles measured by odometry and inertial sensors. It is proved that the adaptive algorithm leads to global exponential convergence of the position estimation errors to zero. Simulations and real-world experiments are performed to demonstrate the performance of the proposed algorithm.

  6. An Omnidirectional Mobile Millimeters Size Micro-Robot with Novel Duel-Wheels

    Directory of Open Access Journals (Sweden)

    Chen Zhang

    2008-11-01

    Full Text Available A millimeters size omni-directional mobile micro-robot is presented in this paper. A unique duel-wheel structure is designed for no-slip motion during the steering, by turning the slip friction between the wheel and ground into rolling friction. The robot was driven by four electromagnetic micromotors with 2.1mm?2.1mm?1.3mm size. Three of them are for translation and the other one is for rotation. Kinematics model is analyzed to prove the omni-directional mobility. Virtual-Winding Approach (VWA and PWM-Based VectorSynthesize Approach(PBVSA current control methods are presented to satisfy a requirement of higher positioning accuracy. Experimental results demonstrate the feasibility of this concept.

  7. Omnidirectional stereo vision sensor based on single camera and catoptric system.

    Science.gov (United States)

    Zhou, Fuqiang; Chai, Xinghua; Chen, Xin; Song, Ya

    2016-09-01

    An omnidirectional stereo vision sensor based on one single camera and catoptric system is proposed. As crucial components, one camera and two pyramid mirrors are used for imaging. The omnidirectional measurement towards different directions in the horizontal field can be performed by four pairs of virtual cameras, with a consummate synchronism and an improved compactness. Moreover, the perspective projection invariance is ensured in the imaging process, which avoids the imaging distortion reflected by the curved mirrors. In this paper, the structure model of the sensor was established and a sensor prototype was designed. The influences of the structural parameters on the field of view and the measurement accuracy were also discussed. In addition, real experiments and analyses were performed to evaluate the performance of the proposed sensor in the measurement application. The results proved the feasibility of the sensor, and exhibited a considerable accuracy in 3D coordinate reconstruction.

  8. Confinement in a planar waveguide with porous silicon omnidirectional mirrors as confining walls

    Energy Technology Data Exchange (ETDEWEB)

    Xifre-Perez, E. [Departament d' Enginyeria Electronica, Electrica i Automatica, ETSE, Campus Sescelades, Universitat Rovira i Virgili, Avda. Paisos Catalans 26, 43007 Tarragona (Spain); Marsal, L.F. [Departament d' Enginyeria Electronica, Electrica i Automatica, ETSE, Campus Sescelades, Universitat Rovira i Virgili, Avda. Paisos Catalans 26, 43007 Tarragona (Spain)]. E-mail: lluis.marsal@urv.cat; Ferre-Borrull, J. [Departament d' Enginyeria Electronica, Electrica i Automatica, ETSE, Campus Sescelades, Universitat Rovira i Virgili, Avda. Paisos Catalans 26, 43007 Tarragona (Spain); Pallares, J. [Departament d' Enginyeria Electronica, Electrica i Automatica, ETSE, Campus Sescelades, Universitat Rovira i Virgili, Avda. Paisos Catalans 26, 43007 Tarragona (Spain)

    2006-12-15

    We present the design and study of waveguide structures based on porous silicon where the light confinement is not due to the usual total reflection effect but to the use of photonic crystals (PCs) as confining walls. These PC are omnidirectional mirrors (OMs), consisting of the periodic repetition of two porous silicon layers with different refractive indices and thicknesses. They reflect the radiation for all angles of incidence within a frequency range called the omnidirectional band gap (OBG). We have followed the PC formalism to investigate the properties of the OM as a multimode waveguide: the number of modes within the band gap, their field spatial distribution and their confinement as a function of the frequency and the core thickness.

  9. Decoupling and Robust Adaptive Control of Omnidirectional, Automated Guided Vehicle Based on Nonguided Line Navigation System

    OpenAIRE

    Kawasaki, Yoshinori; Iwai, Zenta; Haramaki, Shinya; カワサキ, ヨシノリ; イワイ, ゼンタ; ハラマキ, シンヤ; 川崎, 義則; 岩井, 善太; 原槙, 真也

    1994-01-01

    This paper is concerned with a control system design for the new type of omnidirectional AGV (automated guided vehicle) without any steering mechanisms. The system is regarded as a highly nonlinear multidimensional system with parameter uncertainties, so the conventional control techniques are not available. Here we propose a new control algorithm by combining nonlinear decoupling control with robust simple adaptive control (SAC). Both techniques were developed by one of the authors. The cont...

  10. Multimodal and omnidirectional beam splitters for Lamb modes in elastic plates

    Directory of Open Access Journals (Sweden)

    Yabin Jin

    2016-12-01

    Full Text Available Omnidirectional beam splitters for the simultaneous control of the three fundamental Lamb modes in an elastic plate are designed and numerically studied. Beam splitters consist in radially symmetric and inhomogeneous lenses designed to redirect the incoming energy towards a given angle. In this work, these devices are designed by means of graded phononic crystals combined with thickness variations of the plate. Numerical simulations are presented to show the performance of the designed devices.

  11. Development of an Omnidirectional-Capable Electromagnetic Shock Wave Generator for Lipolysis

    Directory of Open Access Journals (Sweden)

    Ming Hau Chang

    2017-01-01

    Full Text Available Traditional methods for adipose tissue removal have progressed from invasive methods such as liposuction to more modern methods of noninvasive lipolysis. This research entails the development and evaluation of an omnidirectional-capable flat-coil electromagnetic shock wave generator (EMSWG for lipolysis. The developed EMSWG has the advantage of omnidirectional-capable operation. This capability increases the eventual clinical usability by adding three designed supports to the aluminum disk of the EMSWG to allow omnidirectional operation. The focal pressures of the developed EMSWG for different operating voltages were measured, and its corresponding energy intensities were calculated. The developed EMSWG was mounted in a downward orientation for lipolysis and evaluated as proof of concept. In vitro tests on porcine fatty tissues have been carried out. It is found that at a 6 kV operating voltage with 1500 shock wave exposures, a 2 cm thick subcutaneous hypodermis of porcine fatty tissue can be ruptured, resulting in a damaged area of 1.39 mm2. At a 6.5 kV operating voltage with 2000 shock wave exposures, the damaged area is increased to about 5.20 mm2, which can be enlarged by changing the focal point location, resulting in significant lipolysis for use in clinical applications.

  12. DISTRIBUTED CONTROL ARCHITECTURE OF AN OMNI-DIRECTIONAL AUTONOMOUS GUIDED VEHICLE

    Directory of Open Access Journals (Sweden)

    N.S. Tlale

    2012-01-01

    Full Text Available

    ENGLISH ABSTRACT: Omni-directionality is the ability of a mobile robot to move instantaneously in any direction. This paper describes the wheel and controller designs of a Mecanumwheeled, autonomous guided vehicle (AGV for reconfigurable manufacturing systems. Mecanum wheels use slip developed between rollers and surface, surface and ground, to achieve omni-directionality. An advantage of omni-directional robotic platforms is that they are capable of performing tasks in congested environments such as those found in factory workshops, narrow aisles, warehouses, etc. Controller Area Network (CAN is implemented as a distributed controller to control motion and navigation tasks of the developed robot. The design of the distributed controller is described and its performance analyzed. This increases the reliability and functionality of the mobile robot.

    AFRIKAANSE OPSOMMING: Die artikel beskryf wiel - en beheerontwerpe van ‘n veelrigting mobiele robot. Die robot is ‘n selfstandigbeheerde voertuig vir gebruik by vervaardigingstelsels met veranderbare konfigurasie. Die ontwerp van die robot en bypassende beheerstelsel word beskryf en ontleed teen die agterground van bewegings – en navigeertake. Die betroubaarheid en funksionering van die sisteem word beoordeel.

  13. Omnidirectional Photonic Band Gap Using Low Refractive Index Contrast Materials and its Application in Optical Waveguides

    KAUST Repository

    Vidal Faez, Angelo

    2012-07-01

    Researchers have argued for many years that one of the conditions for omnidirectional reflection in a one-dimensional photonic crystal is a strong refractive index contrast between the two constituent dielectric materials. Using numerical simulations and the theory of Anderson localization of light, in this work we demonstrate that an omnidirectional band gap can indeed be created utilizing low refractive index contrast materials when they are arranged in a disordered manner. Moreover, the size of the omnidirectional band gap becomes a controllable parameter, which now depends on the number of layers and not only on the refractive index contrast of the system, as it is widely accepted. This achievement constitutes a major breakthrough in the field since it allows for the development of cheaper and more efficient technologies. Of particular interest is the case of high index contrast one-dimensional photonic crystal fibers, where the propagation losses are mainly due to increased optical scattering from sidewall roughness at the interfaces of high index contrast materials. By using low index contrast materials these losses can be reduced dramatically, while maintaining the confinement capability of the waveguide. This is just one of many applications that could be proven useful for this discovery.

  14. Geomagnetic activity control on VHF scintillations over an Indian low ...

    Indian Academy of Sciences (India)

    The satellite radio beacon measurements because of their better time resolution, relative accuracy and potential for data continuity became a valuable and effective technique for the study of geomag- netic disturbances such as storms on ionospheric electron density and irregularities. During these events ionosphere shows ...

  15. Solar Radio

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Scientists monitor the structure of the solar corona, the outer most regions of the Sun's atmosphere, using radio waves (100?s of MHz to 10?s of GHz). Variations in...

  16. Impact of Beamforming on the Path Connectivity in Cognitive Radio Ad Hoc Networks

    Directory of Open Access Journals (Sweden)

    Le The Dung

    2017-03-01

    Full Text Available This paper investigates the impact of using directional antennas and beamforming schemes on the connectivity of cognitive radio ad hoc networks (CRAHNs. Specifically, considering that secondary users use two kinds of directional antennas, i.e., uniform linear array (ULA and uniform circular array (UCA antennas, and two different beamforming schemes, i.e., randomized beamforming and center-directed to communicate with each other, we study the connectivity of all combination pairs of directional antennas and beamforming schemes and compare their performances to those of omnidirectional antennas. The results obtained in this paper show that, compared with omnidirectional transmission, beamforming transmission only benefits the connectivity when the density of secondary user is moderate. Moreover, the combination of UCA and randomized beamforming scheme gives the highest path connectivity in all evaluating scenarios. Finally, the number of antenna elements and degree of path loss greatly affect path connectivity in CRAHNs.

  17. Impact of Beamforming on the Path Connectivity in Cognitive Radio Ad Hoc Networks.

    Science.gov (United States)

    Dung, Le The; Hieu, Tran Dinh; Choi, Seong-Gon; Kim, Byung-Seo; An, Beongku

    2017-03-27

    This paper investigates the impact of using directional antennas and beamforming schemes on the connectivity of cognitive radio ad hoc networks (CRAHNs). Specifically, considering that secondary users use two kinds of directional antennas, i.e., uniform linear array (ULA) and uniform circular array (UCA) antennas, and two different beamforming schemes, i.e., randomized beamforming and center-directed to communicate with each other, we study the connectivity of all combination pairs of directional antennas and beamforming schemes and compare their performances to those of omnidirectional antennas. The results obtained in this paper show that, compared with omnidirectional transmission, beamforming transmission only benefits the connectivity when the density of secondary user is moderate. Moreover, the combination of UCA and randomized beamforming scheme gives the highest path connectivity in all evaluating scenarios. Finally, the number of antenna elements and degree of path loss greatly affect path connectivity in CRAHNs.

  18. Self-localization for an autonomous mobile robot based on an omni-directional vision system

    Science.gov (United States)

    Chiang, Shu-Yin; Lin, Kuang-Yu; Chia, Tsorng-Lin

    2013-12-01

    In this study, we designed an autonomous mobile robot based on the rules of the Federation of International Robotsoccer Association (FIRA) RoboSot category, integrating the techniques of computer vision, real-time image processing, dynamic target tracking, wireless communication, self-localization, motion control, path planning, and control strategy to achieve the contest goal. The self-localization scheme of the mobile robot is based on the algorithms featured in the images from its omni-directional vision system. In previous works, we used the image colors of the field goals as reference points, combining either dual-circle or trilateration positioning of the reference points to achieve selflocalization of the autonomous mobile robot. However, because the image of the game field is easily affected by ambient light, positioning systems exclusively based on color model algorithms cause errors. To reduce environmental effects and achieve the self-localization of the robot, the proposed algorithm is applied in assessing the corners of field lines by using an omni-directional vision system. Particularly in the mid-size league of the RobotCup soccer competition, selflocalization algorithms based on extracting white lines from the soccer field have become increasingly popular. Moreover, white lines are less influenced by light than are the color model of the goals. Therefore, we propose an algorithm that transforms the omni-directional image into an unwrapped transformed image, enhancing the extraction features. The process is described as follows: First, radical scan-lines were used to process omni-directional images, reducing the computational load and improving system efficiency. The lines were radically arranged around the center of the omni-directional camera image, resulting in a shorter computational time compared with the traditional Cartesian coordinate system. However, the omni-directional image is a distorted image, which makes it difficult to recognize the

  19. Design VHF Antennas for Space Borne Receivers for SmallSats

    Science.gov (United States)

    Deshpande, Manohar

    2017-01-01

    Space borne microwave remote sensors at VHF/UHF frequencies are important instruments to observe reflective properties of land surfaces through thick and heavy forestation on a global scale. One of the most cost effective ways of measuring land reflectivity at VHF/UHF frequencies is to use signals transmitted by existing communication satellites (operating at VHF/UHF band) as a signal of opportunity (SoOp) signal and passive receivers integrated with airborne/space borne platforms operating in the Low Earth Orbit (LEO). One of the critical components of the passive receiver is two antennas (one to receive only direct signal and other to receive only reflected signal) which need to have ideally high (>30dB) isolation. However, because of small size of host platforms and broad beam width of dipole antennas, achieving adequate isolation between two channels is a challenging problem and need to be solved for successful implementation of space borne SoOp technology for remote sensing. In this presentation a novel enabling VHF antenna technology for Cubesat platforms is presented to receive direct as well as reflected signal with needed isolation. The novel scheme also allows enhancing the gain of individual channels by factor of 2 without use of reflecting ground plane.

  20. A VHF Class E DC-DC Converter with Self-Oscillating Gate Driver

    DEFF Research Database (Denmark)

    Andersen, Toke Meyer; Christensen, Søren K.; Knott, Arnold

    2011-01-01

    This paper describes the analysis and design of a DC-DC converter topology which is operational at frequencies in the Very High Frequency (VHF) band ranging from 30 MHz − 300 MHz. The presented topology, which consists of a class E inverter, class E rectifier, and self-oscillating gate driver, is...

  1. First wind shear observation in PMSE with the tristatic EISCAT VHF radar

    Science.gov (United States)

    Mann, I.; Häggström, I.; Tjulin, A.; Rostami, S.; Anyairo, C. C.; Dalin, P.

    2016-11-01

    The Polar Summer Mesosphere has the lowest temperatures that occur in the entire Earth system. Water ice particles below the optically observable size range participate there in the formation of strong radar echoes (Polar Mesospheric Summer Echoes, PMSE). To study PMSE we carried out observations with the European Incoherent Scatter (EISCAT) VHF and EISCAT UHF radar simultaneously from a site near Tromsø (69.58°N, 19.2272°E) and observed VHF backscattering also with the EISCAT receivers in Kiruna (67.86°N, 20.44°E) and Sodankylä (67.36°N, 26.63°E). This is one of the first tristatic measurements with EISCAT VHF, and we therefore describe the observations and geometry in detail. We present observations made on 26 June 2013 from 7:00 to 13:00 h UT where we found similar PMSE patterns with all three VHF receivers and found signs of wind shear in PMSE. The observations suggest that the PMSE contains sublayers that move in different directions horizontally, and this points to Kelvin-Helmholtz instability possibly playing a role in PMSE formation. We find no signs of PMSE in the UHF data. The electron densities that we derive from observed incoherent scatter at UHF are at PMSE altitudes close to the noise level but possibly indicate reduced electron densities directly above the PMSE.

  2. An analysis on the mid-latitude scintillation and coherence frequency bandwidth using transionospheric VHF signals

    Energy Technology Data Exchange (ETDEWEB)

    Juang, Zhen [Los Alamos National Laboratory; Roussel-dupre, Robert [Los Alamos National Laboratory

    2008-01-01

    An analysis was perfonned on the mid-latitude scintillation and coherence frequency bandwidth (Fcoh) using transionospheric VHF signal data. The data include 1062 events spanning from November 1997 to June 2002. Each event records FORTE satellite received VHF signals from LAPP located at Los Alamos, New Mexico. Fcohs were derived to study scintillation characteristics on diurnal and seasonal variations, as well as changes due to solar and geomagnetic activities. Comparisons to the VHFIUHF coherence frequency bandwidth studies previously reported at equatorial and mid-latitude regions are made using a 4th power frequency dependence relationship. Furthennore, a wideband ionospheric scintillation model, WBMOD, was used to estimate Fcohs and compared with our VHF Fcoh values. Our analysis indicates mid-latitude scintillation characteristics that are not previously revealed. At the VHF bottom frequency range (3035 MHz), distinguished smaller Fcohs are found in time period from sunset to midnight, in wann season from May to August, and in low solar activity years. The effects of geomagnetic storm activity on Fcoh are characterized by a sudden transition at a Kp index of 50-60. Comparisons with median Fcohs estimated from other studies validated our VHF Fcohs for daytime while an order of magnitude larger Fcohs are found for nighttime, implying a time-dependent issue in applying the 4th order power relationship. Furthermore, comparisons with WBMOD-estimated Fcohs indicated generally matched median scintillation level estimates while differences do exist for those events undergoing high geomagnetic stonn activity which may imply underestimates of scintillation level by the WBMOD in the mid-latitude regions.

  3. Molecular Switching in Confined Spaces: Effects of Encapsulating the DHA/VHF Photo-Switch in Cucurbiturils

    DEFF Research Database (Denmark)

    Petersen, Michael Å.; Rasmussen, Brian; Andersen, Nicolaj N.

    2017-01-01

    complexes, the kinetics of the thermal VHF-to-DHA back-reaction is accelerated, while in CB8 inclusion complexes, the kinetics is slowed down as compared to the free photo-switch. The effect of the CB encapsulation of the photo-switch can be effectively canceled by introducing a guest that binds the CB more...... strongly. According to DFT calculations, a stabilization of the reactive s-cis VHF conformer relative to the s-trans VHF appears to be a contributing factor responsible for the accelerated back-reaction when encapsulated in CB7....

  4. VHF/UHF filters and multicouplers application of air resonators

    CERN Document Server

    Piette, Bernard

    2013-01-01

    This book describes the various devices used in radio communication and broadcasting to achieve high selectivity filtering and coupling. After providing a background in the basics of microwave theory and more detailed material - including a special chapter on precision and errors in measurement - the reader will find detailed descriptions, manufacturing processes, and, for the most useful instances, a number of worked-through formulas, which will allow engineers and technicians to design circuits or components for filtering or coupling applications. Content is covered in this format across a b

  5. Omnidirectional configuration and control approach on mini heavy loaded forklift autonomous guided vehicle

    Directory of Open Access Journals (Sweden)

    Adam Norsharimie

    2017-01-01

    Full Text Available This paper presents the omnidirectional configuration and control approach on Mini Heavy Loaded Forklift Autonomous Guided Vehicle (MHeLFAGV for flexibility maneuverability in confine and narrow area. The issue in turning motion for nonholonomic vehicle in confine area becoming a motivation in MHeLFAGV design to provide holonomic vehicle with flexible movement. Therefore an omni-wheeled named Mecanum wheel has been configured in this vehicle design as well as omnidirectional control algorithm. MHeLFAGV system is developed with collaboration and inspired from Vacuumshmelze (M Sdn. Bhd. Pekan, Pahang in order to have a customized mini forklift that able to work in a very confined warehouse (170cm × 270cm square with heavy payload in a range of 20-200kg. In electronics control design, two stages of controller boards are developed namely as Board 1 and 2 that specifically for movement controller board and monitoring controller board respectively. In addition separate module of left, right, forward, backward, diagonal and zigzagging movement is developed as embedded modules for MHeLFAGV system’s control architecture. A few experiments are done to verify the algorithm for each omnidirectional movement of MHeLFAGV system in the wide area. The waypoint of MHeLFAGV movement is plotted using Global Positioning System (GPS as well as a digital compass by mapping the longitude and latitude of the vehicle. There are slightly different between the targeted movements with recorded data since Mecanum wheeled affected by the uneven surface of the landscape. The experiment is also further on moving in confine are on the actual targeted warehouse.

  6. Radio astronomy

    CERN Document Server

    Alder, Berni

    1975-01-01

    Methods in Computational Physics, Volume 14: Radio Astronomy is devoted to the role of the digital computer both as a control device and as a calculator in addressing problems related to galactic radio noise. This volume contains four chapters and begins with a technical description of the hardware and the special data-handling problems of using radioheliography, with an emphasis on a selection of observational results obtained with the Culgoora radioheliograph and their significance to solar physics and to astrophysics in general. The subsequent chapter examines interstellar dispersion, i

  7. High-efficiency omnidirectional photoresponses based on monolayer lateral p–n heterojunctions

    KAUST Repository

    Tsai, Meng-Lin

    2016-10-28

    Electrical and optical properties of lateral monolayer WSe2–MoS2 p–n heterojunctions were characterized to demonstrate a high responsivity of 0.26 A W−1 with an excellent omnidirectional photodetection capability. The heterojunction functioning as a diode exhibits a prominent gate-tuning behavior with an ideality factor of 1.25. In addition, ultrafast photoresponse, low-light detectability, and high-temperature operation have been achieved. These unique characteristics pave a way for the future development of sub-nano semiconductor devices.

  8. Motion Control Design for an Omnidirectional Mobile Robot Subject to Velocity Constraints

    Directory of Open Access Journals (Sweden)

    Ollin Peñaloza-Mejía

    2015-01-01

    Full Text Available A solution to achieve global asymptotic tracking with bounded velocities in an omnidirectional mobile robot is proposed in this paper. It is motivated by the need of having a useful in-practice motion control scheme, which takes into account the physical limits of the velocities. To this end, a passive nonlinear controller is designed and combined with a tracking controller in a negative feedback connection structure. By using Lyapunov theory and passivity tools, global asymptotic tracking with desired bounded velocities is proved. Simulations and experimental results are provided to show the effectiveness of the proposal.

  9. A new type of artificial structure to achieve broadband omnidirectional acoustic absorption

    Directory of Open Access Journals (Sweden)

    Li-Yang Zheng

    2013-10-01

    Full Text Available We present a design for a two-dimensional omnidirectional acoustic absorber that can achieve 98.6% absorption of acoustic waves in water, forming an effective acoustic black hole. This artificial black hole consists of an absorptive core coated with layers of periodically distributed polymer cylinders embedded in water. Effective medium theory describes the response of the coating layers to the acoustic waves. The polymer parameters can be adjusted, allowing practical fabrication of the absorber. Since the proposed structure does not rely on resonances, it is applicable to broad bandwidths. The design might be extended to a variety of applications.

  10. A new type of artificial structure to achieve broadband omnidirectional acoustic absorption

    KAUST Repository

    Zheng, L.-Y.

    2013-10-18

    We present a design for a two-dimensional omnidirectional acoustic absorber that can achieve 98.6% absorption of acoustic waves in water, forming an effective acoustic black hole. This artificial black hole consists of an absorptive core coated with layers of periodically distributed polymer cylinders embedded in water. Effective medium theory describes the response of the coating layers to the acoustic waves. The polymer parameters can be adjusted, allowing practical fabrication of the absorber. Since the proposed structure does not rely on resonances, it is applicable to broad bandwidths. The design might be extended to a variety of applications.

  11. Omnidirectional refractive devices for flexural waves based on graded phononic crystals

    Energy Technology Data Exchange (ETDEWEB)

    Torrent, Daniel, E-mail: daniel.torrent@iemn.univ-lille1.fr; Pennec, Yan; Djafari-Rouhani, Bahram [Institut d' Electronique, de Microléctronique et de Nanotechnologie, UMR CNRS 8520, Université de Lille 1, 59655 Villeneuve d' Ascq (France)

    2014-12-14

    Different omnidirectional refractive devices for flexural waves in thin plates are proposed and numerically analyzed. Their realization is explained by means phononic crystal plates, where a previously developed homogenization theory is employed for the design of graded index refractive devices. These devices consist of a circular cluster of inclusions with a properly designed gradient in their radius. With this approach, the Luneburg and Maxwell lenses and a family of beam splitters for flexural waves are proposed and analyzed. Results show that these devices work properly in a broadband frequency region, being therefore an efficient approach for the design of refractive devices specially interesting for nano-scale applications.

  12. A broadband and omnidirectional electromagnetic wave concentrator with gradient woodpile structure.

    Science.gov (United States)

    Yin, Ming; Tian, Xiao Yong; Wu, Ling Ling; Li, Di Chen

    2013-08-12

    We present the first realized three-dimensional (3D) practical implementation of the so called "optical black hole" in microwave frequencies, an electromagnetic (EM) concentrator. The 3D EM wave concentrator was designed with non-resonant gradient index (GRIN) 3D woodpile photonic crystals (PCs) structure in metamaterial regime, and fabricated by Stereolithography (SL) process. Omnidirectional EM wave capture and absorbing ability of the device in a broad bandwidth (12GHz-15GHz) were validated by full-wave simulation and experiments. Such devices may have applications in microwave energy harvesting and radiation detector.

  13. Analysis of Omni-directivity Error of Electromagnetic Field Probe using Isotropic Antenna

    Directory of Open Access Journals (Sweden)

    Hartansky Rene

    2016-12-01

    Full Text Available This manuscript analyzes the omni-directivity error of an electromagnetic field (EM probe and its dependence on frequency. The global directional characteristic of a whole EM probe consists of three independent directional characteristics of EM sensors - one for each coordinate. The shape of particular directional characteristics is frequency dependent and so is the shape of the whole EM probe’s global directional characteristic. This results in systematic error induced in the measurement of EM fields. This manuscript also contains quantitative formulation of such errors caused by the shape change of directional characteristics for different types of sensors depending on frequency and their mutual arrangement.

  14. Motion Planning for Omnidirectional Wheeled Mobile Robot by Potential Field Method

    Directory of Open Access Journals (Sweden)

    Weihao Li

    2017-01-01

    Full Text Available In this paper, potential field method has been used to navigate a three omnidirectional wheels’ mobile robot and to avoid obstacles. The potential field method is used to overcome the local minima problem and the goals nonreachable with obstacles nearby (GNRON problem. For further consideration, model predictive control (MPC has been used to incorporate motion constraints and make the velocity more realistic and flexible. The proposed method is employed based on the kinematic model and dynamics model of the mobile robot in this paper. To show the performance of proposed control scheme, simulation studies have been carried to perform the motion process of mobile robot in specific workplace.

  15. An evolutional artificial potential field algorithm based on the anisotropy of omnidirectional mobile robot

    Science.gov (United States)

    Cao, Qixin; Leng, Chuntao; Huang, Yanwen

    2007-12-01

    The traditional artificial potential field (APF) method is widely used for motion planning of traditional mobile robot, but there is little research about the application to the omnidirectional mobile robot (OMR). To propose a more suitable motion planning for OMR, an evolutional APF is presented in this paper, by introducing the revolving factor into the APF. The revolving factor synthesizes the anisotropy of OMR and the affect of dynamic environment. Finally simulation is carried out to demonstrate that, the evolutional APF is a high-speed and high-efficiency motion planning by comparing with the traditional APF, and the advantages of OMR is exerted.

  16. Omnidirectional Antenna with Multi-Resonance Performance for Microwave Imaging Systems

    Directory of Open Access Journals (Sweden)

    N. Ojaroudi

    2013-11-01

    Full Text Available In this paper, a novel ultra-wideband printed monopole antenna (PMA for microwave imaging systems is presented. The proposed antenna provides a wide usable fractional bandwidth of more than 160% (2.12-17.87 GHz. The antenna has an ordinary square radiating patch, therefore displays a good omni-directional radiation pattern even at higher frequencies and also its radiation efficiency is greater than 82% across the entire radiating band. The designed antenna has a small size of 12×18 mm2.

  17. Investigation into the Effects of VHF and UHF Band Radiation on Hewlett-Packard (HP) Cesium Beam Frequency Standards

    National Research Council Canada - National Science Library

    Dickens, Andrew

    1994-01-01

    This paper documents an investigation into reports which have indicated that exposure to VHF and UHF band radiation has adverse effects on the frequency stability of HP cesium beam frequency standards...

  18. Investigation into the effects of VHF and UHF band radiation on Hewlett-Packard (HP) Cesium Beam Frequency Standards

    Science.gov (United States)

    Dickens, Andrew

    1995-01-01

    This paper documents an investigation into reports which have indicated that exposure to VHF and UHF band radiation has adverse effects on the frequency stability of HP cesium beam frequency standards. Tests carried out on the basis of these reports show that sources of VHF and UHF radiation such as two-way hand held police communications devices do cause reproducible adverse effects. This investigation examines reproducible effects and explores possible causes.

  19. Digitale radio

    NARCIS (Netherlands)

    Schiphorst, Roelof; Zondervan, L.

    2007-01-01

    Als eerste in Europa heeft Nederland begin december 2006 de omschakeling van analoge naar digitale ethertelevisie gemaakt. Voor de analoge FM-radio is er ook een digitale variant, T-DAB. T-DAB staat voor 'Terrestrial Digital Audio Broadcasting'. Dit artikel gaat verder in op deze techniek en de

  20. Kinematics modeling and simulation of an autonomous omni-directional mobile robot

    Directory of Open Access Journals (Sweden)

    Daniel Garcia Sillas

    2015-08-01

    Full Text Available Although robotics has progressed to the extent that it has become relatively accessible with low-cost projects, there is still a need to create models that accurately represent the physical behavior of a robot. Creating a completely virtual platform allows us to test behavior algorithms such as those implemented using artificial intelligence, and additionally, it enables us to find potential problems in the physical design of the robot. The present work describes a methodology for the construction of a kinematic model and a simulation of the autonomous robot, specifically of an omni-directional wheeled robot. This paper presents the kinematic model development and its implementation using several tools. The result is a model that follows the kinematics of a triangular omni-directional mobile wheeled robot, which is then tested by using a 3D model imported from 3D Studio® and Matlab® for the simulation. The environment used for the experiment is very close to the real environment and reflects the kinematic characteristics of the robot.

  1. Omni-Directional Scanning Localization Method of a Mobile Robot Based on Ultrasonic Sensors.

    Science.gov (United States)

    Mu, Wei-Yi; Zhang, Guang-Peng; Huang, Yu-Mei; Yang, Xin-Gang; Liu, Hong-Yan; Yan, Wen

    2016-12-20

    Improved ranging accuracy is obtained by the development of a novel ultrasonic sensor ranging algorithm, unlike the conventional ranging algorithm, which considers the divergence angle and the incidence angle of the ultrasonic sensor synchronously. An ultrasonic sensor scanning method is developed based on this algorithm for the recognition of an inclined plate and to obtain the localization of the ultrasonic sensor relative to the inclined plate reference frame. The ultrasonic sensor scanning method is then leveraged for the omni-directional localization of a mobile robot, where the ultrasonic sensors are installed on a mobile robot and follow the spin of the robot, the inclined plate is recognized and the position and posture of the robot are acquired with respect to the coordinate system of the inclined plate, realizing the localization of the robot. Finally, the localization method is implemented into an omni-directional scanning localization experiment with the independently researched and developed mobile robot. Localization accuracies of up to ±3.33 mm for the front, up to ±6.21 for the lateral and up to ±0.20° for the posture are obtained, verifying the correctness and effectiveness of the proposed localization method.

  2. Modeling and Implementation of Omnidirectional Soccer Robot with Wide Vision Scope Applied in Robocup-MSL

    Directory of Open Access Journals (Sweden)

    Mohsen Taheri

    2010-04-01

    Full Text Available The purpose of this paper is to design and implement a middle size soccer robot to conform RoboCup MSL league. First, according to the rules of RoboCup, we design the middle size soccer robot, The proposed autonomous soccer robot consists of the mechanical platform, motion control module, omni-directional vision module, front vision module, image processing and recognition module, investigated target object positioning and real coordinate reconstruction, robot path planning, competition strategies, and obstacle avoidance. And this soccer robot equips the laptop computer system and interface circuits to make decisions. In fact, the omnidirectional vision sensor of the vision system deals with the image processing and positioning for obstacle avoidance and
    target tracking. The boundary-following algorithm (BFA is applied to find the important features of the field. We utilize the sensor data fusion method in the control system parameters, self localization and world modeling. A vision-based self-localization and the conventional odometry
    systems are fused for robust selflocalization. The localization algorithm includes filtering, sharing and integration of the data for different types of objects recognized in the environment. In the control strategies, we present three state modes, which include the Attack Strategy, Defense Strategy and Intercept Strategy. The methods have been tested in the many Robocup competition field middle size robots.

  3. Omni-directional lens for structure-borne wave focusing and energy harvesting

    Science.gov (United States)

    Tol, S.; Degertekin, F. L.; Erturk, A.

    2017-04-01

    In this paper, a Luneburg lens is explored for omnidirectional structure-borne wave focusing both numerically and experimentally. The proposed lens is formed by radially distributed blind holes with different diameters based on the gradient index phononic crystal theory. The radial orientation and diameter of the holes are determined according to the refractive index distribution which is guided by finite-element simulations of the lowest asymmetric mode Lamb wave band diagrams. According to this design, the wave travels slower at the center of the lens and converges at the focal spot which is on the circular lens boundary. Wave simulations are performed in COMSOL Multiphysics® under plane wave excitation from a line source and wave focusing is observed at the opposite border of the lens with respect to the incoming wave direction. Experimentally measured wave fields with a scanning laser vibrometer successfully validate simulated wave focusing. Furthermore, omnidirectionality is verified by testing the lens under plane wave excitation from different directions. With piezoelectric energy harvesters located at the boundary of the Luneburg lens substantially larger power output can be obtained as compared to the baseline case of energy harvesting without the lens on the uniform plate counterpart for the same incident plane wave excitation.

  4. Hierarchical Graphene Foam for Efficient Omnidirectional Solar-Thermal Energy Conversion.

    Science.gov (United States)

    Ren, Huaying; Tang, Miao; Guan, Baolu; Wang, Kexin; Yang, Jiawei; Wang, Feifan; Wang, Mingzhan; Shan, Jingyuan; Chen, Zhaolong; Wei, Di; Peng, Hailin; Liu, Zhongfan

    2017-10-01

    Efficient solar-thermal energy conversion is essential for the harvesting and transformation of abundant solar energy, leading to the exploration and design of efficient solar-thermal materials. Carbon-based materials, especially graphene, have the advantages of broadband absorption and excellent photothermal properties, and hold promise for solar-thermal energy conversion. However, to date, graphene-based solar-thermal materials with superior omnidirectional light harvesting performances remain elusive. Herein, hierarchical graphene foam (h-G foam) with continuous porosity grown via plasma-enhanced chemical vapor deposition is reported, showing dramatic enhancement of broadband and omnidirectional absorption of sunlight, which thereby can enable a considerable elevation of temperature. Used as a heating material, the external solar-thermal energy conversion efficiency of the h-G foam impressively reaches up to ≈93.4%, and the solar-vapor conversion efficiency exceeds 90% for seawater desalination with high endurance. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  5. Omni-Directional Scanning Localization Method of a Mobile Robot Based on Ultrasonic Sensors

    Directory of Open Access Journals (Sweden)

    Wei-Yi Mu

    2016-12-01

    Full Text Available Improved ranging accuracy is obtained by the development of a novel ultrasonic sensor ranging algorithm, unlike the conventional ranging algorithm, which considers the divergence angle and the incidence angle of the ultrasonic sensor synchronously. An ultrasonic sensor scanning method is developed based on this algorithm for the recognition of an inclined plate and to obtain the localization of the ultrasonic sensor relative to the inclined plate reference frame. The ultrasonic sensor scanning method is then leveraged for the omni-directional localization of a mobile robot, where the ultrasonic sensors are installed on a mobile robot and follow the spin of the robot, the inclined plate is recognized and the position and posture of the robot are acquired with respect to the coordinate system of the inclined plate, realizing the localization of the robot. Finally, the localization method is implemented into an omni-directional scanning localization experiment with the independently researched and developed mobile robot. Localization accuracies of up to ±3.33 mm for the front, up to ±6.21 for the lateral and up to ±0.20° for the posture are obtained, verifying the correctness and effectiveness of the proposed localization method.

  6. Efficient target tracking with an ad-hoc network of omni-directional sensors

    Science.gov (United States)

    Atanassov, Kalin

    2015-05-01

    Ad-hoc networks of omni-directional sensors provide an efficient means to obtain low-cost, easily deployed, reliable target tracking systems. To remove target position dependency on the target power, a transformation to another coordinate system is introduced. It can be shown that the problem of sensing target position with omni-directional sensors can be adapted to the conventional Kalman filter framework. To validate the proposed methodology, first an analysis is conducted to show that by converting to log-ratio space and at the same time reducing the number of parameters to track, no information about target position is lost. The analysis is done by deriving the CRLBs for the position estimation error in both original and transformed spaces and showing that they are the same. Second, to show how the traditional Kalman filter framework performs, a particle filter that works off the transformed coordinates is designed. The number of particles is selected to be sufficiently large and the result is used as ground truth to compare with the performance of the Kalman tracker. The comparisons are done for different target movement speeds and sensor density modes. The results provide an insight into Kalman tracker performance in different situations.

  7. Design of an omnidirectional single-point photodetector for large-scale spatial coordinate measurement

    Science.gov (United States)

    Xie, Hongbo; Mao, Chensheng; Ren, Yongjie; Zhu, Jigui; Wang, Chao; Yang, Lei

    2017-10-01

    In high precision and large-scale coordinate measurement, one commonly used approach to determine the coordinate of a target point is utilizing the spatial trigonometric relationships between multiple laser transmitter stations and the target point. A light receiving device at the target point is the key element in large-scale coordinate measurement systems. To ensure high-resolution and highly sensitive spatial coordinate measurement, a high-performance and miniaturized omnidirectional single-point photodetector (OSPD) is greatly desired. We report one design of OSPD using an aspheric lens, which achieves an enhanced reception angle of -5 deg to 45 deg in vertical and 360 deg in horizontal. As the heart of our OSPD, the aspheric lens is designed in a geometric model and optimized by LightTools Software, which enables the reflection of a wide-angle incident light beam into the single-point photodiode. The performance of home-made OSPD is characterized with working distances from 1 to 13 m and further analyzed utilizing developed a geometric model. The experimental and analytic results verify that our device is highly suitable for large-scale coordinate metrology. The developed device also holds great potential in various applications such as omnidirectional vision sensor, indoor global positioning system, and optical wireless communication systems.

  8. Omnidirectional polarization insensitive tunable absorption in graphene metamaterial of nanodisk structure

    Science.gov (United States)

    Ning, Renxia; Bao, Jie; Jiao, Zheng; Xu, Yuan

    2015-11-01

    Tunable absorption based on graphene metamaterial with nanodisk structure at near-infrared frequency was investigated using the finite difference time domain method. The absorption of the nanodisk structure which consisting of Au-MgF2-graphene-Au-polyimide (from bottom to top) can be tuned by the chemical potential of graphene at certain diameter of nanodisk. The permittivity of graphene is discussed with different chemical potential to obtain tunable absorption. It is shown that the increased value of the chemical potential of graphene can lead to blue-shifted of the absorption peaks and the values decreased. Moreover, dual-band and triple-band absorption can be achieved for resonance frequencies at normal incidence. Compared with diameter of nanodisks, the multilayer structure shows multi-band absorber, and an omnidirectional absorption at 195.25 THz is insensitive to TE/TM polarization. This omnidirectional polarization insensitive absorption may be applied by optical communications such as optical absorber, near infrared stealth, and filter.

  9. A Novel Generic Ball Recognition Algorithm Based on Omnidirectional Vision for Soccer Robots

    Directory of Open Access Journals (Sweden)

    Hui Zhang

    2013-11-01

    Full Text Available It is significant for the final goal of RoboCup to realize the recognition of generic balls for soccer robots. In this paper, a novel generic ball recognition algorithm based on omnidirectional vision is proposed by combining the modified Haar-like features and AdaBoost learning algorithm. The algorithm is divided into offline training and online recognition. During the phase of offline training, numerous sub-images are acquired from various panoramic images, including generic balls, and then the modified Haar-like features are extracted from them and used as the input of the AdaBoost learning algorithm to obtain a classifier. During the phase of online recognition, and according to the imaging characteristics of our omnidirectional vision system, rectangular windows are defined to search for the generic ball along the rotary and radial directions in the panoramic image, and the learned classifier is used to judge whether a ball is included in the window. After the ball has been recognized globally, ball tracking is realized by integrating a ball velocity estimation algorithm to reduce the computational cost. The experimental results show that good performance can be achieved using our algorithm, and that the generic ball can be recognized and tracked effectively.

  10. Broadband VHF observations for lightning impulses from a small satellite SOHLA-1 (Maido 1)

    Science.gov (United States)

    Morimoto, T.; Kikuchi, H.; Ushio, T.; Kawasaki, Z.; Hidekazu, H.; Aoki, T.

    2009-12-01

    Lightning Research Group of Osaka University (LRG-OU) has been developing VHF Broadband Digital Interferometer (DITF) to image precise lightning channels and monitor lightning activity widely. The feature of broadband DITF is its ultrawide bandwidth (from 25MHz to 100MHz) and implicit redundancy for estimating VHF source location. LRG-OU considers an application of the broadband DITF to the spaceborne measurement system and joins the SOHLA (Space Oriented Higashi-Osaka Leading Associate) satellite project. The SOHLA satellite project represents a technology transfer program to expand the range of the space development community in Japan. The objective is to get SMEs (Small and Medium sized manufacturing Enterprises) involved in small space projects and new space technologies. Under the cooperative agreement, JAXA (Japan Aerospace Exploration Agency) intends to contribute to socio-economic development by returning its R&D results to society, and SOHLA tries to revitalize the local economy through the commercialization of versatile small satellites. According to the agreement, JAXA provides SOHLA its technical information on small satellites and other technical assistance for the development of the small satellites, SOHLA-1. The prime objective of the SOHLA-1 program is to realize low-cost and short term development of a microsatellite which utilizes the components and bus technologies of JAXA’s MicroLabSat. SOHLA-1 is a spin-stabilized microsatellite of MicroLabSat heritage (about 50 kg). The spin axis is fixed to inertial reference frame. The spin axis (z-axis) lies in the plane containing the solar direction and the normal to the orbital plane. LRG-OU takes responsibility for a science mission of SOHLA-1. To examine the feasibility of the DITF receiving VHF lightning impulses in space, LRG-OU proposes the BMW (Broadband Measurement of Waveform for VHF Lightning Impulses). BMW consists of a single pair of an antenna, a band-pass filter, an amplifier, and an

  11. Comparison study of Lightning VHF interferometric and LF time-of-arival maps

    Science.gov (United States)

    Kudo, A.; Stock, M.; Kawasaki, Z.; Ushio, T.

    2016-12-01

    Lightning discharges radiate broad band frequency electromagnetic waves from ULF to UHF. Using sensors which detect this radiation is an effective technique to detect lightning flashes, even if they are in a cloud. If multiple sensors are present, a lightning flash can be located using various techniques. At low frequencies, the power radiated by lightning is very high, but because the wavelengths are long, the location resolution is somewhat low. At very high frequencies, the wavelengths are much shorter allowing for much better location resolution, but the power radiation is also much lower, making it more difficult to detect. The VHF band is a good compromise between good location resolution, and good detection efficiency. One technique to locate VHF signals from lightning is interferometry. Using this technique, the signals arriving at three or more VHF broadband antennas are coherently combined to produce an image of the lightning flash. The current generation broadband lightning interferometer being developed in Japan by RAIRAN and the University of Osaka called Lightning Interferometer via VHF Emission (LIVE). Currently, LIVE is installed in Kaizuka, a city to the south of Osaka, near Osaka Bay to observe Japanese summer lightning. In the current study, we are comparing the high detail, 2-dimensional lightning maps produced by LIVE to the lower detail, 3-dimensional maps produced by a low frequency time-of-arrival system called the Broadband Observation network for Lightning and Thunderstorms (BOLT). In order to better compare the data, a new GPS timing device is being developed for LIVE to allow high absolute timing accuracy without sacrificing one of the 4 high speed digitizer channels. The objectives of the study are to better understand Japanese summer lightning, and to prepare for a future campaign as part of the GLM validation study.

  12. Bias-Voltage Stabilizer for HVHF Amplifiers in VHF Pulse-Echo Measurement Systems

    Directory of Open Access Journals (Sweden)

    Hojong Choi

    2017-10-01

    Full Text Available The impact of high-voltage–high-frequency (HVHF amplifiers on echo-signal quality is greater with very-high-frequency (VHF, ≥100 MHz ultrasound transducers than with low-frequency (LF, ≤15 MHz ultrasound transducers. Hence, the bias voltage of an HVHF amplifier must be stabilized to ensure stable echo-signal amplitudes. We propose a bias-voltage stabilizer circuit to maintain stable DC voltages over a wide input range, thus reducing the harmonic-distortion components of the echo signals in VHF pulse-echo measurement systems. To confirm the feasibility of the bias-voltage stabilizer, we measured and compared the deviations in the gain of the HVHF amplifier with and without a bias-voltage stabilizer. Between −13 and 26 dBm, the measured gain deviations of a HVHF amplifier with a bias-voltage stabilizer are less than that of an amplifier without a bias-voltage stabilizer. In order to confirm the feasibility of the bias-voltage stabilizer, we compared the pulse-echo responses of the amplifiers, which are typically used for the evaluation of transducers or electronic components used in pulse-echo measurement systems. From the responses, we observed that the amplitudes of the echo signals of a VHF transducer triggered by the HVHF amplifier with a bias-voltage stabilizer were higher than those of the transducer triggered by the HVHF amplifier alone. The second, third, and fourth harmonic-distortion components of the HVHF amplifier with the bias-voltage stabilizer were also lower than those of the HVHF amplifier alone. Hence, the proposed scheme is a promising method for stabilizing the bias voltage of an HVHF amplifier, and improving the echo-signal quality of VHF transducers.

  13. First wind shear observation in PMSE with the tristatic EISCAT VHF radar

    OpenAIRE

    Mann, Ingrid; Häggström, I.; Tjulin, A; Rostami, S; Anyairo, CC; Dalin, P

    2016-01-01

    (c) American Geophysical Union, reprinted with permission. Article also available at source: https://doi.org/10.1002/2016JA023080 The Polar Summer Mesosphere has the lowest temperatures that occur in the entire Earth system. Water ice particles below the optically observable size range participate there in the formation of strong radar echoes (Polar Mesospheric Summer Echoes, PMSE). To study PMSE we carried out observations with the European Incoherent Scatter (EISCAT) VHF and EIS...

  14. Bias-Voltage Stabilizer for HVHF Amplifiers in VHF Pulse-Echo Measurement Systems.

    Science.gov (United States)

    Choi, Hojong; Park, Chulwoo; Kim, Jungsuk; Jung, Hayong

    2017-10-23

    The impact of high-voltage-high-frequency (HVHF) amplifiers on echo-signal quality is greater with very-high-frequency (VHF, ≥100 MHz) ultrasound transducers than with low-frequency (LF, ≤15 MHz) ultrasound transducers. Hence, the bias voltage of an HVHF amplifier must be stabilized to ensure stable echo-signal amplitudes. We propose a bias-voltage stabilizer circuit to maintain stable DC voltages over a wide input range, thus reducing the harmonic-distortion components of the echo signals in VHF pulse-echo measurement systems. To confirm the feasibility of the bias-voltage stabilizer, we measured and compared the deviations in the gain of the HVHF amplifier with and without a bias-voltage stabilizer. Between -13 and 26 dBm, the measured gain deviations of a HVHF amplifier with a bias-voltage stabilizer are less than that of an amplifier without a bias-voltage stabilizer. In order to confirm the feasibility of the bias-voltage stabilizer, we compared the pulse-echo responses of the amplifiers, which are typically used for the evaluation of transducers or electronic components used in pulse-echo measurement systems. From the responses, we observed that the amplitudes of the echo signals of a VHF transducer triggered by the HVHF amplifier with a bias-voltage stabilizer were higher than those of the transducer triggered by the HVHF amplifier alone. The second, third, and fourth harmonic-distortion components of the HVHF amplifier with the bias-voltage stabilizer were also lower than those of the HVHF amplifier alone. Hence, the proposed scheme is a promising method for stabilizing the bias voltage of an HVHF amplifier, and improving the echo-signal quality of VHF transducers.

  15. 2-D inner-shelf current observations from a single VHF WEllen RAdar (WERA) station

    Science.gov (United States)

    Voulgaris, G.; Kumar, N.; Gurgel, K.-W.; Warner, J.C.; List, J.H.

    2011-01-01

    The majority of High Frequency (HF) radars used worldwide operate at medium to high frequencies (8 to 30 MHz) providing spatial resolutions ranging from 3 to 1.5 km and ranges from 150 to 50 km. This paper presents results from the deployment of a single Very High Frequency (VHF, 48 MHz) WEllen RAdar (WERA) radar with spatial resolution of 150 m and range 10-15 km, used in the nearshore off Cape Hatteras, NC, USA. It consisted of a linear array of 12 antennas operating in beam forming mode. Radial velocities were estimated from radar backscatter for a variety of wind and nearshore wave conditions. A methodology similar to that used for converting acoustically derived beam velocities to an orthogonal system is presented for obtaining 2-D current fields from a single station. The accuracy of the VHF radar-derived radial velocities is examined using a new statistical technique that evaluates the system over the range of measured velocities. The VHF radar velocities showed a bias of 3 to 7 cm/s over the experimental period explainable by the differences in radar penetration and in-situ measurement height. The 2-D current field shows good agreement with the in-situ measurements. Deviations and inaccuracies are well explained by the geometric dilution analysis. ?? 2011 IEEE.

  16. The Radio JOVE Project - Shoestring Radio Astronomy

    Science.gov (United States)

    Thieman, J.; Flagg, R.; Greenman, W.; Higgins, C.; Reyes, F.; Sky, J.

    2010-01-01

    Radio JOVE is an education and outreach project intended to give students and other interested individuals hands-on experience in learning radio astronomy. They can do this through building a radio telescope from a relatively inexpensive kit that includes the parts for a receiver and an antenna as well as software for a computer chart recorder emulator (Radio Skypipe) and other reference materials

  17. Strong control and squeezing effects of radiation states in a slab waveguide sandwiched between two omnidirectional mirrors

    NARCIS (Netherlands)

    van Driel, H.M.; Hoekstra, Hugo; Stoffer, Remco; Yudistira, D.

    The effect of sandwiching a slab waveguide in air between two omnidirectional mirrors on the local density of modes is investigated theoretically. Design aspects of such a structure are considered, and it is shown that the local density of modes other than the slab-guided mode can be strongly

  18. Front and Back Movement Analysis of a Triangle-Structured Three-Wheeled Omnidirectional Mobile Robot by Varying the Angles between Two Selected Wheels.

    Science.gov (United States)

    Mohanraj, A P; Elango, A; Reddy, Mutra Chanakya

    2016-01-01

    Omnidirectional robots can move in all directions without steering their wheels and it can rotate clockwise and counterclockwise with reference to their axis. In this paper, we focused only on front and back movement, to analyse the square- and triangle-structured omnidirectional robot movements. An omnidirectional mobile robot shows different performances with the different number of wheels and the omnidirectional mobile robot's chassis design. Research is going on in this field to improve the accurate movement capability of omnidirectional mobile robots. This paper presents a design of a unique device of Angle Variable Chassis (AVC) for linear movement analysis of a three-wheeled omnidirectional mobile robot (TWOMR), at various angles (θ) between the wheels. Basic mobility algorithm is developed by varying the angles between the two selected omnidirectional wheels in TWOMR. The experiment is carried out by varying the angles (θ = 30°, 45°, 60°, 90°, and 120°) between the two selected omniwheels and analysing the movement of TWOMR in forward direction and reverse direction on a smooth cement surface. Respectively, it is compared to itself for various angles (θ), to get its advantages and weaknesses. The conclusion of the paper provides effective movement of TWOMR at a particular angle (θ) and also the application of TWOMR in different situations.

  19. Front and Back Movement Analysis of a Triangle-Structured Three-Wheeled Omnidirectional Mobile Robot by Varying the Angles between Two Selected Wheels

    Directory of Open Access Journals (Sweden)

    A. P. Mohanraj

    2016-01-01

    Full Text Available Omnidirectional robots can move in all directions without steering their wheels and it can rotate clockwise and counterclockwise with reference to their axis. In this paper, we focused only on front and back movement, to analyse the square- and triangle-structured omnidirectional robot movements. An omnidirectional mobile robot shows different performances with the different number of wheels and the omnidirectional mobile robot’s chassis design. Research is going on in this field to improve the accurate movement capability of omnidirectional mobile robots. This paper presents a design of a unique device of Angle Variable Chassis (AVC for linear movement analysis of a three-wheeled omnidirectional mobile robot (TWOMR, at various angles (θ between the wheels. Basic mobility algorithm is developed by varying the angles between the two selected omnidirectional wheels in TWOMR. The experiment is carried out by varying the angles (θ = 30°, 45°, 60°, 90°, and 120° between the two selected omniwheels and analysing the movement of TWOMR in forward direction and reverse direction on a smooth cement surface. Respectively, it is compared to itself for various angles (θ, to get its advantages and weaknesses. The conclusion of the paper provides effective movement of TWOMR at a particular angle (θ and also the application of TWOMR in different situations.

  20. Space Telecommunications Radio System STRS Cognitive Radio

    Science.gov (United States)

    Briones, Janette C.; Handler, Louis M.

    2013-01-01

    Radios today are evolving from awareness toward cognition. A software defined radio (SDR) provides the most capability for integrating autonomic decision making ability and allows the incremental evolution toward a cognitive radio. This cognitive radio technology will impact NASA space communications in areas such as spectrum utilization, interoperability, network operations, and radio resource management over a wide range of operating conditions. NASAs cognitive radio will build upon the infrastructure being developed by Space Telecommunication Radio System (STRS) SDR technology. This paper explores the feasibility of inserting cognitive capabilities in the NASA STRS architecture and the interfaces between the cognitive engine and the STRS radio. The STRS architecture defines methods that can inform the cognitive engine about the radio environment so that the cognitive engine can learn autonomously from experience, and take appropriate actions to adapt the radio operating characteristics and optimize performance.

  1. Provocative radio transients and base rate bias: a Bayesian argument for conservatism

    CERN Document Server

    Hair, Thomas W

    2012-01-01

    Most searches for alien radio transmission have focused on finding omni-directional or purposefully earth-directed beams of enduring duration. However, most of the interesting signals so far detected have been transient and non-repeatable in nature. These signals could very well be the first data points in an ever-growing data base of such signals used to construct a probabilistic argument for the existence of extraterrestrial intelligence. This paper looks at the effect base rate bias could have on deciding which signals to include in such an archive based upon the likely assumption that our ability to discern natural from artificial signals will be less than perfect.

  2. Design of a Novel UWB Omnidirectional Antenna Using Particle Swarm Optimization

    Directory of Open Access Journals (Sweden)

    Chengyang Yu

    2015-01-01

    Full Text Available A UWB E-plane omnidirectional microwave antenna is designed and fabricated for IEEE 802.11a communication system and microwave magnetron source system as a radiation monitor. A cooptimization method based on particle swarm optimization (PSO algorithm and FDTD software is presented. The presented PSO algorithm is useful in many industrial microwave applications, such as microwave magnetron design and other techniques with a high power level. The maximum measured relative bandwidth of 65% is achieved for the proposed antenna after a rapid and efficient optimization. Furthermore, the measured antenna polarization purity reaches about 20 dB at the communication C band. The PSO algorithm is a powerful candidate for microwave passive component design.

  3. Omnidirectional mirror based on Bragg stacks with a periodic gain-loss modulation

    Energy Technology Data Exchange (ETDEWEB)

    Manzanares-Martinez, Jesus; Ham-Rodriguez, Carlos Ivan [Departamento de Investigacion en Fisica, Universidad de Sonora, Apartado Postal 5-088, Hermosillo, Sonora 83000 (Mexico); Moctezuma-Enriquez, Damian, E-mail: foxonicos@gmail.com [Centro de Investigacion en Materiales Avanzados (CIMAV), Miguel de Cervantes 120, Chihuahua 31109 (Mexico); Manzanares-Martinez, Betsabe [Departamento de Fisica, Universidad de Sonora, Blvd. Luis Encinas y Rosales, Hermosillo, Sonora 83000 (Mexico)

    2014-01-15

    In this work we demonstrate that a Bragg Stack with a periodic gain-loss modulation can function as an Omnidirectional Mirror (OM) with complete reflection at any angle of incidence irrespective of the light polarization. The Bragg Stack is composed by the periodic variation of two layers with the same value of the real part of the refractive index (n{sub r}) and a periodic modulation in the imaginary part (n{sub i}). The origin of the band gaps is due to the interference of complex waves with propagating and evanescent fields in each layer. It is found that the band gaps are wider as the contrast n{sub i}/n{sub r} increases. We have found the ambient conditions to obtain an OM considering an auxiliary medium n{sup ′} external to the Bragg Stack.

  4. Engineered omnidirectional external-reflectivity spectra from one-dimensional layered interference filters.

    Science.gov (United States)

    Yablonovitch, E

    1998-11-01

    Owing to optical refraction, external rays that are incident upon a high-refractive-index medium fall within a small internal cone angle. A one-dimensionally periodic Bragg structure can reflect over an angular acceptance range that is greater than the small internal refraction cone, if the internal refractive-index contrast is sufficient. Thus Winn et al. [Opt. Lett. (to be published)] charted the range of refractive indices at which omnidirectional external reflection occurs. A wide spectral gap requires a high-index contrast. It is proposed that, by chirping or grading the periodicity of the structure, one can cover an arbitrarily wide spectral range with only a modest index contrast and, furthermore, that arbitrary spectral shapes can be produced. The graded-periodicity approach requires only a modest index contrast, provided that the average refractive index is >2 .

  5. Robust Redundant Input Reliable Tracking Control for Omnidirectional Rehabilitative Training Walker

    Directory of Open Access Journals (Sweden)

    Ping Sun

    2014-01-01

    Full Text Available The problem of robust reliable tracking control on the omnidirectional rehabilitative training walker is examined. The new nonlinear redundant input method is proposed when one wheel actuator fault occurs. The aim of the study is to design an asymptotically stable controller that can guarantee the safety of the user and ensure tracking on a training path planned by a physical therapist. The redundant degrees of freedom safety control and the asymptotically zero state detectable concept of the walker are presented, the model of redundant degree is constructed, and the property of center of gravity constant shift is obtained. A controller that can satisfy asymptotic stability is obtained using a common Lyapunov function for admissible uncertainties resulting from an actuator fault. Simulation results confirm the effectiveness of the proposed method and verify that the walker can provide safe sequential motion when one wheel actuator is at fault.

  6. Design and Construction of a Robotic Vehicle with Omni-directional Mecanum Wheels

    Directory of Open Access Journals (Sweden)

    Ján VACHÁLEK

    2014-06-01

    Full Text Available The paper deals with the design and construction of a universal robotic vehicle prototype, used for laboratory and educational purposes. The main goal is its use as a technology demonstrator for the needs of students, therefore it is equipped with several kinds of sensors and universal advanced control technologies and design solutions. Its basis is a control system and construction concept using mobile battery gear and omnidirectional Mecanum wheels. A manipulating arm and advanced tracking and spatial navigation systems are also components of the design. Since the problem of a customized design and construction of such a robotic vehicle is very complex and solved in various scientific fields, in this paper we will mainly focus on the detailed description of the control systems and subsystems of the vehicle.

  7. Highly conductive metal interconnects on three-dimensional objects fabricated with omnidirectional ink jet printing technology

    Science.gov (United States)

    Yoshida, Yasunori; Wada, Hikaru; Izumi, Konami; Tokito, Shizuo

    2017-05-01

    In this work, we demonstrate that highly conductive metal interconnects can be fabricated on the surface of three-dimensional objects using “omnidirectional ink jet” (OIJ) printing technology. OIJ printing technology makes it possible to perform ink jet printing in all directions by combining the motion of a 6-axis vertically articulated robot with precise positioning and a thermal drying process, which allows for the printing of stacked layers. By using OIJ technology, we were the first to successfully fabricate printed interconnect layers having a very low electrical resistance of 12 mΩ over a 10 mm length. Moreover, the results of the high-current test demonstrated that the printed interconnects can withstand high-current-flow of 5 A for 30 min or more.

  8. MPC-Based Path Following Control of an Omnidirectional Mobile Robot with Consideration of Robot Constraints

    Directory of Open Access Journals (Sweden)

    Kiattisin Kanjanawanishkul

    2015-01-01

    Full Text Available In this paper, the path following problem of an omnidirectional mobile robot (OMR has been studied. Unlike nonholonomic mobile robots, translational and rotational movements of OMRs can be controlled simultaneously and independently. However the constraints of translational and rotational velocities are coupled through the OMR's orientation angle. Therefore, a combination of a virtual-vehicle concept and a model predictive control (MPC strategy is proposed in this work to handle both robot constraints and the path following problem. Our proposed control scheme allows the OMR to follow the reference path successfully and safely, as illustrated in simulation experiments. The forward velocity is close to the desired one and the desired orientation angle is achieved at a given point on the path, while the robot's wheel velocities are maintained within boundaries.

  9. Thermally tunable broadband omnidirectional and polarization-independent super absorber using phase change material VO2

    Directory of Open Access Journals (Sweden)

    Zhejun Liu

    Full Text Available In this letter, we numerically demonstrate a thermally tunable super absorber by using phase change material VO2 as absorbing layer in metal-insulator-metal structure. An omnidirectional super absorption at λ=2.56μm can be realized by heating the patterned grating VO2 film due to magnetic resonance mechanism. Furthermore, a broadband super absorption higher than 0.8 in the entire 1.6μm–4μm region is achieved when VO2 film is patterned chessboard structure and transformed to metal phase beyond transition temperature. This broadband super absorption can be fulfilled in a wide range of incident angle (0°–70° and under all polarization conditions. Keywords: Phase change material, Metal-insulator-metal, Super absorption, Magnetic resonance

  10. Directional Relays for Multi-Hop Cooperative Cognitive Radio Networks

    Directory of Open Access Journals (Sweden)

    N. Nouri

    2013-09-01

    Full Text Available In this paper, we investigate power allocation and beamforming in a relay assisted cognitive radio (CR network. Our objective is to maximize the performance of the CR network while limiting interference in the direction of the primary users (PUs. In order to achieve these goals, we first consider joint power allocation and beamforming for cognitive nodes in direct links. Then, we propose an optimal power allocation strategy for relay nodes in indirect transmissions. Unlike the conventional cooperative relaying networks, the applied relays are equipped with directional antennas to further reduce the interference to PUs and meet the CR network requirements. The proposed approach employs genetic algorithm (GA to solve the optimization problems. Numerical simulation results illustrate the quality of service (QoS satisfaction in both primary and secondary networks. These results also show that notable improvements are achieved in the system performance if the conventional omni-directional relays are replaced with directional ones.

  11. Omnidirectional photonic band gap enlarged by one-dimensional ternary unmagnetized plasma photonic crystals based on a new Fibonacci quasiperiodic structure

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Haifeng [College of Electronic and Information Engineering, Nanjing University of Aeronautics and Astronautics, Nanjing 210016 (China); Nanjing Artillery Academy, Nanjing 211132 (China); Liu Shaobin [College of Electronic and Information Engineering, Nanjing University of Aeronautics and Astronautics, Nanjing 210016 (China); State Key Laboratory of Millimeter Waves of Southeast University, Nanjing Jiangsu 210096 (China); Kong Xiangkun; Bian Borui; Dai Yi [College of Electronic and Information Engineering, Nanjing University of Aeronautics and Astronautics, Nanjing 210016 (China)

    2012-11-15

    In this paper, an omnidirectional photonic band gap realized by one-dimensional ternary unmagnetized plasma photonic crystals based on a new Fibonacci quasiperiodic structure, which is composed of homogeneous unmagnetized plasma and two kinds of isotropic dielectric, is theoretically studied by the transfer matrix method. It has been shown that such an omnidirectional photonic band gap originates from Bragg gap in contrast to zero-n gap or single negative (negative permittivity or negative permeability) gap, and it is insensitive to the incidence angle and the polarization of electromagnetic wave. From the numerical results, the frequency range and central frequency of omnidirectional photonic band gap can be tuned by the thickness and density of the plasma but cease to change with increasing Fibonacci order. The bandwidth of omnidirectional photonic band gap can be notably enlarged. Moreover, the plasma collision frequency has no effect on the bandwidth of omnidirectional photonic band gap. It is shown that such new structure Fibonacci quasiperiodic one-dimensional ternary plasma photonic crystals have a superior feature in the enhancement of frequency range of omnidirectional photonic band gap compared with the conventional ternary and conventional Fibonacci quasiperiodic ternary plasma photonic crystals.

  12. Effect of temperature on terahertz photonic and omnidirectional band gaps in one-dimensional quasi-periodic photonic crystals composed of semiconductor InSb.

    Science.gov (United States)

    Singh, Bipin K; Pandey, Praveen C

    2016-07-20

    Engineering of thermally tunable terahertz photonic and omnidirectional bandgaps has been demonstrated theoretically in one-dimensional quasi-periodic photonic crystals (PCs) containing semiconductor and dielectric materials. The considered quasi-periodic structures are taken in the form of Fibonacci, Thue-Morse, and double periodic sequences. We have shown that the photonic and omnidirectional bandgaps in the quasi-periodic structures with semiconductor constituents are strongly depend on the temperature, thickness of the constituted semiconductor and dielectric material layers, and generations of the quasi-periodic sequences. It has been found that the number of photonic bandgaps increases with layer thickness and generation of the quasi-periodic sequences. Omnidirectional bandgaps in the structures have also been obtained. Results show that the bandwidths of photonic and omnidirectional bandgaps are tunable by changing the temperature and lattice parameters of the structures. The generation of quasi-periodic sequences can also change the properties of photonic and omnidirectional bandgaps remarkably. The frequency range of the photonic and omnidirectional bandgaps can be tuned by the change of temperature and layer thickness of the considered quasi-periodic structures. This work will be useful to design tunable terahertz PC devices.

  13. Measurements methodology for evaluation of Digital TV operation in VHF high-band

    Science.gov (United States)

    Pudwell Chaves de Almeida, M.; Vladimir Gonzalez Castellanos, P.; Alfredo Cal Braz, J.; Pereira David, R.; Saboia Lima de Souza, R.; Pereira da Soledade, A.; Rodrigues Nascimento Junior, J.; Ferreira Lima, F.

    2016-07-01

    This paper describes the experimental setup of field measurements carried out for evaluating the operation of the ISDB-TB (Integrated Services Digital Broadcasting, Terrestrial, Brazilian version) standard digital TV in the VHF-highband. Measurements were performed in urban and suburban areas in a medium-sized Brazilian city. Besides the direct measurements of received power and environmental noise, a measurement procedure involving the injection of Gaussian additive noise was employed to achieve the signal to noise ratio threshold at each measurement site. The analysis includes results of static reception measurements for evaluating the received field strength and the signal to noise ratio thresholds for correct signal decoding.

  14. Luminous phenomena and electromagnetic VHF wave emission originated from earthquake-related radon exhalation

    Science.gov (United States)

    Seki, A.; Tobo, I.; Omori, Y.; Muto, J.; Nagahama, H.

    2013-12-01

    Anomalous luminous phenomena and electromagnetic wave emission before or during earthquakes have been reported (e.g., the 1965 Matsushiro earthquake swarm). However, their mechanism is still unsolved, in spite of many models for these phenomena. Here, we propose a new model about luminous phenomena and electromagnetic wave emission during earthquake by focusing on atmospheric radon (Rn-222) and its daughter nuclides (Po-218 and Po-214). Rn-222, Po-218 and Po-214 are alpha emitters, and these alpha particles ionize atmospheric molecules. A light emission phenomenon, called 'the air luminescence', is caused by de-excitation of the ionized molecules of atmospheric nitrogen due to electron impact ionization from alpha particles. The de-excitation is from the second positive system of neutral nitrogen molecules and the first negative system of nitrogen molecule ion. Wavelengths of lights by these transitions include the visible light wavelength. So based on this mechanism, we proposed a new luminous phenomenon model before or during earthquake: 1. The concentration of atmospheric radon and its daughter nuclides increase anomalously before or during earthquakes, 2. Nitrogen molecules and their ions are excited by alpha particles emitted from Rn-222, Po-218 and Po-214, and air luminescence is generated by their de-excitation. Similarly, electromagnetic VHF wave emission can be explained by ionizing effect of radon and its daughter nuclides. Boyarchuk et al. (2005) proposed a model that electromagnetic VHF wave emission is originated when excited state of neutral clusters changes. Radon gas ionizes atmosphere and forms positively and negatively charged heavy particles. The process of ion hydration in ordinary air can be determined by the formation of complex chemically active structures of the various types of ion radicals. As a result of the association of such hydration radical ions, a neutral cluster, which is dipole quasi-molecules, is formed. A neutral cluster

  15. Observations of Mesospheric Turbulence by Rocket Probe and VHF Radar, Part 2.4A

    Science.gov (United States)

    Royrvik, O.; Smith, L. G.

    1984-01-01

    Data from the Jicamarca VHF radar and from a Languir probe fine-structure on a Nike Orion rocket launched from Punto Lobos, Peru, have been compared. A single mesospheric scattering layer was observed by the radar. The Langmuir probe detected irregularities in the electron-density profile in a narrow region between 85.2 and 86.6 km. It appears from a comparison between these two data sets that turbulence in the neutral atmosphere is the mechanism generating the refractive index irregularities.

  16. Web-Mediated Augmentation and Interactivity Enhancement of Omni-Directional Video in Both 2D and 3D

    OpenAIRE

    Wijnants, Maarten; Van Erum, Kris; QUAX, Peter; Lamotte, Wim

    2015-01-01

    Video consumption has since the emergence of the medium largely been a passive affair. This paper proposes augmented Omni-Directional Video (ODV) as a novel format to engage viewers and to open up new ways of interacting with video content. Augmented ODV blends two important contemporary technologies: Augmented Video Viewing and 360 degree video. The former allows for the addition of interactive features to Web-based video playback, while the latter unlocks spatial video navigation opportunit...

  17. A Low Power RC-Coupled VHF Amplifier Designed for Fabrication by Hybrid Microcircuit Techniques.

    Science.gov (United States)

    RADIOFREQUENCY AMPLIFIERS, HYBRID CIRCUITS, MICROMINIATURIZATION , VERY HIGH FREQUENCY, MODULES(ELECTRONICS), TRANSISTOR AMPLIFIERS, RADIO RECEIVERS, COMMUNICATION EQUIPMENT, SATELLITE COMMUNICATIONS.

  18. Realization of Quasi-Omnidirectional Solar Cells with Superior Electrical Performance by All-Solution-Processed Si Nanopyramids.

    Science.gov (United States)

    Zhong, Sihua; Wang, Wenjie; Tan, Miao; Zhuang, Yufeng; Shen, Wenzhong

    2017-11-01

    Large-scale (156 mm × 156 mm) quasi-omnidirectional solar cells are successfully realized and featured by keeping high cell performance over broad incident angles (θ), via employing Si nanopyramids (SiNPs) as surface texture. SiNPs are produced by the proposed metal-assisted alkaline etching method, which is an all-solution-processed method and highly simple together with cost-effective. Interestingly, compared to the conventional Si micropyramids (SiMPs)-textured solar cells, the SiNPs-textured solar cells possess lower carrier recombination and thus superior electrical performances, showing notable distinctions from other Si nanostructures-textured solar cells. Furthermore, SiNPs-textured solar cells have very little drop of quantum efficiency with increasing θ, demonstrating the quasi-omnidirectional characteristic. As an overall result, both the SiNPs-textured homojunction and heterojunction solar cells possess higher daily electric energy production with a maximum relative enhancement approaching 2.5%, when compared to their SiMPs-textured counterparts. The quasi-omnidirectional solar cell opens a new opportunity for photovoltaics to produce more electric energy with a low cost.

  19. Realization of Quasi‐Omnidirectional Solar Cells with Superior Electrical Performance by All‐Solution‐Processed Si Nanopyramids

    Science.gov (United States)

    Zhong, Sihua; Wang, Wenjie; Tan, Miao; Zhuang, Yufeng

    2017-01-01

    Abstract Large‐scale (156 mm × 156 mm) quasi‐omnidirectional solar cells are successfully realized and featured by keeping high cell performance over broad incident angles (θ), via employing Si nanopyramids (SiNPs) as surface texture. SiNPs are produced by the proposed metal‐assisted alkaline etching method, which is an all‐solution‐processed method and highly simple together with cost‐effective. Interestingly, compared to the conventional Si micropyramids (SiMPs)‐textured solar cells, the SiNPs‐textured solar cells possess lower carrier recombination and thus superior electrical performances, showing notable distinctions from other Si nanostructures‐textured solar cells. Furthermore, SiNPs‐textured solar cells have very little drop of quantum efficiency with increasing θ, demonstrating the quasi‐omnidirectional characteristic. As an overall result, both the SiNPs‐textured homojunction and heterojunction solar cells possess higher daily electric energy production with a maximum relative enhancement approaching 2.5%, when compared to their SiMPs‐textured counterparts. The quasi‐omnidirectional solar cell opens a new opportunity for photovoltaics to produce more electric energy with a low cost. PMID:29201616

  20. An HF and lower VHF spectrum assessment system exploiting instantaneously wideband capture

    Science.gov (United States)

    Barnes, Rod I.; Singh, Malkiat; Earl, Fred

    2017-09-01

    We report on a spectral environment evaluation and recording (SEER) system, for instantaneously wideband spectral capture and characterization in the HF and lower VHF band, utilizing a direct digital receiver coupled to a data recorder. The system is designed to contend with a wide variety of electromagnetic environments and to provide accurately calibrated spectral characterization and display from very short (ms) to synoptic scales. The system incorporates a novel RF front end involving automated gain and equalization filter selection which provides an analogue frequency-dependent gain characteristic that mitigates the high dynamic range found across the HF and lower VHF spectrum. The system accurately calibrates its own internal noise and automatically subtracts this from low variance, external spectral estimates, further extending the dynamic range over which robust characterization is possible. Laboratory and field experiments demonstrate that the implementation of these concepts has been effective. Sensitivity to varying antenna load impedance of the internal noise reduction process has been examined. Examples of software algorithms to provide extraction and visualization of spectral behavior over narrowband, wideband, short, and synoptic scales are provided. Application in HF noise spectral density monitoring, spectral signal strength assessment, and electromagnetic interference detection is possible with examples provided. The instantaneously full bandwidth collection provides some innovative applications, and this is demonstrated by the collection of discrete lightning emissions, which form fast ionograms called "flashagrams" in power-delay-frequency plots.

  1. PMSE strength during enhanced D region electron densities: Faraday rotation and absorption effects at VHF frequencies

    Science.gov (United States)

    Chau, Jorge L.; Röttger, Jürgen; Rapp, Markus

    2014-10-01

    In this paper we study the effects of absorption and Faraday rotation on measurements of polar mesosphere summer echoes (PMSE). We found that such effects can produce significant reduction of signal-to-noise ratio (SNR) when the D region electron densities (Ne) are enhanced, and VHF radar systems with linearly polarized antennas are used. In particular we study the expected effects during the strong solar proton event (SPE) of July 2000, also known as the Bastille day flare event. During this event, a strong anti-correlation between the PMSE SNR and the D-region Ne was found over three VHF radar sites at high latitudes: Andøya, Kiruna, and Svalbard. This anti-correlation has been explained (a) in terms of transport effects due to strong electric fields associated to the SPE and (b) due to a limited amount of aerosol particles as compared to the amount of D-region electrons. Our calculations using the Ne profiles used by previous researchers explain most, if not all, of the observed SNR reduction in both time (around the SPE peak) and altitude. This systematic effect, particularly the Faraday rotation, should be recognized and tested, and possibly avoided (e.g., using circular polarization), in future observations during the incoming solar maximum period, to contribute to the understanding of PMSE during enhanced D region Ne.

  2. A Long-Range Directional Wake-Up Radio for Wireless Mobile Networks

    Directory of Open Access Journals (Sweden)

    Wen-Chan Shih

    2015-08-01

    Full Text Available This paper describes a long-range directional wake-up radio (LDWuR for wireless mobile networks. In contrast to most wake-up radios (WuR to date, which are short range, ours is applicable to long-range deployments. Existing studies achieve long distance by using modulation and coding schemes or by directional antennas, though the latter require exploring the direction of the transmitter. To address this issue, our LDWuR adopts both static and dynamic antennas, where the static ones are directional, while the dynamic ones are omnidirectional for beamforming. We present our LDWuR prototype and design principle. Simulation results show that our LDWuR and event-driven MAC protocol suppress the idle-listening of Wi-Fi stations in a wireless network, thereby enhancing the Wi-Fi power savings.

  3. Molecular Switching in Confined Spaces: Effects of Encapsulating the DHA/VHF Photo-Switch in Cucurbiturils.

    Science.gov (United States)

    Petersen, Michael Å; Rasmussen, Brian; Andersen, Nicolaj N; Sauer, Stephan P A; Nielsen, Mogens Brøndsted; Beeren, Sophie R; Pittelkow, Michael

    2017-09-18

    Confinement of reactive chemical species uniquely affects chemical reactivity by restricting the physical space available and by restricting access to interactions with the solvent. In Nature, for example, confined protein binding pockets govern processes following photoisomerization reactions and the isomerizations themselves. Here we describe the first example of a dihydroazulene/vinylheptafulvene (DHA/VHF) photo-switch functioning in water, and we show how its switching behavior is strongly influenced by supramolecular interactions with a series of cucurbit[n]uril (CB) host molecules. In CB7 inclusion complexes, the kinetics of the thermal VHF-to-DHA back-reaction is accelerated, while in CB8 inclusion complexes, the kinetics is slowed down as compared to the free photo-switch. The effect of the CB encapsulation of the photo-switch can be effectively canceled by introducing a guest that binds the CB more strongly. According to DFT calculations, a stabilization of the reactive s-cis VHF conformer relative to the s-trans VHF appears to be a contributing factor responsible for the accelerated back-reaction when encapsulated in CB7. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  4. A New Peak of Leonids observed by Radio Technics

    Science.gov (United States)

    Suzuki, K.; Maegawa, K.; Minagawa, Y.

    Radio meteor observations with amateur ham radio wave have been carried out in Japan since August, 1996, by using forward-scattered meteor echoes of VHF radio waves (53.75MHz, 50W, CW) transmitted in Sabae, Fukui prefecture. A strong activity of Leonids was observed between 22h and 01h on November 16/17 (UT), 1996. The hourly rate of long duration echoes reached over 50 times larger than in non-shower period and 1.2 to 1.5 times larger than that at the normal maximum of Leonids, respectively. This enhanced activity occurred at a solar longitude (SL) of 234.95 plus or minus 0.05 degrees (2000.0 eq.), and is probably different from normal peak of Leonids at 235.45 plus or minus 0.05 degrees(2000.0 eq.) observed in 1990's. A corresponding peak in 1995 was also reported by visual meteor observation by many observers in Japan. The ascending node of Comet Tempel-Tuttle in 1966 was at 235.11 degrees in SL, and is closer to the new peak than the normal one (at 235.45 degrees in SL).

  5. Performance of Global-Appearance Descriptors in Map Building and Localization Using Omnidirectional Vision

    Directory of Open Access Journals (Sweden)

    Luis Payá

    2014-02-01

    Full Text Available Map building and localization are two crucial abilities that autonomous robots must develop. Vision sensors have become a widespread option to solve these problems. When using this kind of sensors, the robot must extract the necessary information from the scenes to build a representation of the environment where it has to move and to estimate its position and orientation with robustness. The techniques based on the global appearance of the scenes constitute one of the possible approaches to extract this information. They consist in representing each scene using only one descriptor which gathers global information from the scene. These techniques present some advantages comparing to other classical descriptors, based on the extraction of local features. However, it is important a good configuration of the parameters to reach a compromise between computational cost and accuracy. In this paper we make an exhaustive comparison among some global appearance descriptors to solve the mapping and localization problem. With this aim, we make use of several image sets captured in indoor environments under realistic working conditions. The datasets have been collected using an omnidirectional vision sensor mounted on the robot.

  6. Three forms of omnidirectional acoustic invisibility engineered using fast elastodynamic transfer-matrix method

    Science.gov (United States)

    Bowen, Patrick T.; Urzhumov, Yaroslav A.

    2016-04-01

    Acoustic metamaterial structures with discrete and continuous rotational symmetries attract interest of theorists and engineers due to the relative simplicity of their design and fabrication. They are also likely candidates for omnidirectional acoustic cloaking and other transformation-acoustical novelties. In this paper, we employ a stratified description of such structures, and develop the theory and an efficient symbolic/numerical algorithm for analyzing the scattering properties of such structures immersed in homogeneous fluid environments. The algorithm calculates the partial scattering amplitudes and the related scattering phases for an arbitrary layered distribution of acoustic material properties. The efficiency of the algorithm enables us to find approximate solutions to certain inverse scattering problems through quasi-global optimization. The scattering problems addressed here are the three forms of cloaking: (1) extinction cross-section suppression, the canonical form of cloaking, (2) monostatic sonar invisibility (backscattering suppression), and (3) acoustic force cloaking (transport cross-section suppression). We also address the efficiency-bandwidth tradeoff and design approximate cloaks with wider bandwidth using a new optimization formulation.

  7. A Motion Planning Method for Omnidirectional Mobile Robot Based on the Anisotropic Characteristics

    Directory of Open Access Journals (Sweden)

    Chuntao Leng

    2008-11-01

    Full Text Available A more suitable motion planning method for an omni-directional mobile robot (OMR, an improved APF method (iAPF, is proposed in this paper by introducing the revolving factor into the artificial potential field (APF. Accordingly, the motion direction derived from traditional artificial potential field (tAPF is regulated. The maximum velocity, maximum acceleration and energy consumption of the OMR moving in different directions are analyzed, based on the kinematic and dynamic constraints of an OMR, and the anisotropy of OMR is presented in this paper. Then the novel concept of an Anisotropic-Function is proposed to indicate the quality of motion in different directions, which can make a very favorable trade-off between time-optimality, stability and efficacy-optimality. In order to obtain the optimal motion, the path that the robot can take in order to avoid the obstacle safely and reach the goal in a shorter path is deduced. Finally, simulations and experiments are carried out to demonstrate that the motion resulting from the iAPF is high-speed, highly stable and highly efficient when compared to the tAPF.

  8. Omnidirectional regeneration (ODR) of proximity sensor signals for robust diagnosis of journal bearing systems

    Science.gov (United States)

    Jung, Joon Ha; Jeon, Byung Chul; Youn, Byeng D.; Kim, Myungyon; Kim, Donghwan; Kim, Yeonwhan

    2017-06-01

    Some anomaly states of journal bearing rotor systems are direction-oriented (e.g., rubbing, misalignment). In these situations, vibration signals vary according to the direction of the sensors and the health state. This makes diagnosis difficult with traditional diagnosis methods. This paper proposes an omnidirectional regeneration method to develop a robust diagnosis algorithm for rotor systems. The proposed method can generate vibration signals in arbitrary directions without using extra sensors. In this method, signals are generated around the entire circumference of the rotor to consider all possible directions. Then, the directionality of each state is proved by mathematically and is evaluated using a proposed metric. When a directional state is determined, the classification is carried out on all of the generated signals. When a non-directional state is found, the classification is performed on only one of the generated signals to minimize computational load without sacrificing accuracy. The proposed ODR method was validated using experimental data. The classification results show that the proposed method generally outperforms the conventional classification method. The results support the proposed concept of using ODR signals in diagnosis procedures for journal bearing systems.

  9. Immersive Molecular Visualization with Omnidirectional Stereoscopic Ray Tracing and Remote Rendering.

    Science.gov (United States)

    Stone, John E; Sherman, William R; Schulten, Klaus

    2016-05-01

    Immersive molecular visualization provides the viewer with intuitive perception of complex structures and spatial relationships that are of critical interest to structural biologists. The recent availability of commodity head mounted displays (HMDs) provides a compelling opportunity for widespread adoption of immersive visualization by molecular scientists, but HMDs pose additional challenges due to the need for low-latency, high-frame-rate rendering. State-of-the-art molecular dynamics simulations produce terabytes of data that can be impractical to transfer from remote supercomputers, necessitating routine use of remote visualization. Hardware-accelerated video encoding has profoundly increased frame rates and image resolution for remote visualization, however round-trip network latencies would cause simulator sickness when using HMDs. We present a novel two-phase rendering approach that overcomes network latencies with the combination of omnidirectional stereoscopic progressive ray tracing and high performance rasterization, and its implementation within VMD, a widely used molecular visualization and analysis tool. The new rendering approach enables immersive molecular visualization with rendering techniques such as shadows, ambient occlusion lighting, depth-of-field, and high quality transparency, that are particularly helpful for the study of large biomolecular complexes. We describe ray tracing algorithms that are used to optimize interactivity and quality, and we report key performance metrics of the system. The new techniques can also benefit many other application domains.

  10. Controllable Nanoscale Inverted Pyramids for High-Efficient Quasi-Omnidirectional Crystalline Silicon Solar Cells.

    Science.gov (United States)

    Xu, Haiyuan; Zhong, Sihua; Zhuang, Yufeng; Shen, Wenzhong

    2017-11-14

    Nanoscale inverted pyramid structures (NIPs) have always been regarded as one of the most paramount light management schemes to achieve the extraordinary performance in various devices, especially in solar cells, due to their outstanding antireflection ability with relative lower surface enhancement ratio. However, the current approaches to fabricating the NIPs are complicated and not cost-effective for the massive cell production in the photovoltaic industry. Here, controllable NIPs are fabricated on crystalline silicon (c-Si) wafers by Ag catalyzed chemical etching and alkaline modification, which is a preferable all-solution-processed method. Through applying the NIPs to c-Si solar cells and optimizing the cell design, we have successfully achieved highly efficient NIPs textured solar cells with the champion efficiency of 20.5%. Importantly, the NIPs textured solar cells are further demonstrated to possess the quasi-omnidirectional property over the broad sunlight incident angles of approximately 0°-60°. Moreover, the NIPs are theoretically revealed to offer light trapping advantage for ultrathin c-Si solar cells. Hence, the NIPs formed by the controllable method exhibit a great potential to be used in the future photovoltaic industry as surface texture. © 2017 IOP Publishing Ltd.

  11. An FPGA-Based Omnidirectional Vision Sensor for Motion Detection on Mobile Robots

    Directory of Open Access Journals (Sweden)

    Jones Y. Mori

    2012-01-01

    Full Text Available This work presents the development of an integrated hardware/software sensor system for moving object detection and distance calculation, based on background subtraction algorithm. The sensor comprises a catadioptric system composed by a camera and a convex mirror that reflects the environment to the camera from all directions, obtaining a panoramic view. The sensor is used as an omnidirectional vision system, allowing for localization and navigation tasks of mobile robots. Several image processing operations such as filtering, segmentation and morphology have been included in the processing architecture. For achieving distance measurement, an algorithm to determine the center of mass of a detected object was implemented. The overall architecture has been mapped onto a commercial low-cost FPGA device, using a hardware/software co-design approach, which comprises a Nios II embedded microprocessor and specific image processing blocks, which have been implemented in hardware. The background subtraction algorithm was also used to calibrate the system, allowing for accurate results. Synthesis results show that the system can achieve a throughput of 26.6 processed frames per second and the performance analysis pointed out that the overall architecture achieves a speedup factor of 13.78 in comparison with a PC-based solution running on the real-time operating system xPC Target.

  12. Cell density-dependent differential proliferation of neural stem cells on omnidirectional nanopore-arrayed surface.

    Science.gov (United States)

    Cha, Kyoung Je; Kong, Sun-Young; Lee, Ji Soo; Kim, Hyung Woo; Shin, Jae-Yeon; La, Moonwoo; Han, Byung Woo; Kim, Dong Sung; Kim, Hyun-Jung

    2017-10-12

    Recently, the importance of surface nanotopography in the determination of stem cell fate and behavior has been revealed. In the current study, we generated polystyrene cell-culture dishes with an omnidirectional nanopore arrayed surface (ONAS) (diameter: 200 nm, depth: 500 nm, center-to-center distance: 500 nm) and investigated the effects of nanotopography on rat neural stem cells (NSCs). NSCs cultured on ONAS proliferated better than those on the flat surface when cell density was low and showed less spontaneous differentiation during proliferation in the presence of mitogens. Interestingly, NSCs cultured on ONAS at clonal density demonstrated a propensity to generate neurospheres, whereas those on the flat surface migrated out, proliferated as individuals, and spread out to attach to the surface. However, the differential patterns of proliferation were cell density-dependent since the distinct phenomena were lost when cell density was increased. ONAS modulated cytoskeletal reorganization and inhibited formation of focal adhesion, which is generally observed in NSCs grown on flat surfaces. ONAS appeared to reinforce NSC-NSC interaction, restricted individual cell migration and prohibited NSC attachment to the nanopore surface. These data demonstrate that ONAS maintains NSCs as undifferentiated while retaining multipotency and is a better topography for culturing low density NSCs.

  13. Analysis of Closure Characteristics of a MEMS Omnidirectional Inertial Switch under Shock Loads

    Directory of Open Access Journals (Sweden)

    Yun Cao

    2015-01-01

    Full Text Available A preliminary theoretical method for calculating contact time of a dual mass-spring system applied to shock acceleration was proposed based on the MEMS omnidirectional inertial switch. The influence of relevant parameters on the contact time was analyzed, and the theoretical results were in agreement with the simulation predictions. The theoretical method could provide the design of MEMS inertial switch for prolonged contact time. The system stiffness of the mass-spring system in all directions was obtained by using the FE method. Dynamic contact simulation results of contact time in typical directions under the applied shock acceleration indicate that the switch has a contact time within the range of 33 μs to 95 μs and has an enhanced contact effect with the dual mass-spring system in the MEMS inertial switch. The fabricated switches were tested by a shock test device. The results show that the switch can be reliably closed in all directions under the applied shock acceleration and has a long contact time, which is basically in accordance with the theoretical results.

  14. Radio frequency detection assembly and method for detecting radio frequencies

    Science.gov (United States)

    Cown, Steven H.; Derr, Kurt Warren

    2010-03-16

    A radio frequency detection assembly is described and which includes a radio frequency detector which detects a radio frequency emission produced by a radio frequency emitter from a given location which is remote relative to the radio frequency detector; a location assembly electrically coupled with the radio frequency detector and which is operable to estimate the location of the radio frequency emitter from the radio frequency emission which has been received; and a radio frequency transmitter electrically coupled with the radio frequency detector and the location assembly, and which transmits a radio frequency signal which reports the presence of the radio frequency emitter.

  15. Complementary code and digital filtering for detection of weak VHF radar signals from the mesoscale. [SOUSY-VHF radar, Harz Mountains, Germany

    Science.gov (United States)

    Schmidt, G.; Ruster, R.; Czechowsky, P.

    1983-01-01

    The SOUSY-VHF-Radar operates at a frequency of 53.5 MHz in a valley in the Harz mountains, Germany, 90 km from Hanover. The radar controller, which is programmed by a 16-bit computer holds 1024 program steps in core and controls, via 8 channels, the whole radar system: in particular the master oscillator, the transmitter, the transmit-receive-switch, the receiver, the analog to digital converter, and the hardware adder. The high-sensitivity receiver has a dynamic range of 70 dB and a video bandwidth of 1 MHz. Phase coding schemes are applied, in particular for investigations at mesospheric heights, in order to carry out measurements with the maximum duty cycle and the maximum height resolution. The computer takes the data from the adder to store it in magnetic tape or disc. The radar controller is programmed by the computer using simple FORTRAN IV statements. After the program has been loaded and the computer has started the radar controller, it runs automatically, stopping at the program end. In case of errors or failures occurring during the radar operation, the radar controller is shut off caused either by a safety circuit or by a power failure circuit or by a parity check system.

  16. Frequency Reuse, Cell Separation, and Capacity Analysis of VHF Digital Link Mode 3 TDMA

    Science.gov (United States)

    Shamma, Mohammed A.; Nguyen, Thanh C.; Apaza, Rafael D.

    2003-01-01

    The most recent studies by the Federal Aviation Administration (FAA) and the aviation industry have indicated that it has become increasingly difficult to make new VHF frequency or channel assignments to meet the aviation needs for air-ground communications. FAA has planned for several aggressive improvement measures to the existing systems, but these measures would not meet the projected voice communications needs beyond 2009. FAA found that since 1974 there has been, on the average, a 4 percent annual increase in the number of channel assignments needed to satisfy the air-ground communication traffic (approximately 300 new channel assignments per year). With the planned improvement measures, the channel assignments are expected to reach a maximum number of 16615 channels by about 2010. Hence, the FAA proposed the use of VDL Mode 3 as a new integrated digital voice and data communications systems to meet the future air traffic demand. This paper presents analytical results of frequency reuse; cell separation and capacity estimation of VDL Mode 3 TDMA systems that FAA has planned to implement the future VHF air-ground communications system by the year 2010. For TDMA, it is well understood that the frequency reuse factor is a crucial parameter for capacity estimation. Formulation of this frequency reuse factor is shown, taking into account the limitation imposed by the requirement to have a sufficient Signal to Co-Channel Interference Ratio. Several different values for the Signal to Co-Channel Interference Ratio were utilized corresponding to the current analog VHF DSB-AM systems, and the future digital VDL Mode 3. The required separation of Co-Channel cells is computed for most of the Frequency Protected Service Volumes (FPSV's) currently in use by the FAA. Additionally, the ideal cell capacity for each FPSV is presented. Also, using actual traffic for the Detroit air space, a FPSV traffic distribution model is used to generate a typical cell for channel capacity

  17. Layered Polar Mesospheric Summer Echoes Observed with the Tri-Static Eiscat VHF

    Science.gov (United States)

    Mann, I.; Anyairo, C.; Häggström, I.; Tjulin, A.

    2014-12-01

    Polar mesospheric summer echoes (PMSE) are strong radar echoes that are typically observed at 50 to 500 MHz. They are often discussed in the context of dusty plasma studies and linked to e.g. the existence of charged ice particles, neutral atmospheric turbulence and atmospheric stratification. The PMSE are observed at mesospheric temperature minimum when ice particles form, though the exact path of formation is still a topic for research. Mesospheric smoke particles that are assumed to form after or during the meteor ablation process possibly contribute to the formation of the ice particles. For understanding the formation of the radar echoes their variation with scattering angle is an important parameter. We analyze PMSE observations with the tri-static EISCAT VHF radar (224 MHz) during one day in June when PMSE were observed almost continuously from 7:00 to 13:00 UT. The radar signal was transmitted and received in zenith direction with the EISCAT VHF antenna near Tromsø. The receivers in Kiruna and Sodankylä were pointed at typical PMSE heights above the Tromsø transmitter and detected radar reflections at the same time and altitude as the Tromsø radar. The altitude of the PMSE changed with time and the extension of the echoes in altitude was smaller toward the end of the observation. These observations are among the first tri-static observations of PMSE. The observations suggest that the scattering process underlying the PMSE occurs over a broad range of scattering angles. Based on the observations we will show that the spectral width of the received echoes is most likely determined by the variations within the observed volume rather than by the scattering process. The observed frequency shifts suggest a layer structure and horizontal motions that vary with altitude. UHF (933 MHz) radar observations were carried out in parallel, they display predominantly incoherent scatter and an electron density typical for the altitude. Some other studies, have in

  18. 78 FR 25404 - Proposed Establishment of Class E Airspace; Grand Canyon, AZ

    Science.gov (United States)

    2013-05-01

    ...This action proposes to establish Class E airspace at the Grand Canyon VHF Omni-Directional Radio Range/Distance Measuring Equipment (VOR/DME) navigation aid, Grand Canyon, AZ, to facilitate vectoring of Instrument Flight Rules (IFR) aircraft under control of Los Angeles Air Route Traffic Control Center (ARTCC). The FAA is proposing this action to enhance the safety and management of aircraft operations within the National Airspace System.

  19. Quantifying the TV White Spaces Spectrum Opportunity for Cognitive Radio Access

    Science.gov (United States)

    Nekovee, Maziar

    Cognitive radio is being intensively researched for opportunistic access to the so-called TV White Spaces (TVWS): large portions of the VHF/UHF TV bands which become available on a geographical basis after the digital switchover. In this paper we take a step back from the excitement surrounding TVWS, and quantitatively examine the real spectrum opportunity associated with this form of access. Using accurate digital TV (DTV) coverage maps together with a database of DTV transmitters, we develop a methodology for identifying TVWS frequencies at any given location in the United Kingdom. We use our methodology to investigate variations in TVWS as a function of the location and transmit power of cognitive radios, and examine how constraints on adjacent channel interference imposed by regulators may affect the results. Our analysis provides a realistic view on the spectrum opportunity associated with cognitive devices, and presents the first quantitative study of the availability and frequency composition of TWVS outside the United States.

  20. Disturbance-induced responses of VHF and satellite tagged harbour seals

    DEFF Research Database (Denmark)

    Andersen, Signe May; Teilmann, Jonas; Dietz, Rune

    2014-01-01

    ABSTRACT 1. The response of individual harbour seals (Phoca vitulina) to controlled and sporadic disturbances when hauled out in the Anholt seal reserve, Denmark, was studied. Sporadic disturbances from pedestrians, boats, low-flying aeroplanes and grey seals (Halichoerus grypus) were observed...... in or near the reserve. VHF and satellite transmitters were attached to eight harbour seals to determine post-disturbance and undisturbed behaviour during the pre-breeding period (25 April to 21 May 2008). 2. Both disturbed and undisturbed seals mostly returned to the haul-out site from dusk and throughout...... within 40 km from the haul-out site. The maximum extent of post-disturbance trips, however, varied among individuals and disturbance types, and was strongly correlated with the duration of trips. 3. Disturbed and undisturbed seals used the same areas, suggesting that these areas represent normal foraging...

  1. Graphene-based tunable non-foster circuit for VHF applications

    Directory of Open Access Journals (Sweden)

    Jing Tian

    2016-06-01

    Full Text Available This paper presents a negative impedance converter (NIC based on graphene field effect transistors (GFETs for VHF applications. The NIC is designed following Linvill’s open circuit stable (OCS topology. The DC modelling parameters of GFET are extracted from a device measured by Meric et al. [IEEE Electron Devices Meeting, 23.2.1 (2010] Estimated parasitics are also taken into account. Simulation results from Keysight Advanced Design System (ADS show good NIC performance up to 200 MHz and the value of negative capacitance is directly proportional to the capacitive load. In addition, it has been shown that by varying the supply voltage the value of negative capacitance can also be tuned. The NIC stability has been tested up to 2 GHz (10 times the maximum operation frequency using Nyquist stability criterion to ensure there are no oscillation issues.

  2. Recent Comparisons of VHF Lightning Mapping Using Interferometry and Time-of-Arrival Techniques

    Science.gov (United States)

    Lojou, J.; Cummins, K. L.

    2005-12-01

    As part of Vaisala's technology and applications test bed in the Dallas-Fort Worth area in Texas, we have been operating two overlapping Total Lightning detection networks. One network employs VHF Interferometry (both 2- and 3-timensional instrumentation) and the other employs VHF 3-dimensional Time-Of-Arrival (TOA) techniques. For the first time, these two technologies can be compared and contrasted in a common region where they both exhibit good performance. The aim of the work presented is to evaluate the spatial and temporal "description" of lightning flashes provided by these two techniques, and to compare and contrast the relative strengths of these two approaches for Total Lightning mapping. This study employs data acquired during the summer of 2005. The analysis set includes data obtained by these two networks, as well as cloud-to-ground location data from the U.S. National Lightning Detection Network (NLDN). The spatial extent and vertical profile of sources from individual in-cloud and cloud-to-ground flashes are compared for various storm conditions, with both technologies clearly contributing supplemental information not provided by the other. Leader propagation velocities show a substantially unimodal distribution centered at about 105 m/s for TOA-derived sources, whereas the velocity distribution for sources detected using interferometry exhibit a bimodal distribution with the second mode at about 107 m/s. The most-probable interval-between-sources for TOA-derived sources seems to be a few milliseconds, whereas interferometry produces large populations with intervals near 100 microseconds and 100 milliseconds.

  3. Impact of cognitive radio on radio astronomy

    NARCIS (Netherlands)

    Bentum, Marinus Jan; Boonstra, A.J.; Baan, W.A.

    2010-01-01

    The introduction of new communication techniques requires an increase in the efficiency of spectrum usage. Cognitive radio is one of the new techniques that fosters spectrum efficiency by using unoccupied frequency spectrum for communications. However, cognitive radio will increase the transmission

  4. Radio Stalin as an example of the Czech pirate radio

    OpenAIRE

    Prágrová, Šárka

    2017-01-01

    Diploma thesis "Radio Stalin as an example of Czech piracy radio broadcast" is aimed to complexly present radio station Radio Stalin which was broadcasting in October 1990 in Prague. Radio Stalin is presented in the context of events of that time and related changes in politics, economy, society and media and in the context of piracy radio broadcast. First of all the emphasis is put on media transformation and changes in legislative framework of radio broadcasting after 1989. Radio Stalin is ...

  5. Leaving home [radio drama

    OpenAIRE

    Lawrence, Conan

    2014-01-01

    A 50 minute Radio Drama tracing the stories of Amy, Edie and Barnard Beechey as they prepare for the First World War and the changes it brings to their lives. Broadcast on BBC Radio Lincolnshire, 4th August, 2014.

  6. Fast Radio Bursts

    Indian Academy of Sciences (India)

    28

    FRBs) which were first discovered a decade ago. Following an introduction to radio transients in general, including pulsars and Rotating Radio. Transients, we discuss the discovery of FRBs. We then discuss FRB follow-up observations in the ...

  7. MARS PATHFINDER RADIO TRACKING

    Data.gov (United States)

    National Aeronautics and Space Administration — The Mars Pathfinder (MPF) Radio Science (RS) data archive contains both raw radio tracking data collected during the surface lifetime of the MPF Lander and results...

  8. A variable-frequency structural health monitoring system based on omnidirectional shear horizontal wave piezoelectric transducers

    Science.gov (United States)

    Huan, Qiang; Miao, Hongchen; Li, Faxin

    2018-02-01

    Structural health monitoring (SHM) is of great importance for engineering structures as it may detect the early degradation and thus avoid life and financial loss. Guided wave based inspection is very useful in SHM due to its capability for long distance and wide range monitoring. The fundamental shear horizontal (SH0) wave based method should be most promising since SH0 is the unique non-dispersive wave mode in plate-like structures. In this work, a sparse array SHM system based on omnidirectional SH wave piezoelectric transducers (OSH-PT) was proposed and the multi data fusion method was used for defect inspection in a 2 mm thick aluminum plate. Firstly, the performances of three types OSH-PTs was comprehensively compared and the thickness-poled d15 mode OSH-PT used in this work was demonstrated obviously superior to the other two. Then, the signal processing method and imaging algorithm for this SHM system was presented. Finally, experiments were carried out to examine the performance of the proposed SHM system in defect localization and imaging. Results indicated that this SHM system can locate a through hole as small as 0.12λ (4 mm) in diameter (where λ is the wavelength corresponding to the central operation frequency) under frequencies from 90 to 150 kHz. It can also locate multiple defects accurately based on the baseline subtraction method. Obviously, this SHM system can detect larger areas with sparse sensors because of the adopted single mode, non-dispersive and low frequency SH0 wave which can propagate long distance with small attenuation. Considering its good performances, simple data processing and sparse array, this SH0 wave-based SHM system is expected to greatly promote the applications of guided wave inspection.

  9. Ham radio for dummies

    CERN Document Server

    Silver, H Ward

    2013-01-01

    An ideal first step for learning about ham radio Beyond operating wirelessly, today's ham radio operators can transmit data and pictures; use the Internet, laser, and microwave transmitters; and travel to places high and low to make contact. This hands-on beginner guide reflects the operational and technical changes to amateur radio over the past decade and provides you with updated licensing requirements and information, changes in digital communication (such as the Internet, social media, and GPS), and how to use e-mail via radio. Addresses the critical use of ham radio for replacing downe

  10. Radiography of Spanish Radio

    Directory of Open Access Journals (Sweden)

    Dra. Emma Rodero Antón

    2007-01-01

    Full Text Available In its eighty years of existence, radio has been always characterized to adapt to the social, cultural and technological transformations. Thus it has been until this moment. Nevertheless, some years ago, the authors and professionals of this medium have been detecting a stagnation that affects to its structure. At a time in continuous technological evolution, radio demands a deep transformation. For that reason, from the conviction of which the future radio, public and commercial, will necessarily have to renew itself, in this paper we establish ten problems and their possible solutions to the radio crisis in order to draw an x-ray of radio in Spain. Radio has future, but it is necessary to work actively by it. That the radio continues being part of sound of our life, it will depend on the work of all: companies, advertisers, professionals, students, investigators and listeners.

  11. VHF volume-imaging radar observation of aspect-sensitive scatterers tilted in mountain waves above a convective boundary layer

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    2005-06-01

    Full Text Available Thin stable atmospheric layers cause VHF radars to receive increased echo power from near zenith. Layers can be tilted from horizontal, for instance by gravity waves, and the direction of VHF "glinting" is measurable by spatial domain interferometry or many-beam Doppler beam swinging (DBS. This paper uses the Middle and Upper atmosphere (MU radar, Shigaraki, Japan as a volume-imaging radar with 64-beam DBS, to show tilting of layers and air flow in mountain waves. Tilt of aspect-sensitive echo power from horizontal is nearly parallel to air flow, as assumed in earlier measurements of mountain-wave alignment. Vertical-wind measurements are self-consistent from different beam zenith angles, despite the combined effects of aspect sensitivity and horizontal-wind gradients.

  12. The Design and Development of an Omni-Directional Mobile Robot Oriented to an Intelligent Manufacturing System.

    Science.gov (United States)

    Qian, Jun; Zi, Bin; Wang, Daoming; Ma, Yangang; Zhang, Dan

    2017-09-10

    In order to transport materials flexibly and smoothly in a tight plant environment, an omni-directional mobile robot based on four Mecanum wheels was designed. The mechanical system of the mobile robot is made up of three separable layers so as to simplify its combination and reorganization. Each modularized wheel was installed on a vertical suspension mechanism, which ensures the moving stability and keeps the distances of four wheels invariable. The control system consists of two-level controllers that implement motion control and multi-sensor data processing, respectively. In order to make the mobile robot navigate in an unknown semi-structured indoor environment, the data from a Kinect visual sensor and four wheel encoders were fused to localize the mobile robot using an extended Kalman filter with specific processing. Finally, the mobile robot was integrated in an intelligent manufacturing system for material conveying. Experimental results show that the omni-directional mobile robot can move stably and autonomously in an indoor environment and in industrial fields.

  13. VHF digital ultrasound three-dimensional scanning in the diagnosis of myopic regression after corneal refractive surgery.

    Science.gov (United States)

    Reinstein, Dan Z; Ameline, Barbara; Puech, Michel; Montefiore, Guy; Laroche, Laurent

    2005-01-01

    To perform VHF digital ultrasound scanning and analysis of a case of high-myopic undercorrection in an eye that had undergone multiple surgical interventions for the correction of an initial refraction of -12.00 diopters (D). A 49-year-old woman was evaluated after undergoing three surgical interventions for correction of an initial refraction of -12.00 D in the left eye. Automated lamellar keratoplasty (ALK) was followed by arcuate keratotomy (for induced astigmatism) and surface photorefractive keratectomy (PRK). The residual ametropia on presentation was -6.75 -3.50 x 95 degrees. VHF digital ultrasound scanning and analysis was performed. On ultrasound, the ALK interface was clearly visible. Residual stromal thickness beneath the cap was at least 275 microm. The absence of Bowman's layer indicated the region of PRK. New stroma and nascent stromal layers were differentiated within the flap. Neo stromal deposition and central epithelial hyperplasia were determined to be responsible for the myopic shift, as opposed to biomechanical changes. In this case, refraction, slit-lamp examination, and topography were unable to provide a diagnosis for regression following multiple corneal refractive procedures. By providing layered anatomical mapping, VHF digital ultrasound scanning was able to exclude a diagnosis of ectasia and provide anatomical diagnostic information to explain the clinical observations.

  14. Heart rate variability (HRV) analysis in radio and TV broadcasting stations workers.

    Science.gov (United States)

    Bortkiewicz, Alicja; Gadzicka, Elżbieta; Szymczak, Wiesław; Zmyślony, Marek

    2012-09-01

    The aim of the study was to assess the mechanism of cardiovascular impairments in workers exposed to UHF-VHF radio frequency electromagnetic fields (EMF). Heart rate variability (HRV) was analysed using 512 normal heart beats registered at rest. The analysis concerned time-domain (STD R-R) and frequency-domain (VLF, LF, HF) parameters of HRV. Fifty nine workers (group I) with low-level and 12 workers (group II) with high-level exposure were examined. The mean age of the subjects was 47 ± 9 years and 41 ± 14 years, and mean exposure duration 19.1 ± 8.8 years and 13 ± 4 years, in groups I and II, respectively. The groups were divided according to: E(max), E(dose), E(mean) for frequencies UHF, VHF and UHF+VHF: The control group consisted of 42 non-exposed subjects, aged 49 ± 8 years. Statistical analysis comprised one-way analysis of variance, covariance analysis and logistic regression models. In the exposed groups, the heart rate was higher than in the control one. Standard deviation of R-R intervals (STD R-R) was found to be significantly (p = 0.0285) lower in group I (42.5 ± 24.7 ms) compared to the control group (62.9 ± 53.5 ms). The risk of lowered STD R-R was significantly increased (OR = 2.37, p = 0.023) in group II. Both exposed groups presented significantly higher VLF and LF values than the control group (p = 0.005 and p = 0.0025, respectively). The EMF-exposed groups were characterised by the dominance of the sympathetic system (LF/HF 1.3 ± 0.35). The results indicate that exposure to radiofrequency EMF may affect the neurovegetative regulation.

  15. First results from an iron lidar and a VHF radar at Davis, Antarctica

    Science.gov (United States)

    Luebken, F.; Morris, R. J.; Hoeffner, J.; Kaifler, B.; Viehl, T.

    2012-12-01

    We present temperature measurements at Davis, Antarctica (69°S, 78°E), and compare with simultaneous and co-located radar measurements of polar mesosphere summer echoes (PMSE). The mobile scanning iron lidar of the IAP in Kuehlungsborn was installed at Davis in December 2010. It measures iron densities, vertical winds, and temperatures in the iron layer, i. e. from approximately 80 to 100 km. It is based on probing the Doppler broadened resonance line of iron atoms at 386 nm and can operate under daylight conditions. Typical values for temperature uncertainty, altitude and time resolution are 3-5 K, 1 km, and 1 hour, respectively. The lidar also measures neutral air densities and temperatures in the stratosphere and lower mesosphere. At Davis the lidar has up to now achieved approximately 2700 hours of data which is presumably the largest nearly continuous data set in Antarctica. The mesopause altitude changes throughout the summer season by several kilometers, significantly different from the northern hemisphere summer. Depending on altitude, temperatures can be warmer or colder compared to the NH summer. Temperatures at Davis near 86 km are rather similar to the NH, but they are much colder at higher altitudes. The thermal structure around the mesopause at Davis is closely related to the general circulation in the stratosphere, namely to the transition from winter to summer conditions. Different from expectations we sometimes find the mesopause significantly higher and colder(!) compared to the NH. Furthermore, we find large thermal tides in the summer months with amplitudes of up to 6-7~K, which is much larger than expected from models. The Australien Antarctic Division operates a 55 MHz VHF radar at Davis since February 2003. We report first simultaneous measurements of PMSE and temperatures by the Fe lidar. PMSE are strong radar echoes related to ice particles and therefore require atmospheric temperatures being lower than the frost point temperature

  16. The radio structure of radio-quiet quasars

    NARCIS (Netherlands)

    Leipski, C.; Falcke, H.D.E.; Bennert, N.; Hüttemeister, S.

    2006-01-01

    Aims.We investigate the radio emitting structures of radio-quiet active galactic nuclei with an emphasis on radio-quiet quasars to study their connection to Seyfert galaxies.
    Methods: .We present and analyse high-sensitivity VLA radio continuum images of 14 radio-quiet quasars and six Seyfert

  17. Senior radio listeners

    DEFF Research Database (Denmark)

    Blaakilde, Anne Leonora

    media platforms, not the least when listening to radio. The elder generation is no exception from this. Recently, for instance, the Danish public broadcast DR has carried out an exodus of programmes targeted for the senior segment. These programmes are removed from regular FM and sent to DAB receivers......Radiobroadcasting and the hardware materialization of radio have during the 20th century changed significantly, which means that senior radio listeners have travelled along with this evolution from large, impressive radio furnitures to DAB and small, wireless, mobile devices, and from grave...... and solemn radio voices to lightharted, laughing and chatting speakers. Senior radio listerners have experienced the development and refinements of technique, content and genres. It is now expected of all media users that they are capable of crossing media, combining, juggling and jumping between various...

  18. STEM on the radio

    Science.gov (United States)

    Showstack, Randy

    2011-10-01

    Looking for an Internet radio station focusing on programing about science, technology, engineering, and math (STEM)? The U.S. National Science Foundation (NSF) announced on 26 September the launch of Science360 Radio, which it says is the first Internet radio stream dedicated to STEM programing. Science360 includes more than 100 radio shows and podcasts that are available on the Web as well as on iPhone and Android devices. The shows originate from a variety of sources, including NSF, other U.S. government agencies, science organizations, universities, and media outlets. For more information, see http://science360.gov/files/.

  19. A Zynq-based Cluster Cognitive Radio

    OpenAIRE

    Rooks, Kurtis M.

    2014-01-01

    Traditional hardware radios provide very rigid solutions to radio problems. Intelligent software defined radios, also known as cognitive radios, provide flexibility and agility compared to hardware radio systems. Cognitive radios are well suited for radio applications in a changing radio frequency environment, such as dynamic spectrum access. In this thesis, a cognitive radio is demonstrated where the system self reconfigures to dem...

  20. Long-period unstable gravity-waves and associated VHF radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    Full Text Available VHF atmospheric radar is used to measure the wind velocity and radar echo power related to long-period wind perturbations, including gravity waves, which are observed commonly in the lower stratosphere and tropopause region, and sometimes in the troposphere. These wind structures have been identified previously as either inertia-gravity waves, often associated with jet streams, or mountain waves. At heights of peak wind shear, imbalances are found between the echo powers of a symmetric pair of radar beams, which are expected to be equal. The largest of these power differences are found for conditions of simultaneous high wind shear and high aspect sensitivity. It is suggested that the effect might arise from tilted specular reflectors or anisotropic turbulent scatterers, a result of, for example, Kelvin-Helmholtz instabilities generated by the strong wind shears. This radar power-difference effect could offer information about the onset of saturation in long-period waves, and the formation of thin layers of turbulence.

  1. Anisotropy of Doppler spectral parameters in the VHF radar observations at MU and White Sands

    Directory of Open Access Journals (Sweden)

    G. D. Nastrom

    2001-08-01

    Full Text Available Significant differences are found between the mean spectral widths from beams in the meridional plane and in the zonal plane at both the MU and the White Sands VHF radars. The spectral width in the beam directed perpendicular to the prevailing wind is greater than that in the beam parallel to the wind. The magnitudes of the differences in spectral width show a linear relationship with wind speed, with the greatest differences at the greatest wind speeds. The differences in spectral width show a positive correlation with the differences in backscattered power. The anisotropy in backscattered power is well-known and is usually attributed to aspect sensitivity effects. However, the anisotropy in spectral width does not appear to be due to the same mechanism, and while several hypotheses to account for this are considered, including finite range-volume effects, effects from the tilting of isentropic layers, and anisotropic turbulence effects, it is seen that each of these suggestions has its shortcomings.Key words. Meteorology and atmospheric dynamics (turbulence; instruments and techniques

  2. Anisotropy of Doppler spectral parameters in the VHF radar observations at MU and White Sands

    Directory of Open Access Journals (Sweden)

    G. D. Nastrom

    Full Text Available Significant differences are found between the mean spectral widths from beams in the meridional plane and in the zonal plane at both the MU and the White Sands VHF radars. The spectral width in the beam directed perpendicular to the prevailing wind is greater than that in the beam parallel to the wind. The magnitudes of the differences in spectral width show a linear relationship with wind speed, with the greatest differences at the greatest wind speeds. The differences in spectral width show a positive correlation with the differences in backscattered power. The anisotropy in backscattered power is well-known and is usually attributed to aspect sensitivity effects. However, the anisotropy in spectral width does not appear to be due to the same mechanism, and while several hypotheses to account for this are considered, including finite range-volume effects, effects from the tilting of isentropic layers, and anisotropic turbulence effects, it is seen that each of these suggestions has its shortcomings.

    Key words. Meteorology and atmospheric dynamics (turbulence; instruments and techniques

  3. Range imaging observations of PMSE using the EISCAT VHF radar: Phase calibration and first results

    Directory of Open Access Journals (Sweden)

    J. R. Fernandez

    2005-01-01

    Full Text Available A novel phase calibration technique for use with the multiple-frequency Range IMaging (RIM technique is introduced based on genetic algorithms. The method is used on data collected with the European Incoherent SCATter (EISCAT VHF radar during a 2002 experiment with the goal of characterizing the vertical structure of Polar Mesosphere Summer Echoes (PMSE over northern Norway. For typical Doppler measurements, the initial phases of the transmitter and receiver are not required to be the same. The EISCAT receiver systems exploit this fact, allowing a multi-static configuration. However, the RIM method relies on the small phase differences between closely spaced frequencies. As a result, the high-resolution images produced by the RIM method can be significantly degraded if not properly calibrated. Using an enhanced numerical radar simulator, in which data from multiple sampling volumes are simultaneously generated, the proposed calibration method is validated. Subsequently, the method is applied to preliminary data from the EISCAT radar, providing first results of RIM images of PMSE. Data using conventional analysis techniques, and confirmed by RIM, reveal an often-observed double-layer structure with higher stability in the lower layer. Moreover, vertical velocity oscillations exhibit a clear correlation with the apparent motion of the layers shown in the echo power plots.

  4. Study of CNT growth using nanocatalyst Ag precursor by HWC-VHF-PECVD

    Energy Technology Data Exchange (ETDEWEB)

    Eliyana, Ajeng; Rosikin, Ahmad; Winata, Toto, E-mail: toto@fi.itb.ac.id [Physics of Electronics Material Research Division, Physics Programme, Faculty of Mathematics and Natural Sciences, Institut Teknologi Bandung, Jl. Ganesha 10, Bandung 40132, West Java (Indonesia)

    2015-04-16

    The study of CNT growth has been done by using silver (Ag) nanocatalyst as a guide precursor on corning glass 7059 substrate. The silver catalyst was prepared by the evaporation method by varying deposition time for 50, 25, and 14 seconds. The silver films were then annealed at temperature of 400°C for 4 hours. From Scanning Electron Microscope (SEM) and Energy Dispersive X-ray Spectroscopy (EDX) results the grain sizes are 65 nm, 57 nm, and 33 nm, and also the atomic compositions are 6,06%, 4,52%, and 3,73% for 14, 25 and 50 seconds samples, respectively. The 33 nm samples were then used for CNT growth by using Hot Wire Cell (HWC) – Very High Frequency (VHF) – Plasma Enhanced Chemical Vapor Deposition (PECVD) at 275 ° C deposition temperature and pressure of 300 mTorr. The rf power was varied from 8 to 20 watts, with deposition time for 60 minutes. The methane (CH4) 99.999% was used as Carbon sources. Hydrogen gas (H2) was used to etch the oxide layer formed during the pre-deposition process. The diameter and length for the CNT are 125 nm and 1.650 to 2.989 nm respectively.

  5. Arctic and Antarctic polar mesosphere summer echoes observed with oblique incidence HF radars: analysis using simultaneous MF and VHF radar data

    Directory of Open Access Journals (Sweden)

    T. Ogawa

    2004-12-01

    Full Text Available Polar mesosphere summer echoes (PMSEs have been well studied using vertical incidence VHF radars at northern high-latitudes. In this paper, two PMSE events detected with the oblique incidence SuperDARN HF radars at Hankasalmi, Finland (62.3° N and Syowa Station, Antarctica (69.0° S, are analyzed, together with simultaneous VHF and medium-frequency (MF radar data. Altitude resolutions of the HF radars in the mesosphere and the lower thermosphere are too poor to know exact PMSE altitudes. However, a comparison of Doppler velocity from the HF radar and neutral wind velocity from the MF radar shows that PMSEs at the HF band appeared at altitudes within 80-90km, which are consistent with those from previous vertical incidence HF-VHF radar results. The HF-VHF PMSE occurrences exhibit a semidiurnal behavior, as observed by other researchers. It is found that in one event, PMSEs occurred when westward semidiurnal winds with large amplitude at 85-88km altitudes attained a maximum. When the HF-VHF PMSEs were observed at distances beyond 180km from MF radar sites, the MF radars detected no appreciable signatures of echo enhancement. Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; thermospheric dynamics; waves and tides

  6. Arctic and Antarctic polar mesosphere summer echoes observed with oblique incidence HF radars: analysis using simultaneous MF and VHF radar data

    Directory of Open Access Journals (Sweden)

    T. Ogawa

    2004-12-01

    Full Text Available Polar mesosphere summer echoes (PMSEs have been well studied using vertical incidence VHF radars at northern high-latitudes. In this paper, two PMSE events detected with the oblique incidence SuperDARN HF radars at Hankasalmi, Finland (62.3° N and Syowa Station, Antarctica (69.0° S, are analyzed, together with simultaneous VHF and medium-frequency (MF radar data. Altitude resolutions of the HF radars in the mesosphere and the lower thermosphere are too poor to know exact PMSE altitudes. However, a comparison of Doppler velocity from the HF radar and neutral wind velocity from the MF radar shows that PMSEs at the HF band appeared at altitudes within 80-90km, which are consistent with those from previous vertical incidence HF-VHF radar results. The HF-VHF PMSE occurrences exhibit a semidiurnal behavior, as observed by other researchers. It is found that in one event, PMSEs occurred when westward semidiurnal winds with large amplitude at 85-88km altitudes attained a maximum. When the HF-VHF PMSEs were observed at distances beyond 180km from MF radar sites, the MF radars detected no appreciable signatures of echo enhancement.

    Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; thermospheric dynamics; waves and tides

  7. Boom Booom Net Radio

    DEFF Research Database (Denmark)

    Grimshaw, Mark Nicholas; Yong, Louisa; Dobie, Ian

    1999-01-01

    of an existing Internet radio station; Boom Booom Net Radio. Whilst necessity dictates some use of technology-related terminology, wherever possible we have endeavoured to keep such jargon to a minimum and to either explain it in the text or to provide further explanation in the appended glossary....

  8. The LOFAR radio environment

    NARCIS (Netherlands)

    Offringa, A. R.; de Bruyn, A. G.; Zaroubi, S.; van Diepen, G.; Martinez-Ruby, O.; Labropoulos, P.; Brentjens, M. A.; Ciardi, B.; Daiboo, S.; Harker, G.; Jelic, V.; Kazemi, S.; Koopmans, L. V. E.; Pandey, V. N.; Pizzo, R. F.; Schaye, J.; Vedantham, H.; Veligatla, V.; Wijnholds, S. J.; Yatawatta, S.; Zarka, P.; Alexov, A.; Anderson, J.; Asgekar, A.; Avruch, M.; Beck, R.; Bell, M.; Bell, M. R.; Bentum, M.; Bernardi, G.; Best, P.; Birzan, L.; Bonafede, A.; Breitling, F.; Broderick, J. W.; Brueggen, M.; Butcher, H.; Conway, J.; de Vos, M.; Dettmar, R. J.; Eisloeffel, J.; Falcke, H.; Fender, R.; Frieswijk, W.; Gerbers, M.; Griessmeier, J. M.; Gunst, A. W.; Hassall, T. E.; Heald, G.; Hessels, J.; Hoeft, M.; Horneffer, A.; Karastergiou, A.; Kondratiev, V.; Koopman, Y.; Kuniyoshi, M.; Kuper, G.; Maat, P.; Mann, G.; McKean, J.; Meulman, H.; Mevius, M.; Mol, J.D.; Nijboer, R.; Noordam, J.; Norden, M.; Paas, H.; Pandey, M.; Pizzo, R.; Polatidis, A.; Rafferty, D.; Rawlings, S.; Reich, W.; Roettgering, H. J. A.; Schoenmakers, A. P.; Sluman, J.; Smirnov, O.; Sobey, C.; Stappers, B.; Steinmetz, M.; Swinbank, J.; Tagger, M.; Tang, Y.; Tasse, C.; van Ardenne, A.; van Cappellen, W.; van Duin, A. P.; van Haarlem, M.; van Leeuwen, J.; van Weeren, R. J.; Vermeulen, R.; Vocks, C.; Wijers, R. A. M. J.; Wise, M.; Wucknitz, O.; Mellema, G.

    Aims. This paper discusses the spectral occupancy for performing radio astronomy with the Low-Frequency Array (LOFAR), with a focus on imaging observations. Methods. We have analysed the radio-frequency interference (RFI) situation in two 24-h surveys with Dutch LOFAR stations, covering 30-78 MHz

  9. Radio Graceful Hamming Graphs

    Directory of Open Access Journals (Sweden)

    Niedzialomski Amanda

    2016-11-01

    Full Text Available For k ∈ ℤ+ and G a simple, connected graph, a k-radio labeling f : V (G → ℤ+ of G requires all pairs of distinct vertices u and v to satisfy |f(u − f(v| ≥ k + 1 − d(u, v. We consider k-radio labelings of G when k = diam(G. In this setting, f is injective; if f is also surjective onto {1, 2, . . . , |V (G|}, then f is a consecutive radio labeling. Graphs that can be labeled with such a labeling are called radio graceful. In this paper, we give two results on the existence of radio graceful Hamming graphs. The main result shows that the Cartesian product of t copies of a complete graph is radio graceful for certain t. Graphs of this form provide infinitely many examples of radio graceful graphs of arbitrary diameter. We also show that these graphs are not radio graceful for large t.

  10. Writing for Radio.

    Science.gov (United States)

    Tupper, Marianna S.

    1995-01-01

    Describes a 24-hour commercial radio station simulation class project for eighth-grade language arts. Students wrote their own scripts, chose music and were disc jockeys on their own music and talk shows, and prepared news and traffic reports. Guest speakers from actual commercial radio came in to discuss issues such as advertising, censorship,…

  11. Uranus radio emissions

    Science.gov (United States)

    Kaiser, Michael L.

    An overview of the Voyager 2 Planetary Radio Astronomy instrument observations of the planet Uranus is presented. From these observations, a number of inferences have been made including the rotation period of the interior of the planet and the source locations of several of the radio components.

  12. Radio Surveys: an Overview

    NARCIS (Netherlands)

    Morganti, Raffaella

    Radio astronomy has provided important surveys that have made possible key (and sometimes serendipitous) discoveries. I will briefly mention some of the past continuum and line (HI) radio surveys as well as new, on-going surveys and surveys planned for the near future. This new generation of large

  13. Ionosphere and Radio Communication

    Indian Academy of Sciences (India)

    The upperionosphere is used for radio communication and navigationas it reflects long, medium, as well as short radio waves. Sincesolar radiation is the main cause of the existence of ionosphere,any variation in the radiations can affect the entireradio communication system. This article attempts to brieflyintroduce the ...

  14. Valuing commercial radio licences

    NARCIS (Netherlands)

    Kerste, M.; Poort, J.; van Eijk, N.

    2015-01-01

    Within the EU regulatory framework, licensees for commercial radio broadcasting may be charged a fee to ensure optimal allocation of scarce resources but not to maximize public revenues. While radio licence renewal occurs in many EU countries, an objective, model-based approach for setting licence

  15. Design of an omnidirectional band gap independent of ambient media refractive indices by using a heterostructure magnetic photonic crystal

    Science.gov (United States)

    Ansari, N.; Tehranchi, M. M.

    2010-04-01

    This paper aims to study the general conditions under which omnidirectional band gaps (OBGs) are achieved by using heterostructure magnetic photonic crystals (HMPCs). These structures contain periodic layers with alternative dielectric permittivity and magnetic permeability. The proposed design offers the stacking of two magnetic photonic crystals (MPCs), where one MPC has Brewster’s angle at TE polarization and another has the angle at TM polarization. The propagation of electromagnetic waves is investigated by means of the transfer matrix method. Also, the total reflection frequency range for any incident angle and polarization is discussed in this paper. As a conclusion, although each MPC has no OBG individually, the proposed HMPC may contain an OBG. The main advantage of the proposed design is that the obtained OBG is independent of the ambient media refractive index. Therefore, it can be used in engineering omnireflectors in integrated photonics.

  16. Packaging Glass with a Hierarchically Nanostructured Surface: A Universal Method to Achieve Self-Cleaning Omnidirectional Solar Cells

    KAUST Repository

    Lin, Chin An

    2015-12-01

    Fused-silica packaging glass fabricated with a hierarchical structure by integrating small (ultrathin nanorods) and large (honeycomb nanowalls) structures was demonstrated with exceptional light-harvesting solar performance, which is attributed to the subwavelength feature of the nanorods and an efficient scattering ability of the honeycomb nanowalls. Si solar cells covered with the hierarchically structured packaging glass exhibit enhanced conversion efficiency by 5.2% at normal incidence, and the enhancement went up to 46% at the incident angle of 60°. The hierarchical structured packaging glass shows excellent self-cleaning characteristics: 98.8% of the efficiency is maintained after 6 weeks of outdoor exposure, indicating that the nanostructured surface effectively repels polluting dust/particles. The presented self-cleaning omnidirectional light-harvesting design using the hierarchical structured packaging glass is a potential universal scheme for practical solar applications.

  17. Finding the Quickest Straight-Line Trajectory for a Three-Wheeled Omnidirectional Robot under Input Voltage Constraints

    Directory of Open Access Journals (Sweden)

    Ki Bum Kim

    2015-01-01

    Full Text Available We provide an analytical solution to the problem of generating the quickest straight-line trajectory for a three-wheeled omnidirectional mobile robot, under the practical constraint of limited voltage. Applying the maximum principle to the geometric properties of the input constraints, we find that an optimal input vector of motor voltages has at least one extreme value when the orientation of the robot is fixed and two extreme values when rotation is allowed. We can find an explicit representation of the optimal vector for a motion under fixed orientation. We derive several properties of quickest straight-line trajectories and verify them through simulation. We show that the quickest trajectory when rotation is allowed is always faster than the quickest with fixed orientation.

  18. Implementation of obstacle-avoidance control for an autonomous omni-directional mobile robot based on extension theory.

    Science.gov (United States)

    Pai, Neng-Sheng; Hsieh, Hung-Hui; Lai, Yi-Chung

    2012-10-16

    The paper demonstrates a following robot with omni-directional wheels, which is able to take action to avoid obstacles. The robot design is based on both fuzzy and extension theory. Fuzzy theory was applied to tune the PMW signal of the motor revolution, and correct path deviation issues encountered when the robot is moving. Extension theory was used to build a robot obstacle-avoidance model. Various mobile models were developed to handle different types of obstacles. The ultrasonic distance sensors mounted on the robot were used to estimate the distance to obstacles. If an obstacle is encountered, the correlation function is evaluated and the robot avoids the obstacle autonomously using the most appropriate mode. The effectiveness of the proposed approach was verified through several tracking experiments, which demonstrates the feasibility of a fuzzy path tracker as well as the extensible collision avoidance system.

  19. Exceptionally omnidirectional broadband light harvesting scheme for multi-junction concentrator solar cells achieved via ZnO nanoneedles

    KAUST Repository

    Yeh, Li-Ko

    2016-12-14

    GaInP/GaAs/Ge triple-junction concentrator solar cells with significant efficiency enhancement were demonstrated with antireflective ZnO nanoneedles. The novel nanostructure was attained with a Zn(NO3)2-based solution containing vitamin C. Under one sun AM 1.5G solar spectrum, conversion efficiency of the triple-junction device was improved by 23.7% via broadband improvement in short-circuit currents of 3 sub-cells after the coverage by the nanoneedles with a graded refractive index profile. The efficiency enhancement further went up to 45.8% at 100 suns. The performance boost through the nanoneedles also became increasingly pronounced in the conditions of high incident angles and the cloudy weather, e.g. 220.0% of efficiency enhancement was observed at the incident angle of 60°. These results were attributed to the exceptional broadband omnidirectionality of the antireflective nanoneedles.

  20. Implementation of Obstacle-Avoidance Control for an Autonomous Omni-Directional Mobile Robot Based on Extension Theory

    Directory of Open Access Journals (Sweden)

    Yi-Chung Lai

    2012-10-01

    Full Text Available The paper demonstrates a following robot with omni-directional wheels, which is able to take action to avoid obstacles. The robot design is based on both fuzzy and extension theory. Fuzzy theory was applied to tune the PMW signal of the motor revolution, and correct path deviation issues encountered when the robot is moving. Extension theory was used to build a robot obstacle-avoidance model. Various mobile models were developed to handle different types of obstacles. The ultrasonic distance sensors mounted on the robot were used to estimate the distance to obstacles. If an obstacle is encountered, the correlation function is evaluated and the robot avoids the obstacle autonomously using the most appropriate mode. The effectiveness of the proposed approach was verified through several tracking experiments, which demonstrates the feasibility of a fuzzy path tracker as well as the extensible collision avoidance system.

  1. AUTOMATIC TEXTURE MAPPING WITH AN OMNIDIRECTIONAL CAMERA MOUNTED ON A VEHICLE TOWARDS LARGE SCALE 3D CITY MODELS

    Directory of Open Access Journals (Sweden)

    F. Deng

    2012-07-01

    Full Text Available Today high resolution panoramic images with competitive quality have been widely used for rendering in some commercial systems. However the potential applications such as mapping, augmented reality and modelling which need accurate orientation information are still poorly studied. Urban models can be quickly obtained from aerial images or LIDAR, however with limited quality or efficiency due to low resolution textures and manual texture mapping work flow. We combine an Extended Kalman Filter (EKF with the traditional Structure from Motion (SFM method without any prior information based on a general camera model which can handle various kinds of omnidirectional and other kind of single perspective image sequences even with unconnected or weakly connected frames. The orientation results is then applied to mapping the textures from panoramas to the existing building models obtained from aerial photogrammetry. It turns out to largely improve the quality of the models and the efficiency of the modelling procedure.

  2. 3D Statistical Shape Models Incorporating Landmark-Wise Random Regression Forests for Omni-Directional Landmark Detection.

    Science.gov (United States)

    Norajitra, Tobias; Maier-Hein, Klaus H

    2017-01-01

    3D Statistical Shape Models (3D-SSM) are widely used for medical image segmentation. However, during segmentation, they typically perform a very limited unidirectional search for suitable landmark positions in the image, relying on weak learners or use-case specific appearance models that solely take local image information into account. As a consequence, segmentation errors arise, and results in general depend on the accuracy of a previous model initialization. Furthermore, these methods become subject to a tedious and use-case dependent parameter tuning in order to obtain optimized results. To overcome these limitations, we propose an extension of 3D-SSM by landmark-wise random regression forests that perform an enhanced omni-directional search for landmark positions, thereby taking rich non-local image information into account. In addition, we provide a long distance model fitting based on a multi-scale approach, that allows an accurate and reproducible segmentation even from distant image positions, thus enabling an application without model initialization. Finally, translation of the proposed method to different organs is straightforward and requires no adaptation of the training process. In segmentation experiments on 45 clinical CT volumes, the proposed omni-directional search significantly increased accuracy and displayed great precision regardless of model initialization. Furthermore, for liver, spleen and kidney segmentation in a competitive multi-organ labeling challenge on publicly available data, the proposed method achieved similar or better results than the state of the art. Finally, liver segmentation results were obtained that successfully compete with specialized state-of-the-art methods from the well-known liver segmentation challenge SLIVER.

  3. RADIO REFRACTIVITY RADIO REFRACTIVITY STUDY IN AKURE ...

    African Journals Online (AJOL)

    eobe

    The basic parameters that describe the troposphere region are pressure, temperature and relative humidity. Variations in these conditions within the troposphere cause changes in the refractive index of air and large scale changes of refractive index with height cause radio waves to be refracted and the effect can be quite.

  4. Spectral characteristics of ionospheric scintillations of VHF radiosignal near magnetic zenith

    Science.gov (United States)

    Vasilyev, Roman; Globa, Mariia; Kushnarev, Dmitry; Medvedev, Andrey; Ratovsky, Konstantin

    2017-07-01

    We present the results of observing the Cygnus-A radio source scintillation in the Earth's ionosphere under quiet and disturbed geomagnetic conditions by using the Irkutsk incoherent scattering radar (IISR). The scintillation method applied for ionosphere testing at IISR confidently determines the Fresnel frequency and power cutoff, the spectral characteristics usually related to the velocities and spatial spectra of ionospheric plasma irregularities. We also use the IGRF magnetic field model to show the relation between the shape of discrete radio source scintillation spectra and the direction to the radio source with respect to the geomagnetic field. The S4 index increase within the magnetic zenith is observed to be conditioned by the scintillation spectrum widening. We also evaluate the zonal velocity of observed ionospheric irregularities as ∼10 m/sec assuming the irregularity height to be equal to the F2-layer maximum height in the ionosphere.

  5. Effect of solar and magnetic activity on VHF scintillations near the equatorial anomaly crest

    Directory of Open Access Journals (Sweden)

    R. P. Singh

    2004-09-01

    Full Text Available The VHF amplitude scintillation recorded during the period January 1991 to December 1993 in the declining phase of a solar cycle and April 1998 to December 1999 in the ascending phase of the next solar cycle at Varanasi (geogr. lat.=25.3°, long.=83.0°, dip=37°N have been analyzed to study the behavior of ionospheric irregularities during active solar periods and magnetic storms. It is shown that irregularities occur at arbitrary times and may last for <30min. A rise in solar activity increases scintillations during winter (November-February and near equinoxes (March-April; September-October, whereas it depresses the scintillations during the summer (May-July. In general, the role of magnetic activity is to suppress scintillations in the pre-midnight period and to increase it in the post-midnight period during equinox and winter seasons, whilst during summer months the effect is reversed. The pre-midnight scintillation is sometimes observed when the main phase of Dst corresponds to the pre-midnight period. The annual variation shows suppression of scintillations on disturbed days, both during pre-midnight and post-midnight period, which becomes more effective during years of high solar activity. It is observed that for magnetic storms for which the recovery phase starts post-midnight, the probability of occurrence of irregularities is enhanced during this time. If the magnetic storm occurred during daytime, then the probability of occurrence of scintillations during the night hours is decreased. The penetration of magnetospheric electric fields to the magnetic equator affects the evolution of low-latitude irregularities. A delayed disturbance dynamo electric field also affects the development of irregularities.

  6. Seasonal and diurnal changes in wind variability from Flatland VHF profiler observations

    Energy Technology Data Exchange (ETDEWEB)

    Nastrom, G.D. [Saint Cloud State Univ., MN (United States). Dept. of Earth Sci.; Clark, W.L. [National Oceanic and Atmospheric Administration, Boulder, CO (United States). Aeronomy Lab.; Zandt, T.E. van [National Oceanic and Atmospheric Administration, Boulder, CO (United States). Aeronomy Lab.; Warnock, J.M. [National Oceanic and Atmospheric Administration, Boulder, CO (United States). Aeronomy Lab.

    1996-02-01

    Climatological results are presented on the hourly variance of the wind observed in the mid-troposphere (3 to 9 km MSL). This quantity roughly indicates the energy in the atmospheric wind field for variations with periods roughly less than 1 hour. Observations are from the Flatland VHF research wind profiler, located near Champaign/Urbana, Illinois, well away from significant orographic features. The period of record covers two years, September 1990 through August 1992. The values of the variance of the winds along vertical and oblique (15 degrees from zenith in the cardinal directions) beams are presented versus height, season, time-of-day, and beam pointing direction. It is found that the hourly variance values have approximately lognormal frequency distribution. The mean hourly variance is significantly larger for the oblique wind observations than for the vertical. Mean wind variances also tend to be larger in the east/west steering plane than in the north/south plane. The mean variance generally increases with height, but faster than would be expected if it were due solely to the decrease in atmospheric density, implying the presence of local source/sinks of wind energy. The rate of change with height is noticeably different for the vertical and oblique beams, being much less for the vertical beam, in some seasons even decreasing with height. With respect to season, the mean hourly variance is smallest in the summer and largest in the winter. With respect to diurnal changes, the variance is maximum during the afternoon for spring, summer, and autumn, with the maximum up to a factor of two larger than the minimum. In winter, the diurnal change is much smaller, with little indication of an afternoon maximum. (orig.)

  7. VHF radar observations of turbulent structures in the polar mesopause region

    Directory of Open Access Journals (Sweden)

    P. Czechowsky

    Full Text Available The mobile SOUSY VHF Radar was operated in the summer of 1987 during the MAC/SINE campaign in northern Norway to study the polar mesosphere summer echoes (PMSE. Measurements of the spectral width indicate that two types of structures occur. In general mesospheric layers are bifurcated exhibiting a narrow spectral width and a well-defined aspect sensitivity. However, for about 10% of the observation time cells of enhanced turbulence characterized by extremely broad spectral widths appear predominantly in the upper sublayer above 86 km. Identification and separation of beam and shear broadening allows a determination of the turbulence-induced component of the spectral width. This case study reveals that during several events these cloud-like structures of enhanced turbulence move with an apparent velocity of several tens of meters per second which is almost identical with the phase trace velocity of simultaneously observed waves. Since, at that time, the Richardson number was less than a quarter, it was concluded that these turbulent cells were generated by a Kelvin-Helmholtz mechanism. The horizontal extent of these structures was calculated to be less than 40 km. A general relation between spectral width and echo power was not detected. The turbulent component of the spectral width was used to calculate typical values of the energy dissipation rate at times where narrow spectral width dominates and during periods of enhanced turbulence. In addition, the outer scale of the inertial subrange (buoyancy scale was estimated. For the first time the occurrence and motion of this type of structures of enhanced spectral width is analyzed and discussed in detail.

  8. VHF radar observations of turbulent structures in the polar mesopause region

    Directory of Open Access Journals (Sweden)

    P. Czechowsky

    1997-08-01

    Full Text Available The mobile SOUSY VHF Radar was operated in the summer of 1987 during the MAC/SINE campaign in northern Norway to study the polar mesosphere summer echoes (PMSE. Measurements of the spectral width indicate that two types of structures occur. In general mesospheric layers are bifurcated exhibiting a narrow spectral width and a well-defined aspect sensitivity. However, for about 10% of the observation time cells of enhanced turbulence characterized by extremely broad spectral widths appear predominantly in the upper sublayer above 86 km. Identification and separation of beam and shear broadening allows a determination of the turbulence-induced component of the spectral width. This case study reveals that during several events these cloud-like structures of enhanced turbulence move with an apparent velocity of several tens of meters per second which is almost identical with the phase trace velocity of simultaneously observed waves. Since, at that time, the Richardson number was less than a quarter, it was concluded that these turbulent cells were generated by a Kelvin-Helmholtz mechanism. The horizontal extent of these structures was calculated to be less than 40 km. A general relation between spectral width and echo power was not detected. The turbulent component of the spectral width was used to calculate typical values of the energy dissipation rate at times where narrow spectral width dominates and during periods of enhanced turbulence. In addition, the outer scale of the inertial subrange (buoyancy scale was estimated. For the first time the occurrence and motion of this type of structures of enhanced spectral width is analyzed and discussed in detail.

  9. The relationship between VHF radar auroral backscatter amplitude and Doppler velocity: a statistical study

    Directory of Open Access Journals (Sweden)

    B. A. Shand

    1996-08-01

    Full Text Available A statistical investigation of the relationship between VHF radar auroral backscatter intensity and Doppler velocity has been undertaken with data collected from 8 years operation of the Wick site of the Sweden And Britain Radar-auroral Experiment (SABRE. The results indicate three different regimes within the statistical data set; firstly, for Doppler velocities <200 m s–1, the backscatter intensity (measured in decibels remains relatively constant. Secondly, a linear relationship is observed between the backscatter intensity (in decibels and Doppler velocity for velocities between 200 m s–1 and 700 m s–1. At velocities greater than 700 m s–1 the backscatter intensity saturates at a maximum value as the Doppler velocity increases. There are three possible geophysical mechanisms for the saturation in the backscatter intensity at high phase speeds: a saturation in the irregularity turbulence level, a maximisation of the scattering volume, and a modification of the local ambient electron density. There is also a difference in the dependence of the backscatter intensity on Doppler velocity for the flow towards and away from the radar. The results for flow towards the radar exhibit a consistent relationship between backscatter intensity and measured velocities throughout the solar cycle. For flow away from the radar, however, the relationship between backscatter intensity and Doppler velocity varies during the solar cycle. The geometry of the SABRE system ensures that flow towards the radar is predominantly associated with the eastward electrojet, and flow away is associated with the westward electrojet. The difference in the backscatter intensity variation as a function of Doppler velocity is attributed to asymmetries between the eastward and westward electrojets and the geophysical parameters controlling the backscatter amplitude.

  10. The relationship between VHF radar auroral backscatter amplitude and Doppler velocity: a statistical study

    Directory of Open Access Journals (Sweden)

    B. A. Shand

    Full Text Available A statistical investigation of the relationship between VHF radar auroral backscatter intensity and Doppler velocity has been undertaken with data collected from 8 years operation of the Wick site of the Sweden And Britain Radar-auroral Experiment (SABRE. The results indicate three different regimes within the statistical data set; firstly, for Doppler velocities <200 m s–1, the backscatter intensity (measured in decibels remains relatively constant. Secondly, a linear relationship is observed between the backscatter intensity (in decibels and Doppler velocity for velocities between 200 m s–1 and 700 m s–1. At velocities greater than 700 m s–1 the backscatter intensity saturates at a maximum value as the Doppler velocity increases. There are three possible geophysical mechanisms for the saturation in the backscatter intensity at high phase speeds: a saturation in the irregularity turbulence level, a maximisation of the scattering volume, and a modification of the local ambient electron density. There is also a difference in the dependence of the backscatter intensity on Doppler velocity for the flow towards and away from the radar. The results for flow towards the radar exhibit a consistent relationship between backscatter intensity and measured velocities throughout the solar cycle. For flow away from the radar, however, the relationship between backscatter intensity and Doppler velocity varies during the solar cycle. The geometry of the SABRE system ensures that flow towards the radar is predominantly associated with the eastward electrojet, and flow away is associated with the westward electrojet. The difference in the backscatter intensity variation as a function of Doppler velocity is attributed to asymmetries between the eastward and westward electrojets and the geophysical parameters controlling the backscatter amplitude.

  11. Cut-off low monitoring by the French VHF-ST-radar network during the ESTIME campaign

    Science.gov (United States)

    Caccia, J.-L.; Bertin, F.; Campistron, B.; Klaus, V.; Pointin, Y.; van Baelen, J.; Wilson, R.

    2000-05-01

    In order to investigate mesoscale strato-tropospheric exchanges, the field campaign `Echanges Stratosphère-Troposphère: Investigations à Moyenne Echelle' was conducted in France from late 1993 to mid 1995 and focused on cut-off low events. It involved the French research network of five VHF (Very High Frequency) ST (Strato-Tropospheric) radars deployed in southern France. Observations corresponding to three Intensive Observing Periods are reported here. The radar data analyzed and discussed are time-height diagrams of the aspect ratio (AR), that is, the vertical to oblique beam-returned power ratio, used for monitoring three cut-off low events. In order to discuss the validity of the method, 506 h of radar AR data were compared with time-height diagrams of the static stability and the humidity obtained from synoptic European Center for Medium-range Weather Forecasts model analyses. A dataset corresponding to 297 h of observations is analyzed and discussed here. It is concluded that the AR is a good tracer to document cut-off low events, including tropopause folding identification and the detection of tropospheric air masses of enhanced stability, in dry or weakly humid cases. On the other hand, although the effects of the specific humidity and its gradients on VHF radar echo power could not be extensively investigated, our results suggest that the same parameter cannot be used at mid- and lower-tropospheric levels when the effects of specific humidity significantly reinforce the moist static stability. It is important to take into account these insights in the context of future observing campaigns in which a network of VHF-ST-radars will be involved, and where their role will be to observe and to document the evolution of upper-level features or potential vorticity streamers, or more generally stratospheric-tropospheric exchanges.

  12. Radio broadcasting via satellite

    Science.gov (United States)

    Helm, Neil R.; Pritchard, Wilbur L.

    1990-10-01

    Market areas offering potential for future narrowband broadcast satellites are examined, including international public diplomacy, government- and advertising-supported, and business-application usages. Technical issues such as frequency allocation, spacecraft types, transmission parameters, and radio receiver characteristics are outlined. Service and system requirements, advertising revenue, and business communications services are among the economic issues discussed. The institutional framework required to provide an operational radio broadcast service is studied, and new initiatives in direct broadcast audio radio systems, encompassing studies, tests, in-orbit demonstrations of, and proposals for national and international commercial broadcast services are considered.

  13. Unlocking radio broadcasts

    DEFF Research Database (Denmark)

    Lykke, Marianne; Skov, Mette

    2012-01-01

    This poster reports the preliminary results of a user study uncovering the information seeking behaviour of humanities scholars dedicated to radio research. The study is part of an interdisciplinary research project on radio culture and auditory resources. The purpose of the study is to inform...... the design of information architecture and interaction design of a research infrastructure that will enable future radio and audio based research. Results from a questionnaire survey on humanities scholars’ research interest and information needs, preferred access points, and indexing levels are reported...

  14. Shoestring Budget Radio Astronomy

    Science.gov (United States)

    Hoot, John E.

    2017-06-01

    The commercial exploitation of microwave frequencies for cellular, WiFi, Bluetooth, HDTV, and satellite digital media transmission has brought down the cost of the components required to build an effective radio telescope to the point where, for the cost of a good eyepiece, you can construct and operate a radio telescope. This paper sets forth a family of designs for 1421 MHz telescopes. It also proposes a method by which operators of such instruments can aggregate and archive data via the Internet. With 90 or so instruments it will be possible to survey the entire radio sky for transients with a 24 hour cadence.

  15. Cryocooled wideband digital channelizing radio-frequency receiver based on low-pass ADC

    Energy Technology Data Exchange (ETDEWEB)

    Vernik, Igor V; Kirichenko, Dmitri E; Dotsenko, Vladimir V; Miller, Robert; Webber, Robert J; Shevchenko, Pavel; Talalaevskii, Andrei; Gupta, Deepnarayan; Mukhanov, Oleg A [HYPRES, Inc., 175 Clearbrook Road, Elmsford, NY 10523 (United States)

    2007-11-15

    We have demonstrated a digital receiver performing direct digitization of radio-frequency signals over a wide frequency range from kilohertz to gigahertz. The complete system, consisting of a cryopackaged superconductor all-digital receiver (ADR) chip followed by room-temperature interface electronics and a field programmable gate array (FPGA) based post-processing module, has been developed. The ADR chip comprises a low-pass analog-to-digital converter (ADC) delta modulator with phase modulation-demodulation architecture together with digital in-phase and quadrature mixer and a pair of digital decimation filters. The chip is fabricated using a 4.5 kA cm{sup -2} process and is cryopackaged using a commercial-off-the-shelf cryocooler. Experimental results in HF, VHF, UHF and L bands and their analysis, proving consistent operation of the cryopackaged ADR chip up to 24.32 GHz clock frequency, are presented and discussed.

  16. Spectrum Measurement and Analysis of TV Band in Support of Cognitive Radio Operation in India

    DEFF Research Database (Denmark)

    Patil, Kishor P.; Skouby, Knud Erik; Prasad, Ramjee

    2013-01-01

    ) Cognitive Radio operation in TV band. Also we have stressed on the need of quantitative analysis of TVWSs availability and compatibility studies for protection of incumbent services for CR access of TVWSs in India. Also this paper reviews the state-of-the-art in standardization of cognitive access to TVWS.......TV White Spaces constitutes the major portion of the VHF and UHF TV band which is geographically unused after digital switchover. The most important regulatory trend in the context of Dynamic Spectrum Access (DSA) is the Cognitive access of TV white Spaces. Through spectrum measurement campaign we...... have estimated the spectrum utilization of TV band in Pune, India. We have designed the measurement set up and methodology for the measurement campaign. Our spectrum occupancy analysis provides the realistic view on the spectrum opportunities in India for (i) spectrum refarming of TV band; (ii...

  17. Music, radio and mediatization

    DEFF Research Database (Denmark)

    Michelsen, Morten; Krogh, Mads

    2016-01-01

    Mediatization has become a key concept for understanding the relations between media and other cultural and social fields. Contributing to the discussions related to the concept of mediatization, this article discusses how practices of radio and music(al life) influence each other. We follow Deacon......’s and Stanyer’s advice to supplement the concept of mediatization with ‘a series of additional concepts at lower levels of abstraction’ and suggest, in this respect, the notion of heterogeneous milieus of music–radio. Hereby, we turn away from the all-encompassing perspectives related to the concept...... of mediatization where media as such seem to be ascribed agency. Instead, we consider historical accounts of music–radio in order to address the complex nonlinearity of concrete processes of mediatization as they take place in the multiple meetings between a decentred notion of radio and musical life....

  18. The digital sport radio.

    Directory of Open Access Journals (Sweden)

    Hilario José ROMERO BEJARANO

    2014-07-01

    Full Text Available Radio has been immersed in recent years in a phase of technological integration and business of multimedia, as well as diversification of systems and channels for broadcasting. In addition, Internet has been consolidated as the platform of digital radio that more has evolved as a result of its continued expansion. However, the merger radio-Internet must be understood as a new form of communication, and not solely as a new complementary medium. In this context, it is of great interest to analyze that transformations in the way of reception, contents, languages, programs and schedules, has brought with it for the radio that integration. To this end is taken as main reference the sports areas, a key aspect and broadly representative of the current broadcasting landscape.

  19. Social cognitive radio networks

    CERN Document Server

    Chen, Xu

    2015-01-01

    This brief presents research results on social cognitive radio networks, a transformational and innovative networking paradigm that promotes the nexus between social interactions and cognitive radio networks. Along with a review of the research literature, the text examines the key motivation and challenges of social cognitive radio network design. Three socially inspired distributed spectrum sharing mechanisms are introduced: adaptive channel recommendation mechanism, imitation-based social spectrum sharing mechanism, and evolutionarily stable spectrum access mechanism. The brief concludes with a discussion of future research directions which ascertains that exploiting social interactions for distributed spectrum sharing will advance the state-of-the-art of cognitive radio network design, spur a new line of thinking for future wireless networks, and enable novel wireless service and applications.

  20. Eratosthenes via Ham Radio

    Science.gov (United States)

    Koser, John F.

    1975-01-01

    A secondary geology class used Eratosthenes' method for measuring the circumference of the earth by comparing their measurements of the shadow of a vertical rod to the measurements made by another person contacted by ham radio. (MLH)

  1. Everyday Radio Telescope

    CERN Document Server

    Mandal, Pranshu; Kumar, Pratik; Yelikar, Anjali; Soni, Kanchan; T, Vineeth Krishna

    2016-01-01

    We have developed an affordable, portable college level radio telescope for amateur radio astronomy which can be used to provide hands-on experience with the fundamentals of a radio telescope and an insight into the realm of radio astronomy. With our set-up one can measure brightness temperature and flux of the Sun at 11.2 GHz and calculate the beam width of the antenna. The set-up uses commercially available satellite television receiving system and parabolic dish antenna. We report the detection of point sources like Saturn and extended sources like the galactic arm of the Milky way. We have also developed python pipeline, which are available for free download, for data acquisition and visualization.

  2. Wireless radio a history

    CERN Document Server

    Coe, Lewis

    2006-01-01

    ""Informative...recommended""--Choice; ""interesting...a good read...well worth reading""--Contact Magazine. This history first looks at Marconi's wireless communications system and then explores its many applications, including marine radio, cellular telephones, police and military uses, television and radar. Radio collecting is also discussed, and brief biographies are provided for the major figures in the development and use of the wireless.

  3. Classics in radio astronomy

    CERN Document Server

    Sullivan, Woodruff Turner

    1982-01-01

    Radio techniques were the nrst to lead astronomy away from the quiescent and limited Universe revealed by traditional observations at optical wave­ lengths. In the earliest days of radio astronomy, a handful of radio physicists and engineers made one startling discovery after another as they opened up the radio sky. With this collection of classic papers and the extensive intro­ ductory material, the reader can experience these exciting discoveries, as well as understand the developing techniques and follow the motivations which prompted the various lines of inquiry. For instance he or she will follow in detail the several attempts to detect radio waves from the sun at the turn of the century; the unravelling by Jansky of a "steady hiss type static"; the incredible story of Reber who built a 9 meter dish in his backyard in 1937 and then mapped the Milky Way; the vital discoveries by Hey and colleagues of radio bursts from the Sun and of a discrete source in the constellation of Cygnus; the development of re...

  4. Sistema de adquisición de datos para la medición de parámetros radioeléctricos en antenas lineales en la banda de TV de VHF y UHF System of acquisition of information for measurement of radioelectric parameters in linear antennas in the band of VHF and UHF’s television

    Directory of Open Access Journals (Sweden)

    María del Pilar Celemín

    2007-06-01

    Full Text Available Este proyecto desarrolla un sistema de adquisición y procesamiento de datos para la medición y ajuste de parámetros radioeléctricos de antenas lineales en las bandas de VHF y UHF. Como señal de prueba se utilizan algunas de las señales de televisión que se encuentran en el espectro radioeléctrico, provenientes de los transmisores que radian señales de canales nacionales. El receptor implementado incluye un sintonizador comercial de televisión que toma como muestra la señal portadora de video. Esta señal es amplificada, filtrada, almacenada y acondicionada, para ser leída por el puerto serial de un computador personal y procesada empleando un programa en Visual Basic, con una interfaz gráfica que permite una interacción amigable con el usuario. Desde acá se interactúa con un microcontrolador que controla el mecanismo de posicionamiento de la antena receptora por medio de una estructura electromecánica, que le permite ejecutar movimientos en dos grados de libertad: en azimut y en elevación. Con esto se logra un sistema capaz de determinar automáticamente el apuntamiento óptimo de la antena de acuerdo al máximo nivel de recepción de señal. Así mismo, se determinan parámetros propios de la antena tales como: el patrón de radiación (tanto en el plano horizontal como vertical, la ganancia directiva de la antena, la ganancia en cada uno de los puntos que conforman el plano principal, y otros parámetros de interés para el análisis de las características reales de antenas lineales.This project develops a data acquisition and processing system for measuring and adjusting lineal-antenna radioelectric parameters in VHF and UHF. Television signals are used as test signal. They can be found in radio electric spectrum, as they come from commercial transmitters that broadcast signals of national channels. The achieved receptor includes a television commercial tuner for obtaining video signal. Later, this signal is conditioning to

  5. Lightning VHF radiation location system based on short-baseline TDOA technique — Validation in rocket-triggered lightning

    Science.gov (United States)

    Sun, Zhuling; Qie, Xiushu; Liu, Mingyuan; Cao, Dongjie; Wang, Dongfang

    2013-07-01

    A lightning VHF radiation location system based on short-baseline time-difference of arrival (TDOA) technology is newly developed. Based on the orthogonal 10 m-baseline antenna array with four identical broadband flat plane antennas, this system receives the lightning broadband VHF radiation signals and calculates TDOA between antennas in order to determine the location of lightning radiation sources in two dimensions (elevation and azimuth). To reduce noise and improve estimation accuracy of time delay, a general correlation time delay estimation algorithm based on direct correlation method and wavelet transform is proposed. Moreover, parabolic interpolation algorithm is used in the fractional delay estimation to improve the time resolution of the positioning system. In this paper, a rocket-triggered lightning discharge and a cloud lightning discharge are analyzed respectively, combining with simultaneous observations of high-speed camera and fast/slow electric field changes. The results indicate that the TDOA location system could effectively map the lightning radiation sources in 2 dimensions and are in a good agreement with the high-speed video camera images.

  6. Radar efficiency and the calculation of decade-long PMSE backscatter cross-section for the Resolute Bay VHF radar

    Directory of Open Access Journals (Sweden)

    N. Swarnalingam

    2009-04-01

    Full Text Available The Resolute Bay VHF radar, located in Nunavut, Canada (75.0° N, 95.0° W and operating at 51.5 MHz, has been used to investigate Polar Mesosphere Summer Echoes (PMSE since 1997. PMSE are a unique form of strong coherent radar echoes, and their understanding has been a challenge to the scientific community since their discovery more than three decades ago. While other high latitude radars have recorded strong levels of PMSE activities, the Resolute Bay radar has observed relatively lower levels of PMSE strengths. In order to derive absolute measurements of PMSE strength at this site, a technique is developed to determine the radar efficiency using cosmic (sky noise variations along with the help of a calibrated noise source. VHF radars are only rarely calibrated, but determination of efficiency is even less common. Here we emphasize the importance of efficiency for determination of cross-section measurements. The significant advantage of this method is that it can be directly applied to any MST radar system anywhere in the world as long as the sky noise variations are known. The radar efficiencies for two on-site radars at Resolute Bay are determined. PMSE backscatter cross-section is estimated, and decade-long PMSE strength variations at this location are investigated. It was noticed that the median of the backscatter cross-section distribution remains relatively unchanged, but over the years a great level of variability occurs in the high power tail of the distribution.

  7. Meteoroid Fragmentation as Revealed in Head- and Trail-Echoes Observed with the Arecibo UHF and VHF Radars

    Science.gov (United States)

    Mathews, J. D.; Malhorta, A.

    2011-01-01

    We report recent 46.8/430 MHz (VHF/UHF) radar meteor observations at Arecibo Observatory (AO) that reveal many previously unreported features in the radar meteor return - including flare-trails at both UHF and VHF - that are consistent with meteoroid fragmentation. Signature features of fragmentation include strong intra-pulse and pulse-to-pulse fading as the result of interference between or among multiple meteor head-echo returns and between head-echo and impulsive flare or "point" trail-echoes. That strong interference fading occurs implies that these scatterers exhibit well defined phase centers and are thus small compared with the wavelength. These results are consistent with and offer advances beyond a long history of optical and radar meteoroid fragmentation studies. Further, at AO, fragmenting and flare events are found to be a large fraction of the total events even though these meteoroids are likely the smallest observed by the major radars. Fragmentation is found to be a major though not dominate component of the meteors observed at other HPLA radars that are sensitive to larger meteoroids.

  8. A uniform-sensitivity omnidirectional shear-horizontal (SH) wave transducer based on a thickness poled, thickness-shear (d15) piezoelectric ring

    Science.gov (United States)

    Huan, Qiang; Miao, Hongchen; Li, Faxin

    2017-08-01

    The fundamental shear horizontal (SH0) wave in plates is of great importance in the field of nondestructive testing (NDT) and structural health monitoring (SHM) since it is the unique non-dispersive guided wave mode. For practical applications, a phased array system based on omnidirectional SH0 wave transducers is most useful as it can cover a wide range of a plate. However, so far very few omnidirectional SH wave transducers have been developed. In this work, we proposed an omnidirectional SH wave piezoelectric transducer (OSH-PT) based on a thickness poled piezoelectric ring. The ring is equally divided into twelve sectors and the electric field is circumferentially applied, resulting in a new thickness-shear (d15) mode. Finite element analysis shows that the proposed OSH-PT can excite single-mode SH0 wave and receive the SH0 wave only. Experiments were then conducted to examine the performance of the proposed OSH-PT. Results indicated that it can generate and receive single-mode SH0 wave in a wide frequency range with nearly uniform sensitivities along all directions. Considering its quite simple configuration, compact size and low cost, the proposed OSH-PT is expected to greatly promote the applications of SH waves in the field of NDT and SHM.

  9. Design and implementation of an omni-directional underwater acoustic micro-modem based on a low-power micro-controller unit.

    Science.gov (United States)

    Won, Tae-Hee; Park, Sung-Joon

    2012-01-01

    For decades, underwater acoustic communication has been restricted to the point-to-point long distance applications such as deep sea probes and offshore oil fields. For this reason, previous acoustic modems were typically characterized by high data rates and long working ranges at the expense of large size and high power consumption. Recently, as the need for underwater wireless sensor networks (UWSNs) has increased, the research and development of compact and low-power consuming communication devices has become the focus. From the consideration that the requisites of acoustic modems for UWSNs are low power consumption, omni-directional beam pattern, low cost and so on, in this paper, we design and implement an omni-directional underwater acoustic micro-modem satisfying these requirements. In order to execute fast digital domain signal processing and support flexible interfaces with other peripherals, an ARM Cortex-M3 is embedded in the micro-modem. Also, for the realization of small and omni-directional properties, a spherical transducer having a resonant frequency of 70 kHz and a diameter of 34 mm is utilized for the implementation. Physical layer frame format and symbol structure for efficient packet-based underwater communication systems are also investigated. The developed acoustic micro-modem is verified analytically and experimentally in indoor and outdoor environments in terms of functionality and performance. Since the modem satisfies the requirements for use in UWSNs, it could be deployed in a wide range of applications requiring underwater acoustic communication.

  10. Radio-tomographic images of postmidnight equatorial plasma depletions

    Science.gov (United States)

    Hei, Matthew A.; Bernhardt, Paul A.; Siefring, Carl L.; Wilkens, Matthew R.; Huba, Joseph D.; Krall, Jonathan F.; Valladares, Cesar E.; Heelis, Roderick A.; Hairston, Marc R.; Coley, W. Robin; Chau, Jorge L.; De La Jara, Cesar

    2014-01-01

    the first time, equatorial plasma depletions (EPDs) have been imaged in the longitude-altitude plane using radiotomography. High-resolution (~10 km) reconstructions of electron density were derived from total electron content (TEC) measurements provided by a receiver array in Peru. TEC data were obtained from VHF/UHF signals transmitted by the Coherent Electromagnetic Radio Tomography (CERTO) beacon on the C/NOFS satellite. EPDs generated premidnight were observed near dawn. On one night, the bubble densities were highly reduced, 100-1000 km wide, and embedded within a layerlike ionosphere. Three nights later, the EPDs exhibited similar features but were embedded in a locally uplifted ionosphere. The C/NOFS in situ instruments detected a dawn depletion where the reconstruction showed lifted EPDs, implying that the postmidnight electric fields raised sections of ionosphere to altitudes where embedded/reactivated fossil EPDs were detected as dawn depletions. Satellites flying under domelike distortions of the ionosphere may observe these distortions as broad plasma decreases (BPDs).

  11. High-Rate Fabrication of a-Si-Based Thin-Film Solar Cells Using Large-Area VHF PECVD Processes

    Energy Technology Data Exchange (ETDEWEB)

    Deng, Xunming [University of Toledo; Fan, Qi Hua

    2011-12-31

    The University of Toledo (UT), working in concert with it’s a-Si-based PV industry partner Xunlight Corporation (Xunlight), has conducted a comprehensive study to develop a large-area (3ft x 3ft) VHF PECVD system for high rate uniform fabrication of silicon absorber layers, and the large-area VHF PECVD processes to achieve high performance a-Si/a-SiGe or a-Si/nc-Si tandem junction solar cells during the period of July 1, 2008 to Dec. 31, 2011, under DOE Award No. DE-FG36-08GO18073. The project had two primary goals: (i) to develop and improve a large area (3 ft × 3 ft) VHF PECVD system for high rate fabrication of > = 8 Å/s a-Si and >= 20 Å/s nc-Si or 4 Å/s a-SiGe absorber layers with high uniformity in film thicknesses and in material structures. (ii) to develop and optimize the large-area VHF PECVD processes to achieve high-performance a-Si/nc-Si or a-Si/a-SiGe tandem-junction solar cells with >= 10% stable efficiency. Our work has met the goals and is summarized in “Accomplishments versus goals and objectives”.

  12. Analisis interferensi T-DAB dan TV Analog pada pita Very High Frequency (VHF

    Directory of Open Access Journals (Sweden)

    Kasmad Ariansyah

    2014-09-01

    Full Text Available Kehadiran teknologi digital telah membawa perubahan di dalam berbagai aspek kehidupan, tak terkecuali di dunia penyiaran. Digitalisasi dibidang penyiaran diyakini dapat memberikan manfaat dalam hal efisiensi spektrum frekuensi radio. Berkaitan dengan penyiaran radio, Menteri  Komunikasi  dan  Informatika telah menetapkan DAB family sebagai standard penyiaran radio digital di Indonesia. Kajian dilakukan untuk mendapatkan jarak minimum yang diperlukan  antara sistem T-DAB dan TV analog sebagai solusi terhadap kemungkinan interferensi. Analisis dilakukan dengan bantuan SEAMCAT. Berdasarkan hasil analisis disimpulkan bahwa  kanal  A  T-DAB  merupakan  kanal yang paling rentan terhadap interferensi; Untuk mencapai probabilitas interferensi maksimum 5%, separasi geograpis minimum antara cakupan terluar TV analog kanal n dan transmitter terluar pada jaringan SFN T-DAB untuk kanal (n- 1D, nA, nB, nC berturut-turut adalah 220 Km, 290 Km, 145 Km dan  40  Km.  Sedangkan  untuk  kanal  nD  dan  (n+1A  dapat dioperasikan tanpa separasi geograpis dengan TV analog.

  13. Tools of radio astronomy

    CERN Document Server

    Wilson, Thomas L; Hüttemeister, Susanne

    2013-01-01

    This 6th edition of “Tools of Radio Astronomy”, the most used introductory text in radio astronomy, has been revised to reflect the current state of this important branch of astronomy. This includes the use of satellites, low radio frequencies, the millimeter/sub-mm universe, the Cosmic Microwave Background and the increased importance of mm/sub-mm dust emission. Several derivations and presentations of technical aspects of radio astronomy and receivers, such as receiver noise, the Hertz dipole and  beam forming have been updated, expanded, re-worked or complemented by alternative derivations. These reflect advances in technology. The wider bandwidths of the Jansky-VLA and long wave arrays such as LOFAR and mm/sub-mm arrays such as ALMA required an expansion of the discussion of interferometers and aperture synthesis. Developments in data reduction algorithms have been included. As a result of the large amount of data collected in the past 20 years, the discussion of solar system radio astronomy, dust em...

  14. Radio Galaxy Zoo: A Search for Hybrid Morphology Radio Galaxies

    Science.gov (United States)

    Kapińska, A. D.; Terentev, I.; Wong, O. I.; Shabala, S. S.; Andernach, H.; Rudnick, L.; Storer, L.; Banfield, J. K.; Willett, K. W.; de Gasperin, F.; Lintott, C. J.; López-Sánchez, Á. R.; Middelberg, E.; Norris, R. P.; Schawinski, K.; Seymour, N.; Simmons, B.

    2017-12-01

    Hybrid morphology radio sources (HyMoRS) are a rare type of radio galaxy that display different Fanaroff-Riley classes on opposite sides of their nuclei. To enhance the statistical analysis of HyMoRS, we embarked on a large-scale search of these sources within the international citizen science project, Radio Galaxy Zoo (RGZ). Here, we present 25 new candidate hybrid morphology radio galaxies. Our selected candidates are moderate power radio galaxies ({L}{median}=4.7× {10}24 W Hz-1 sr-1) at redshifts 0.14 1 Mpc) radio galaxies, one resides at the center of a galaxy cluster, and one is hosted by a rare green bean galaxy. Although the origin of the hybrid morphology radio galaxies is still unclear, this type of radio source starts depicting itself as a rather diverse class. We discuss hybrid radio morphology formation in terms of the radio source environment (nurture) and intrinsically occurring phenomena (nature; activity cessation and amplification), showing that these peculiar radio galaxies can be formed by both mechanisms. While high angular resolution follow-up observations are still necessary to confirm our candidates, we demonstrate the efficacy of the RGZ in the pre-selection of these sources from all-sky radio surveys, and report the reliability of citizen scientists in identifying and classifying complex radio sources.

  15. Omnidirectional Harvesting of Weak Light Using a Graphene Quantum Dot-Modified Organic/Silicon Hybrid Device

    KAUST Repository

    Tsai, Meng-Lin

    2017-04-21

    Despite great improvements in traditional inorganic photodetectors and photovoltaics, more progress is needed in the detection/collection of light at low-level conditions. Traditional photodetectors tend to suffer from high noise when operated at room temperature; therefore, these devices require additional cooling systems to detect weak or dim light. Conventional solar cells also face the challenge of poor light-harvesting capabilities in hazy or cloudy weather. The real world features such varying levels of light, which makes it important to develop strategies that allow optical devices to function when conditions are less than optimal. In this work, we report an organic/inorganic hybrid device that consists of graphene quantum dot-modified poly(3,4-ethylenedioxythiophene) polystyrenesulfonate spin-coated on Si for the detection/harvest of weak light. The hybrid configuration provides the device with high responsivity and detectability, omnidirectional light trapping, and fast operation speed. To demonstrate the potential of this hybrid device in real world applications, we measured near-infrared light scattered through human tissue to demonstrate noninvasive oximetric photodetection as well as characterized the device\\'s photovoltaic properties in outdoor (i.e., weather-dependent) and indoor weak light conditions. This organic/inorganic device configuration demonstrates a promising strategy for developing future high-performance low-light compatible photodetectors and photovoltaics.

  16. Development of an omnidirectional gamma-ray imaging Compton camera for low-radiation-level environmental monitoring

    Science.gov (United States)

    Watanabe, Takara; Enomoto, Ryoji; Muraishi, Hiroshi; Katagiri, Hideaki; Kagaya, Mika; Fukushi, Masahiro; Kano, Daisuke; Satoh, Wataru; Takeda, Tohoru; Tanaka, Manobu M.; Tanaka, Souichi; Uchida, Tomohisa; Wada, Kiyoto; Wakamatsu, Ryo

    2018-02-01

    We have developed an omnidirectional gamma-ray imaging Compton camera for environmental monitoring at low levels of radiation. The camera consisted of only six CsI(Tl) scintillator cubes of 3.5 cm, each of which was readout by super-bialkali photo-multiplier tubes (PMTs). Our camera enables the visualization of the position of gamma-ray sources in all directions (∼4π sr) over a wide energy range between 300 and 1400 keV. The angular resolution (σ) was found to be ∼11°, which was realized using an image-sharpening technique. A high detection efficiency of 18 cps/(µSv/h) for 511 keV (1.6 cps/MBq at 1 m) was achieved, indicating the capability of this camera to visualize hotspots in areas with low-radiation-level contamination from the order of µSv/h to natural background levels. Our proposed technique can be easily used as a low-radiation-level imaging monitor in radiation control areas, such as medical and accelerator facilities.

  17. Quantitative analysis of the improvement in omnidirectional maritime surveillance and tracking due to real-time image enhancement

    Science.gov (United States)

    de Villiers, Jason P.; Bachoo, Asheer K.; Nicolls, Fred C.; le Roux, Francois P. J.

    2011-05-01

    Tracking targets in a panoramic image is in many senses the inverse problem of tracking targets with a narrow field of view camera on a pan-tilt pedestal. In a narrow field of view camera tracking a moving target, the object is constant and the background is changing. A panoramic camera is able to model the entire scene, or background, and those areas it cannot model well are the potential targets and typically subtended far fewer pixels in the panoramic view compared to the narrow field of view. The outputs of an outward staring array of calibrated machine vision cameras are stitched into a single omnidirectional panorama and used to observe False Bay near Simon's Town, South Africa. A ground truth data-set was created by geo-aligning the camera array and placing a differential global position system receiver on a small target boat thus allowing its position in the array's field of view to be determined. Common tracking techniques including level-sets, Kalman filters and particle filters were implemented to run on the central processing unit of the tracking computer. Image enhancement techniques including multi-scale tone mapping, interpolated local histogram equalisation and several sharpening techniques were implemented on the graphics processing unit. An objective measurement of each tracking algorithm's robustness in the presence of sea-glint, low contrast visibility and sea clutter - such as white caps is performed on the raw recorded video data. These results are then compared to those obtained with the enhanced video data.

  18. Omnidirectional, polarization-independent, ultra-broadband metamaterial perfect absorber using field-penetration and reflected-wave-cancellation.

    Science.gov (United States)

    Zhong, Yan Kai; Lai, Yi-Chun; Tu, Ming-Hsiang; Chen, Bo-Ruei; Fu, Sze Ming; Yu, Peichen; Lin, Albert

    2016-05-16

    In this work, we present the result of nickel (Ni)-based metamaterial perfect absorbers (MPA) with ultra-broadband close-to-one absorbance. The experimental broadband characteristic is significantly improved over the past effort on metamaterial perfect absorbers. An in-depth physical picture and quantitative analysis is presented to reveal the physical origin of its ultrabroadband nature. The key constituent is the cancellation of the reflected wave using ultra-thin, moderate-extinction metallic films. The ultra-thin metal thickness can reduce the reflection as the optical field penetrates through the metallic films. This leads to minimal reflection at each ultra-thin metal layer, and light is penetrating into the Ni/SiO2 stacking. More intuitively, when the layer thickness is much smaller than the photon wavelength, the layer is essentially invisible to the photons. This results in absorption in the metal thin-film through penetration while there is minimal reflection by the metal film. More importantly, the experimental evidence for omni-directionality and polarization-insensitivity are established for the proposed design. Detailed measurement is conducted. Due to the ultrathin metal layers and the satisfactory tolerance in dielectric thickness, the broadband absorption has minimal degradation at oblique incidence. Such a wide angle, polarization-insensitive, ultra-broadband MPA can be very promising in the future, and the optical physics using sub-skin-depth metal film can also facilitate miniaturized high-performance nano-photonic devices.

  19. A Special Unique Solution Case of the Perspective-Three-Point Problem for External Parameter Calibration of an Omnidirectional Camera

    Directory of Open Access Journals (Sweden)

    Xiaoxiao Zhu

    2012-11-01

    Full Text Available In the field of machine vision, the multi-solution problem of the perspective-three-point (P3P camera pose estimation problem has been widely researched. Many researchers have tried to find unique solutions that will enable the use of the P3P method in practical applications such as the calibration of external parameters of a camera. Gao found a special case that is very simple and intuitive, but can only be used for a camera with a very large field of view. Therefore, it did not attract much attention. The purpose of this study was to analyse Gao's special case and use it for calibrating the external parameters of an omnidirectional camera, which is used widely because of its very large field of view. We first verify Gao's special case and extend its application. We then propose an iterative method for finding the unique solution. After this, we perform a simulation experiment to determine the effect of the configuration of the three control points on the accuracy of the unique solution. Finally, we use an application to examine the efficiency of the method.

  20. Galactic radio astronomy

    CERN Document Server

    Sofue, Yoshiaki

    2017-01-01

    This book is a concise primer on galactic radio astronomy for undergraduate and graduate students, and provides wide coverage of galactic astronomy and astrophysics such as the physics of interstellar matter and the dynamics and structure of the Milky Way Galaxy and galaxies. Radio astronomy and its technological development have led to significant progress in galactic astronomy and contributed to understanding interstellar matter and galactic structures. The book begins with the fundamental physics of radio-wave radiation, i.e., black body radiation, thermal emission, synchrotron radiation, and HI and molecular line emissions. The author then gives overviews of ingredients of galactic physics, including interstellar matter such as the neutral (HI), molecular hydrogen, and ionized gases, as well as magnetic fields in galaxies. In addition, more advanced topics relevant to the Galaxy and galaxies are also contained here: star formation, supernova remnants, the Galactic Center and black holes, galactic dynamics...

  1. Radio frequency spectrum management

    Science.gov (United States)

    Sujdak, E. J., Jr.

    1980-03-01

    This thesis is a study of radio frequency spectrum management as practiced by agencies and departments of the Federal Government. After a brief introduction to the international agency involved in radio frequency spectrum management, the author concentrates on Federal agencies engaged in frequency management. These agencies include the National Telecommunications and Information Administration (NTIA), the Interdepartment Radio Advisory Committee (IRAC), and the Department of Defense (DoD). Based on an analysis of Department of Defense frequency assignment procedures, recommendations are given concerning decentralizing military frequency assignment by delegating broader authority to unified commanders. This proposal includes a recommendation to colocate the individual Service frequency management offices at the Washington level. This would result in reduced travel costs, lower manpower requirements, and a common tri-Service frequency management data base.

  2. A reconfigurable radio architecture for Cognitive Radio in emergency networks

    NARCIS (Netherlands)

    Zhang, Q.; Kokkeler, Andre B.J.; Smit, Gerardus Johannes Maria

    2006-01-01

    Cognitive Radio has been proposed as a promising technology to solve today’s spectrum scarcity problem. Cognitive Radio is able to sense the spectrum to find the free spectrum, which can be optimally used by Cognitive Radio without causing interference to the licensed user. In the scope of the

  3. Radio spectra of Gigahertz Peaked Spectrum radio sources

    NARCIS (Netherlands)

    deVries, WH; Barthel, PD; ODea, CP

    A well defined sample of 72 Gigahertz Peaked Spectrum radio sources is compiled, having turnover frequencies in the range of 0.5 - 10 GHz. Using this sample, the canonical GPS radio spectrum is constructed, which is found to have a constant shape, independent of AGN type, redshift or radio

  4. Spectrum management and radio resource management considering cognitive radio systems

    NARCIS (Netherlands)

    Haartsen, J.C.; Wieweg, Lasse; Huschke, Jörg

    2005-01-01

    International fora and some national administrations define a cognitive radio (CR) as a pioneering radio communication system that would be capable of altering and adapting its transmitter and receiver parameters based on communication and the exchange of information with related detectable radio

  5. 75 FR 10439 - Cognitive Radio Technologies and Software Defined Radios

    Science.gov (United States)

    2010-03-08

    ... COMMISSION 47 CFR Part 2 Cognitive Radio Technologies and Software Defined Radios AGENCY: Federal... of Engineering and Technology, (202) 418-7506, e-mail: [email protected] . SUPPLEMENTARY... Order 1. On March 17, 2005, the Commission adopted the Cognitive Radio Report and Order, 70 FR 23032...

  6. Low VHF Channel Measurements and Simulations in Indoor and Outdoor Scenarios

    Science.gov (United States)

    2015-05-01

    S11 and radiation pattern of the λ/6 antenna ......................8 Fig. 5 The USRP integrated on a PackBot mobile platform...comparison, whereas in Fig. 3a the signal is only received via an antenna. 3.1 System Hardware 3.1.1 Radio and Daughtercards We use the USRP model N210 SDR for...our tests.46 The USRP N210 provides an Ethernet interface that allows us to use software control for transmission and reception. The USRP is

  7. CLUSTERED RADIO INTERFEROMETRIC CALIBRATION

    NARCIS (Netherlands)

    Kazemi, S.; Yatawatta, S.; Zaroubi, S.

    2011-01-01

    This paper introduces an amendment to radio interferometric calibration of sources below the noise level. The main idea is to employ the information of the stronger sources' measured signals as a plug-in criterion to solve for the weaker ones. For this purpose, we construct a number of source

  8. Educational Broadcasting--Radio.

    Science.gov (United States)

    Ahamed, Uvais; Grimmett, George

    This manual is intended for those who must conduct educational radio broadcasting training courses in Asia-Pacific countries without the resources of experienced personnel, as well as for individuals to use in self-learning situations. The selection of material has been influenced by the need to use broadcasting resources effectively in programs…

  9. Radio Broadcast Technology

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 7; Issue 1. Radio Broadcast Technology. Harsh Vardhan. General Article Volume 7 Issue 1 January 2002 pp 53-63. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/007/01/0053-0063. Keywords. Hertzian ...

  10. Division x: Radio Astronomy

    NARCIS (Netherlands)

    Taylor, Russ; Chapman, Jessica; Rendong, Nan; Carilli, Christopher; Giovannini, Gabriele; Hills, Richard; Hirabayashi, Hisashi; Jonas, Justin; Lazio, Joseph; Morganti, Raffaella; Rubio, Monica; Shastri, Prajval

    This triennium has seen a phenomenal investment in development of observational radio astronomy facilities in all parts of the globe at a scale that significantly impacts the international community. This includes both major enhancements such as the transition from the VLA to the EVLA in North

  11. Torun Radio Astronomy Observatory

    Science.gov (United States)

    Murdin, P.

    2000-11-01

    Torun Center for Astronomy is located at Piwnice, 15 km north of Torun, Poland. A part of the Faculty of Physics and Astronomy of the Nicolaus Copernicus University, it was created by the union of Torun Radio Astronomy Observatory (TRAO) and the Institute of Astronomy on 1 January 1997....

  12. Valuing commercial radio licences

    NARCIS (Netherlands)

    Kerste, M.; Poort, J.; van Eijk, N.

    2011-01-01

    Within the EU Regulatory Framework, licensees for commercial radio broadcasting may be charged a fee to ensure optimal allocation of scarce resources but not to maximize public revenues. In this paper, it is described how such a fee can be determined for the purpose of licence renewal or extension.

  13. Digital Low Frequency Radio Camera

    Science.gov (United States)

    Fullekrug, M.; Mezentsev, A.; Soula, S.; van der Velde, O.; Poupeney, J.; Sudre, C.; Gaffet, S.; Pincon, J.

    2012-04-01

    This contribution reports the design, realization and operation of a novel digital low frequency radio camera towards an exploration of the Earth's electromagnetic environment with particular emphasis on lightning discharges and subsequent atmospheric effects such as transient luminous events. The design of the digital low frequency radio camera is based on the idea of radio interferometry with a network of radio receivers which are separated by spatial baselines comparable to the wavelength of the observed radio waves, i.e., ~1-100 km which corresponds to a frequency range from ~3-300 kHz. The key parameter towards the realization of the radio interferometer is the frequency dependent slowness of the radio waves within the Earth's atmosphere with respect to the speed of light in vacuum. This slowness is measured with the radio interferometer by using well documented radio transmitters. The digital low frequency radio camera can be operated in different modes. In the imaging mode, still photographs show maps of the low frequency radio sky. In the video mode, movies show the dynamics of the low frequency radio sky. The exposure time of the photograhps, the frame rate of the video, and the radio frequency of interest can be adjusted by the observer. Alternatively, the digital radio camera can be used in the monitoring mode, where a particular area of the sky is observed continuously. The first application of the digital low frequency radio camera is to characterize the electromagnetic energy emanating from sprite producing lightning discharges, but it is expected that it can also be used to identify and investigate numerous other radio sources of the Earth's electromagnetic environment.

  14. Ham Radio is Mir Magic.

    Science.gov (United States)

    Evans, Gary

    1997-01-01

    Presents a classroom activity in which students communicated with U.S. and Russian astronauts via ham radio while they were in orbit on the space station Mir. Gives suggestions for other ham radio classroom activities as well as names of organizations, publications, and grant programs that teachers can access to help in bring ham radio into their…

  15. Extragalactic radio continuum surveys and the transformation of radio astronomy

    Science.gov (United States)

    Norris, Ray P.

    2017-10-01

    Next-generation radio surveys are about to transform radio astronomy by discovering and studying tens of millions of previously unknown radio sources. These surveys will provide fresh insights for understanding the evolution of galaxies, measuring the evolution of the cosmic star-formation rate, and rivalling traditional techniques in the measurement of fundamental cosmological parameters. By observing a new volume of observational parameter space, they are also likely to discover unexpected phenomena. This Review traces the evolution of extragalactic radio continuum surveys from the earliest days of radio astronomy to the present, and identifies the challenges that must be overcome to achieve this transformational change.

  16. INOVASI RADIO KAMPUS (RANCANG BANGUN RADIO UDINUS DENGAN INOVASI TEKNOLOGI @RADIO

    Directory of Open Access Journals (Sweden)

    Wellia Shinta Sari

    2014-08-01

    Full Text Available Perkembangan Teknologi Informasi dan Komunikasi (TIK memaksa industri penyiaran untuk ikut menyesuaikan diri. Radio konvensional bisa jadi akan tertinggal jika tidak melakukan inovasi teknologi yang ada. Begitu juga dengan radio kampus, yang keberadaannya sangat dibutuhkan sebagai wadah kreativitas dan sarana pembelajaran di sebuah universitas, apalagi yang memiliki program studi penyiaran. Radio kampus Suara Dian yang masih konvensional sehingga hampir kehilangan eksistensinya harus segera dibenahi dan dihidupkan kembali dengan mengikuti perkembangan teknologi di era konvergensi. Metode Inovasi teknologi yang bisa dilakukan adalah dengan menggunakan teknologi @Radio Streaming, yang bukan sekedar streaming, tapi juga optimalisasi teknologi yang terintegrasi dinamis melalui RISE (Radio Broadcasting Integrated System. Dengan berbagai fitur unggul dari inovasi teknologi tersebut, maka diharapkan Radio kampus Udinus ”Suara Dian” dapat kembali hidup, berkembang dan lebih kompetitif ditengah industri penyiaran Radio. Kata kunci : radio, kampus, konvergensi, streaming.

  17. MODELING OF PATTERN FORMING PROCESS OF AUTOMATIC RADIO DIRECTION FINDER OF PHASE VHF IN THE DEVELOPMENT ENVIRONMENT OF LabVIEW APPLIED PROGRAMS

    Directory of Open Access Journals (Sweden)

    G. K. Aslanov

    2015-01-01

    Full Text Available In the article is developed the model demonstrating the forming process of pattern of antenna system of aerodrome quasidopler automatic radiodirection-finder station in the development environment of LabVIEW applied programs of National Instrument company. 

  18. Configurable SDR Operation for Cognitive Radio Applications using GNU Radio and the Universal Software Radio Peripheral

    OpenAIRE

    Scaperoth, David Alan

    2007-01-01

    With interoperability issues plaguing emergency responders throughout the country, Cognitive Radio (CR) offers a unique solution to streamline communication between police, Emergency Medical Technicians (EMT), and military officers. Using Software Defined Radio (SDR) technology, a flexible radio platform can be potentially configured using a Cognitive Engine (CE) to transmit and receive many different incompatible radio standards. In this thesis, an interface between a Cognitive Engine and...

  19. Estimating the position and orientation of a mobile robot with respect to a trajectory using omnidirectional imaging and global appearance

    Science.gov (United States)

    2017-01-01

    Along the past years, mobile robots have proliferated both in domestic and in industrial environments to solve some tasks such as cleaning, assistance, or material transportation. One of their advantages is the ability to operate in wide areas without the necessity of introducing changes into the existing infrastructure. Thanks to the sensors they may be equipped with and their processing systems, mobile robots constitute a versatile alternative to solve a wide range of applications. When designing the control system of a mobile robot so that it carries out a task autonomously in an unknown environment, it is expected to take decisions about its localization in the environment and about the trajectory that it has to follow in order to arrive to the target points. More concisely, the robot has to find a relatively good solution to two crucial problems: building a model of the environment, and estimating the position of the robot within this model. In this work, we propose a framework to solve these problems using only visual information. The mobile robot is equipped with a catadioptric vision sensor that provides omnidirectional images from the environment. First, the robot goes along the trajectories to include in the model and uses the visual information captured to build this model. After that, the robot is able to estimate its position and orientation with respect to the trajectory. Among the possible approaches to solve these problems, global appearance techniques are used in this work. They have emerged recently as a robust and efficient alternative compared to landmark extraction techniques. A global description method based on Radon Transform is used to design mapping and localization algorithms and a set of images captured by a mobile robot in a real environment, under realistic operation conditions, is used to test the performance of these algorithms. PMID:28464032

  20. Estimating the position and orientation of a mobile robot with respect to a trajectory using omnidirectional imaging and global appearance.

    Science.gov (United States)

    Payá, Luis; Reinoso, Oscar; Jiménez, Luis M; Juliá, Miguel

    2017-01-01

    Along the past years, mobile robots have proliferated both in domestic and in industrial environments to solve some tasks such as cleaning, assistance, or material transportation. One of their advantages is the ability to operate in wide areas without the necessity of introducing changes into the existing infrastructure. Thanks to the sensors they may be equipped with and their processing systems, mobile robots constitute a versatile alternative to solve a wide range of applications. When designing the control system of a mobile robot so that it carries out a task autonomously in an unknown environment, it is expected to take decisions about its localization in the environment and about the trajectory that it has to follow in order to arrive to the target points. More concisely, the robot has to find a relatively good solution to two crucial problems: building a model of the environment, and estimating the position of the robot within this model. In this work, we propose a framework to solve these problems using only visual information. The mobile robot is equipped with a catadioptric vision sensor that provides omnidirectional images from the environment. First, the robot goes along the trajectories to include in the model and uses the visual information captured to build this model. After that, the robot is able to estimate its position and orientation with respect to the trajectory. Among the possible approaches to solve these problems, global appearance techniques are used in this work. They have emerged recently as a robust and efficient alternative compared to landmark extraction techniques. A global description method based on Radon Transform is used to design mapping and localization algorithms and a set of images captured by a mobile robot in a real environment, under realistic operation conditions, is used to test the performance of these algorithms.

  1. Optical imaging of airglow structure in equatorial plasma bubbles at radio scintillation scales

    Science.gov (United States)

    Holmes, J. M.; Pedersen, T.; Parris, R. T.; Stephens, B.; Caton, R. G.; Dao, E. V.; Kratochvil, S.; Morton, Y.; Xu, D.; Jiao, Y.; Taylor, S.; Carrano, C. S.

    2015-12-01

    Imagery of optical emissions from F-region plasma is one of the few means available todetermine plasma density structure in two dimensions. However, the smallest spatial scalesobservable with this technique are typically limited not by magnification of the lens or resolutionof the detector but rather by the optical throughput of the system, which drives the integrationtime, which in turn causes smearing of the features that are typically moving at speeds of 100m/s or more. In this paper we present high spatio-temporal imagery of equatorial plasma bubbles(EPBs) from an imaging system called the Large Aperture Ionospheric Structure Imager(LAISI), which was specifically designed to capture short-integration, high-resolution images ofF-region recombination airglow at λ557.7 nm. The imager features 8-inch diameter entranceoptics comprised of a unique F/0.87 lens, combined with a monolithic 8-inch diameterinterference filter and a 2x2-inch CCD detector. The LAISI field of view is approximately 30degrees. Filtered all-sky images at common airglow wavelengths are combined with magneticfield-aligned LAISI images, GNSS scintillation, and VHF scintillation data obtained atAscension Island (7.98S, 14.41W geographic). A custom-built, multi-constellation GNSS datacollection system was employed that sampled GPS L1, L2C, L5, GLONASS L1 and L2, BeidouB1, and Galileo E1 and E5a signals. Sophisticated processing software was able to maintainlock of all signals during strong scintillation, providing unprecedented spatial observability ofL band scintillation. The smallest-resolvable scale sizes above the noise floor in the EPBs, as viewed byLAISI, are illustrated for integration times of 1, 5 and 10 seconds, with concurrentzonal irregularity drift speeds from both spaced-receiver VHF measurements and single-stationGNSS measurements of S4 and σφ. These observable optical scale sizes are placed in thecontext of those that give rise to radio scintillation in VHF and L band signals.

  2. The Concept of 'Radio Music'

    DEFF Research Database (Denmark)

    Fjeldsøe, Michael

    2016-01-01

    , educational and didactic effort which would enlighten all of society. For a while it seemed that radio music was considered a genre of its own. To fulfil its function, radio music had to consider technical limitations as well as the educational level and listening modes of the new mass audience. Public radio......, as discussed by Kurt Weill and Paul Hindemith, was at first greeted with great expectations, but soon a more realistic attitude prevailed. Weill, himself a radio critic as well, composed Der Lindberghflug (1929) as a piece of ‘radio music theatre’, but then changed some of its features in order to turn...... it into a didactical play for amateurs, a so-called Lehrstück. The article will present the concept of ‘radio music’ developed within German Neue Sachlichkeit and discuss the relevance of such a concept for current research in the field of radio and music....

  3. Low-cost detection of RC-IED activation signals in VHF band

    Science.gov (United States)

    Camargo Suarez, Victor Hugo; Marulanda B., Jose Ignacio

    2014-05-01

    The proliferation of Radio Controlled Improvised Explosive Devices (RC-IED) is a growing threat around the world. The ease of construction and low cost of these devices are transforming common things in lethal tramps. The fight against this threats normally involves the use of sophisticated and expensive equipment of Electronic Warfare based on high speed DSP systems, just to detect the presence of detonation signals. In this work is showed how to find activation signals based on the characteristic of the power in a specific band and the previous knowledge about the detonation signals. As proof of concept we have taken the information about the RC-IEDs used in the Colombian conflict and develop an algorithm to find detonation signals based on the measured power in frequencies between 136 MHz and 174 MHz (2 meter civil band)

  4. Tools of radio astronomy

    CERN Document Server

    Wilson, Thomas L; Hüttemeister, Susanne

    2009-01-01

    The recent years have seen breathtaking progress in technology, especially in the receiver and digital technologies relevant for radio astronomy, which has at the same time advanced to shorter wavelengths. This is the updated and completely revised 5th edition of the most used introductory text in radio astronomy. It presents a unified treatment of the entire field from centimeter to sub-millimeter wavelengths. Topics covered include instruments, sensitivity considerations, observational methods and interpretations of the data recorded with both single dishes and interferometers. This text is useful to both students and experienced practicing astronomers. Besides making major updates and additions throughout the book, the authors have re-organized a number of chapters to more clearly separate basic theory from rapidly evolving practical aspects. Further, problem sets have been added at the end of each chapter.

  5. Radio Frequency Spectrum Management

    Science.gov (United States)

    1980-03-01

    limits, emmission standards, etc., cover many pages. Other available non-technical policy statements are of the motherhood-and-apple-pie ilk. Further...and 2) by allowing the onscene commander who is acutely aware of the radio frequency emmission environment in his area to make assignments. The author...need for investment in specific human capi- tal vice on the job experience, it will never eliminate it. Rather vice education and training in

  6. Programme driven music radio

    OpenAIRE

    Hayes, Conor; Cunningham, Padraig; Clerkin, Patrick; Grimaldi, Marco

    2002-01-01

    This paper describes the operation of and research behind a networked application for the delivery of personalised streams of music at Trinity College Dublin. Smart Radio is a web based client-server application that uses streaming audio technology and recommendation techniques to allow users build, manage and share music programmes. While it is generally acknowledged that music distribution over the web will dramatically change how the music industry operates, there are ...

  7. Radio Telescope Reflectors

    Science.gov (United States)

    Baars, Jacob W. M.; Kärcher, Hans J.

    2017-11-01

    This book demonstrates how progress in radio astronomy is intimately linked to the development of reflector antennas of increasing size and precision. The authors describe the design and construction of major radio telescopes as those in Dwingeloo, Jodrell Bank, Parkes, Effelsberg and Green Bank since 1950 up to the present as well as millimeter wavelength telescopes as the 30m MRT of IRAM in Spain, the 50m LMT in Mexico and the ALMA submillimeter instrument. The advances in methods of structural design and coping with environmental influences (wind, temperature, gravity) as well as application of new materials are explained in a non-mathematical, descriptive and graphical way along with the story of the telescopes. Emphasis is placed on the interplay between astronomical and electromagnetic requirements and structural, mechanical and control solutions. A chapter on management aspects of large telescope projects closes the book. The authors address a readership with interest in the progress of engineering solutions applied to the development of radio telescope reflectors and ground station antennas for satellite communication and space research. The book will also be of interest to historians of science and engineering with an inclination to astronomy.

  8. Danmarks Radios stemmer

    DEFF Research Database (Denmark)

    Lawaetz, Anna

    kanalspeakerne kändisser, hvis fortalelser i æteren såvel som private gøren og laden blev fulgt nøje i dagspressen. Anna Lawaetz har med ph.d.-afhandlingen Danmarks Radios stemmer med udgangspunkt i kanalspeakerne på P1 i perioden 1925-2012 gennem empiriske studier kortlagt fortællingen om institutionens stemmer...... – nøje udvalgte ikke-fiktionsstemmer i Danmarks Radio igennem tiden. Samtidig har hun lavet en konkret analyse af stemmerne baseret på både akustiske målinger og kategorisering af oplevelsen af stemmerne. Fx taler kanalspeakerne på P1 i dag ikke hurtigere end tidligere, men pauserne er blevet kortere...... datamængder kræver udvikling af nye metoder. Den metodiske udvikling har her været baseret på optagelser af stemmer for at undersøge hvordan man videnskabeligt kan arbejde med optagelser af stemmer som mere end teksttransskriptioner inden for det kulturvidenskabelige felt med afsæt i Danmarks Radios...

  9. Compact Low Frequency Radio Antenna

    Science.gov (United States)

    Punnoose, Ratish J.

    2008-11-11

    An antenna is disclosed that comprises a pair of conductive, orthogonal arches and a pair of conductive annular sector plates, wherein adjacent legs of each arch are fastened to one of the annular sector plates and the opposite adjacent pair of legs is fastened to the remaining annular sector plate. The entire antenna structure is spaced apart from a conductive ground plane by a thin dielectric medium. The antenna is driven by a feed conduit passing through the conductive ground plane and dielectric medium and attached to one of the annular sector plates, wherein the two orthogonal arched act as a pair of crossed dipole elements. This arrangement of elements provides a radiation pattern that is largely omni-directional above the horizon.

  10. The Epi Info Viral Hemorrhagic Fever (VHF) Application: A Resource for Outbreak Data Management and Contact Tracing in the 2014-2016 West Africa Ebola Epidemic.

    Science.gov (United States)

    Schafer, Ilana J; Knudsen, Erik; McNamara, Lucy A; Agnihotri, Sachin; Rollin, Pierre E; Islam, Asad

    2016-10-15

    The Epi Info Viral Hemorrhagic Fever application (Epi Info VHF) was developed in response to challenges managing outbreak data during four 2012 filovirus outbreaks. Development goals included combining case and contact data in a relational database, facilitating data-driven contact tracing, and improving outbreak data consistency and use. The application was first deployed in Guinea, when the West Africa Ebola epidemic was detected, in March 2014, and has been used in 7 African countries and 2 US states. Epi Info VHF enabled reporting of compatible data from multiple countries, contributing to international Ebola knowledge. However, challenges were encountered in accommodating the epidemic's unexpectedly large magnitude, addressing country-specific needs within 1 software product, and using the application in settings with limited Internet access and information technology support. Use of Epi Info VHF in the West Africa Ebola epidemic highlighted the fundamental importance of good data management for effective outbreak response, regardless of the software used. Published by Oxford University Press for the Infectious Diseases Society of America 2016. This work is written by (a) US Government employee(s) and is in the public domain in the US.

  11. Survey of man-made electrical noise affecting radio broadcasting

    Science.gov (United States)

    Bisignani, W. T.; Garner, W. B.

    1969-01-01

    Survey, consisting of limited noise measurements, was made to augment and verify existing data at HF and VHF and to obtain basic data at UHF. Exact frequencies were determined by the absence of intentionally generated signals around three selected frequencies.

  12. Non-Daily Behavior Detection Monitoring System for Elderly People Based on Bayesian Network Representation of Omni-Directional Vision Sensor

    Science.gov (United States)

    Seki, Hirokazu; Tadakuma, Susumu

    This paper describes an unusual behavior detection system based on an omni-directional vision sensor as one of the important elements in realizing “Sensing and Robotic Support Room” for elderly people. Such support rooms are expected to be further developed in the future with the high performance to automatically recognize elderly people's actions and behavior patterns and detect the unusual patterns using some sensors and to support their daily motions using some robotic manipulator control systems. The proposed monitoring system using an omni-directional vision sensor automatically learns the daily behavior patterns and detects the unusual behavior patterns and actions using Bayesian Network approach. The Bayesian Network is constructed using image feature values such as the area and center of gravity values extracted from the captured image sequence and the respective behavior patterns are represented as the conditional probabilities. Unusual behavior patterns can be automatically detected based on the low generation probability values. Some experiments based on the investigation of elderly people's typical daily behavior patterns show the effectiveness of the proposed system.

  13. Statistical characteristics of low-latitude ionospheric field-aligned irregularities obtained with the Piura VHF radar

    Directory of Open Access Journals (Sweden)

    J. L. Chau

    2002-08-01

    Full Text Available We present a summary of the statistical characteristics of echoes from ionospheric (E- and F-region field-aligned irregularities obtained with the Piura VHF radar. This radar is located at ~ 7.0° dip latitude, just outside the equatorial electrojet (EEJ region. Our results are based on (1 intermittent observations made between 1991 and 1999 just few days a year, and (2 continuous observations made between January 2000 and June 2001. During most of the intermittent observations, simultaneous measurements of EEJ and equatorial spread F (ESF irregularities were performed with the Jicamarca VHF radar. From the continuous measurements, we have obtained the diurnal and seasonal characteristics of a variety of parameters (percentage of occurrence, signal-to-noise ratio and/or Doppler velocities from the lower and upper E-region irregularities and also from F-region irregularities over Piura. For example, we have found that (1 the E-region echoes are stronger and occur more frequently during local summer (i.e. between December and March; (2 between May and June, the E-region echoes are weaker and occur less frequently; moreover, during these months, a semidiurnal wave with large amplitudes is observed in the meridional wind (> 100 ms- 1; (3 there is vertical wavelength of about 20 km in the Doppler velocity, particularly after midnight; (4 the lower (upper E-region Doppler velocities are influenced mainly by meridional winds (equatorial F-region vertical drifts. In addition, we have observed that the seasonal and daily occurrences of Piura F-region irregularities are similar to the occurrence of topside ESF irregularities over Jicamarca. The likelihood of occurrence of F-region irregularities over Piura and, therefore, topside ESF over Jicamarca is greater when there are no E-region irregularities over Piura. On the other hand, there is more probability of observing bottomtype/bottomside ESF irregularities over Jicamarca when E-region irregularities

  14. PMSE observations with the EISCAT VHF- and UHF-radars: Ice particles and their effect on ambient electron densities

    Science.gov (United States)

    Li, Qiang; Rapp, Markus

    2013-11-01

    It is now well understood that the occurrence of PMSE is closely connected to the presence of ice particles. These ice particles modify the ambient electron density by electron attachment which occasionally leads to large electron density depletions which have also been called ‘biteouts’. There has been some debate in the literature regarding the relative depth of such depletions which is usually expressed by the parameter Λ=|ZA|NA/ne. Here, |ZA|NA is the charge number density of ice particles and ne is the electron density. In this paper, we present, for the first time, the statistical distribution of Λ using measurements with the EISCAT VHF- and UHF-radars. Based on 25 h of simultaneous observations, we derived a total of 757 Λ values based on 15 min of data each. In each of these cases, PMSE were observed with the EISCAT VHF-radar but not with the UHF-radar and the UHF-measurement were hence used to determine the electron density profile. From these 757 cases, there are 699 cases with Λ⪡1, and only 33 cases with Λ>0.5 (21 cases with Λ>1). A correlation analysis of Λ versus PMSE volume reflectivities further reveals that there is no strong dependence between the two parameters. This is in accordance with current PMSE-theory based on turbulence in combination with a large Schmidt-number. The maxima of Λ from each profile show a negative relationship with the undisturbed electron densities deduced at the same altitudes. This reveals that the variability of Λ mainly depends on the variability of the electron densities. In addition, variations of aerosol number densities may also play a role. Although part of the observations were conducted during the HF heating experiments, the so-called overshoot effects did not significantly bias our statistical results. In order to avoid missing biteouts because of a superposition of coherent and incoherent scatter in the UHF-data, we finally calculated spectral parameters n by applying a simple fit to auto

  15. VHF SoOp (Signal of Opportunity) Technology Demonstration for Soil Moisture Measurement Using Microwave Hydraulic Boom Truck Platform

    Science.gov (United States)

    Joseph, Alicia; Deshpande, Manohar; O'Neill, Peggy; Miles, Lynn

    2017-04-01

    A goal of this research is to test deployable VHF antennas for 6U Cubesat platforms to enable validation of root zone soil moisture (RZSM) estimation algorithms for signal of opportunity (SoOp) remote sensing over the 240-270 MHz frequency band. The proposed work provides a strong foundation for establishing a technology development path for maturing a global direct surface soil moisture (SM) and RZSM measurement system over a variety of land covers. Knowledge of RZSM up to a depth of 1 meter and surface SM up to a depth of 0.05 meter on a global scale, at a spatial resolution of 1-10 km through moderate-to-heavy vegetation, is critical to understanding global water resources and the vertical moisture gradient in the Earth's surface layer which controls moisture interactions between the soil, vegetation, and atmosphere. Current observations of surface SM from space by L-band radiometers (1.4 GHz) and radars (1.26 GHz) are limited to measurements of surface SM up to a depth of 0.05 meter through moderate amounts of vegetation. This limitation is mainly due to the inability of L-band signals to penetrate through dense vegetation and deep into the soil column. Satellite observations of the surface moisture conditions are coupled to sophisticated models which extrapolate the surface SM into the root zone, thus providing an indirect estimate rather than a direct measurement of RZSM. To overcome this limitation, low-frequency airborne radars operating at 435 MHz and 118 MHz have been investigated, since these lower frequencies should penetrate denser vegetation and respond to conditions deeper in the soil. This presentation describes a new and less expensive technique for SM as well as RZSM direct measurement using Signal of Opportunity transmitters. Being less expensive and needing only passive simple RF receiver, the SoOp concept has the potential for being used for space borne applications, thus providing global SM and RZSM measurements. This study will describe

  16. Flexible Adaptation in Cognitive Radios

    CERN Document Server

    Li, Shujun

    2013-01-01

    This book provides an introduction to software-defined radio and cognitive radio, along with methodologies for applying knowledge representation, semantic web, logic reasoning and artificial intelligence to cognitive radio, enabling autonomous adaptation and flexible signaling. Readers from the wireless communications and software-defined radio communities will use this book as a reference to extend software-defined radio to cognitive radio, using the semantic technology described. Readers with a background in semantic web and artificial intelligence will find in this book the application of semantic web and artificial intelligence technologies to wireless communications. For readers in networks and network management, this book presents a new approach to enable interoperability, collaborative optimization and flexible adaptation of network components. Provides a comprehensive ontology covering the core concepts of wireless communications using a formal language; Presents the technical realization of using a ...

  17. Software defined radio architectures evaluation

    OpenAIRE

    Palomo, Alvaro; Villing, Rudi; Farrell, Ronan

    2008-01-01

    This paper presents an performance evaluation of GNU Radio and OSSIE, two open source Software Defined Radio (SDR) architectures. The two architectures were compared by running implementations of a BPSK waveform utilising a software loopback channel on each. The upper bound full duplex throughput was found to be around 700kbps in both cases, though OSSIE was slightly faster than GNU Radio. CPU and memory loads did not differ significantly.

  18. Uzaybimer Radio Telescope Control System

    Science.gov (United States)

    Balbay, R.; Öz, G. K.; Arslan, Ö.; Özeren, F. F.; Küçük, İ.

    2016-12-01

    A 13 meters former NATO radar is being converted into a radio telescope. The radio telescope is controlled by a system which has been developed at UZAYBİMER. The Telescope Control System(TCS) has been designed using modern industrial systems. TCS has been developed in LabView platform in which works Windows embedded OS. The position feedback used on radio telescopes is an industrial EtherCAT standard. ASCOM library is used for astronomical calculations.

  19. Pluralismo, radio e Internet

    Directory of Open Access Journals (Sweden)

    Bruce Girard

    2015-01-01

    Full Text Available En muchas ocasiones de ha oído hablar que internet y las nuevas tecnologías de la comunicación llevarán a la humanidad a un mundo homogeneizado en donde todos compartirán la misa cultura del “ciberespacio” y hablarán el mismo lenguaje. Nuevas iniciativas en América Latina combinan la tecnología de punta y la radio para poner fin a este mito y contribuir a una comunicación más democrática.

  20. Internet Resources for Radio Astronomy

    Science.gov (United States)

    Andernach, H.

    A subjective overview of Internet resources for radio-astronomical information is presented. Basic observing techniques and their implications for the interpretation of publicly available radio data are described, followed by a discussion of existing radio surveys, their level of optical identification, and nomenclature of radio sources. Various collections of source catalogues and databases for integrated radio source parameters are reviewed and compared, as well as the web interfaces to interrogate the current and ongoing large-area surveys. Links to radio observatories with archives of raw (uv-) data are presented, as well as services providing images, both of individual objects or extracts (``cutouts'') from large-scale surveys. While the emphasis is on radio continuum data, a brief list of sites providing spectral line data, and atomic or molecular information is included. The major radio telescopes and surveys under construction or planning are outlined. A summary is given of a search for previously unknown optically bright radio sources, as performed by the students as an exercise, using Internet resources only. Over 200 different links are mentioned and were verified, but despite the attempt to make this report up-to-date, it can only provide a snapshot of the situation as of mid-1998.

  1. Radio Frequency Anechoic Chamber Facility

    Data.gov (United States)

    Federal Laboratory Consortium — FUNCTION: Supports the design, manufacture, and test of antenna systems. The facility is also used as an electromagnetic compatibility/radio frequency interference...

  2. Radio-induced brain lesions

    Directory of Open Access Journals (Sweden)

    Gorgan Mircea Radu

    2014-03-01

    Full Text Available Introduction : Radiotherapy, an important tool in multimodal oncologic treatment, can cause radio-induced brain lesion development after a long period of time following irradiation.

  3. Radio Jove: Citizen Science for Jupiter Radio Astronomy

    Science.gov (United States)

    Higgins, C. A.; Thieman, J.; Reyes, F. J.; Typinski, D.; Flagg, R. F.; Greenman, W.; Brown, J.; Ashcraft, T.; Sky, J.; Cecconi, B.; Garcia, L. N.

    2016-12-01

    The Radio Jove Project (http://radiojove.gsfc.nasa.gov) has been operating as an educational activity for 18 years to introduce radio astronomy activities to students, teachers, and the general public. Participants may build a simple radio telescope kit, make scientific observations, and interact with radio observatories in real-time over the Internet. Recently some of our dedicated citizen science observers have upgraded their systems to better study radio emission from Jupiter and the Sun by adding dual-polarization spectrographs and wide-band antennas in the frequency range of 15-30 MHz. Some of these observations are being used in conjunction with professional telescopes such as the Long Wavelength Array (LWA), the Nancay Decametric Array, and the Ukrainian URAN2 Radio Telescope. In particular, there is an effort to support the Juno Mission radio waves instrument at Jupiter by using citizen science ground-based data for comparison and polarization verification. These data will be archived through a Virtual European Solar and Planetary Access (VESPA) archive (https://voparis-radiojove.obspm.fr/radiojove/welcome) for use by the amateur and professional radio science community. We overview the program and display recent observations that will be of interest to the science community.

  4. The coexistence of cognitive radio and radio astronomy

    NARCIS (Netherlands)

    Bentum, Marinus Jan; Boonstra, A.J.; Baan, W.A.

    2009-01-01

    An increase of the efficiency of spectrum usage requires the development of new communication techniques. Cognitive radio may be one of those new technique, which uses unoccupied frequency bands for communications. This will lead to more power in the bands and therefore an increasing level of Radio

  5. Evaluation of GNU Radio Platform Enhanced for Hardware Accelerated Radio Design

    OpenAIRE

    Karve, Mrudula Prabhakar

    2010-01-01

    The advent of software radio technology has enabled radio developers to design and imple- ment radios with great ease and flexibility. Software radios are effective in experimentation and development of radio designs. However, they have limitations when it comes to high- speed, high-throughput designs. This limitation can be overcome by introducing a hardware element to the software radio platform. Enhancing GNU Radio for Hardware Accelerated Radio Design project implements suc...

  6. Discourse segmentation and the management of multiple tasks in single episodes of air traffic controller-pilot spoken radio communication

    Directory of Open Access Journals (Sweden)

    Paul A. Falzon

    2009-06-01

    Full Text Available Episodes of VHF radio-mediated pilot-controller spoken communication in which multiple tasks are conducted are engendered in and through the skilful deployment and combination, by the parties to the talk, of multiple orders of discourse segmentation. These orders of segmentation are manifest at the levels of transmission design and sequential organisation. Both of these features are analysed from a Conversation Analytic standpoint in order to track their segment by segment genesis, development and completion. From the analysis it emerges that in addition to the serial type of sequential organisations described by Schegloff (1986, there exists an alternative form of organisation that enables tasks to be managed in a quasi-parallel manner, and which affords controllers and pilots a number of practical advantages in the conduct of their radio-mediated service encounters.Cet article présente des extraits d’échanges oraux entre pilots et contrôleurs du ciel via la radio VHF. On peut y voir comment le déploiement et la combinaison habile de plusieurs ordres de segmentation discursive, engageant les deux coénonciateurs de la conversation, leur permet d’accomplir des tâches multiples. Ces ordres de segmentation se manifestent aux niveaux du plan de la transmission et de l’organisation séquentielle. Ces deux niveaux sont envisagées du point de vue de l’analyse conversationnelle dans le but d’examiner, segment après segment, comment ils se mettent en place, se développent puis prennent fin. Notre étude montre que, outre le type sériel d’organisations séquentielles décrit par Schegloff (1986, il existe une forme alternative d’organisation qui permet de gérer les tâches de manière quasi parallèle, et qui fournit aux contrôleurs aériens ainsi qu’aux pilotes de nombreux avantages pratiques dans la conduite de leurs radio.

  7. Dramatugi Penyiar Radio

    Directory of Open Access Journals (Sweden)

    Hastika Yanti Nora

    2009-07-01

    Full Text Available Dramaturgy is the work of Erving Goffman. He wrote "Presentation of Self in Everyday Life" in '1959. Following the theatrical analogy, Goffman spoke of a front stage and back stage. The front stage is that part of the performance that generally functions in rather fixed and general ways to define the situation for those who observed the performance. The back stage is situation where facts suppressed in the front or various kinds of informal actions may appear. A back stage is usually adjacent to the front stage, but it also cut off from it. Everyone in this world have to run his role in their everyday life. It also a radio announcer. As an actor, they have to be a nice and friendy person when they perform to make air personality, that is  a good  impression, from their audience. But before their perform in the front stage, there so much to do to prepare in the backstage. The front and back stage is radio announcer dramaturgy.

  8. Comparison of wind measurements in the troposphere and mesosphere by VHF/MF radars and in-situ techniques

    Directory of Open Access Journals (Sweden)

    N. Engler

    2008-11-01

    Full Text Available Radar wind observations at frequencies between 1.98 and 53.5 MHz obtained at polar latitudes were compared to in-situ wind measurements by radiosondes at tropospheric altitudes and to winds from falling spheres at mesospheric altitudes. Comparisons are shown for several campaigns of radiosonde and falling sphere observations. The radar wind directions agree well to the radiosonde and falling sphere observations and are highly correlated. The winds estimated from radar measurements are less than the radiosonde data by about 15% for spaced antenna observations and by about 10% for the Doppler beam swinging experiment. At mesospheric altitudes the spaced antenna winds obtained from the wide-beam Andenes MF radar are underestimated in the order of 35% and winds from the narrow-beam Saura MF radar are underestimated by about 20% compared to falling sphere winds at altitudes between 70 and 80 km. Furthermore, the relation between wind measurements using narrow-beam and wide-beam antenna arrangements for the MF radars is discussed and VHF radar observations are compared to the wide-beam MF radar.

  9. Comparison of wind measurements in the troposphere and mesosphere by VHF/MF radars and in-situ techniques

    Science.gov (United States)

    Engler, N.; Singer, W.; Latteck, R.; Strelnikov, B.

    2008-11-01

    Radar wind observations at frequencies between 1.98 and 53.5 MHz obtained at polar latitudes were compared to in-situ wind measurements by radiosondes at tropospheric altitudes and to winds from falling spheres at mesospheric altitudes. Comparisons are shown for several campaigns of radiosonde and falling sphere observations. The radar wind directions agree well to the radiosonde and falling sphere observations and are highly correlated. The winds estimated from radar measurements are less than the radiosonde data by about 15% for spaced antenna observations and by about 10% for the Doppler beam swinging experiment. At mesospheric altitudes the spaced antenna winds obtained from the wide-beam Andenes MF radar are underestimated in the order of 35% and winds from the narrow-beam Saura MF radar are underestimated by about 20% compared to falling sphere winds at altitudes between 70 and 80 km. Furthermore, the relation between wind measurements using narrow-beam and wide-beam antenna arrangements for the MF radars is discussed and VHF radar observations are compared to the wide-beam MF radar.

  10. Observation of polar mesosphere summer echoes with calibrated VHF radars at 69° in the Northern and Southern hemispheres

    Science.gov (United States)

    Latteck, R.; Singer, W.; Morris, R. J.; Holdsworth, D. A.; Murphy, D. J.

    2007-07-01

    Polar Mesosphere Summer Echoes (PMSE) observed in the northern and southern hemisphere were studied using continuous measurements obtained by calibrated VHF radars located at Andenes (69.3°N) and Davis (68.6°S) during the boreal summer 2004 and the austral summer 2004/2005. The PMSE observed at Davis have a lower peak volume reflectivity of approximately 4 . 10-11 m-1 compared with their counterparts (7 . 10-10 m-1) observed at Andenes. The duration of the PMSE season is correlated with the dynamical and thermal state of the mesopause region supported by recent studies using meridional winds and temperatures. PMSE occurred less frequently but with greater variability above Davis. The diurnal variation of PMSE occurrence has a maximum around 11-16 LT in both hemispheres, and a minimum occurs during late evening with a longer duration in the southern hemisphere. The mean PMSE season at both sites started around 34 days before solstice, but the duration of the Davis PMSE season is about 9 days shorter than at Andenes. The maximum occurrence height of PMSE at Davis is 86 km which is about 1 km higher than at Andenes.

  11. Comparison of wind measurements in the troposphere and mesosphere by VHF/MF radars and in-situ techniques

    Energy Technology Data Exchange (ETDEWEB)

    Engler, N.; Singer, W.; Latteck, R.; Strelnikov, B. [Rostock Univ., Kuehlungsborn (Germany). Leibniz Inst. of Atmospheric Physics

    2008-07-01

    Radar wind observations at frequencies between 1.98 and 53.5 MHz obtained at polar latitudes were compared to in-situ wind measurements by radiosondes at tropospheric altitudes and to winds from falling spheres at mesospheric altitudes. Comparisons are shown for several campaigns of radiosonde and falling sphere observations. The radar wind directions agree well to the radiosonde and falling sphere observations and are highly correlated. The winds estimated from radar measurements are less than the radiosonde data by about 15% for spaced antenna observations and by about 10% for the Doppler beam swinging experiment. At mesospheric altitudes the spaced antenna winds obtained from the wide-beam Andenes MF radar are underestimated in the order of 35% and winds from the narrow-beam Saura MF radar are underestimated by about 20% compared to falling sphere winds at altitudes between 70 and 80 km. Furthermore, the relation between wind measurements using narrow-beam and wide-beam antenna arrangements for the MF radars is discussed and VHF radar observations are compared to the wide-beam MF radar. (orig.)

  12. Calculating the azimuth of mountain waves, using the effect of tilted fine-scale stable layers on VHF radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    1999-02-01

    Full Text Available A simple method is described, based on standard VHF wind-profiler data, where imbalances of echo power between four off-vertical radar beams, caused by mountain waves, can be used to calculate the orientation of the wave pattern. It is shown that the mountain wave azimuth (direction of the horizontal component of the wavevector, is given by the vector [ W (PE - P W ,W (PN - P S ]; PN, PS, PE, PW are radar echo powers, measured in dB, in beams pointed away from vertical by the same angle towards north, south, east and west respectively, and W is the vertical wind velocity. The method is applied to Aberystwyth MST radar data, and the calculated wave vector usually, but not always, points into the low-level wind direction. The mean vertical wind at Aberystwyth, which may also be affected by tilted aspect-sensitive layers, is investigated briefly using the entire radar output 1990-1997. The mean vertical-wind profile is inconsistent with existing theories, but a new mountain-wave interpretation is proposed.Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; waves and tides; instruments and techniques.

  13. Effect of power on growth of nanocrystalline silicon films deposited by VHF PECVD technique for solar cell applications

    Science.gov (United States)

    Juneja, Sucheta; Verma, Payal; Savelyev, Dmitry A.; Khonina, Svetlana N.; Sudhakar, S.; Kumar, Sushil

    2016-04-01

    An investigation of the effect of power on the deposition of nanocrystalline silicon thin films were carried out using a gaseous mixture of silane and hydrogen in the 60MHz assisted VHF plasma enhanced chemical vapor deposition (PECVD) technique. The power was varied from 10 to 50 watt maintaining all other parameters constant. Corresponding layer properties w.r.t. material microstructure, optical, hydrogen content and electrical transport are studied in detail. The structural properties have been studied by Raman spectroscopy and x-ray diffraction (XRD). The presence of nano-sized crystals and their morphology have been investigated using atomic force microscopy (AFM). The role of bonded hydrogen content in the films have been studied from the results of Fourier transform infrared spectroscopy. It was observed from the results that with increase in power, crystalline volume fraction increases and crystallite size changes from 4 to 9 nm. The optical band gap varies from 1.7 to 2.1eV due to quantum confinement effect and which further can be explained with reduced hydrogen content. These striking features of nc-Si films can be used to fabricate stable thin film solar cells.

  14. Case study of stratospheric gravity waves of convective origin over Arctic Scandinavia. VHF radar observations and numerical modelling

    Energy Technology Data Exchange (ETDEWEB)

    Rechou, A. [La Reunion Univ., St. Denis Messag, Ile de La Reunion (France). Lab. de l' Atmosphere et des Cyclones; Arnault, J.; Dalin, P.; Kirkwood, S. [Swedish Institute of Space Physics, Kiruna (Sweden)

    2013-03-01

    Orography is a well-known source of gravity and inertia-gravity waves in the atmosphere. Other sources, such as convection, are also known to be potentially important but the large amplitude of orographic waves over Scandinavia has generally precluded the possibility to study such other sources experimentally in this region. In order to better understand the origin of stratospheric gravity waves observed by the VHF radar ESRAD (Esrange MST radar) over Kiruna, in Arctic Sweden (67.88 N, 21.10 E), observations have been compared to simulations made using the Weather Research and Forecasting model (WRF) with and without the effects of orography and clouds. This case study concerns gravity waves observed from 00:00 UTC on 18 February to 12:00 UTC on 20 February 2007. We focus on the wave signatures in the static stability field and vertical wind deduced from the simulations and from the observations as these are the parameters which are provided by the observations with the best height coverage. As is common at this site, orographic gravity waves were produced over the Scandinavian mountains and observed by the radar. However, at the same time, southward propagation of fronts in the Barents Sea created short-period waves which propagated into the stratosphere and were transported, embedded in the cyclonic winds, over the radar site. (orig.)

  15. Development of a Coherent Bistatic Vegetation Model for Signal of Opportunity Applications at VHF UHF-Bands

    Science.gov (United States)

    Kurum, Mehmet; Deshpande, Manohar; Joseph, Alicia T.; O'Neill, Peggy E.; Lang, Roger H.; Eroglu, Orhan

    2017-01-01

    A coherent bistatic vegetation scattering model, based on a Monte Carlo simulation, is being developed to simulate polarimetric bi-static reflectometry at VHF/UHF-bands (240-270 MHz). The model is aimed to assess the value of geostationary satellite signals of opportunity to enable estimation of the Earth's biomass and root-zone soil moisture. An expression for bistatic scattering from a vegetation canopy is derived for the practical case of a ground-based/low altitude platforms with passive receivers overlooking vegetation. Using analytical wave theory in conjunction with distorted Born approximation (DBA), the transmit and receive antennas effects (i.e., polarization, orientation, height, etc.) are explicitly accounted for. Both the coherency nature of the model (joint phase and amplitude information) and the explicit account of system parameters (antenna, altitude, polarization, etc) enable one to perform various beamforming techniques to evaluate realistic deployment configurations. In this paper, several test scenarios will be presented and the results will be evaluated for feasibility for future biomass and root-zone soil moisture application using geostationary communication satellite signals of opportunity at low frequencies.

  16. RADIO NOISE ADVANCES SEXUAL MATURITY

    African Journals Online (AJOL)

    ansistf-lewis

    partially illuminated by the normally non-stimulatory 7-h photoperiod, is another possible reason for the earlier sexual development. Plasma melatonin concentrations midway through the 7-h dark period in which the radio was played were similar to those of non-radio controls, indicating that this period was not regarded.

  17. Tuning in to pavement radio

    NARCIS (Netherlands)

    Ellis, S.D.K.

    1989-01-01

    This article describes a phenomenon known all over Africa, for which there is no really satisfactory term in English but which is summed up in the French term 'radio trottoir', literally 'pavement radio'. It may be defined as the popular and unofficial discussion of current affairs in Africa,

  18. Dust tori in radio galaxies

    NARCIS (Netherlands)

    van der Wolk, G.; Barthel, P. D.; Peletier, R. F.; Pel, J. W.

    Aims. We investigate the quasar - radio galaxy unification scenario and detect dust tori within radio galaxies of various types. Methods. Using VISIR on the VLT, we acquired sub-arcsecond (similar to 0.40 '') resolution N-band images, at a wavelength of 11.85 mu m, of the nuclei of a sample of 27

  19. Radio design in nanometer technologies

    CERN Document Server

    Ismail, Mohammed

    2006-01-01

    This is the first volume that looks at the integrated radio design problem as a "piece of a big puzzle" Most books discuss more on communications or more on hardware but not both, this book strikes the right balance between the two and provides the reader with a holistic view of the subject of radio design: current and future trends.

  20. Cognitive Radio for Emergency Networks

    NARCIS (Netherlands)

    Zhang, Q.; Kokkeler, Andre B.J.; Smit, Gerardus Johannes Maria

    2006-01-01

    In the scope of the Adaptive Ad-hoc Freeband (AAF) project, an emergency network built on top of Cognitive Radio is proposed to alleviate the spectrum shortage problem which is the major limitation for emergency networks. Cognitive Radio has been proposed as a promising technology to solve

  1. Radio outburst of BL Lacertae

    Science.gov (United States)

    Buemi, C. S.; Leto, P.; Trigilio, C.; Umana, G.; Giroletti, M.; Orienti, M.; Raiteri, C. M.; Villata, M.; Bach, U.

    2013-04-01

    We report on extremely high radio flux of BL Lacertae at 43 and 8 GHz. Observations at 43 GHz with the 32 m radio telescope in Noto (Italy) revealed a flux density of 10.5 +/- 0.2 Jy on 2013 April 10.65, while observations at 8 GHz with the 32 m radio telescope in Medicina (Italy) detected a flux density of 8.2 +/- 0.7 Jy on April 12.22. These extremely high radio fluxes show that the radio activity likely correlated to the strong optical, near-infrared, and gamma-ray activity of 2011-2012 (see ATels #4028, #4031, #4155, #4271, #4277, #4349, #4565, #4600), and X-ray activity of late 2012 (ATels #4557, #4627), is far to be exhausted.

  2. OMNIDIRECTIONAL SOUND SOURCE

    DEFF Research Database (Denmark)

    1996-01-01

    A sound source comprising a loudspeaker (6) and a hollow coupler (4) with an open inlet which communicates with and is closed by the loudspeaker (6) and an open outlet, said coupler (4) comprising rigid walls which cannot respond to the sound pressures produced by the loudspeaker (6). According...

  3. Radio propagation measurement and channel modelling

    CERN Document Server

    Salous, Sana

    2013-01-01

    While there are numerous books describing modern wireless communication systems that contain overviews of radio propagation and radio channel modelling, there are none that contain detailed information on the design, implementation and calibration of radio channel measurement equipment, the planning of experiments and the in depth analysis of measured data. The book would begin with an explanation of the fundamentals of radio wave propagation and progress through a series of topics, including the measurement of radio channel characteristics, radio channel sounders, measurement strategies

  4. The Radio Language Arts Project: adapting the radio mathematics model.

    Science.gov (United States)

    Christensen, P R

    1985-01-01

    Kenya's Radio Language Arts Project, directed by the Academy for Educational Development in cooperation with the Kenya Institute of Education in 1980-85, sought to teach English to rural school children in grades 1-3 through use of an intensive, radio-based instructional system. Daily 1/2 hour lessons are broadcast throughout the school year and supported by teachers and print materials. The project further was aimed at testing the feasibility of adaptation of the successful Nicaraguan Radio Math Project to a new subject area. Difficulties were encountered in articulating a language curriculum with the precision required for a media-based instructional system. Also a challenge was defining the acceptable regional standard for pronunciation and grammar; British English was finally selected. An important modification of the Radio Math model concerned the role of the teacher. While Radio Math sought to reduce the teacher's responsibilities during the broadcast, Radio Language Arts teachers played an important instructional role during the English lesson broadcasts by providing translation and checks on work. Evaluations of the Radio language Arts Project suggest significant gains in speaking, listening, and reading skills as well as high levels of satisfaction on the part of parents and teachers.

  5. Implementing Software Defined Radio

    CERN Document Server

    Grayver, Eugene

    2013-01-01

    Software Defined Radio makes wireless communications easier, more efficient, and more reliable. This book bridges the gap between academic research and practical implementation. When beginning a project, practicing engineers, technical managers, and graduate students can save countless hours by considering the concepts presented in these pages. The author covers the myriad options and trade-offs available when selecting an appropriate hardware architecture. As demonstrated here, the choice between hardware- and software-centric architecture can mean the difference between meeting an aggressive schedule and bogging down in endless design iterations. Because of the author’s experience overseeing dozens of failed and successful developments, he is able to present many real-life examples. Some of the key concepts covered are: Choosing the right architecture for the market – laboratory, military, or commercial Hardware platforms – FPGAs, GPPs, specialized and hybrid devices Standardization efforts to ens...

  6. AGONIZAN RADIOS MINERAS

    Directory of Open Access Journals (Sweden)

    Raquel Salinas

    2015-01-01

    Full Text Available Se ofrece un amplio análisis sobre la industria electoral, recordando que un candidato a presidente es "un producto para la venta". Se Desmenuzan las estrategias utilizadas en el plebiscito chileno,las elecciones norteamericanas con el NO a BUSH. El Mercadeo Social es una nueva metodología utilizada en proyectos de desarrollo a nivel de campo por ello se hace un esclarecimiento y clarifica el vínculo con la comunicación. Se agrega temas como: Los modelos de recepción de mensajes cuyos marcos conceptuales y metodologías aún no se han adaptado al potencial de esta línea de trabajo.Se analiza la agonía de las radios mineras en Bolivia en la que 42 años de historia y heroísmo se desmoronan.

  7. Japanese radio telescopes

    Science.gov (United States)

    Kawaguchi, Noriyuki

    Japanese principal radio telescopes available for Very Long Baseline Interferometry (VLBI) observations are overviewed, and their characteristics and performances are summarized. Three fixed stations, Usuda, Nobeyama, and Kashima, and one 5-m mobile station use a hydrogen master-frequency standard, while other stations use an ultrastable X'tal oscillator locked to a cesium frequency standard. The 64-m telescope in Usuda developed for tracking satellites of deep-space missions is outlined, as well as the Kashima 34-m telescope covering a frequency range from 300 MHz to 49 GHz with 11 receivers. Attention is given to the Nobeyama 45-m telescope as a major telescope in Japan working in an international mm-VLBI network.

  8. Global Ionosphere Radio Observatory

    Science.gov (United States)

    Galkin, I. A.; Reinisch, B. W.; Huang, X. A.

    2014-12-01

    The Global Ionosphere Radio Observatory (GIRO) comprises a network of ground-based high-frequency vertical sounding sensors, ionosondes, with instrument installations in 27 countries and a central Lowell GIRO Data Center (LGDC) for data acquisition and assimilation, including 46 real-time data streams as of August 2014. The LGDC implemented a suite of technologies for post-processing, modeling, analysis, and dissemination of the acquired and derived data products, including: (1) IRI-based Real-time Assimilative Model, "IRTAM", that builds and publishes every 15-minutes an updated "global weather" map of the peak density and height in the ionosphere, as well as a map of deviations from the classic IRI climate; (2) Global Assimilative Model of Bottomside Ionosphere Timelines (GAMBIT) Database and Explorer holding 15 years worth of IRTAM computed maps at 15 minute cadence;. (3) 17+ million ionograms and matching ionogram-derived records of URSI-standard ionospheric characteristics and vertical profiles of electron density; (4) 10+ million records of the Doppler Skymaps showing spatial distributions over the GIRO locations and plasma drifts; (5) Data and software for Traveling Ionospheric Disturbance (TID) diagnostics; and (6) HR2006 ray tracing software mated to the "realistic" IRTAM ionosphere. In cooperation with the URSI Ionosonde Network Advisory Group (INAG), the LGDC promotes cooperative agreements with the ionosonde observatories of the world to accept and process real-time data of HF radio monitoring of the ionosphere, and to promote a variety of investigations that benefit from the global-scale, prompt, detailed, and accurate descriptions of the ionospheric variability.

  9. Teleoperation of a mobile vehicle via a 23-GHz microwave radio link in nuclear plant environments: a feasibility study

    Science.gov (United States)

    Kerr, David; West, T. C.; Bouazza-Marouf, K.; Hewit, Jim

    1994-11-01

    Free space communication links for remote tele-operation of robots have important applications in hazardous environments. They have a distinct advantage over conventional umbilical control in that they allow potentially greater freedom when manoeuvering around obstacles, and obviate any unnecessary cable payload. Omnidirectional, short-wave radio links are widely used for such purposes. Very little consideration has yet been given to the use of microwave frequencies (10 GHz and above), whose fixed line-of-sight operating mode and high bandwidth have made them ideal for external local area networks. In this paper, we examine the broadcast characteristics of a commercial 23 GHz microwave link using a 25 cm diameter horn. Investigations were carried out in a representative environment over a wide range of distances, alignment criteria, and pathways. We describe the investigations in received signal quality for the communication of analogue video and digital data. Received signal tests using image processing equipment show the signal to noise ratio obtained under test conditions, compared to that required for adequate quality. We conclude by assessing the relative merits and disadvantages of using a microwave link for telemetry applications, compared with conventional radio and laser free space systems.

  10. Fabricating omnidirectional low-reflection films by nano-imprinting method for boosting solar power generation of silicon-based solar cells

    Science.gov (United States)

    Gao, Mengyu; Zhan, Xinghua; Chen, Fei; Si, Yang; Tie, Shengnian; Gao, Wei

    2017-07-01

    Low-reflection polyethylene terephthalate (PET) films are fabricated with nano-imprinting method. The films are then used to cover polycrystalline silicon solar cells. The morphological and optical properties of films are investigated. The films have periodic cylinder-like nanostructures and relatively low reflectivity in light incident angle ranging from 30∘ to 60∘. The nanostructures are with a period of 600 nm and height of 90 nm. Besides, the polycrystalline Si solar cells covered with the films exhibit 12% more power generation than the cells covered with glass. Nano-imprinting method offers a cost-effective approach to fabricate omnidirectional anti-reflection films, which could boost the power generation of Si solar cells. Additionally, the films also have potential applications in different types of solar cells due to its facile fabricating process.

  11. VHF radar observation of atmospheric winds, associated shears and C2n at a tropical location: interdependence and seasonal pattern

    Directory of Open Access Journals (Sweden)

    A. R. Jain

    Full Text Available The turbulence refractivity structure constant (C2n is an important parameter of the atmosphere. VHF radars have been used extensively for the measurements of C2n. Presently, most of such observations are from mid and high latitudes and only very limited observations are available for equatorial and tropical latitudes. Indian MST radar is an excellent tool for making high-resolution measurements of atmospheric winds, associated shears and turbulence refractivity structure constant (C2n. This radar is located at Gadanki (13.45° N, 79.18° E, a tropical station in India. The objective of this paper is to bring out the height structure of C2n for different seasons using the long series of data (September 1995 – August 1999 from Indian MST radar. An attempt is also made to understand such changes in the height structure of C2n in relation to background atmospheric parameters such as horizontal winds and associated shears. The height structure of C2n, during the summer monsoon and post-monsoon season, shows specific height features that are found to be related to Tropical Easterly Jet (TEJ winds. It is important to examine the nature of the radar back-scatterers and also to understand the causative mechanism of such scatterers. Aspect sensitivity of the received radar echo is examined for this purpose. It is observed that radar back-scatterers at the upper tropospheric and lower stratospheric heights are more anisotropic, with horizontal correlation length of 10–20 m, as compared to those observed at lower and middle tropospheric heights.Key words. Meteorology and atmospheric dynamics (climatology; tropical meteorology; turbulence

  12. VHF SoOp (Signal of Opportunity) Technology Demonstration for Soil Moisture Measurement Using Microwave Hydraulic Boom Truck Platform

    Science.gov (United States)

    Joseph, A. T.; Deshpande, M.; O'Neill, P. E.; Miles, L.

    2017-01-01

    A goal of this research is to test deployable VHF antennas for 6U Cubesat platforms to enable validation of root zone soil moisture (RZSM) estimation algorithms for signal of opportunity (SoOp) remote sensing over the 240-270 MHz frequency band. The proposed work provides a strong foundation for establishing a technology development path for maturing a global direct surface soil moisture (SM) and RZSM measurement system over a variety of land covers. Knowledge of RZSM up to a depth of 1 meter and surface SM up to a depth of 0.05 meter on a global scale, at a spatial resolution of 1-10 km through moderate-to-heavy vegetation, is critical to understanding global water resources and the vertical moisture gradient in the Earths surface layer which controls moisture interactions between the soil, vegetation, and atmosphere. Current observations of surface SM from space by L-band radiometers (1.4 GHz) and radars (1.26 GHz) are limited to measurements of surface SM up to a depth of 0.05 meter through moderate amounts of vegetation. This limitation is mainly due to the inability of L-band signals to penetrate through dense vegetation and deep into the soil column. Satellite observations of the surface moisture conditions are coupled to sophisticated models which extrapolate the surface SM into the root zone, thus providing an indirect estimate rather than a direct measurement of RZSM. To overcome this limitation, low-frequency airborne radars operating at 435 MHz and 118 MHz have been investigated, since these lower frequencies should penetrate denser vegetation and respond to conditions deeper in the soil.

  13. Spatial variability of the aspect sensitivity of VHF radar echoes in the troposphere and lower stratosphere during jet stream passages

    Directory of Open Access Journals (Sweden)

    J. G. Yoe

    Full Text Available The aspect sensitivity of SOUSY-VHF-radar oblique-beam echoes from the troposphere and lower stratosphere has been examined for a number of jet stream passages during the years 1990 - 1992. When the core of the jet is overhead or nearly so, vertical profiles of the aspect sensitivity display two notable features. First, the distinction between mainly isotropic and strongly aspect-sensitive echoes in the troposphere and the lower stratosphere, respectively, often reported for measurements made during calm conditions, does not necessarily prevail in the vicinity of the jet stream. Second, echoes obtained at altitudes near the height of the horizontal wind maximum are found to be more aspect sensitive for beams directed parallel to the horizontal flow or nearly so, than for other beam directions. It is demonstrated that time-averaged horizontal wind speeds estimated from the radar data, taking into account the reduced effective oblique-beam zenith angle resulting from aspect sensitivity, may exceed uncorrected wind speeds by as much as 10 m s-1 in these circumstances. Implications for wind profiling and for describing the backscattering process are discussed. Doppler spectral widths examined for one jet stream passage are found to be narrower in a beam aligned with the horizontal wind at heights near the wind speed maximum than corresponding widths measured in a beam projected at right angles to the jet. The narrowest spectra thus coincide with the most aspect-sensitive echoes, consistent with the hypothesis that such returns result from specular backscattering processes.

  14. Calculating the azimuth of mountain waves, using the effect of tilted fine-scale stable layers on VHF radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    Full Text Available A simple method is described, based on standard VHF wind-profiler data, where imbalances of echo power between four off-vertical radar beams, caused by mountain waves, can be used to calculate the orientation of the wave pattern. It is shown that the mountain wave azimuth (direction of the horizontal component of the wavevector, is given by the vector [ W (PE - P W ,W (PN - P S ]; PN, PS, PE, PW are radar echo powers, measured in dB, in beams pointed away from vertical by the same angle towards north, south, east and west respectively, and W is the vertical wind velocity. The method is applied to Aberystwyth MST radar data, and the calculated wave vector usually, but not always, points into the low-level wind direction. The mean vertical wind at Aberystwyth, which may also be affected by tilted aspect-sensitive layers, is investigated briefly using the entire radar output 1990-1997. The mean vertical-wind profile is inconsistent with existing theories, but a new mountain-wave interpretation is proposed.

    Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; waves and tides; instruments and techniques.

  15. RadioBOT: A spatial cognitive radio testbed

    Science.gov (United States)

    Beck, Brian M.; Kim, Joseph H.; Baxley, Robert J.; Walkenhorst, Brett T.

    This paper introduces RadioBOT, a flexible system of mobile robots for acquisition of radio frequency data. The motivation for such a test system is described, namely the difficulty in acquiring real world data for the purpose of spatial cognitive radio (CR) research. Some current areas of CR research are presented for which RadioBOT can gather data. We then describe the hardware and software components of our system. As a demonstration of the system's capability, we present here the results of a spectrum mapping experiment. In this experiment, we uniformly sample average signal power in a laboratory hallway where an emitter is present. From this data, we form an interpolated spectrum map of the signal power as a function of space. Knowledge of the area's spectrum map is then used to optimize the relay channel communication rate between a transmitter and receiver, by optimally positioning the relay node.

  16. Foundations for radio frequency engineering

    CERN Document Server

    Geyi, Wen

    2015-01-01

    The book provides a comprehensive coverage of the fundamental topics in microwave engineering, antennas and wave propagation, and electromagnetic compatibility, including electromagnetic boundary value problems, waveguide theory, microwave resonators, antennas and wave propagation, microwave circuits, principles of electromagnetic compatibility designs, information theory and systems. Deals systematically with fundamental problems in radio frequency engineering, this important volume provides an updated treatment of radio frequency theory and techniques. The book can be used as a one-semester course for senior and first-year graduate students or as a reference for radio frequency engineers and applied physicists.

  17. La radio en el ciberespacio

    Directory of Open Access Journals (Sweden)

    Ricardo Horvath

    2015-01-01

    Full Text Available Mientras la radio comunitaria se esfuerza por sobrevivir ante la carencia de leyes de radiodifusión que la protejan, sin fondos económicos ni posibilidades ciertas de expansión, la sofisticada radio digital por satélite (DAB ya es un hecho. Su presencia en el ciberespacio permitirá a los grupos multinacionales difundir sus productos culturales a escala mundial, con calidad de CD, y liquidar las programaciones locales. En este contexto, el reto de la radio democrática se multiplica y complica.

  18. DID INSTAGRAM KILLED THE MYSTERY OF RADIO? USE OF INSTAGRAM IN TURKISH RADIO STATIONS AND RADIO HOSTS

    Directory of Open Access Journals (Sweden)

    Michalis Kuyucu

    2016-04-01

    Full Text Available Turning voice into imagination, radio translated imagination into reality with social media. The radio audience imagined there were people inside the receiver and wondered what kind of people those people were. This convergence between radio and the new media ensured realization of this imagination. The new media established communication between the people inside that radio receiver and the audience. Social media platform Instagram is the latest step in turning the radio from an image into reality. Are radio stations revealing themselves by throwing away the mystery via Instagram or do they still remain mysterious? The purpose of this study is to carry out a research directed at Instagram use of radio stations in Turkey and makes observations with regards to the existence of radio medium in Instagram. The existence of ten Turkish radio stations with the highest ratings among radio stations and ten radio hosts in Instagram was studied within this scope. The messages shared by the radio stations and hosts on their Instagram accounts were examined and an analysis was made intended at use of Instagram through these messages. The Instagram account activities of radio stations between 01 June – 31 December 2015 were reviewed within this scope and Instagram’s contribution to public relations activities of radio stations carried out by social media was scrutinized. The question “Did Instagram unveiled the mystery of radio?” was discussed and how radio is revealed by means of Instagram was underlined in this study.

  19. Comparison of Antenna Array Systems Using OFDM for Software Radio via the SIBIC Model

    Directory of Open Access Journals (Sweden)

    Robert D. Palmer

    2005-09-01

    Full Text Available This paper investigates the performance of two candidates for software radio WLAN, reconfigurable OFDM modulation and antenna diversity, in an indoor environment. The scenario considered is a 20 m×10 m×3 m room with two base units and one mobile unit. The two base units use omnidirectional antennas to transmit and the mobile unit uses either a single antenna with equalizer, a fixed beamformer with equalizer, or an adaptive beamformer with equalizer to receive. The modulation constellation of the data is QPSK and 16-QAM. The response of the channel at the mobile unit is simulated using a three-dimensional indoor WLAN propagation model that generates multipath components with realistic spatial and temporal correlation. An underlying assumption of the scenario is that existing antenna hardware is available and could be exploited if software processing resources are allocated. The results of the simulations indicate that schemes using more resources outperform simpler schemes in most cases. This implies that desired user performance could be used to dynamically assign software processing resources to the demands of a particular indoor WLAN channel if such resources are available.

  20. Radio channel measurement and modelling for future mobile radio systems

    Science.gov (United States)

    Guerdenli, E.; Huish, P. W.

    1989-12-01

    Digital mobile radio systems will require planning methods that provide accurate predictions of signal strength, distortion, and interference for situations ranging from very small cells in dense urban locations to large rural cells. Topographic and land usage data bases will find increasing use to enhance the accuracy of prediction models. The implications of these issues are discussed and the work in progress at British Telecommunications Research Laboratories on land mobile radio propagation modeling and wide-band channel measurements is presented.

  1. Radio frequency integrated circuit design for cognitive radio systems

    CERN Document Server

    Fahim, Amr

    2015-01-01

    This book fills a disconnect in the literature between Cognitive Radio systems and a detailed account of the circuit implementation and architectures required to implement such systems.  Throughout the book, requirements and constraints imposed by cognitive radio systems are emphasized when discussing the circuit implementation details.  In addition, this book details several novel concepts that advance state-of-the-art cognitive radio systems.  This is a valuable reference for anybody with background in analog and radio frequency (RF) integrated circuit design, needing to learn more about integrated circuits requirements and implementation for cognitive radio systems. ·         Describes in detail cognitive radio systems, as well as the circuit implementation and architectures required to implement them; ·         Serves as an excellent reference to state-of-the-art wideband transceiver design; ·         Emphasizes practical requirements and constraints imposed by cognitive radi...

  2. Reconfigurable, Digital EVA Radio Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The nature of human exploration missions to the Moon and Mars demands a frequency-agile, reconfigurable, durable digital radio delivering telemetry, ranging, voice,...

  3. Radio Wave Propagation in Tunnels

    National Research Council Canada - National Science Library

    Lee, Jeho

    2000-01-01

    This report examines the radio propagation model for narrow and long tunnels. Modal analysis is used to model the path gain in 2-D and 3-D rectangular tunnels and the coupling loss of L, T and cross tunnels...

  4. Miniaturized Digital EVA Radio Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Bennett Aerospace and Team Partners propose to develop a small, lightweight, and very power-efficient mobile radio for use on the Lunar surface. Our Team will...

  5. Sea Turtle Radio Telemetry Data

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Radio transmitters attached to sea turtles captured in various fishing gear enabled us to track and measure surfacing time of each turtle. Determining location of...

  6. Innovativeness and the Public Radio Audience.

    Science.gov (United States)

    Williams, Wenmouth, Jr.; Krugman, Dean M.

    1981-01-01

    A public radio audience was surveyed to test the hypothesis that a relationship exists between innovativeness and public radio listening. Rather than supporting the hypothesis, findings indicate that the entertainment and information elements of public radio are the primary attractions for the public radio audience. (MER)

  7. On the evaluation of Web Radio

    NARCIS (Netherlands)

    Field, A.N.; Hartel, Pieter H.

    We develop an evaluation method for Web radio, and perform it to see what we can be learnt about seven prominent Web radio sites. We also evaluate a commercial FM radio station for control purposes. We present a taxonomy of Web radio, and we give our observations and conclusions on this evaluation.

  8. Ecuador: Construyendo radio y pueblo

    OpenAIRE

    Teodoro Galarza

    2015-01-01

    En el Ecuador a diferencia de Argentina y Colombia, las radios populares crecen a ritmo lento. En la década pasada hubo estancamiento, pero en los años 90 hay un resurgir de estos medios, con nuevos estilos de trabajo. La coordinadora de radios Populares y Educativas del Ecuador, CORAPE, sigue de cerca esta evolución. El texto trata de la capacitación profesional.

  9. Radio and line transmission 2

    CERN Document Server

    Roddy, Dermot

    2013-01-01

    Radio and Line Transmission, Volume 2 gives a detailed treatment of the subject as well as an introduction to additional advanced subject matter. Organized into 14 chapters, this book begins by explaining the radio wave propagation, signal frequencies, and bandwidth. Subsequent chapters describe the transmission lines and cables; the aerials; tuned and coupled circuits; bipolar transistor amplifiers; field-effect transistors and circuits; thermionic valve amplifiers; LC oscillators; the diode detectors and modulators; and the superheterodyne receiver. Other chapters explore noise and interfere

  10. Interoperability: Stop Blaming the Radio

    Science.gov (United States)

    2007-02-01

    Interoperability: Stop Blaming the Radio Ronald P. Timmons INTRODUCTION One of the most pressing first responder issues emerging in the post-9...00-00-2007 4. TITLE AND SUBTITLE Interoperability: Stop Blaming the Radio 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 6...recording of a reporter describing the crash of the Hindenburg (“oh, the humanity!”) can attest, stress causes the human voice to take on a very

  11. Ecuador: Construyendo radio y pueblo

    Directory of Open Access Journals (Sweden)

    Teodoro Galarza

    2015-01-01

    Full Text Available En el Ecuador a diferencia de Argentina y Colombia, las radios populares crecen a ritmo lento. En la década pasada hubo estancamiento, pero en los años 90 hay un resurgir de estos medios, con nuevos estilos de trabajo. La coordinadora de radios Populares y Educativas del Ecuador, CORAPE, sigue de cerca esta evolución. El texto trata de la capacitación profesional.

  12. Automatic radio-transmission monitor

    Science.gov (United States)

    Bernstein, A. J.

    1978-01-01

    System continuously monitors radio transmissions stored in memory. If spectrum deviates beyond present limits, alarm is tripped and spectrum is transferred to long-term storage for later analysis. Monitor can be useful in ensuring proper power level and spectral quality and in finding cause of failure. It might also be used to monitor radio-frequency interference or power levels of citizen's-band transmitters.

  13. A zero-power radio receiver.

    Energy Technology Data Exchange (ETDEWEB)

    Brocato, Robert Wesley

    2004-09-01

    This report describes both a general methodology and some specific examples of passive radio receivers. A passive radio receiver uses no direct electrical power but makes sole use of the power available in the radio spectrum. These radio receivers are suitable as low data-rate receivers or passive alerting devices for standard, high power radio receivers. Some zero-power radio architectures exhibit significant improvements in range with the addition of very low power amplifiers or signal processing electronics. These ultra-low power radios are also discussed and compared to the purely zero-power approaches.

  14. RADIO WITHOUT A LISTENER: "MAYAK"

    Directory of Open Access Journals (Sweden)

    Bysko Maxim V.

    2017-12-01

    Full Text Available The singularity of this article is that it is entirely based on a critical analysis of only one live musical radio program on the Mayak radio station and dedicated to the life and work of the famous British composer Andrew Lloyd Webber. In principle, the article can be considered a scientific review of the media product. Based on his analysis, the author comes to the paradoxical conclusion that the presence of a listener becomes unnecessary for modern broadcasting. This is stated by many principles of the conduct of the air, presented in the radio program, where all the information load is placed on the guest in the studio, where there is no preparatory work of the DJs, where their inability to navigate the genres of journalism violates communication norms and colloquial ethics, where an obvious deconstructive approach to the material offered for the listener. In addition, the phenomenon of being the DJs in the radio studio exclusively "for themselves" is emphasized by the sound design of the radio program, which runs counter to the logic of auditory perception (for example, the sequence of jingles, as well as the incompetent selection of musical material, which undoubtedly repels professional radio listeners-musicians.

  15. The radio properties of infrared-faint radio sources

    Science.gov (United States)

    Middelberg, E.; Norris, R. P.; Hales, C. A.; Seymour, N.; Johnston-Hollitt, M.; Huynh, M. T.; Lenc, E.; Mao, M. Y.

    2011-02-01

    Context. Infrared-faint radio sources (IFRS) are objects that have flux densities of several mJy at 1.4 GHz, but that are invisible at 3.6 μm when using sensitive Spitzer observations with μJy sensitivities. Their nature is unclear and difficult to investigate since they are only visible in the radio. Aims: High-resolution radio images and comprehensive spectral coverage can yield constraints on the emission mechanisms of IFRS and can give hints to similarities with known objects. Methods: We imaged a sample of 17 IFRS at 4.8 GHz and 8.6 GHz with the Australia Telescope Compact Array to determine the structures on arcsecond scales. We added radio data from other observing projects and from the literature to obtain broad-band radio spectra. Results: We find that the sources in our sample are either resolved out at the higher frequencies or are compact at resolutions of a few arcsec, which implies that they are smaller than a typical galaxy. The spectra of IFRS are remarkably steep, with a median spectral index of -1.4 and a prominent lack of spectral indices larger than -0.7. We also find that, given the IR non-detections, the ratio of 1.4 GHz flux density to 3.6 μm flux density is very high, and this puts them into the same regime as high-redshift radio galaxies. Conclusions: The evidence that IFRS are predominantly high-redshift sources driven by active galactic nuclei (AGN) is strong, even though not all IFRS may be caused by the same phenomenon. Compared to the rare and painstakingly collected high-redshift radio galaxies, IFRS appear to be much more abundant, but less luminous, AGN-driven galaxies at similar cosmological distances.

  16. Information Content in Radio Waves: Student Investigations in Radio Science

    Science.gov (United States)

    Jacobs, K.; Scaduto, T.

    2013-12-01

    We describe an inquiry-based instructional unit on information content in radio waves, created in the summer of 2013 as part of a MIT Haystack Observatory (Westford, MA) NSF Research Experiences for Teachers (RET) program. This topic is current and highly relevant, addressing science and technical aspects from radio astronomy, geodesy, and atmospheric research areas as well as Next Generation Science Standards (NGSS). Projects and activities range from simple classroom demonstrations and group investigations, to long term research projects incorporating data acquisition from both student-built instrumentation as well as online databases. Each of the core lessons is applied to one of the primary research centers at Haystack through an inquiry project that builds on previously developed units through the MIT Haystack RET program. In radio astronomy, students investigate the application of a simple and inexpensive software defined radio chip (RTL-SDR) for use in systems implementing a small and very small radio telescope (SRT and VSRT). Both of these systems allow students to explore fundamental principles of radio waves and interferometry as applied to radio astronomy. In ionospheric research, students track solar storms from the initial coronal mass ejection (using Solar Dynamics Observatory images) to the resulting variability in total electron density concentrations using data from the community standard Madrigal distributed database system maintained by MIT Haystack. Finally, students get to explore very long-baseline interferometry as it is used in geodetic studies by measuring crustal plate displacements over time. Alignment to NextGen standards is provided for each lesson and activity with emphasis on HS-PS4 'Waves and Their Applications in Technologies for Information Transfer'.

  17. Observations of mesosphere summer echoes with calibrated VHF radars at latitudes between 54°N and 69°N in summer 2004

    Science.gov (United States)

    Latteck, R.; Singer, W.; Kirkwood, S.; Jönsson, L. O.; Eriksson, Håkan

    2005-08-01

    Mesosphere Summer Echoes (MSE) have been observed with 50-MHz VHF radars at middle (MSE) and polar latitudes (PMSE) for more than 20 years. The occurrence and seasonal variation of these radar echoes as well as their dependence on solar and geomagnetic activity are mostly studied basing on relative signal strength measurements (signal-to-noise ratios). The latitudinal dependence of the appearance and intensity of mesospheric summer echoes is still an open question as the widely used relative signal strength observations are determined by the atmospheric properties as well as by the individual radar characteristics. The use of absolutely calibrated echo powers allows a system in-depended comparison of mesospheric summer echoes observed at different sites by different systems. We present two different radar calibration methods. One applies a noise source to calibrate the receive path of the radar only, a second uses the radar signal itself to calibrate the complete transmitting and receiving path of the radar system. Both techniques and the same calibration hardware have been applied to the ALWIN VHF radar at Andenes/Norway (69°N), the ESRAD radar at Kiruna/Sweden (68deg;N) and OSWIN radar at Kühlungsborn/Germany (54°N). The sensitivity of the different radar systems and the seasonal and diurnal variation of the occurrence of mesospheric summer echoes at different locations are discussed on the basis of radar backscatter cross-sections.

  18. SISTEMA WEB DE GEOLOCALIZACIÓN Y MONITOREO DE LA TORTUGA PODOCNEMIS LEWYANA EN EL RÍO SINÚ, MEDIANTE EL USO DE ANTENAS VHF Y DISPOSITIVOS GPS

    Directory of Open Access Journals (Sweden)

    Mario Macea Anaya

    2016-03-01

    Full Text Available Este trabajo tiene como finalidad el diseño e implementación de una aplicación para el monitoreo de las Tortugas de Río Podocnemis Lewyana, utilizando las tecnologías GPS (Global Positioning System y VHF (Very High Frequency. La aplicación permite apoyar los procesos de conservación y recuperación de la especie en el Departamento de Córdoba, en las poblaciones de Caño Viejo y Cotocá Arriba del municipio Santa Cruz de Lorica, Colombia. El uso de esa herramienta está dirigido a biólogos y personas de las comunidades rurales dedicadas a conservar dicha especie. En el desarrollo del proyecto se utilizaron 18 Tortugas de Río para su monitoreo. El resultado del trabajo es la aplicación Web Podocnemis-Soft. Su funcionamiento se basa en un dispositivo GPS y VHF, ubicado en una o varias de las tortugas Podocnemis Lewyana; los dispositivos envían los datos de la ubicación de la tortuga hasta un servidor para su procesamiento y posterior visualización de la información.

  19. Relationship between propagation direction of gravity waves in OH and OI airglow images and VHF radar echo occurrence during the SEEK-2 campaign

    Directory of Open Access Journals (Sweden)

    F. Onoma

    2005-10-01

    Full Text Available We report simultaneous observations of atmospheric gravity waves (AGW in OI (557.7nm and OH airglow images and VHF radar backscatter from field-aligned irregularities (FAI in the E-region during the SEEK-2 (Sporadic-E Experiment over Kyushu 2 campaign period from 29 July to 9 August 2002. An all-sky imager was operated at Nishino-Omote (30.5 N, 130.1 E, Japan. On 14 nights, 17 AGW events were detected in OI and OH airglow images. AGW propagated mostly toward the northeast or southeast. From comparison with the E-region FAI occurrence, which is detected by a nearby VHF radar (31.57MHz, we found that AGW tended to propagate southeastward during FAI events. This result suggests that the interaction between AGW and E-region plasma plays an important role in generating FAI. Furthermore, polarization electric fields generated directly by AGW may contribute to the FAI generation.

    Keywords. Atmospheric composition and structure (Airglow and aurora, Ionosphere (Ionospheric irregularities, Mid-latitude ionosphere

  20. Radio Frequency Interference Site Survey for Thai Radio Telescopes

    Science.gov (United States)

    Jaroenjittichai, P.; Punyawarin, S.; Singwong, D.; Somboonpon, P.; Prasert, N.; Bandudej, K.; Kempet, P.; Leckngam, A.; Poshyachinda, S.; Soonthornthum, B.; Kramer, B.

    2017-09-01

    Radio astronomical observations have increasingly been threaten by the march of today telecommunication and wireless technology. Performance of radio telescopes lies within the fact that astronomical sources are extremely weak. National Astronomy Research Institute of Thailand (NARIT) has initiated a 5-year project, known as the Radio Astronomy Network and Geodesy for Development (RANGD), which includes the establishment of 40-meter and 13-meter radio telescopes. Possible locations have been narrowed down to three candidates, situated in the Northern part of Thailand, where the atmosphere is sufficiently dry and suitable for 22 and 43 GHz observations. The Radio Frequency Interference (RFI) measurements were carried out with a DC spectrum analyzer and directional antennas at 1.5 meter above ground, from 20 MHz to 6 GHz with full azimuth coverage. The data from a 3-minute pointing were recorded for both horizontal and vertical polarizations, in maxhold and average modes. The results, for which we used to make preliminary site selection, show signals from typical broadcast and telecommunication services and aeronautics applications. The signal intensity varies accordingly to the presence of nearby population and topography of the region.

  1. IA-Regional-Radio - Social Network for Radio Recommendation

    Science.gov (United States)

    Dziczkowski, Grzegorz; Bougueroua, Lamine; Wegrzyn-Wolska, Katarzyna

    This chapter describes the functions of a system proposed for the music hit recommendation from social network data base. This system carries out the automatic collection, evaluation and rating of music reviewers and the possibility for listeners to rate musical hits and recommendations deduced from auditor's profiles in the form of regional Internet radio. First, the system searches and retrieves probable music reviews from the Internet. Subsequently, the system carries out an evaluation and rating of those reviews. From this list of music hits, the system directly allows notation from our application. Finally, the system automatically creates the record list diffused each day depending on the region, the year season, the day hours and the age of listeners. Our system uses linguistics and statistic methods for classifying music opinions and data mining techniques for recommendation part needed for recorded list creation. The principal task is the creation of popular intelligent radio adaptive on auditor's age and region - IA-Regional-Radio.

  2. Industrial interference and radio astronomy

    Science.gov (United States)

    Jessner, A.

    2013-07-01

    The interferer - victim scenario is described for the case of industrial interference affecting radio astronomical observatories. The sensitivity of radio astronomical receivers and their interference limits are outlined. EMC above 30 MHz is a serious problem for Radio Astronomy. Interferer (CISPR) and victim (ITU-R RA 769) standards are not harmonised. The emissions from the interferer and their spectral characteristics are not defined sufficiently well by CISPR standards. The required minimum coupling losses (MCL) between an industrial device and radio astronomical antenna depends on device properties but is shown to exceed 140 dB in most cases. Spatial separation of a few km is insufficient on its own, the terrain must shield > 30-40 dB, additional mitigations such as extra shielding or suppression of high frequency emissions may be necessary. A case by case compatibility analysis and tailored EMC measures are required for individual installations. Aggregation of many weak rfi emitters can become serious problem. If deployment densities are high enough, the emission constraints can even exceed those for a single interferer at a short distance from the radio observatory. Compatibility studies must account not only for the single interferer but also for many widely distributed interference sources.

  3. Unseen cosmos the universe in radio

    CERN Document Server

    Graham-Smith, Francis

    2013-01-01

    Radio telescopes have transformed our understanding of the Universe. Pulsars, quasars, Big Bang cosmology: all are discoveries of the new science of radio astronomy. Here, Francis Graham-Smith describes the birth, development, and maturity of radio astronomy, from the first discovery of cosmic radio waves to its present role as a major part of modern astronomy. Radio is part of the electromagnetic spectrum, covering infra-red, visible light, ultraviolet, X-rays, and gamma-rays, and Graham-Smith explains why it is that radio waves give us a unique view of the Universe. Tracing the development o

  4. ¿Radio popular o comunitaria?

    Directory of Open Access Journals (Sweden)

    María Cristina Mata

    2015-01-01

    Full Text Available Conocidas como Radios populares o educativas en América Latina; Radio Rural o local en África; Radio pública en Australia y Radio libre o Asociativa en Europa todas en busca de la democratización de la comunicación a escala comunitaria y que se iniciaron hace casi medio siglo. En todas partes no deja de ser un tipo de radio hecha para servir al pueblo, una radio que favorece la expresión y la participación al tiempo que valora la cultura local.

  5. Reconfigurable radio systems network architectures and standards

    CERN Document Server

    Iacobucci, Maria Stella

    2013-01-01

    This timely book provides a standards-based view of the development, evolution, techniques and potential future scenarios for the deployment of reconfigurable radio systems.  After an introduction to radiomobile and radio systems deployed in the access network, the book describes cognitive radio concepts and capabilities, which are the basis for reconfigurable radio systems.  The self-organizing network features introduced in 3GPP standards are discussed and IEEE 802.22, the first standard based on cognitive radio, is described. Then the ETSI reconfigurable radio systems functional ar

  6. Magnetic filaments associated radio-source feedback

    Science.gov (United States)

    Birkinshaw, Mark; Worrall, Diana

    2015-08-01

    Heating of the intergalactic medium by radio sources must be associated with magnetization. We present a case study of a double radio galaxy system that shows extensive field injection through two different radio plume morphologies that both extend hundreds of kpc. One plume exhibits two exceptionally narrow radio-bright features which extend along much of its length. The extreme length-to-width radio of these filaments suggests that they trace organized and stable magnetic ropes that have been drawn out by the motion of the radio galaxy through the intergalactic mediu, and that dissipate only slowly.

  7. Effects of plant phenology and vertical height on accuracy of radio-telemetry locations

    Science.gov (United States)

    Grovenburg, Troy W.; Jacques, Christopher N.; Klaver, Robert W.; DePerno, Christopher S.; Lehman, Chad P.; Brinkman, Todd J.; Robling, Kevin A.; Rupp, Susan P.; Jenks, Jonathan A.

    2013-01-01

    The use of very high frequency (VHF) radio-telemetry remains wide-spread in studies of wildlife ecology and management. However, few studies have evaluated the influence of vegetative obstruction on accuracy in differing habitats with varying transmitter types and heights. Using adult and fawn collars at varying heights above the ground (0, 33, 66 and 100 cm) to simulate activities (bedded, feeding and standing) and ages (neonate, juvenile and adult) of deer Odocoileus spp., we collected 5,767 bearings and estimated 1,424 locations (28-30 for each of 48 subsamples) in three habitat types (pasture, grassland and forest), during two stages of vegetative growth (spring and late summer). Bearing error was approximately twice as large at a distance of 900 m for fawn (9.9°) than for adult deer collars (4.9°). Of 12 models developed to explain the variation in location error, the analysis of covariance model (HT*D + C*D + HT*TBA + C*TBA) containing interactions of height of collar above ground (HT), collar type (C), vertical height of understory vegetation (D) and tree basal area (TBA) was the best model (wi = 0.92) and explained ∼ 71% of the variation in location error. Location error was greater for both collar types at 0 and 33 cm above the ground compared to 66 and 100 cm above the ground; however, location error was less for adult than fawn collars. Vegetation metrics influenced location error, which increased with greater vertical height of understory vegetation and tree basal area. Further, interaction of vegetation metrics and categorical variables indicated significant effects on location error. Our results indicate that researchers need to consider study objectives, life history of the study animal, signal strength of collar (collar type), distance from transmitter to receiver, topographical changes in elevation, habitat composition and season when designing telemetry protocols. Bearing distances in forested habitat should be decreased (approximately 23

  8. La Radio et ses publics

    OpenAIRE

    Glévarec, Hervé; Pinet, Michel

    2011-01-01

    Média ancien, fortement ancré dans les routines et les activités de la vie quotidienne, la radio est l’objet d’un fort investissement de la part des Français. Pourtant, l’intérêt scientifique à l’endroit des publics de la radio est relativement récent. On ne sait pas grand-chose de la structuration de cet univers qui offre en France une diversité remarquable de stations, privées musicales jeunes (NRJ, Fun radio, Skyrock…), adultes (Nostalgie, Virgin, RTL2…), généralistes (RTL, Europe 1), de s...

  9. Radio Context Awareness and Applications

    Directory of Open Access Journals (Sweden)

    Luca Reggiani

    2013-01-01

    Full Text Available The context refers to “any information that can be used to characterize the situation of an entity, where an entity can be a person, place, or physical object.” Radio context awareness is defined as the ability of detecting and estimating a system state or parameter, either globally or concerning one of its components, in a radio system for enhancing performance at the physical, network, or application layers. In this paper, we review the fundamentals of context awareness and the recent advances in the main radio techniques that increase the context awareness and smartness, posing challenges and renewed opportunities to added-value applications in the context of the next generation of wireless networks.

  10. Modular Software-Defined Radio

    Directory of Open Access Journals (Sweden)

    Rhiemeier Arnd-Ragnar

    2005-01-01

    Full Text Available In view of the technical and commercial boundary conditions for software-defined radio (SDR, it is suggestive to reconsider the concept anew from an unconventional point of view. The organizational principles of signal processing (rather than the signal processing algorithms themselves are the main focus of this work on modular software-defined radio. Modularity and flexibility are just two key characteristics of the SDR environment which extend smoothly into the modeling of hardware and software. In particular, the proposed model of signal processing software includes irregular, connected, directed, acyclic graphs with random node weights and random edges. Several approaches for mapping such software to a given hardware are discussed. Taking into account previous findings as well as new results from system simulations presented here, the paper finally concludes with the utility of pipelining as a general design guideline for modular software-defined radio.

  11. Phenomenology of magnetospheric radio emissions

    Science.gov (United States)

    Carr, T. D.; Desch, M. D.; Alexander, J. K.

    1983-01-01

    Jupiter has now been observed over 24 octaves of the radio spectrum, from about 0.01 MHz to 300,000 MHz. Its radio emissions fill the entire spectral region where interplanetary electromagnetic propagation is possible at wavelengths longer than infrared. Three distinct types of radiation are responsible for this radio spectrum. Thermal emission from the atmosphere accounts for virtually all the radiation at the high frequency end. Synchrotron emission from the trapped high-energy particle belt deep within the inner magnetosphere is the dominant spectral component from about 4000 to 40 MHz. The third class of radiation consists of several distinct components of sporadic low frequency emission below 40 MHz. The decimeter wavelength emission is considered, taking into account the discovery of synchrotron emission, radiation by high-energy electrons in a magnetic field, and the present status of Jovian synchrotron phenomenology. Attention is also given to the decameter and hectometer wavelength emission, and emissions at kilometric wavelengths.

  12. Miniature EVA Software Defined Radio

    Science.gov (United States)

    Pozhidaev, Aleksey

    2012-01-01

    As NASA embarks upon developing the Next-Generation Extra Vehicular Activity (EVA) Radio for deep space exploration, the demands on EVA battery life will substantially increase. The number of modes and frequency bands required will continue to grow in order to enable efficient and complex multi-mode operations including communications, navigation, and tracking applications. Whether conducting astronaut excursions, communicating to soldiers, or first responders responding to emergency hazards, NASA has developed an innovative, affordable, miniaturized, power-efficient software defined radio that offers unprecedented power-efficient flexibility. This lightweight, programmable, S-band, multi-service, frequency- agile EVA software defined radio (SDR) supports data, telemetry, voice, and both standard and high-definition video. Features include a modular design, an easily scalable architecture, and the EVA SDR allows for both stationary and mobile battery powered handheld operations. Currently, the radio is equipped with an S-band RF section. However, its scalable architecture can accommodate multiple RF sections simultaneously to cover multiple frequency bands. The EVA SDR also supports multiple network protocols. It currently implements a Hybrid Mesh Network based on the 802.11s open standard protocol. The radio targets RF channel data rates up to 20 Mbps and can be equipped with a real-time operating system (RTOS) that can be switched off for power-aware applications. The EVA SDR's modular design permits implementation of the same hardware at all Network Nodes concept. This approach assures the portability of the same software into any radio in the system. It also brings several benefits to the entire system including reducing system maintenance, system complexity, and development cost.

  13. Radio Relays Improve Wireless Products

    Science.gov (United States)

    2009-01-01

    Signal Hill, California-based XCOM Wireless Inc. developed radio frequency micromachine (RF MEMS) relays with a Phase II Small Business Innovation Research (SBIR) contract through NASA?s Jet Propulsion Laboratory. In order to improve satellite communication systems, XCOM produced wireless RF MEMS relays and tunable capacitors that use metal-to-metal contact and have the potential to outperform most semiconductor technologies while using less power. These relays are used in high-frequency test equipment and instrumentation, where increased speed can mean significant cost savings. Applications now also include mainstream wireless applications and greatly improved tactical radios.

  14. radio frequency emf radio frequency emf exposure due to gsm

    African Journals Online (AJOL)

    eobe

    point microwave radio, and satellite communications systems. The most recent concern is the safety .... examined by a set of equation called Maxwell's equations [5]. Mathematically, Maxwell derived a differential and integral wave form of the electric and magnetic equations in free space using four field quantities namely the ...

  15. Impact of African Farm Radio Research Initiative Participatory Radio ...

    African Journals Online (AJOL)

    zeleza

    The AFRRI participatory action research and radio communication/extension based project involved, per design, three Active Listening (ALC) communities of Labvu, Makombe and Lovimbi while Magodi and Chambakata acted as Passive Listening Communities (PLC) and. Control Communities (CC). ALC participants were ...

  16. Radio Astronomy and the Giant Metre-Wave Radio Telescope

    Indian Academy of Sciences (India)

    but the energy of each type of wave varies inversely with its wavelength. Thus ... parent to radio-waves; much of the galaxy is also transparent to ..... stars in the galaxies. The im- age has been inverted (like a film negative) so darker re- gions in the image are ac- tually brighter. In the opti- cal image the two galaxies.

  17. Intelligent Cognitive Radio Models for Enhancing Future Radio Astronomy Observations

    Directory of Open Access Journals (Sweden)

    Ayodele Abiola Periola

    2016-01-01

    Full Text Available Radio astronomy organisations desire to optimise the terrestrial radio astronomy observations by mitigating against interference and enhancing angular resolution. Ground telescopes (GTs experience interference from intersatellite links (ISLs. Astronomy source radio signals received by GTs are analysed at the high performance computing (HPC infrastructure. Furthermore, observation limitation conditions prevent GTs from conducting radio astronomy observations all the time, thereby causing low HPC utilisation. This paper proposes mechanisms that protect GTs from ISL interference without permanent prevention of ISL data transmission and enhance angular resolution. The ISL transmits data by taking advantage of similarities in the sequence of observed astronomy sources to increase ISL connection duration. In addition, the paper proposes a mechanism that enhances angular resolution by using reconfigurable earth stations. Furthermore, the paper presents the opportunistic computing scheme (OCS to enhance HPC utilisation. OCS enables the underutilised HPC to be used to train learning algorithms of a cognitive base station. The performances of the three mechanisms are evaluated. Simulations show that the proposed mechanisms protect GTs from ISL interference, enhance angular resolution, and improve HPC utilisation.

  18. radio frequency based radio frequency based water level monitor

    African Journals Online (AJOL)

    eobe

    Key words: radio frequency, PIC microcontroller, encoder, decoder, water pump, residential. 1. ... The sensors emit high frequency (20kHz to 200 kHz) acoustic waves that are reflected back to and detected by the emitting transducer [2-4]. In addition, optical interface ... is another method; in this method optical sensors are.

  19. Radio Galaxy Zoo: cosmological alignment of radio sources

    Science.gov (United States)

    Contigiani, O.; de Gasperin, F.; Miley, G. K.; Rudnick, L.; Andernach, H.; Banfield, J. K.; Kapińska, A. D.; Shabala, S. S.; Wong, O. I.

    2017-11-01

    We study the mutual alignment of radio sources within two surveys, Faint Images of the Radio Sky at Twenty-centimetres (FIRST) and TIFR GMRT Sky Survey (TGSS). This is done by producing two position angle catalogues containing the preferential directions of respectively 30 059 and 11 674 extended sources distributed over more than 7000 and 17 000 deg2. The identification of the sources in the FIRST sample was performed in advance by volunteers of the Radio Galaxy Zoo (RGZ) project, while for the TGSS sample it is the result of an automated process presented here. After taking into account systematic effects, marginal evidence of a local alignment on scales smaller than 2.5 deg is found in the FIRST sample. The probability of this happening by chance is found to be less than 2 per cent. Further study suggests that on scales up to 1.5 deg the alignment is maximal. For one third of the sources, the RGZ volunteers identified an optical counterpart. Assuming a flat Λ cold dark matter cosmology with Ω _m = 0.31, Ω _Λ = 0.69, we convert the maximum angular scale on which alignment is seen into a physical scale in the range [19, 38] Mpc h_{70}^{-1}. This result supports recent evidence reported by Taylor and Jagannathan of radio jet alignment in the 1.4 deg2 ELAIS N1 field observed with the Giant Metrewave Radio Telescope. The TGSS sample is found to be too sparsely populated to manifest a similar signal.

  20. Perkembangan dan Problematika Radio Komunitas di Indonesia

    Directory of Open Access Journals (Sweden)

    Masduki .

    2013-12-01

    Full Text Available Abstract: This article is about the development of community radio in Indonesia, it is problems and solutions. Community radio in Indonesia developed as an alternative to both public radio and commercial radio after the fall of Soeharto in 1998. Two important features of community radio are that it provides all community members with equal access to information, enhancing their rights and obligations, access to justice, public accountability and also enables them to participate actively in radio management and production. Both features enhance people’s selfawareness and sense of belonging to a community. The expansion of the progressive, participatory, community ownership, and non-profit model of community radio, has become a third sector of communication beside the commercial or state media. The dynamic development of community radio in Indonesia faced several problems starting from it is definition, implementation of regulation until standards of programmes operation based on the concept of community approach and participation

  1. Radio Search for Alien Space Probes

    Science.gov (United States)

    Arkhipov, A. V.

    It is shown that the search for alien space probes by occasional interceptions of their radio communication beams appears to be a promising task not beyond the ability of amateur radio astronomers and all-sky monitoring systems.

  2. Enhanced omnidirectional and weatherability of Cu2ZnSnSe4 solar cells with ZnO functional nanorod arrays.

    Science.gov (United States)

    Lai, Fang-I; Yang, Jui-Fu; Liao, Wei-Xiang; Kuo, Shou-Yi

    2017-11-02

    This paper presents the use of nanorods of different sizes, deposited from a chemical solution, as an antireflection layer in copper-zinc-tin selenide (CZTSe) solar cells. With the aid of the nanorods, the surface reflection of the CZTSe solar cells was reduced from 7.76% to 2.97%, and a cell efficiency of 14% was obtained as a result. Omni-directional anti-reflection was verified by the angle-dependent reflection measurements. The nanorod arrays also provided the CZTSe solar cells with a hydrophobic surface, allowing it to exhibit high resistance against humidity during weatherability tests. This shows that the surface passivation brought by the nanorod layer at the surface could effectively extend the lifetime of the CZTSe solar cells. The rate of efficiency decay of the CZTSe solar cells was reduced by 46.85% from that of the device without a nanorod array at the surface, indicating that this surface layer not only provided effective resistance against reflection at the device surface, but also served as a passivation layer and humidity-resistant surface-protection layer.

  3. High-Efficiency Nanowire Solar Cells with Omnidirectionally Enhanced Absorption Due to Self-Aligned Indium-Tin-Oxide Mie Scatterers.

    Science.gov (United States)

    van Dam, Dick; van Hoof, Niels J J; Cui, Yingchao; van Veldhoven, Peter J; Bakkers, Erik P A M; Gómez Rivas, Jaime; Haverkort, Jos E M

    2016-12-27

    Photovoltaic cells based on arrays of semiconductor nanowires promise efficiencies comparable or even better than their planar counterparts with much less material. One reason for the high efficiencies is their large absorption cross section, but until recently the photocurrent has been limited to less than 70% of the theoretical maximum. Here we enhance the absorption in indium phosphide (InP) nanowire solar cells by employing broadband forward scattering of self-aligned nanoparticles on top of the transparent top contact layer. This results in a nanowire solar cell with a photovoltaic conversion efficiency of 17.8% and a short-circuit current of 29.3 mA/cm(2) under 1 sun illumination, which is the highest reported so far for nanowire solar cells and among the highest reported for III-V solar cells. We also measure the angle-dependent photocurrent, using time-reversed Fourier microscopy, and demonstrate a broadband and omnidirectional absorption enhancement for unpolarized light up to 60° with a wavelength average of 12% due to Mie scattering. These results unambiguously demonstrate the potential of semiconductor nanowires as nanostructures for the next generation of photovoltaic devices.

  4. Mechanoresponsive, omni-directional and local matrix-degrading actin protrusions in human mesenchymal stem cells microencapsulated in a 3D collagen matrix.

    Science.gov (United States)

    Ho, Fu Chak; Zhang, Wei; Li, Yuk Yin; Chan, Barbara Pui

    2015-01-01

    Cells are known to respond to multiple niche signals including extracellular matrix and mechanical loading. In others and our own studies, mechanical loading has been shown to induce the formation of cell alignment in 3D collagen matrix with random meshwork, challenging our traditional understanding on the necessity of having aligned substrates as the prerequisite of alignment formation. This motivates our adventure in deciphering the mechanism of loading-induced cell alignment and hence the discovery of the novel protrusive functional structure at the cell-matrix interface. Here we report the formation of mechanoresponsive, omni-directional and local matrix-degrading actin protrusions in human mesenchymal stem cells (hMSCs) microencapsulated in collagen following a shifted actin assembly/disassembly balance. These actin protrusive structures exhibit morphological and compositional similarity to filopodia and invadopodia but differ from them in stability, abundance, signaling and function. Without ruling out the possibility that these structures may comprise special subsets of filopodia and invadopodia, we propose to name them as mechanopodia so as to reveal their mechano-inductive mechanism. We also suggest that more intensive investigations are needed to delineate the functional significance and physiological relevance of these structures. This work identifies a brand new target for cell-matrix interaction and mechanoregulation studies. Copyright © 2015 Elsevier Ltd. All rights reserved.

  5. Zero-Power Radio Device.

    Energy Technology Data Exchange (ETDEWEB)

    Brocato, Robert W.

    2018-02-01

    This report describes an unpowered radio receiver capable of detecting and responding to weak signals t ransmit ted from comparatively lon g distances . This radio receiver offers key advantages over a short range zero - power radio receiver pre viously described in SAND2004 - 4610, A Zero - Power Radio Receiver . The device described here can be fabricated as an integrated circuit for use in portable wireless devices, as a wake - up circuit, or a s a stand - alone receiver operating in conjunction with identification decoders or other electroni cs. It builds on key sub - components developed at Sandia National L aboratories o ver many years. It uses surface acous tic wave (SAW) filter technology. It uses custom component design to e nable the efficient use of sma ll aperture antennas. This device uses a key component, the pyroelectric demodulator , covered by Sandia owned U.S. Patent 7397301, Pyroelectric Demodulating Detector [1] . This device is also described in Sandia owned U.S. Patent 97266446, Zero Power Receiver [2].

  6. Radio frequency modulation made easy

    CERN Document Server

    Faruque, Saleh

    2017-01-01

    This book introduces Radio Frequency Modulation to a broad audience. The author blends theory and practice to bring readers up-to-date in key concepts, underlying principles and practical applications of wireless communications. The presentation is designed to be easily accessible, minimizing mathematics and maximizing visuals.

  7. RADIO NOISE ADVANCES SEXUAL MATURITY

    African Journals Online (AJOL)

    ansistf-lewis

    Supplementary radio noise advances sexual maturity in domestic pullets exposed to 7-h photoperiods. P.D. Lewis. #. , B.A. Middleton. 1 and R.M. Gous. Animal and Poultry Science, School of Agricultural Sciences and Agribusiness, University of KwaZulu-Natal,. Scottsville 3209, South Africa. 1 School of Biomedical and ...

  8. A repeating fast radio burst

    Science.gov (United States)

    Spitler, L. G.; Scholz, P.; Hessels, J. W. T.; Bogdanov, S.; Brazier, A.; Camilo, F.; Chatterjee, S.; Cordes, J. M.; Crawford, F.; Deneva, J.; Ferdman, R. D.; Freire, P. C. C.; Kaspi, V. M.; Lazarus, P.; Lynch, R.; Madsen, E. C.; McLaughlin, M. A.; Patel, C.; Ransom, S. M.; Seymour, A.; Stairs, I. H.; Stappers, B. W.; van Leeuwen, J.; Zhu, W. W.

    2016-03-01

    Fast radio bursts are millisecond-duration astronomical radio pulses of unknown physical origin that appear to come from extragalactic distances. Previous follow-up observations have failed to find additional bursts at the same dispersion measure (that is, the integrated column density of free electrons between source and telescope) and sky position as the original detections. The apparent non-repeating nature of these bursts has led to the suggestion that they originate in cataclysmic events. Here we report observations of ten additional bursts from the direction of the fast radio burst FRB 121102. These bursts have dispersion measures and sky positions consistent with the original burst. This unambiguously identifies FRB 121102 as repeating and demonstrates that its source survives the energetic events that cause the bursts. Additionally, the bursts from FRB 121102 show a wide range of spectral shapes that appear to be predominantly intrinsic to the source and which vary on timescales of minutes or less. Although there may be multiple physical origins for the population of fast radio bursts, these repeat bursts with high dispersion measure and variable spectra specifically seen from the direction of FRB 121102 support an origin in a young, highly magnetized, extragalactic neutron star.

  9. Link Dependent Adaptive Radio Simulation

    Science.gov (United States)

    2014-06-01

    of Electrical and Computer Engineering Morgan State University ABSTRACT This paper shows the optimized Link Dependent Adaptive Radio (LDAR...Instrumentation (PEO STRI ). 9 9. REFERENCES [1] M. Elrais, B. Mengiste, B. Gautam and E. Dambia, "Variable OFDM Performance on Aeronautical

  10. Kashima 34-m Radio Telescope

    Science.gov (United States)

    Sekido, Mamoru; Kawai, Eiji

    2013-01-01

    The Kashima 34-m radio telescope has been continuously operated and maintained by the National Institute of Information and Communications Technology (NICT) as a facility of the Kashima Space Technology Center (KSTC) in Japan. This brief report summarizes the status of this telescope, the staff, and activities during 2012.

  11. Radio Relics in Cosmological Simulations

    Indian Academy of Sciences (India)

    Radio relics have been discovered in many galaxy clusters. They are believed to trace shock fronts induced by cluster mergers. Cosmological simulations allow us to study merger shocks in detail since the intra-cluster medium is heated by shock dissipation. Using high resolution cosmological simulations, identifying shock ...

  12. Radio frequency propagation made easy

    CERN Document Server

    Faruque, Saleh

    2015-01-01

    This book introduces Radio Frequency Propagation to a broad audience.  The author blends theory and practice to bring readers up-to-date in key concepts, underlying principles and practical applications of wireless communications.  The presentation is designed to be easily accessible, minimizing mathematics and maximizing visuals.

  13. Utrecht and Galactic Radio Astronomy

    NARCIS (Netherlands)

    van Woerden, H.

    Important roles in early Dutch Galactic radio astronomy were played by several Utrecht astronomers: Van de Hulst, Minnaert and Houtgast. The poster announcing the conference contained a number of pictures referring to scientific achievements of the Astronomical Institute Utrecht. One of these

  14. GNU Based Security in Software Defined Radio

    OpenAIRE

    H. B. Bhadka

    2012-01-01

    Various new technologies are explored for radio communication toward the 21st century. Among them the technology of "software defined radio" attracts large attention. Software Defined Radio (SDR) technology implements some of the functional modules of a radio system in software enabling highly flexible handsets. SDR devices may be reconfigured dynamically via the download of new software modules. Malicious or malfunctioning downloaded software present serious security risks to SDR devices and...

  15. Newnes radio and electronics engineer's pocket book

    CERN Document Server

    Moorshead, H W; Perry, J

    1978-01-01

    Newnes Radio and Electronics Engineer's Pocket Book, Fifteenth Edition provides reference of the information relevant in radio and electronics engineering. The book presents tables, illustrations, and diagrams of various data used in radio and electronics engineering. The coverage of the text includes abbreviations and symbols, electrical equations, and code conversions. The text will be useful to engineers, technicians, and other professionals who require a reference about the different aspects of radio and electronics.

  16. Spectrum Sharing Models in Cognitive Radio

    OpenAIRE

    Rifà Pous, Helena; Rifà Coma, Josep

    2011-01-01

    Spectrum scarcity demands thinking new ways to manage the distribution of radio frequency bands so that its use is more effective. The emerging technology that can enable this paradigm shift is the cognitive radio. Different models for organizing and managing cognitive radios have emerged, all with specific strategic purposes. In this article we review the allocation spectrum patterns of cognitive radio networks and analyse which are the common basis of each model.We expose the vulne...

  17. Cognitive radios for dynamic spectrum access - Polyphase Multipath Radio Circuits for Dynamic Spectrum Access

    NARCIS (Netherlands)

    Klumperink, Eric A.M.; Shrestha, R.; Mensink, E.; Arkesteijn, V.J.; Nauta, Bram

    2007-01-01

    ABSTRACT Dynamic access of unused spectrum via a cognitive radio asks for flexible radio circuits that can work at an arbitrary radio frequency. This article reviews techniques to realize radios without resorting to frequency selective dedicated filters. In particular, a recently proposed polyphase

  18. 47 CFR 90.185 - Multiple licensing of radio transmitting equipment in the mobile radio service.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Multiple licensing of radio transmitting equipment in the mobile radio service. 90.185 Section 90.185 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES PRIVATE LAND MOBILE RADIO SERVICES Policies...

  19. Radiografia de la radio en Espana

    National Research Council Canada - National Science Library

    Rodero Anton, Emma; Sanchez Serrano, Chelo

    2007-01-01

    ... a la crisis que atraviesa el medio en un intento de dibujar una radiografia de la radio en Espana. La radio tiene futuro, pero hay que trabajar activamente por el. Que la radio siga siendo parte del sonido de nuestra vida dependera, en definitiva, del trabajo de todos nosotros: empresas, anunciantes, profesionales, universitarios, investigadores y oyentes.

  20. Making Waves: Pirate Radio and Popular Music.

    Science.gov (United States)

    Jones, Steve

    The history of pirate radio--radio broadcasts offered by unlicensed broadcasters as alternatives to licensed, commercial radio programming--is difficult to trace, both in America and the United Kingdom (UK) since mention of pirate broadcasts of a less-then-thrilling nature are rarely found. Also, until 1927, the U.S. government did not formally…