WorldWideScience

Sample records for vhf epr analysis

  1. Phase and coherence analysis of VHF scintillation over Christmas Island

    Directory of Open Access Journals (Sweden)

    E. B. Shume

    2014-03-01

    Full Text Available This short paper presents phase and coherence data from the cross-wavelet transform applied on longitudinally separated very high frequency (VHF equatorial ionospheric scintillation observations over Christmas Island. The phase and coherence analyses were employed on a pair of scintillation observations, namely, the east-looking and west-looking VHF scintillation monitors at Christmas Island. Our analysis includes 3 years of peak season scintillation data from 2008, 2009 (low solar activity, and 2011 (moderate solar activity. In statistically significant and high spectral coherence regions of the cross-wavelet transform, scintillation observations from the east-looking monitor lead those from the west-looking monitor by about 20 to 60 (40 ± 20 min (most frequent lead times. Using several years (seasons and solar cycle of lead (or lag and coherence information of the cross-wavelet transform, we envisage construction of a probability model for forecasting scintillation in the nighttime equatorial ionosphere.

  2. An analysis on the mid-latitude scintillation and coherence frequency bandwidth using transionospheric VHF signals

    Energy Technology Data Exchange (ETDEWEB)

    Juang, Zhen [Los Alamos National Laboratory; Roussel-dupre, Robert [Los Alamos National Laboratory

    2008-01-01

    An analysis was perfonned on the mid-latitude scintillation and coherence frequency bandwidth (Fcoh) using transionospheric VHF signal data. The data include 1062 events spanning from November 1997 to June 2002. Each event records FORTE satellite received VHF signals from LAPP located at Los Alamos, New Mexico. Fcohs were derived to study scintillation characteristics on diurnal and seasonal variations, as well as changes due to solar and geomagnetic activities. Comparisons to the VHFIUHF coherence frequency bandwidth studies previously reported at equatorial and mid-latitude regions are made using a 4th power frequency dependence relationship. Furthennore, a wideband ionospheric scintillation model, WBMOD, was used to estimate Fcohs and compared with our VHF Fcoh values. Our analysis indicates mid-latitude scintillation characteristics that are not previously revealed. At the VHF bottom frequency range (3035 MHz), distinguished smaller Fcohs are found in time period from sunset to midnight, in wann season from May to August, and in low solar activity years. The effects of geomagnetic storm activity on Fcoh are characterized by a sudden transition at a Kp index of 50-60. Comparisons with median Fcohs estimated from other studies validated our VHF Fcohs for daytime while an order of magnitude larger Fcohs are found for nighttime, implying a time-dependent issue in applying the 4th order power relationship. Furthermore, comparisons with WBMOD-estimated Fcohs indicated generally matched median scintillation level estimates while differences do exist for those events undergoing high geomagnetic stonn activity which may imply underestimates of scintillation level by the WBMOD in the mid-latitude regions.

  3. Quantitative analysis of dinuclear manganese(II) EPR spectra.

    Science.gov (United States)

    Golombek, Adina P; Hendrich, Michael P

    2003-11-01

    A quantitative method for the analysis of EPR spectra from dinuclear Mn(II) complexes is presented. The complex [(Me(3)TACN)(2)Mn(II)(2)(mu-OAc)(3)]BPh(4) (1) (Me(3)TACN=N, N('),N(")-trimethyl-1,4,7-triazacyclononane; OAc=acetate(1-); BPh(4)=tetraphenylborate(1-)) was studied with EPR spectroscopy at X- and Q-band frequencies, for both perpendicular and parallel polarizations of the microwave field, and with variable temperature (2-50K). Complex 1 is an antiferromagnetically coupled dimer which shows signals from all excited spin manifolds, S=1 to 5. The spectra were simulated with diagonalization of the full spin Hamiltonian which includes the Zeeman and zero-field splittings of the individual manganese sites within the dimer, the exchange and dipolar coupling between the two manganese sites of the dimer, and the nuclear hyperfine coupling for each manganese ion. All possible transitions for all spin manifolds were simulated, with the intensities determined from the calculated probability of each transition. In addition, the non-uniform broadening of all resonances was quantitatively predicted using a lineshape model based on D- and r-strain. As the temperature is increased from 2K, an 11-line hyperfine pattern characteristic of dinuclear Mn(II) is first observed from the S=3 manifold. D- and r-strain are the dominate broadening effects that determine where the hyperfine pattern will be resolved. A single unique parameter set was found to simulate all spectra arising for all temperatures, microwave frequencies, and microwave modes. The simulations are quantitative, allowing for the first time the determination of species concentrations directly from EPR spectra. Thus, this work describes the first method for the quantitative characterization of EPR spectra of dinuclear manganese centers in model complexes and proteins. The exchange coupling parameter J for complex 1 was determined (J=-1.5+/-0.3 cm(-1); H(ex)=-2JS(1).S(2)) and found to be in agreement with a

  4. Analysis of the VHF-UHF electromagnetic radiation of lightning: Application to a model of the negative stepped leader propagation

    Science.gov (United States)

    Taudiere, Isabelle

    1991-03-01

    The space and time characteristics of the VHF-UHF radiation from lightning are analyzed on the bases of 300 MHz emission sources, localized in three dimensions by interferometric measurements. The main phases that contribute to the development of intracloud lightning are examined in detail, also using electric field measurements at the lower frequency. This research is complemented by an experimental and theoretical analysis of long discharge (8m) radio emissions generated with both polarities in the laboratory. These investigations revealed that the VHF radiation is associated with the channel reillumination phase accompanying each step in the negative spark. The outcome of this work is the creation of a simple model for the propagation of the negative leader. The current and the radiated field during this phase of the discharge are computed from an equivalent electric circuit using the physical laws governing the variation of resistance. The extrapolation of these results to the case of the stepped leader of natural lightning is discussed.

  5. Radiolysis of proteins in the solid state: an approach by EPR and product analysis.

    Science.gov (United States)

    Terryn, Hélène; Deridder, Véronique; Sicard-Roselli, Cécile; Tilquin, Bernard; Houée-Levin, Chantal

    2005-05-01

    Radio-induced modifications in proteins have been studied using several techniques. Electron paramagnetic resonance (EPR) was used to characterize free radicals, and analysis methods (high-performance liquid chromatography, capillary electrophoresis) were employed to visualize final degraded forms. Whereas EPR indicates that perthiyl radicals are formed, analysis does not detect any compound in which such bonds would be broken. Since EPR signals decay with time, it is concluded that rearrangements occur at subsequent steps, in which the solvent used during the analysis might play a role.

  6. Quantitative Analysis of the Enhanced Permeation and Retention (EPR Effect.

    Directory of Open Access Journals (Sweden)

    Andrew D Wong

    Full Text Available Tumor vasculature is characterized by a variety of abnormalities including irregular architecture, poor lymphatic drainage, and the upregulation of factors that increase the paracellular permeability. The increased permeability is important in mediating the uptake of an intravenously administered drug in a solid tumor and is known as the enhanced permeation and retention (EPR effect. Studies in animal models have demonstrated a cut-off size of 500 nm - 1 µm for molecules or nanoparticles to extravasate into a tumor, however, surprisingly little is known about the kinetics of the EPR effect. Here we present a pharmacokinetic model to quantitatively assess the influence of the EPR effect on the uptake of a drug into a solid tumor. We use pharmacokinetic data for Doxil and doxorubicin from human clinical trials to illustrate how the EPR effect influences tumor uptake. This model provides a quantitative framework to guide preclinical trials of new chemotherapies and ultimately to develop design rules that can increase targeting efficiency and decrease unwanted side effects in normal tissue.

  7. Uncertainty analysis for absorption and first-derivative EPR spectra

    Science.gov (United States)

    Tseitlin, Mark; Eaton, Sandra S.; Eaton, Gareth R.

    2015-01-01

    Electron paramagnetic resonance (EPR) experimental techniques produce absorption or first-derivative spectra. Uncertainty analysis provides the basis for comparison of spectra obtained by different methods. In this study it was used to derive analytical equations to relate uncertainties for integrated intensity and line widths obtained from absorption or first-derivative spectra to the signal-to-noise ratio (SNR), with the assumption of white noise. Predicted uncertainties for integrated intensities and line widths are in good agreement with Monte Carlo calculations for Lorentzian and Gaussian lineshapes. Conservative low-pass filtering changes the noise spectrum, which can be modeled in the Monte Carlo simulations. When noise is close to white, the analytical equations provide useful estimates of uncertainties. For example, for a Lorentzian line with white noise, the uncertainty in the number of spins obtained from the first-derivative spectrum is 2.6 times greater than from the absorption spectrum at the same SNR. Uncertainties in line widths obtained from absorption and first-derivative spectra are similar. The impact of integration or differentiation on SNR and on uncertainties in fitting parameters was analyzed. Although integration of the first-derivative spectrum improves the apparent smoothness of the spectrum, it also changes the frequency distribution of the noise. If the lineshape of the signal is known, the integrated intensity can be determined more accurately by fitting the first-derivative spectrum than by first integrating and then fitting the absorption spectrum. Uncertainties in integrated intensities and line widths are less when the parameters are determined from the original data than from spectra that have been either integrated or differentiated. PMID:25774102

  8. Uncertainty analysis for absorption and first-derivative EPR spectra.

    Science.gov (United States)

    Tseitlin, Mark; Eaton, Sandra S; Eaton, Gareth R

    2012-11-01

    Electron paramagnetic resonance (EPR) experimental techniques produce absorption or first-derivative spectra. Uncertainty analysis provides the basis for comparison of spectra obtained by different methods. In this study it was used to derive analytical equations to relate uncertainties for integrated intensity and line widths obtained from absorption or first-derivative spectra to the signal-to-noise ratio (SNR), with the assumption of white noise. Predicted uncertainties for integrated intensities and line widths are in good agreement with Monte Carlo calculations for Lorentzian and Gaussian lineshapes. Conservative low-pass filtering changes the noise spectrum, which can be modeled in the Monte Carlo simulations. When noise is close to white, the analytical equations provide useful estimates of uncertainties. For example, for a Lorentzian line with white noise, the uncertainty in the number of spins obtained from the first-derivative spectrum is 2.6 times greater than from the absorption spectrum at the same SNR. Uncertainties in line widths obtained from absorption and first-derivative spectra are similar. The impact of integration or differentiation on SNR and on uncertainties in fitting parameters was analyzed. Although integration of the first-derivative spectrum improves the apparent smoothness of the spectrum, it also changes the frequency distribution of the noise. If the lineshape of the signal is known, the integrated intensity can be determined more accurately by fitting the first-derivative spectrum than by first integrating and then fitting the absorption spectrum. Uncertainties in integrated intensities and line widths are less when the parameters are determined from the original data than from spectra that have been either integrated or differentiated.

  9. EPR analysis and DFT computations of a series of polynitroxides.

    Science.gov (United States)

    Ottaviani, M Francesca; Modelli, Alberto; Zeika, Olaf; Jockusch, Steffen; Moscatelli, Alberto; Turro, Nicholas J

    2012-01-12

    Polynitroxides with varying numbers of nitroxide groups (one to four) derived from different aromatic core structures show intramolecular electron spin-spin coupling. The scope of this study is to establish an easy methodology for extracting structural, dynamical, and thermodynamical information from the EPR spectra of these polynitroxides which might find use as spin probes in complex systems, such as biological and host/guest systems, and as polarizing agents in dynamic nuclear polarization (DNP) applications. Density functional theory (DFT) calculations at the B3LYP/6-31G(d) level provided information on the structural details such as bond lengths and angles in the gas phase, which were compared with the single crystal X-ray diffraction data in the solid state. Polarizable continuum model (PCM) calculations were performed to account for solvent influences. The electron paramagnetic resonance (EPR) spectra of the polynitroxides in chloroform were analyzed in detail to extract information such as the percentages of different conformers, hyperfine coupling constants a, and rotational correlation times τ(c). The temperature dependence on the line shape of the EPR spectra gave thermodynamic parameters ΔH and ΔS for the conformational transitions. These parameters were found to depend on the number and relative positions of the nitroxide and other polar groups.

  10. Frequency Reuse, Cell Separation, and Capacity Analysis of VHF Digital Link Mode 3 TDMA

    Science.gov (United States)

    Shamma, Mohammed A.; Nguyen, Thanh C.; Apaza, Rafael D.

    2003-01-01

    The most recent studies by the Federal Aviation Administration (FAA) and the aviation industry have indicated that it has become increasingly difficult to make new VHF frequency or channel assignments to meet the aviation needs for air-ground communications. FAA has planned for several aggressive improvement measures to the existing systems, but these measures would not meet the projected voice communications needs beyond 2009. FAA found that since 1974 there has been, on the average, a 4 percent annual increase in the number of channel assignments needed to satisfy the air-ground communication traffic (approximately 300 new channel assignments per year). With the planned improvement measures, the channel assignments are expected to reach a maximum number of 16615 channels by about 2010. Hence, the FAA proposed the use of VDL Mode 3 as a new integrated digital voice and data communications systems to meet the future air traffic demand. This paper presents analytical results of frequency reuse; cell separation and capacity estimation of VDL Mode 3 TDMA systems that FAA has planned to implement the future VHF air-ground communications system by the year 2010. For TDMA, it is well understood that the frequency reuse factor is a crucial parameter for capacity estimation. Formulation of this frequency reuse factor is shown, taking into account the limitation imposed by the requirement to have a sufficient Signal to Co-Channel Interference Ratio. Several different values for the Signal to Co-Channel Interference Ratio were utilized corresponding to the current analog VHF DSB-AM systems, and the future digital VDL Mode 3. The required separation of Co-Channel cells is computed for most of the Frequency Protected Service Volumes (FPSV's) currently in use by the FAA. Additionally, the ideal cell capacity for each FPSV is presented. Also, using actual traffic for the Detroit air space, a FPSV traffic distribution model is used to generate a typical cell for channel capacity

  11. Analysis of two-player quantum games in an EPR setting using Clifford's geometric algebra.

    Directory of Open Access Journals (Sweden)

    James M Chappell

    Full Text Available The framework for playing quantum games in an Einstein-Podolsky-Rosen (EPR type setting is investigated using the mathematical formalism of geometric algebra (GA. The main advantage of this framework is that the players' strategy sets remain identical to the ones in the classical mixed-strategy version of the game, and hence the quantum game becomes a proper extension of the classical game, avoiding a criticism of other quantum game frameworks. We produce a general solution for two-player games, and as examples, we analyze the games of Prisoners' Dilemma and Stag Hunt in the EPR setting. The use of GA allows a quantum-mechanical analysis without the use of complex numbers or the Dirac Bra-ket notation, and hence is more accessible to the non-physicist.

  12. Analysis of two-player quantum games in an EPR setting using Clifford's geometric algebra.

    Science.gov (United States)

    Chappell, James M; Iqbal, Azhar; Abbott, Derek

    2012-01-01

    The framework for playing quantum games in an Einstein-Podolsky-Rosen (EPR) type setting is investigated using the mathematical formalism of geometric algebra (GA). The main advantage of this framework is that the players' strategy sets remain identical to the ones in the classical mixed-strategy version of the game, and hence the quantum game becomes a proper extension of the classical game, avoiding a criticism of other quantum game frameworks. We produce a general solution for two-player games, and as examples, we analyze the games of Prisoners' Dilemma and Stag Hunt in the EPR setting. The use of GA allows a quantum-mechanical analysis without the use of complex numbers or the Dirac Bra-ket notation, and hence is more accessible to the non-physicist.

  13. A meteor head echo analysis algorithm for the lower VHF band

    Directory of Open Access Journals (Sweden)

    J. Kero

    2012-04-01

    Full Text Available We have developed an automated analysis scheme for meteor head echo observations by the 46.5 MHz Middle and Upper atmosphere (MU radar near Shigaraki, Japan (34.85° N, 136.10° E. The analysis procedure computes meteoroid range, velocity and deceleration as functions of time with unprecedented accuracy and precision. This is crucial for estimations of meteoroid mass and orbital parameters as well as investigations of the meteoroid-atmosphere interaction processes. In this paper we present this analysis procedure in detail. The algorithms use a combination of single-pulse-Doppler, time-of-flight and pulse-to-pulse phase correlation measurements to determine the radial velocity to within a few tens of metres per second with 3.12 ms time resolution. Equivalently, the precision improvement is at least a factor of 20 compared to previous single-pulse measurements. Such a precision reveals that the deceleration increases significantly during the intense part of a meteoroid's ablation process in the atmosphere. From each received pulse, the target range is determined to within a few tens of meters, or the order of a few hundredths of the 900 m long range gates. This is achieved by transmitting a 13-bit Barker code oversampled by a factor of two at reception and using a novel range interpolation technique. The meteoroid velocity vector is determined from the estimated radial velocity by carefully taking the location of the meteor target and the angle from its trajectory to the radar beam into account. The latter is determined from target range and bore axis offset. We have identified and solved the signal processing issue giving rise to the peculiar signature in signal to noise ratio plots reported by Galindo et al. (2011, and show how to use the range interpolation technique to differentiate the effect of signal processing from physical processes.

  14. Dicty_cDB: VHF264 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF264 (Link to dictyBase) - - - Contig-U16260-1 VHF264P (Link to Original site) VHF...264F 606 VHF264Z 693 VHF264P 1279 - - Show VHF264 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-C/VHF264Q.Seq.d/ Representative seq. ID VHF...264P (Link to Original site) Representative DNA sequence >VHF264 (VHF264Q) /CSM/VH/VHF2-C/VHF...DRRKNIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHFEMPKEDKLPAGCTS

  15. Dicty_cDB: VHF181 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF181 (Link to dictyBase) - - - Contig-U16260-1 VHF181P (Link to Original site) VHF...181F 610 VHF181Z 416 VHF181P 1006 - - Show VHF181 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-D/VHF181Q.Seq.d/ Representative seq. ID VHF...181P (Link to Original site) Representative DNA sequence >VHF181 (VHF181Q) /CSM/VH/VHF1-D/VHF...VKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKVSG DMRYMSCRADEQERGITIKSSSVSLHF

  16. Dicty_cDB: VHF777 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF777 (Link to dictyBase) - - - Contig-U16283-1 VHF777P (Link to Original site) VHF...777F 474 VHF777Z 669 VHF777P 1123 - - Show VHF777 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-D/VHF777Q.Seq.d/ Representative seq. ID VHF...777P (Link to Original site) Representative DNA sequence >VHF777 (VHF777Q) /CSM/VH/VHF7-D/VHF...PNIIGVEHYKVATDVQKILXRI*itsryychfryg*fi *rpksncipcs*dstflittirscprxhqygr*ir*tlrlyq

  17. Dicty_cDB: VHF354 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF354 (Link to dictyBase) - - - Contig-U16260-1 VHF354P (Link to Original site) VHF...354F 617 VHF354Z 721 VHF354P 1318 - - Show VHF354 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-C/VHF354Q.Seq.d/ Representative seq. ID VHF...354P (Link to Original site) Representative DNA sequence >VHF354 (VHF354Q) /CSM/VH/VHF3-C/VHF...no Acid sequence LSSAKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGD

  18. Dicty_cDB: VHF590 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF590 (Link to dictyBase) - - - Contig-U16306-1 VHF590P (Link to Original site) VHF...590F 115 VHF590Z 603 VHF590P 698 - - Show VHF590 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-D/VHF590Q.Seq.d/ Representative seq. ID VHF...590P (Link to Original site) Representative DNA sequence >VHF590 (VHF590Q) /CSM/VH/VHF5-D/VHF5...qlphvlrqlk*sqnfhkkylkkvqeqqq--- ---rwifhrwccfqsthdamyflyqxfgslsw*snlxrpkist*xfyhifghfw*rls*l ss*ipi*lqkwysyv

  19. Dicty_cDB: VHF536 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF536 (Link to dictyBase) - - - Contig-U16531-1 VHF536P (Link to Original site) VHF...536F 255 VHF536Z 685 VHF536P 920 - - Show VHF536 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-B/VHF536Q.Seq.d/ Representative seq. ID VHF...536P (Link to Original site) Representative DNA sequence >VHF536 (VHF536Q) /CSM/VH/VHF5-B/VHF5...ti*mlhliskvmtvh*mslslfyggyfl*lsi*llwnysig qvvvcliksikxerllkstmt--- ---*erlcl*ilxlvsichf

  20. Dicty_cDB: VHF730 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF730 (Link to dictyBase) - - - Contig-U15767-1 VHF730P (Link to Original site) VHF...730F 569 VHF730Z 718 VHF730P 1267 - - Show VHF730 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-B/VHF730Q.Seq.d/ Representative seq. ID VHF...730P (Link to Original site) Representative DNA sequence >VHF730 (VHF730Q) /CSM/VH/VHF7-B/VHF...QEKRIPVLNSMDANDSINKKA RISWPDGFKYFFVDNQAGDSESAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQXFN DVSYPV--- ---lhvvvvkxvhtlpvnvnqivhf

  1. Dicty_cDB: VHF649 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF649 (Link to dictyBase) - - - Contig-U11031-1 VHF649P (Link to Original site) VHF...649F 562 VHF649Z 671 VHF649P 1213 - - Show VHF649 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF6-C/VHF649Q.Seq.d/ Representative seq. ID VHF...649P (Link to Original site) Representative DNA sequence >VHF649 (VHF649Q) /CSM/VH/VHF6-C/VHF...PNTPPTIKIELPSQSILKPSGQLKK*x* Translated Amino Acid sequence (All Frames) Frame A: i*qlvchlsivlfhhqviyphvlklekhf

  2. Dicty_cDB: VHF527 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF527 (Link to dictyBase) - - - Contig-U16260-1 VHF527P (Link to Original site) VHF...527F 571 VHF527Z 456 VHF527P 1007 - - Show VHF527 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-B/VHF527Q.Seq.d/ Representative seq. ID VHF...527P (Link to Original site) Representative DNA sequence >VHF527 (VHF527Q) /CSM/VH/VHF5-B/VHF...AKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQXRGITIKSSSVSLHF

  3. Dicty_cDB: VHF294 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF294 (Link to dictyBase) - - - Contig-U16441-1 VHF294P (Link to Original site) VHF...294F 573 VHF294Z 215 VHF294P 768 - - Show VHF294 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-D/VHF294Q.Seq.d/ Representative seq. ID VHF...294P (Link to Original site) Representative DNA sequence >VHF294 (VHF294Q) /CSM/VH/VHF2-D/VHF2...ssfst*scisfttfry*gfsdctfr*fhfn**RFWFNMEQCII QWVMFYS--- ---DCHVSIKKFFKWWQRLDRWCCXXXSCXXXSWWFWFPTFLRIQISNXXY*k

  4. Dicty_cDB: VHF690 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF690 (Link to dictyBase) - - - Contig-U11064-1 VHF690P (Link to Original site) VHF...690F 199 VHF690Z 419 VHF690P 598 - - Show VHF690 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF6-D/VHF690Q.Seq.d/ Representative seq. ID VHF...690P (Link to Original site) Representative DNA sequence >VHF690 (VHF690Q) /CSM/VH/VHF6-D/VHF6...vllksqsknqyl*hlikslidfinif*hgmhqiyhqrkkn*nq *k--- ---rrwfpr*rernhhfqlc*sts*rgcryw

  5. Dicty_cDB: VHF273 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF273 (Link to dictyBase) - - - Contig-U11514-1 VHF273P (Link to Original site) VHF...273F 644 VHF273Z 678 VHF273P 1302 - - Show VHF273 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-D/VHF273Q.Seq.d/ Representative seq. ID VHF...273P (Link to Original site) Representative DNA sequence >VHF273 (VHF273Q) /CSM/VH/VHF2-D/VHF...ctr*ccnvkdwchyssrl*syrs*ts*nrsifidr*iftsh*kdw**s llwfsnetr*skmcchcnwckhflwscckfstrnrrtwssssys*kywslly*fhrhlg

  6. Dicty_cDB: VHF243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF243 (Link to dictyBase) - - - Contig-U16423-1 VHF243P (Link to Original site) VHF...243F 580 VHF243Z 334 VHF243P 894 - - Show VHF243 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-B/VHF243Q.Seq.d/ Representative seq. ID VHF...243P (Link to Original site) Representative DNA sequence >VHF243 (VHF243Q) /CSM/VH/VHF2-B/VHF2...AATCNAGATATTCCAGATTGGTTTGAAAAGATGG TACA sequence update 2002.10.25 Translated Amino Acid sequence ifihadkff*RISHF

  7. Dicty_cDB: VHF134 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF134 (Link to dictyBase) - - - Contig-U16260-1 VHF134P (Link to Original site) VHF...134F 533 VHF134Z 404 VHF134P 917 - - Show VHF134 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-B/VHF134Q.Seq.d/ Representative seq. ID VHF...134P (Link to Original site) Representative DNA sequence >VHF134 (VHF134Q) /CSM/VH/VHF1-B/VHF1...cid sequence LSSAKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHFEMPKE

  8. Dicty_cDB: VHF892 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF892 (Link to dictyBase) - - - Contig-U16260-1 VHF892P (Link to Original site) VHF...892F 140 VHF892Z 417 VHF892P 537 - - Show VHF892 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF8-D/VHF892Q.Seq.d/ Representative seq. ID VHF...892P (Link to Original site) Representative DNA sequence >VHF892 (VHF892Q) /CSM/VH/VHF8-D/VHF8... Translated Amino Acid sequence TIKSSSVSLHFEMPXEDKLPAGCTSHEFLINLIDSPSHVDFS--- ---ELTASPNILEPIYLVEITAPENAIGGI

  9. Dicty_cDB: VHF479 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF479 (Link to dictyBase) - - - Contig-U11426-1 VHF479P (Link to Original site) VHF...479F 629 VHF479Z 691 VHF479P 1300 - - Show VHF479 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF4-D/VHF479Q.Seq.d/ Representative seq. ID VHF...479P (Link to Original site) Representative DNA sequence >VHF479 (VHF479Q) /CSM/VH/VHF4-D/VHF...EKNPQEWRWSGGFFVDSISDYVVKSRNTERPDHDSLLF HVNIKEKQGTHFIRIPLSSKESPPYIIQNDTQFKISFFQRDSPENIDYIEPKEKLCYGWD EPSAEYVL

  10. Dicty_cDB: VHF754 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF754 (Link to dictyBase) - - - Contig-U16531-1 VHF754P (Link to Original site) VHF...754F 526 VHF754Z 624 VHF754P 1130 - - Show VHF754 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-C/VHF754Q.Seq.d/ Representative seq. ID VHF...754P (Link to Original site) Representative DNA sequence >VHF754 (VHF754Q) /CSM/VH/VHF7-C/VHF...ixnkmqwlkmlqvk*killk*ekvvslgiiftipf--- ---flvsichfnchc*itfccsrwnnlxllxfldsryllqw*

  11. Dicty_cDB: VHF461 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF461 (Link to dictyBase) - - - Contig-U11551-1 VHF461P (Link to Original site) VHF...461F 646 VHF461Z 261 VHF461P 887 - - Show VHF461 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF4-C/VHF461Q.Seq.d/ Representative seq. ID VHF...461P (Link to Original site) Representative DNA sequence >VHF461 (VHF461Q) /CSM/VH/VHF4-C/VHF4...TTAAATTATTAAAAATAGTAAATAAAAAAAA sequence update 2002.10.25 Translated Amino Acid sequence fyfifenfkthfhiiffl

  12. Dicty_cDB: VHF781 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF781 (Link to dictyBase) - - - Contig-U16440-1 VHF781P (Link to Original site) VHF...781F 452 VHF781Z 680 VHF781P 1112 - - Show VHF781 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-D/VHF781Q.Seq.d/ Representative seq. ID VHF...781P (Link to Original site) Representative DNA sequence >VHF781 (VHF781Q) /CSM/VH/VHF7-D/VHF...vlkmmmlkf*xixftr*r Frame C: glldinkleeiik*rfhlfylfl*rlllayhfhkilfqlisktaligsnfnhyiqikmim y*l*iqdqrmf*kdqqmvv

  13. Dicty_cDB: VHF435 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF435 (Link to dictyBase) - - - Contig-U16260-1 VHF435P (Link to Original site) VHF...435F 616 VHF435Z 703 VHF435P 1299 - - Show VHF435 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF4-B/VHF435Q.Seq.d/ Representative seq. ID VHF...435P (Link to Original site) Representative DNA sequence >VHF435 (VHF435Q) /CSM/VH/VHF4-B/VHF...AKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHF

  14. Dicty_cDB: VHF553 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF553 (Link to dictyBase) - - - Contig-U16433-1 VHF553P (Link to Original site) VHF...553F 122 VHF553Z 533 VHF553P 635 - - Show VHF553 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-C/VHF553Q.Seq.d/ Representative seq. ID VHF...553P (Link to Original site) Representative DNA sequence >VHF553 (VHF553Q) /CSM/VH/VHF5-C/VHF5...ed Amino Acid sequence syhfylfiy*IIIYLLNYYLLSCVNYLPINFNILYIY--- ---YVINLTLDGDNVNGFPKTVTVKPAPSXEQXYAEGEGLVKVF

  15. Dicty_cDB: VHF163 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF163 (Link to dictyBase) - - - Contig-U11129-1 VHF163P (Link to Original site) VHF1...63F 611 VHF163Z 654 VHF163P 1245 - - Show VHF163 Library VH (Link to library) Clone ID VHF1...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-C/VHF163Q.Seq.d/ Representative seq. ID VHF1...63P (Link to Original site) Representative DNA sequence >VHF163 (VHF163Q) /CSM/VH/VHF1-C/VHF1...nt alignments: (bits) Value VHF163 (VHF163Q) /CSM/VH/VHF1-C/VHF163Q.Seq.d/ 2357 0.0 VHM584 (VHM584Q) /CSM/VH

  16. Dicty_cDB: VHF444 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (Link to library) VHF444 (Link to dictyBase) - G20601 DDB0204337 Contig-U12392-1 VHF444P (Link to Original...site) VHF444F 579 VHF444Z 213 VHF444P 772 - - Show VHF444 Library VH (Link to library) Clone ID VHF444 (Link...tsukuba.ac.jp/CSM/VH/VHF4-B/VHF444Q.Seq.d/ Representative seq. ID VHF444P (Link to Original site) Representative...Representative DNA sequence >VHF444 (VHF444Q) /CSM/VH/VHF4-B/VHF444Q.Seq.d/ CAAAAGAAATAAATAATTATGCCATCA...significant alignments: (bits) Value VHF444 (VHF444Q) /CSM/VH/VHF4-B/VHF444Q.Seq.d/ 1479 0.0 VHA836 (VHA836Q)

  17. Dicty_cDB: VHF338 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF338 (Link to dictyBase) - - - Contig-U14303-1 VHF338P (Link to Original site) VHF3...38F 208 VHF338Z 685 VHF338P 873 - - Show VHF338 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF338Q.Seq.d/ Representative seq. ID VHF3...38P (Link to Original site) Representative DNA sequence >VHF338 (VHF338Q) /CSM/VH/VHF3-B/VHF3...significant alignments: (bits) Value VHF338 (VHF338Q) /CSM/VH/VHF3-B/VHF338Q.Seq.d/ 1296 0.0 VHK267 (VHK267Q

  18. Dicty_cDB: VHF394 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF394 (Link to dictyBase) - - - Contig-U16260-1 VHF394P (Link to Original site) VHF3...94F 563 VHF394Z 417 VHF394P 960 - - Show VHF394 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-D/VHF394Q.Seq.d/ Representative seq. ID VHF3...94P (Link to Original site) Representative DNA sequence >VHF394 (VHF394Q) /CSM/VH/VHF3-D/VHF3...nt alignments: (bits) Value VHF394 (VHF394Q) /CSM/VH/VHF3-D/VHF394Q.Seq.d/ 1776 0

  19. Dicty_cDB: VHF340 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF340 (Link to dictyBase) - - - Contig-U11939-1 VHF340P (Link to Original site) VHF3...40F 113 VHF340Z 506 VHF340P 599 - - Show VHF340 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF340Q.Seq.d/ Representative seq. ID VHF3...40P (Link to Original site) Representative DNA sequence >VHF340 (VHF340Q) /CSM/VH/VHF3-B/VHF3...Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF340 (VHF340Q) /CSM/VH/VHF3-B/VHF3

  20. Dicty_cDB: VHF329 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF329 (Link to dictyBase) - - - Contig-U16260-1 VHF329P (Link to Original site) VHF3...29F 618 VHF329Z 633 VHF329P 1231 - - Show VHF329 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF329Q.Seq.d/ Representative seq. ID VHF3...29P (Link to Original site) Representative DNA sequence >VHF329 (VHF329Q) /CSM/VH/VHF3-B/VHF3...s CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF329 (VHF329Q) /CSM/VH/VHF3

  1. An ambiguity-function-based method for analysis of Doppler decompressed radar signals applied to EISCAT measurements of oblique UHF-VHF meteor echoes

    Science.gov (United States)

    Wannberg, G.; Pellinen-Wannberg, A.; Westman, A.

    1996-05-01

    Binary phase modulation using Barker codes as the modulating sequences is often used as a pulse compression technique in incoherent scatter radar measurements of the ionospheric E region. Demodulation of the compressed signal is usually accomplished by matched filtering techniques. If the target has appreciable velocity, the resulting Doppler shift detunes the scattered signal relative to the filter, and the target response spreads over a large range interval. The paper describes the development of a new data analysis method, based on an ambiguity function description of radar total-power measurements, which uses the characteristic Doppler decompression signatures to identify, extract, and analyze high-velocity events from conventional Barker-coded power profile type incoherent scatter (IS) measurements. Data sets recorded with the European Incoherent Scatter UHF (931 MHz) and VHF (224 MHz) radars during the 1990-1991 Geminid and 1993 Perseid showers are shown to contain many events which are associated with individual meteors crossing the radar beams over a wide range of aspect angles, including a few near-radial cases. Line-of-sight velocities and effective cross sections are derived for some of the best dual radar events. The cross sections are very small and increase with decreasing wavelength, something not observed before. It is suggested that this is indicative of a scattering mechanism different from the one operating at near-normal incidence at VHF, and Rayleigh scatter from compact "balls" of plasma contained within the meteor coma is proposed as a possible candidate, in qualitative agreement with the observations. Finally, some signal-processing related aspects of the method are discussed. It is shown that most IS radars should be able to apply it to their existing programs with very little effort and without having to compromise the performance in normal E region applications. The method could therefore become a powerful tool for studies of meteor

  2. Searching for biosignatures using electron paramagnetic resonance (EPR) analysis of manganese oxides.

    Science.gov (United States)

    Kim, Soon Sam; Bargar, John R; Nealson, Kenneth H; Flood, Beverly E; Kirschvink, Joseph L; Raub, Timothy D; Tebo, Bradley M; Villalobos, Mario

    2011-10-01

    Manganese oxide (Mn oxide) minerals from bacterial sources produce electron paramagnetic resonance (EPR) spectral signatures that are mostly distinct from those of synthetic simulants and abiogenic mineral Mn oxides. Biogenic Mn oxides exhibit only narrow EPR spectral linewidths (∼500 G), whereas abiogenic Mn oxides produce spectral linewidths that are 2-6 times broader and range from 1200 to 3000 G. This distinction is consistent with X-ray structural observations that biogenic Mn oxides have abundant layer site vacancies and edge terminations and are mostly of single ionic species [i.e., Mn(IV)], all of which favor narrow EPR linewidths. In contrast, abiogenic Mn oxides have fewer lattice vacancies, larger particle sizes, and mixed ionic species [Mn(III) and Mn(IV)], which lead to the broader linewidths. These properties could be utilized in the search for extraterrestrial physicochemical biosignatures, for example, on Mars missions that include a miniature version of an EPR spectrometer.

  3. Biomolecular EPR spectroscopy

    CERN Document Server

    Hagen, Wilfred Raymond

    2008-01-01

    Comprehensive, Up-to-Date Coverage of Spectroscopy Theory and its Applications to Biological SystemsAlthough a multitude of books have been published about spectroscopy, most of them only occasionally refer to biological systems and the specific problems of biomolecular EPR (bioEPR). Biomolecular EPR Spectroscopy provides a practical introduction to bioEPR and demonstrates how this remarkable tool allows researchers to delve into the structural, functional, and analytical analysis of paramagnetic molecules found in the biochemistry of all species on the planet. A Must-Have Reference in an Intrinsically Multidisciplinary FieldThis authoritative reference seamlessly covers all important bioEPR applications, including low-spin and high-spin metalloproteins, spin traps and spin lables, interaction between active sites, and redox systems. It is loaded with practical tricks as well as do's and don'ts that are based on the author's 30 years of experience in the field. The book also comes with an unprecedented set of...

  4. Dicty_cDB: VHF187 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF187 (Link to dictyBase) - - - Contig-U16363-1 VHF187P (Link to Original site) VHF1...87F 549 VHF187Z 707 VHF187P 1236 - - Show VHF187 Library VH (Link to library) Clone ID VHF1...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-D/VHF187Q.Seq.d/ Representative seq. ID VHF1...87P (Link to Original site) Representative DNA sequence >VHF187 (VHF187Q) /CSM/VH/VHF1-D/VHF1...* Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF187 (VHF1

  5. Dicty_cDB: VHF368 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF368 (Link to dictyBase) - - - Contig-U12673-1 VHF368P (Link to Original site) VHF3...68F 597 VHF368Z 746 VHF368P 1323 - - Show VHF368 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-C/VHF368Q.Seq.d/ Representative seq. ID VHF3...68P (Link to Original site) Representative DNA sequence >VHF368 (VHF368Q) /CSM/VH/VHF3-C/VHF3...ikfpknkii*nki k*nkiky Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF368 (VHF3

  6. Dicty_cDB: VHF348 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF348 (Link to dictyBase) - - - Contig-U13926-1 VHF348P (Link to Original site) VHF3...48F 539 VHF348Z 473 VHF348P 992 - - Show VHF348 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF348Q.Seq.d/ Representative seq. ID VHF3...48P (Link to Original site) Representative DNA sequence >VHF348 (VHF348Q) /CSM/VH/VHF3-B/VHF3...ksxvlmliltck Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF3

  7. Dicty_cDB: VHF312 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF312 (Link to dictyBase) - - - Contig-U15897-1 VHF312P (Link to Original site) VHF3...12F 543 VHF312Z 483 VHF312P 1006 - - Show VHF312 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF312Q.Seq.d/ Representative seq. ID VHF3...12P (Link to Original site) Representative DNA sequence >VHF312 (VHF312Q) /CSM/VH/VHF3-A/VHF3... 4.0 %: extracellular, including cell wall 4.0 %: plasma membrane 4.0 %: peroxisomal >> prediction for VHF31

  8. Dicty_cDB: VHF375 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF375 (Link to dictyBase) - - - Contig-U16260-1 VHF375P (Link to Original site) VHF3...75F 432 VHF375Z 670 VHF375P 1082 - - Show VHF375 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-D/VHF375Q.Seq.d/ Representative seq. ID VHF3...75P (Link to Original site) Representative DNA sequence >VHF375 (VHF375Q) /CSM/VH/VHF3-D/VHF3...pperekv*pqksqiltnstknskqfkshxsfqr*xsnlkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF3

  9. Arctic and Antarctic polar mesosphere summer echoes observed with oblique incidence HF radars: analysis using simultaneous MF and VHF radar data

    Directory of Open Access Journals (Sweden)

    T. Ogawa

    2004-12-01

    Full Text Available Polar mesosphere summer echoes (PMSEs have been well studied using vertical incidence VHF radars at northern high-latitudes. In this paper, two PMSE events detected with the oblique incidence SuperDARN HF radars at Hankasalmi, Finland (62.3° N and Syowa Station, Antarctica (69.0° S, are analyzed, together with simultaneous VHF and medium-frequency (MF radar data. Altitude resolutions of the HF radars in the mesosphere and the lower thermosphere are too poor to know exact PMSE altitudes. However, a comparison of Doppler velocity from the HF radar and neutral wind velocity from the MF radar shows that PMSEs at the HF band appeared at altitudes within 80-90km, which are consistent with those from previous vertical incidence HF-VHF radar results. The HF-VHF PMSE occurrences exhibit a semidiurnal behavior, as observed by other researchers. It is found that in one event, PMSEs occurred when westward semidiurnal winds with large amplitude at 85-88km altitudes attained a maximum. When the HF-VHF PMSEs were observed at distances beyond 180km from MF radar sites, the MF radars detected no appreciable signatures of echo enhancement. Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; thermospheric dynamics; waves and tides

  10. Arctic and Antarctic polar mesosphere summer echoes observed with oblique incidence HF radars: analysis using simultaneous MF and VHF radar data

    Directory of Open Access Journals (Sweden)

    T. Ogawa

    2004-12-01

    Full Text Available Polar mesosphere summer echoes (PMSEs have been well studied using vertical incidence VHF radars at northern high-latitudes. In this paper, two PMSE events detected with the oblique incidence SuperDARN HF radars at Hankasalmi, Finland (62.3° N and Syowa Station, Antarctica (69.0° S, are analyzed, together with simultaneous VHF and medium-frequency (MF radar data. Altitude resolutions of the HF radars in the mesosphere and the lower thermosphere are too poor to know exact PMSE altitudes. However, a comparison of Doppler velocity from the HF radar and neutral wind velocity from the MF radar shows that PMSEs at the HF band appeared at altitudes within 80-90km, which are consistent with those from previous vertical incidence HF-VHF radar results. The HF-VHF PMSE occurrences exhibit a semidiurnal behavior, as observed by other researchers. It is found that in one event, PMSEs occurred when westward semidiurnal winds with large amplitude at 85-88km altitudes attained a maximum. When the HF-VHF PMSEs were observed at distances beyond 180km from MF radar sites, the MF radars detected no appreciable signatures of echo enhancement.

    Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; thermospheric dynamics; waves and tides

  11. Dicty_cDB: VHF190 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available F0-ATPase putative regulatory protein IF1 (if1) mRNA, complete cds; nuclear gene for mitochondrial produc...VH (Link to library) VHF190 (Link to dictyBase) - - - Contig-U12594-1 - (Link to Original site) VHF1...90F 581 - - - - - - Show VHF190 Library VH (Link to library) Clone ID VHF190 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF1-D/VHF190Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF190 (VHF190Q) /CSM/VH/VHF1-D/VHF190Q.Seq.d/ ATTTTTCATTTTAAAAA

  12. Dicty_cDB: VHF331 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF331 (Link to dictyBase) - - - - - (Link to Original site) VHF3...31F 609 - - - - - - Show VHF331 Library VH (Link to library) Clone ID VHF331 (Link to dictyBase) Atlas ID... - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF3...31Q.Seq.d/ Representative seq. ID - (Link to Original site) Representative DNA sequence >VHF3...31 (VHF331Q) /CSM/VH/VHF3-B/VHF331Q.Seq.d/ AACTCTCGAGTGCAAAAAAAGTAAAGTACAAAATGGTTAATTTCA

  13. Dicty_cDB: VHF709 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF709 (Link to dictyBase) - - - Contig-U15897-1 - (Link to Original site) - - VHF...709Z 602 - - - - Show VHF709 Library VH (Link to library) Clone ID VHF709 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF7-A/VHF709Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF709 (VHF709Q) /CSM/VH/VHF7-A/VHF709Q.Seq.d/ XXXXXXXXXXCGTCCAA...vestir Frame B: ---sknfttrsrlqlccsfnglxpr**rw*tnrqhyhg*cksiwsssfnlsryyw*yrcs ilpqiq*kwchhsnlpiw*wsflyhf

  14. Dicty_cDB: VHF236 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF236 (Link to dictyBase) - - - Contig-U14303-1 - (Link to Original site) - - VHF...236Z 611 - - - - Show VHF236 Library VH (Link to library) Clone ID VHF236 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF2-B/VHF236Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF236 (VHF236Q) /CSM/VH/VHF2-B/VHF236Q.Seq.d/ XXXXXXXXXXTGCCATT...VQKISQELKHLT*tfvsylvlk Frame B: ---plvicc*ninvlhfveilsxhglay*xhcfplvlv*fqilsrmiqs

  15. Dicty_cDB: VHF140 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF140 (Link to dictyBase) - - - Contig-U15309-1 - (Link to Original site) - - VHF...140Z 518 - - - - Show VHF140 Library VH (Link to library) Clone ID VHF140 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF1-B/VHF140Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF140 (VHF140Q) /CSM/VH/VHF1-B/VHF140Q.Seq.d/ XXXXXXXXXXCCGATAA...EDYINMQIKQLENSENSQELIQKLNEHLSEYKASVEEIKHNVQNN Frame C: ---iixvtlmlflqngilhfigviil

  16. Dicty_cDB: VHF507 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF507 (Link to dictyBase) - - - Contig-U11594-1 - (Link to Original site) - - VHF...507Z 541 - - - - Show VHF507 Library VH (Link to library) Clone ID VHF507 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF5-A/VHF507Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF507 (VHF507Q) /CSM/VH/VHF5-A/VHF507Q.Seq.d/ XXXXXXXXXXTACCAAT...nvhsmiwihvglxlvigx*sncfvttsfikst mmvllcstftmllkpsixwivvsmkkyf*clemnxhfw*sviki*knv

  17. Dicty_cDB: VHF321 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF321 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) VHF...321F 617 - - - - - - Show VHF321 Library VH (Link to library) Clone ID VHF321 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF321Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF321 (VHF321Q) /CSM/VH/VHF3-A/VHF321Q.Seq.d/ AACTCTCGAGTGCAAAA...VIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHFEMPKEDKLPAGCTSHEFLINLIDSPGHVDFS SEVTAALRVTDGALVVIDC

  18. Dicty_cDB: VHF866 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF866 (Link to dictyBase) - - - Contig-U16600-1 - (Link to Original site) - - VHF...866Z 388 - - - - Show VHF866 Library VH (Link to library) Clone ID VHF866 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF8-C/VHF866Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF866 (VHF866Q) /CSM/VH/VHF8-C/VHF866Q.Seq.d/ XXXXXXXXXXAAGCAGC...Frame C: ---qhnnifklafptiknftgvpmxfvmtnegdnlgnftvkthfakffstyyscgeaghh yfdsccn*y*qkqgckfhs*h*xkssrr*lcfxqnwfi

  19. Dicty_cDB: VHF155 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF155 (Link to dictyBase) - - - - VHF155P (Link to Original site) VHF155F 587 VHF1...55Z 643 VHF155P 1210 - - Show VHF155 Library VH (Link to library) Clone ID VHF155 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1...-C/VHF155Q.Seq.d/ Representative seq. ID VHF155P (Link to... Original site) Representative DNA sequence >VHF155 (VHF155Q) /CSM/VH/VHF1-C/VHF155Q.Seq.d/ ATTCTCGATACTGGAA

  20. Dicty_cDB: VHF392 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF392 (Link to dictyBase) - - - - VHF392P (Link to Original site) VHF392F 568 VHF3...92Z 375 VHF392P 923 - - Show VHF392 Library VH (Link to library) Clone ID VHF392 (Link ...to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3...-D/VHF392Q.Seq.d/ Representative seq. ID VHF392P (Link to ...Original site) Representative DNA sequence >VHF392 (VHF392Q) /CSM/VH/VHF3-D/VHF392Q.Seq.d/ AACTCTCGAGTGCAAAA

  1. Dicty_cDB: VHF366 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF366 (Link to dictyBase) - - - Contig-U12131-1 | Contig-U13633-1 VHF3...66P (Link to Original site) VHF366F 590 VHF366Z 544 VHF366P 1114 - - Show VHF366 Library VH (Link to library) Clone ID VHF3...131-1 | Contig-U13633-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-C/VHF3...66Q.Seq.d/ Representative seq. ID VHF366P (Link to Original site) Representative DNA sequence >VHF366 (VHF3...66Q) /CSM/VH/VHF3-C/VHF366Q.Seq.d/ AATAATTTATTATTATTATTAATAAGTAATAGAAATAAAAGATGGAACCAATTCCAGATA

  2. Dicty_cDB: VHF310 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF310 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) - - VHF3...10Z 625 - - - - Show VHF310 Library VH (Link to library) Clone ID VHF310 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF310Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF310 (VHF310Q) /CSM/VH/VHF3-A/VHF310Q.Seq.d/ XXXXXXXXXXTCGTCAA...omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF310 (VHF310Q) /CSM/VH/VHF3-A/VHF3

  3. Dicty_cDB: VHF315 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF315 (Link to dictyBase) - G20600 DDB0169270 Contig-U12450-1 VHF3...15P (Link to Original site) VHF315F 216 VHF315Z 353 VHF315P 549 - - Show VHF315 Library VH (Link to library) Clone ID VHF3...ontig-U12450-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF3...15Q.Seq.d/ Representative seq. ID VHF315P (Link to Original site) Representative DNA sequence >VHF315 (VHF315Q) /CSM/VH/VHF3...-A/VHF315Q.Seq.d/ ATTAAAAAACTTCTTACTTGGACACCCCTTTTATATATATAAATAAAAACTTCTAAATAT AAATCCCA

  4. Dicty_cDB: VHF381 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF381 (Link to dictyBase) - - - Contig-U16508-1 - (Link to Original site) - - VHF3...81Z 645 - - - - Show VHF381 Library VH (Link to library) Clone ID VHF381 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF3-D/VHF381Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF381 (VHF381Q) /CSM/VH/VHF3-D/VHF381Q.Seq.d/ XXXXXXXXXXCAACCAA...ignments: (bits) Value VHF381 (VHF381Q) /CSM/VH/VHF3-D/VHF381Q.Seq.d/ 1223 0.0 VHP767 (VHP767Q) /CSM/VH/VHP7

  5. Dicty_cDB: VHF210 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF210 (Link to dictyBase) - - - Contig-U12400-1 | Contig-U16431-1 VHF...210P (Link to Original site) VHF210F 613 VHF210Z 636 VHF210P 1229 - - Show VHF210 Library VH (Link to library) Clone ID VHF...400-1 | Contig-U16431-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-A/VHF...210Q.Seq.d/ Representative seq. ID VHF210P (Link to Original site) Representative DNA sequence >VHF210 (VHF...210Q) /CSM/VH/VHF2-A/VHF210Q.Seq.d/ AATAAAATGATAAGATCATCAATAAAAAATAAAATAACAACAACAAAAAGTTTATCATGT

  6. Dicty_cDB: VHF575 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF575 (Link to dictyBase) - - - Contig-U15481-1 | Contig-U15981-1 VHF...575P (Link to Original site) VHF575F 586 VHF575Z 397 VHF575P 963 - - Show VHF575 Library VH (Link to library) Clone ID VHF...81-1 | Contig-U15981-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-D/VHF...575Q.Seq.d/ Representative seq. ID VHF575P (Link to Original site) Representative DNA sequence >VHF575 (VHF...575Q) /CSM/VH/VHF5-D/VHF575Q.Seq.d/ ATAATAATACAAAGAAGAAATGAAAAATATAAATAATAAAATTTTAAAGATTTTTATTCT

  7. Dicty_cDB: VHF296 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF296 (Link to dictyBase) - G23392 DDB0187414 Contig-U12449-1 VHF...296P (Link to Original site) VHF296F 241 VHF296Z 482 VHF296P 703 - - Show VHF296 Library VH (Link to library) Clone ID VHF...ontig-U12449-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-D/VHF...296Q.Seq.d/ Representative seq. ID VHF296P (Link to Original site) Representative DNA sequence >VHF296 (VHF296Q) /CSM/VH/VHF...2-D/VHF296Q.Seq.d/ GATTATCAGAAAGATTACATTATGAAATTATACCAGATTGTATTAAAATTATTGAAAGCT CAAAACAA

  8. Dicty_cDB: VHF436 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF436 (Link to dictyBase) - - - - VHF436P (Link to Original site) VHF436F 618 VHF...436Z 699 VHF436P 1297 - - Show VHF436 Library VH (Link to library) Clone ID VHF436 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF...4-B/VHF436Q.Seq.d/ Representative seq. ID VHF436P (Link to... Original site) Representative DNA sequence >VHF436 (VHF436Q) /CSM/VH/VHF4-B/VHF436Q.Seq.d/ AACTCTCGAGTGCAAA

  9. Dicty_cDB: VHF158 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF158 (Link to dictyBase) - - - - VHF158P (Link to Original site) VHF158F 608 VHF...158Z 693 VHF158P 1281 - - Show VHF158 Library VH (Link to library) Clone ID VHF158 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF...1-C/VHF158Q.Seq.d/ Representative seq. ID VHF158P (Link to... Original site) Representative DNA sequence >VHF158 (VHF158Q) /CSM/VH/VHF1-C/VHF158Q.Seq.d/ AACTCTCGAGTGCAAA

  10. Dicty_cDB: VHF847 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF847 (Link to dictyBase) - - - Contig-U15351-1 | Contig-U16514-1 VHF...847P (Link to Original site) VHF847F 478 VHF847Z 709 VHF847P 1167 - - Show VHF847 Library VH (Link to library) Clone ID VHF...351-1 | Contig-U16514-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF8-B/VHF...847Q.Seq.d/ Representative seq. ID VHF847P (Link to Original site) Representative DNA sequence >VHF847 (VHF...847Q) /CSM/VH/VHF8-B/VHF847Q.Seq.d/ TATGATGTTCCACTTATAATTCAAACGGTTGCCAATAATAAATCAACAAAACTCANTCTT

  11. Dicty_cDB: VHF272 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF272 (Link to dictyBase) - - - Contig-U15754-1 VHF272P (Link to Original site) VHF...272F 515 VHF272Z 603 VHF272P 1098 - - Show VHF272 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-C/VHF272Q.Seq.d/ Representative seq. ID VHF...272P (Link to Original site) Representative DNA sequence >VHF272 (VHF272Q) /CSM/VH/VHF2-C/VHF...id sequence (All Frames) Frame A: ixfssq**wnkkd*mihy*eiligrigvpm*vidngqlfvkimvvnhgptfhtimldhvh idgqrivlvdfvidfkifv*v*hf

  12. vhfRNAi: a web-platform for analysis of host genes involved in viral infections discovered by genome wide RNAi screens.

    Science.gov (United States)

    Thakur, Anamika; Qureshi, Abid; Kumar, Manoj

    2017-06-27

    Knockdown of host genes using high-throughput genome-wide RNA interference screens has identified numerous host factors that affect viral infections, which would be helpful in understanding host-virus interactions. We have developed a vhfRNAi web resource based on genome-wide RNAi experiments for viruses. It contains experimental details of 12 249 entries (host factors + restriction factors) for 18 viruses. Simultaneously, this resource encompasses analysis of overlapping genes, genome wide association studies, gene ontology (GO), pathogen interacting proteins, interaction networks and pathway enrichment. Using overlap analysis, it was found that Influenza A virus shared overlapping host genes with the majority of viruses including Hepatitis C virus and Dengue virus 2. In the genome wide association studies analysis, 429 diseases/traits were mapped, of which obesity-related traits were the most common. GO analysis revealed that the major categories belonged to metabolic processes, molecule transport, signal transduction, proteolysis, etc. In the pathogen interacting protein analysis, protein interaction data from different resources can be explored for further understanding of host-virus biology. By pathway enrichment analysis, a total of 8955 genes were mapped on 303 pathways with most of the hits coming from metabolic pathways. We have found 491 genes that are not essential for the host but essential for the virus and can be targeted to inhibit the virus. These may be explored as potential candidates for drug targets. The resource is freely accessible at and will be useful in understanding host-virus biology as well as identification of targets for the development of antiviral therapeutics.

  13. Characterisation of bhringaraj and guduchi herb by ICP-MS analysis, optical absorption, infrared and EPR spectroscopic methods

    Science.gov (United States)

    Reddy, S. Lakshmi; Fayazuddin, Md.; Reddy, N. C. G.; Ahmad, Adeel; Reddy, G. Siva; Rao, P. Sambasiva; Reddy, B. Jagannatha; Frost, R. L.

    2008-11-01

    Leaves of bhringaraj and guduchi herb of Kadapa district of Andhra Pradesh, India, are dried and powdered. ICP-MS analysis of samples indicates that copper is present in both the samples. An EPR study of guduchi sample also confirms the presence of Fe(III) whereas Eclipta alba confirms the presence of Fe(III), Mn(II) and Cu(II). Optical absorption spectrum of guduchi indicates that Cu(II) is present in rhombically distorted octahedral environment. NIR and IR results are due to carbonate fundamentals.

  14. Thermodynamic basis of electron transfer in dihydroorotate dehydrogenase B from Lactococcus lactis: analysis by potentiometry, EPR spectroscopy, and ENDOR spectroscopy.

    Science.gov (United States)

    Mohsen, Al-Walid A; Rigby, Stephen E J; Jensen, Kaj Frank; Munro, Andrew W; Scrutton, Nigel S

    2004-06-01

    Dihydroorotate dehydrogenase B (DHODB) is a complex iron-sulfur flavoprotein that catalyzes the conversion of dihydroorotate to orotate and the reduction of NAD(+). The enzyme is a dimer of heterodimers containing an FMN, an FAD, and a 2Fe-2S center. UV-visible, EPR, and ENDOR spectroscopies have been used to determine the reduction potentials of the flavins and the 2Fe-2S center and to characterize radicals and their interactions. Reductive titration using dithionite indicates a five-electron capacity for DHODB. The midpoint reduction potential of the 2Fe-2S center (-212 +/- 3 mV) was determined from analysis of absorption data at 540 nm, where absorption contributions from the two flavins are small. The midpoint reduction potentials of the oxidized/semiquinone (E(1)) and semiquinone/hydroquinone (E(2)) couples for the FMN (E(1) = -301 +/- 6 mV; E(2) = -252 +/- 8 mV) and FAD (E(1) = -312 +/- 6 mV; E(2) = -297 +/- 5 mV) were determined from analysis of spectral changes at 630 nm. Corresponding values for the midpoint reduction potentials for FMN (E(1) = -298 +/- 4 mV; E(2) = -259 +/- 5 mV) in the isolated catalytic subunit (subunit D, which lacks the 2Fe-2S center and FAD) are consistent with the values determined for the FMN couples in DHODB. During reductive titration of DHODB, small amounts of the neutral blue semiquinone are observed at approximately 630 nm, consistent with the measured midpoint reduction potentials of the flavins. An ENDOR spectrum of substrate-reduced DHODB identifies hyperfine couplings to proton nuclei similar to those recorded for the blue semiquinone of free flavins in aqueous solution, thus confirming the presence of this species in DHODB. Spectral features observed during EPR spectroscopy of dithionite-reduced DHODB are consistent with the midpoint reduction potentials determined using UV-visible spectroscopy and further identify an unusual EPR signal with very small rhombic anisotropy and g values of 2.02, 1.99, and 1.96. This unusual

  15. Analysis of various modifications in spectra analysis on accuracy of dose reconstructions in EPR dosimetry in tooth enamel

    Energy Technology Data Exchange (ETDEWEB)

    Ciesielski, B., E-mail: bciesiel@gumed.edu.pl [Department of Physics and Biophysics, Medical University of Gdansk, Debinki 1, 80-211 Gdansk (Poland); Kaminska, J. [Department of Oncology and Radiotherapy, Medical University of Gdansk, Debinki 7, 80-211 Gdansk (Poland); Emerich, K. [Department of Paediatric Dentistry, Medical University of Gdansk, Orzeszkowej 18, 80-208 Gdansk (Poland)

    2011-09-15

    The results of EPR measurements performed due to our participation in the 4th International Comparison of EPR Dosimetry using tooth enamel were used to analyze the effects of modifications in numerical analysis of the measured spectra on precision and accuracy of reconstructed doses. The studied modifications included effects of: (1) a use of Mn{sup 2+} standard, (2) variations in experimental native background signals of tooth enamel used for dose reconstructions, (3) signal filtration, (4) subtraction of empty tube spectra, and (5) variations in the spectra ranges used for calculations (fitting windows). It was shown, that the use of a Mn standard, for normalization of intensities of the recorded signals in the spectra processing, strongly increased the dosimetric accuracy. The regression lines of the doses reconstructed using different background spectra against nominal doses, obtained without Mn standard, had slopes about 30% higher and their scatter range was about 2 times higher than the same parameters obtained when Mn standard was applied in the spectra processing. Accuracy of the measured doses characterized by root mean square deviations from the nominal doses was 71 mGy for calculations with Mn standard and 241 mGy without normalization to Mn lines. Despite the large beneficial effect of the use of Mn standard on accuracy (root mean square deviations of the data, slope of the regression lines), it did not significantly improve the dosimetry performance characterized by the critical dose and detection limit. The smoothing of the spectra by 9 point filtration resulted in 1.6% increase of the reconstructed doses. The subtraction of empty tube spectrum had no effect on precision and accuracy of the dose reconstruction. The performance parameters were also practically insensitive to a choice of a width of the spectral window used for the analysis, provided it encompassed the {approx}1.6 mT range covering the main peaks of the radiation induced signal in

  16. Broadband transmission EPR spectroscopy.

    Directory of Open Access Journals (Sweden)

    Wilfred R Hagen

    Full Text Available EPR spectroscopy employs a resonator operating at a single microwave frequency and phase-sensitive detection using modulation of the magnetic field. The X-band spectrometer is the general standard with a frequency in the 9-10 GHz range. Most (biomolecular EPR spectra are determined by a combination of the frequency-dependent electronic Zeeman interaction and a number of frequency-independent interactions, notably, electron spin - nuclear spin interactions and electron spin - electron spin interactions, and unambiguous analysis requires data collection at different frequencies. Extant and long-standing practice is to use a different spectrometer for each frequency. We explore the alternative of replacing the narrow-band source plus single-mode resonator with a continuously tunable microwave source plus a non-resonant coaxial transmission cell in an unmodulated external field. Our source is an arbitrary wave digital signal generator producing an amplitude-modulated sinusoidal microwave in combination with a broadband amplifier for 0.8-2.7 GHz. Theory is developed for coaxial transmission with EPR detection as a function of cell dimensions and materials. We explore examples of a doublet system, a high-spin system, and an integer-spin system. Long, straigth, helical, and helico-toroidal cells are developed and tested with dilute aqueous solutions of spin label hydroxy-tempo. A detection limit of circa 5 µM HO-tempo in water at 800 MHz is obtained for the present setup, and possibilities for future improvement are discussed.

  17. Overview of LBB implementation for the EPR

    Energy Technology Data Exchange (ETDEWEB)

    Cauquelin, C.

    1997-04-01

    This paper presents an overview of the use of leak-before-break (LBB) analysis for EPR reactors. EPR is an evolutionary Nuclear Island of the 4 loop x 1500 Mwe class currently in the design phase. Application of LBB to the main coolant lines and resulting design impacts are summarized. Background information on LBB analysis in France and Germany is also presented.

  18. Broadband Transmission EPR Spectroscopy

    Science.gov (United States)

    Hagen, Wilfred R.

    2013-01-01

    EPR spectroscopy employs a resonator operating at a single microwave frequency and phase-sensitive detection using modulation of the magnetic field. The X-band spectrometer is the general standard with a frequency in the 9–10 GHz range. Most (bio)molecular EPR spectra are determined by a combination of the frequency-dependent electronic Zeeman interaction and a number of frequency-independent interactions, notably, electron spin – nuclear spin interactions and electron spin – electron spin interactions, and unambiguous analysis requires data collection at different frequencies. Extant and long-standing practice is to use a different spectrometer for each frequency. We explore the alternative of replacing the narrow-band source plus single-mode resonator with a continuously tunable microwave source plus a non-resonant coaxial transmission cell in an unmodulated external field. Our source is an arbitrary wave digital signal generator producing an amplitude-modulated sinusoidal microwave in combination with a broadband amplifier for 0.8–2.7 GHz. Theory is developed for coaxial transmission with EPR detection as a function of cell dimensions and materials. We explore examples of a doublet system, a high-spin system, and an integer-spin system. Long, straigth, helical, and helico-toroidal cells are developed and tested with dilute aqueous solutions of spin label hydroxy-tempo. A detection limit of circa 5 µM HO-tempo in water at 800 MHz is obtained for the present setup, and possibilities for future improvement are discussed. PMID:23555819

  19. 2D FTIR correlation spectroscopy and EPR analysis of Urtica dioica leaves from areas of different environmental pollution.

    Science.gov (United States)

    Moskal, Paulina; Wesełucha-Birczyńska, Aleksandra; Łabanowska, Maria; Kurdziel, Magdalena; Filek, Maria

    2018-01-15

    Leaves of Urtica dioica collected from two areas of different environmental pollution were analysed by fourier transform infrared spectroscopy (FTIR) and electron paramagnetic resonance (EPR) spectroscopy. Analysis of FTIR spectra allows to describe main component of plant like proteins, lipids and carbohydrates. Although the FTIR spectra of plants from these two geographical locations of different environmental pollution appear to be relatively similar, 2D correlation shows completely different patterns. Synchronous and asynchronous correlation maps showed sequences of changes occurring during development of plant, manly in Amide I and Amide II, lignin, lipids and cellulose. In addition, 2D analysis revealed another sequence of changes as the function of plant growth depending on the degree of the environmental pollution. Two various kinds of paramagnetic species, transition metal ions (Mn(II), Fe(III)) and stable organic radicals (chlorophyll, semiquinone, tyrosyl and carbon centered) were found in leaves of nettle collected at different stages of development and growing in clean and polluted environment. In plants growing in polluted area the injuries of protein molecules bonding metal ions and the disturbances of photosynthesis and redox equilibrium in cells, as well as instability of polysaccharide structure of cell walls were observed. Copyright © 2017 Elsevier B.V. All rights reserved.

  20. 2D FTIR correlation spectroscopy and EPR analysis of Urtica dioica leaves from areas of different environmental pollution

    Science.gov (United States)

    Moskal, Paulina; Wesełucha-Birczyńska, Aleksandra; Łabanowska, Maria; Kurdziel, Magdalena; Filek, Maria

    2018-01-01

    Leaves of Urtica dioica collected from two areas of different environmental pollution were analysed by fourier transform infrared spectroscopy (FTIR) and electron paramagnetic resonance (EPR) spectroscopy. Analysis of FTIR spectra allows to describe main component of plant like proteins, lipids and carbohydrates. Although the FTIR spectra of plants from these two geographical locations of different environmental pollution appear to be relatively similar, 2D correlation shows completely different patterns. Synchronous and asynchronous correlation maps showed sequences of changes occurring during development of plant, manly in Amide I and Amide II, lignin, lipids and cellulose. In addition, 2D analysis revealed another sequence of changes as the function of plant growth depending on the degree of the environmental pollution. Two various kinds of paramagnetic species, transition metal ions (Mn(II), Fe(III)) and stable organic radicals (chlorophyll, semiquinone, tyrosyl and carbon centered) were found in leaves of nettle collected at different stages of development and growing in clean and polluted environment. In plants growing in polluted area the injuries of protein molecules bonding metal ions and the disturbances of photosynthesis and redox equilibrium in cells, as well as instability of polysaccharide structure of cell walls were observed.

  1. An EPR Primer

    Indian Academy of Sciences (India)

    IAS Admin

    electron paramagnetic resonance (EPR) is given to help the uninitiated reader to get prepared to appreciate the following article. Electron paramagnetic resonance (EPR), also known as electron spin resonance, (ESR) is a form of spectroscopy dealing with electronic spin-state transitions. These transitions are caused.

  2. Dicty_cDB: VHF476 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uences producing significant alignments: (bits) Value VHF476 (VHF476Q) /CSM/VH/VHF4-D/VHF476Q.Seq.d/ 198 2e-...46 own update 2003.10.17 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value...e 2008.10.29 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value (Q54AX5) R

  3. Characterization of red sandalwood by ICP-MS analysis, optical absorption and EPR spectroscopic methods

    Science.gov (United States)

    Reddy, S. L.; Reddy, N. C. G.; Reddy, R. R. S.; Reddy, G. S.; Rao, P. S.; Reddy, B. J.; Frost, R. L.

    2006-09-01

    Red sandalwood sample was subjected to ICP-mass spectrometer analysis for the determination of minor elements. The ash of the sample was also analysed for the presence of major elements. The minor elements present include Cu (281.256), Ba (3722.064), Sr (6365.482), Rb (45.285), Ce (49.863), Zn (375.433) and Pb (80.944) all in ppt. The major elements detected are Cd, Fe, Mn and Ni. Optical absorption spectrum indicates that Fe(III) and Ni(II) are in tetragonal distortion with octahedral geo-metry. ESR (electron spin resonance) spectral analysis also confirms Fe(III) in tetragonal distortion, and the g-values observed for Fe(III) are 6.52, 2.63 and 1.92 and for Mn(II) is 1.99. NIR spectrum is due to carbonate overtones and harmonics and water fundamentals.

  4. 47 CFR 80.911 - VHF transmitter.

    Science.gov (United States)

    2010-10-01

    ... MARITIME SERVICES Compulsory Radiotelephone Installations for Small Passenger Boats § 80.911 VHF..., measured at the power input terminals to the transmitter, and the output power of the transmitter, terminated in a matching artificial load, must be measured at the end of 10 minutes of continuous operation...

  5. A VHF Class E DC-DC Converter with Self-Oscillating Gate Driver

    DEFF Research Database (Denmark)

    Andersen, Toke Meyer; Christensen, Søren K.; Knott, Arnold

    2011-01-01

    This paper describes the analysis and design of a DC-DC converter topology which is operational at frequencies in the Very High Frequency (VHF) band ranging from 30 MHz − 300 MHz. The presented topology, which consists of a class E inverter, class E rectifier, and self-oscillating gate driver, is...

  6. Dicty_cDB: VHF729 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ences producing significant alignments: (bits) Value VHF729 (VHF729Q) /CSM/VH/VHF...4-A/CHC421Q.Seq.d/ 139 9e-33 own update 2002.12.27 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value... 139 2e-29 1 dna update 2008.10.31 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value

  7. EPR analysis of cyanide complexes of wild-type human neuroglobin and mutants in comparison to horse heart myoglobin.

    Science.gov (United States)

    Van Doorslaer, Sabine; Trandafir, Florin; Harmer, Jeffrey R; Moens, Luc; Dewilde, Sylvia

    2014-06-01

    Electron paramagnetic resonance (EPR) data reveal large differences between the ferric ((13)C-)cyanide complexes of wild-type human neuroglobin (NGB) and its H64Q and F28L point mutants and the cyanide complexes of mammalian myo- and haemoglobin. The point mutations, which involve residues comprising the distal haem pocket in NGB, induce smaller, but still significant changes, related to changes in the stabilization of the cyanide ligand. Furthermore, for the first time, the full (13)C hyperfine tensor of the cyanide carbon of cyanide-ligated horse heart myoglobin (hhMb) was determined using Davies ENDOR (electron nuclear double resonance). Disagreement of these experimental data with earlier predictions based on (13)C NMR data and a theoretical model reveal significant flaws in the model assumptions. The same ENDOR procedure allowed also partial determination of the corresponding (13)C hyperfine tensor of cyanide-ligated NGB and H64QNGB. These (13)C parameters differ significantly from those of cyanide-ligated hhMb and challenge our current theoretical understanding of how the haem environment influences the magnetic parameters obtained by EPR and NMR in cyanide-ligated haem proteins. Copyright © 2014 Elsevier B.V. All rights reserved.

  8. From ultrafast spectroscopy to bidirectional molecular switches: DHA/VHF

    Science.gov (United States)

    Schmidhammer, U.; De Waele, V.; Buntinx, G.; Riedle, E.

    The photoconversion from dihydroazulene (DHA) to vinylheptafulvene (VHF) is governed by two mechanisms: The ring opening proceeds on the excited energy surface on the picosecond time scale. It is followed by an intemal conversion to the VHF ground state that is accelerated by the presence of a conical intersection in the case of cyclopenta-DHA. This conical intersection hinders the photoinduced back reaction from the final VHF products. However, we successfully photoconverted the cyanophenyl-VHF-cis back to the DHA with a second delayed pulse. This opens the route to the development of bistable DHAs.

  9. Analysis behaviour of free radicals produced by ionizing radiations in human blood by EPR for biological dosimetry in patients; Analisis del comportamiento de los radicales libre en la radiolisis de la sangre por EPR para dosimetria biologia en pacientes

    Energy Technology Data Exchange (ETDEWEB)

    Mendoza, O. O.; Almanza, A.; Plazas, M. M. C.

    2006-07-01

    In this work is analyzed the biological dosimetry of the free radicals produced by ionizing radiations in human blood obtained by EPR and the biological behaviour of samples In-Vitro, with Rh: O+, in tubes with EDTA (Acid Etilen Diamino Tetracetic) the samples was extracted of the main investigator, these samples were radiated with gammas of ''60Co of a Theratron 780 between plates of PMMA to a depth of Z{sub m}ax of 0.5 cm and between doses 1 to 25 Gy. In these results the behaviors of signal the free radicals presented a increasing a their intensity depending on applied dose, of equal way are results of the biologic dosimetry displayed in sanguineous populations like. White Globules, Red. Platelets etc, to being compared with Resonance Paramagnetic Electronic (EPR). The results show changes in sanguineous populations in high doses (D>10 Gy) in the case of lymphocytes, granulocitos, macusanita, plaquetas, hemoglobina, haematocrit with change similarly in medium and low doses (D>10Gy) in linfocites, platelets, granulocytes, monocytes and the haematocrit. A sanguineous sample without radiating analyzes by EPR giving the presence of signals with values of g=2.13 2,41 in blood. For the first certain value of g authors have associated it to free radicals like: globin (Fe(IV)=0) or Cu''+ incorporated to the ceruloplasmin molecule. (Author)

  10. Characterization of Phyllanthus amarus herb by inductively coupled plasma mass spectrometric (ICP-MS) analysis, optical absorption and electron paramagnetic resonance (EPR) spectroscopic methods

    Science.gov (United States)

    Reddy, S. Lakshmi; Reddy, N. C. Gangi; Reddy, R. Rama Subba; Reddy, G. Siva; Rao, P. Sambasiva; Reddy, B. Jagannatha; Frost, R. L.

    A powdered sample of Phyllanthus amarus herb of Kadapa district of Andhra Pradesh, India, is used in the present study. ICP-MS analysis indicates that copper is present in higher concentration when compared to other elements. Although the Pb is toxic, it is within the permissible limit. The evaluated soil and herb physico-chemical parameters indicate that the sample is acidic in nature in comparison with the soil. An EPR study on powdered sample confirms the presence of Fe(III), Mn(II) and Cu(II). Optical absorption spectrum indicates that Fe(III) impurity is present in octahedral structure whereas Cu(II) is present in rhombically distorted octahedral environment. MIR results are due to carbonate fundamentals.

  11. EPR spectroscopy of spices

    Directory of Open Access Journals (Sweden)

    R. T. Тimakova

    2016-01-01

    Full Text Available From 01 January 2017 you enter the interstate standard GOST 33271-2015 “Dry Spices, herbs and vegetable seasonings. Manual exposure in order to combat pathogens and other microorganisms” which States that the absorbed dose of radiation to the spices should be from 3 to 30 kGy. The study found that before the introduction of permissive legislative framework in the consumer market of Russia there are irradiated food products (chili, ground chili, ground spicy chili, black pepper. For radiation monitoring of food safety, we used the method of electron paramagnetic resonance (EPR, which allows quickly and with a high degree of reliability to establish the fact of irradiation. It is established that all samples of spices irradiated with dose of 12 kGy (technology radappertization gave typical spectra of the signals established by the method of electron paramagnetic resonance in the domestic EPR spectrometer, the intensity, amplitude and peak width of the EPR signal of samples of spices with the increase of irradiation dose increases. It is proven that repeated exposure no effect accumulation. Integration with 2017 Russia in the global practi ce of using radiation technologies of processing of food products and food raw materials with the purpose of extending shelf life confirms the need for a data Bank on the radiation sensitivity of various food products to determine the optimal doses and the eff ect of radiation doses on the shelf life and quality of products.

  12. Dicty_cDB: VHF823 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uences producing significant alignments: (bits) Value VHF823 (VHF823Q) /CSM/VH/VH...186Q.Seq.d/ 86 1e-16 own update 2009. 4. 4 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value...-13 1 dna update 2008.10.31 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value

  13. Ionospheric plasma by VHF waves

    Indian Academy of Sciences (India)

    ... chart recorder at Varanasi during 1991 to 1999. The amplitude fluctuations having peak to peak variations>1 dB have been con- sidered for the present analysis. At Varanasi scintillations are frequently observed during nighttime, hence only nocturnal variation of irregularities in different months and sea- sons are studied.

  14. Quantitative EPR A Practitioners Guide

    CERN Document Server

    Eaton, Gareth R; Barr, David P; Weber, Ralph T

    2010-01-01

    This is the first comprehensive yet practical guide for people who perform quantitative EPR measurements. No existing book provides this level of practical guidance to ensure the successful use of EPR. There is a growing need in both industrial and academic research to provide meaningful and accurate quantitative EPR results. This text discusses the various sample, instrument and software related aspects required for EPR quantitation. Specific topics include: choosing a reference standard, resonator considerations (Q, B1, Bm), power saturation characteristics, sample positioning, and finally, putting all the factors together to obtain an accurate spin concentration of a sample.

  15. Nuclear spin-lattice relaxation in nitroxide spin-label EPR

    DEFF Research Database (Denmark)

    Marsh, Derek

    2016-01-01

    that the definition of nitrogen nuclear relaxation rate Wn commonly used in the CW-EPR literature for 14N-nitroxyl spin labels is inconsistent with that currently adopted in time-resolved EPR measurements of saturation recovery. Redefinition of the normalised 14N spin-lattice relaxation rate, b = Wn/(2We), preserves...... the expressions used for CW-EPR, whilst rendering them consistent with expressions for saturation recovery rates in pulsed EPR. Furthermore, values routinely quoted for nuclear relaxation times that are deduced from EPR spectral diffusion rates in 14N-nitroxyl spin labels do not accord with conventional analysis...

  16. Security Analysis and Improvement of 'a More Secure Anonymous User Authentication Scheme for the Integrated EPR Information System'.

    Directory of Open Access Journals (Sweden)

    S K Hafizul Islam

    Full Text Available Over the past few years, secure and privacy-preserving user authentication scheme has become an integral part of the applications of the healthcare systems. Recently, Wen has designed an improved user authentication system over the Lee et al.'s scheme for integrated electronic patient record (EPR information system, which has been analyzed in this study. We have found that Wen's scheme still has the following inefficiencies: (1 the correctness of identity and password are not verified during the login and password change phases; (2 it is vulnerable to impersonation attack and privileged-insider attack; (3 it is designed without the revocation of lost/stolen smart card; (4 the explicit key confirmation and the no key control properties are absent, and (5 user cannot update his/her password without the help of server and secure channel. Then we aimed to propose an enhanced two-factor user authentication system based on the intractable assumption of the quadratic residue problem (QRP in the multiplicative group. Our scheme bears more securities and functionalities than other schemes found in the literature.

  17. Security Analysis and Improvement of 'a More Secure Anonymous User Authentication Scheme for the Integrated EPR Information System'.

    Science.gov (United States)

    Islam, S K Hafizul; Khan, Muhammad Khurram; Li, Xiong

    2015-01-01

    Over the past few years, secure and privacy-preserving user authentication scheme has become an integral part of the applications of the healthcare systems. Recently, Wen has designed an improved user authentication system over the Lee et al.'s scheme for integrated electronic patient record (EPR) information system, which has been analyzed in this study. We have found that Wen's scheme still has the following inefficiencies: (1) the correctness of identity and password are not verified during the login and password change phases; (2) it is vulnerable to impersonation attack and privileged-insider attack; (3) it is designed without the revocation of lost/stolen smart card; (4) the explicit key confirmation and the no key control properties are absent, and (5) user cannot update his/her password without the help of server and secure channel. Then we aimed to propose an enhanced two-factor user authentication system based on the intractable assumption of the quadratic residue problem (QRP) in the multiplicative group. Our scheme bears more securities and functionalities than other schemes found in the literature.

  18. Dicty_cDB: VHF145 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF145 (Link to dictyBase) - - - Contig-U15430-1 VHF145E (Link...) Clone ID VHF145 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15430-1 Ori...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116984 |AC116984.2 Dictyos... theta DNA for complete sequence of nucleomorph chromosome 2. 48 2e-07 2 ES451909 | PREDICTED: similar to PI...al 16.0 %: nuclear 8.0 %: vacuolar 8.0 %: endoplasmic reticulum 4.0 %: cytoskeletal >> prediction for VHF145

  19. Broadband Grounded Vertical Antennas for 30-180 MHZ (VHF)

    Science.gov (United States)

    2013-10-18

    antennas are well known for their broadband gain (monocone, bicone ) but are never combined with a monopole. An eccentric combination of broadband...DATES COVERED 00-00-2014 to 00-00-2014 4. TITLE AND SUBTITLE Broadband Grounded Vertical Antennas For 30-180 MZH (VHF) 5a. CONTRACT NUMBER 5b...18 Attorney Docket No. 102536 1 of 17 BROADBAND GROUNDED VERTICAL ANTENNAS FOR 30-180 MHZ (VHF) STATEMENT OF GOVERNMENT INTEREST

  20. EPR in characterization of seeds paramagnetic species

    Energy Technology Data Exchange (ETDEWEB)

    Luiz, A.P.C.; Mauro, M.F.F.L.; Portugal, K.O.; Barbana, V.M.; Guedes, C.L.B.; Mauro, E. di; Carneiro, C.E.A.; Zaia, D.A.M.; Prete, C.E.C. [Universidade Estadual de Londrina (UEL), PR (Brazil)

    2011-07-01

    Full text. In Brazil, since 1970s, renewable fuel programs has been developed in order to replace petroleum. Today a program that has been discussed is the bio diesel, which intend to replace diesel fuel, fossil oil, to bio diesel, renewal fuel. As seeds are the basis for production of oil and consequently processed into bio diesel, the goal of this work is to characterize and compare paramagnetic species present in the seeds by Electron Paramagnetic Resonance (EPR). Samples used in this study were seeds of sorghum, barley, corn, peanuts, soy beans, cotton, wheat, oats, mustard, rice, sunflower and turnip. Some paramagnetic species present in soil was also investigated as goethite (FeOOH), hematite (Fe{sub 2}O{sub 3}), magnetite (Fe{sub 3}O{sub 4}), and ferrihydrite (Fe{sub 5}HO{sub 8} {center_dot} 4H{sub 2}O), since, these species present in appreciable quantities in the soil can be present in the seeds and analyzed for comparison. The characterization of these species is essential to understand the EPR seeds spectra. Each sample is placed in a thin quartz tube 4 mm in diameter, and it is inserted into the cavity of the spectrometer at room temperature, at low temperature (77 K) and variable temperature using liquid nitrogen flow and hot flow through a compressor air. It was used as standard Mg O:Mn{sup 2+}, which is also inserted into the cavity. Shortly after the potency is regulated, frequency, amplitude and sweep the field. The spectroscopic analysis by EPR X-band ({approx} 9:5GHz), were performed at the Fluorescence and Electron Paramagnetic Resonance Laboratory, Exact Sciences Center, State University of Londrina, Parana state, Brazil, through an EPR spectrometer JEOL brand (JES-PE-3X). In the EPR spectra, spectroscopic factor or g factor and line width were determined in paramagnetic species. Studies from several seeds with EPR technique detected in all of them presence of same complex of Fe{sup 3+} present in the goethite at g {approx} 2, and in the seeds

  1. 2-D inner-shelf current observations from a single VHF WEllen RAdar (WERA) station

    Science.gov (United States)

    Voulgaris, G.; Kumar, N.; Gurgel, K.-W.; Warner, J.C.; List, J.H.

    2011-01-01

    The majority of High Frequency (HF) radars used worldwide operate at medium to high frequencies (8 to 30 MHz) providing spatial resolutions ranging from 3 to 1.5 km and ranges from 150 to 50 km. This paper presents results from the deployment of a single Very High Frequency (VHF, 48 MHz) WEllen RAdar (WERA) radar with spatial resolution of 150 m and range 10-15 km, used in the nearshore off Cape Hatteras, NC, USA. It consisted of a linear array of 12 antennas operating in beam forming mode. Radial velocities were estimated from radar backscatter for a variety of wind and nearshore wave conditions. A methodology similar to that used for converting acoustically derived beam velocities to an orthogonal system is presented for obtaining 2-D current fields from a single station. The accuracy of the VHF radar-derived radial velocities is examined using a new statistical technique that evaluates the system over the range of measured velocities. The VHF radar velocities showed a bias of 3 to 7 cm/s over the experimental period explainable by the differences in radar penetration and in-situ measurement height. The 2-D current field shows good agreement with the in-situ measurements. Deviations and inaccuracies are well explained by the geometric dilution analysis. ?? 2011 IEEE.

  2. Anechoic chamber for VHF and UHF bands

    Science.gov (United States)

    Morikawa, Takao; Sugiura, Akira; Harima, Katsushige; Masuzawa, Hiroshi

    1995-06-01

    Built in 1969, the anechoic chamber of CRL has been used to the fullest by researchers in many fields such as EMI, EMC, antenna design, standard of electric field intensity, and type approval testing. In particular, in the early days of space development in Japan, many satellite-born antennas were developed in this anechoic chamber. However, a quarter of a century has passed since its construction and deteriorated performance due to superannuation sometimes caused difficulties in experiments conducted in the chamber. In 1993, CRL constructed a Measuring Facility for Radio Research (MFRR) and the anechoic chamber for VHF-UHF bands was remodeled as one of the sub-facilities of MFRR. The remodeling work included full replacement of the electromagnetic shielding, absorbers and measurement system. Since the remodeled anechoic chamber is being used not only for EMI tests but also for other purposes, a full-anechoic chamber has been adopted. In addition the chamber has been designed for the frequency range between 30 MHz and 10 GHz. After the remodeling work, the performance of the chamber is greatly improved. The average shielding factor is better than 85 dB for all frequency ranges and the unwanted reflection characteristic is -30 dB for frequencies above 1 GHZ. This paper summarizes the remodeling work, and the specifications and performance of the remodeled anechoic chamber.

  3. Assessment of an alanine EPR dosimetry technique with enhanced precision and accuracy

    CERN Document Server

    Hayes, R B; Wieser, A; Romanyukha, A A; Hardy, B L; Barrus, J K

    2000-01-01

    Dose reconstruction in the course of a series of blind tests demonstrated that an accuracy of 10 mGy for low doses and 1% for high doses can be achieved using EPR spectroscopy. This was accomplished using a combination of methodologies including polynomial filtration of the EPR spectrum, dosimeter rotation during scanning, use of an EPR standard fixed into the resonator and subtraction of all nonradiogenic signals. Doses were reconstructed over the range of 0.01-1000 Gy using this compound spectral EPR analysis. This EPR technique, being equally applicable to fractionated doses (such as those delivered during multiple radiotherapy treatments), was verified to exhibit dose reciprocity. Irradiated alanine dosimeters which were stored exhibited compound spectral EPR signal fading of ca 3% over 9 months. All error estimates given in this paper are given at the 1 standard deviation level and unless otherwise specified do not account for uncertainties in source calibration.

  4. Ultimate VHF Broadband Interferometer Zen KAWASAKI and Manabu AKITA

    Science.gov (United States)

    Kawasaki, Z.; Akita, M.

    2013-12-01

    Lightning Research Group of Osaka University (LRGOU) has been developing an interferometer for thunderstorm monitoring during these two decades. When LRGOU initiated this project, many related scientists claimed that LRGOU's system was a time of arrival and it must be a sophisticated TOA system. However the key technology of the system were broad band and digital data processing, and it is named the VHF broad band digital interferometer (BDITF), because the phase difference of Fourier components played the very important role. Then the BDITF finally has been realized as a quasi-real time lightning monitoring system, and LRGOU has been operating their BDITFs around Osaka area. Since the BDITF captures the VHF impulses associated with lightning discharges by amplitude triggering, it occasionally misses one of the bi-directional leader progressions because of relatively small amplitude VHF impulses mainly emitted by positive leader tips. All of high density of VHF pulses associated with recoil leaders may not be recorded. Then the ordinary BDITF is able to be accepted as the practical operational system, but from the aspect of science it has been sioriously expected to be improved its performance. To overcome the difficulty New Mexico Institute of Mining and Technology (NMIMT) and LRGOU have started the joint project, and a continuous recording system for digital signals is adopted [M. Stock et al, and M Akita et al,]. The field campaigns have been conducting in New Mexico and in Japan, and successful observations are accomplished. The algorithm to identify individual VHF pulses associated with lightning discharges from back ground noise and/or artificial noise, the dispersion of phase differences for all Fourier components is examined. In case by of small dispersion it is concluded that analyzed VHF pulse has high possibility to be emitted by lightning discharges. This interpretation means that the recorded VHF pulse shape might maintain without deformation during

  5. VHF signal power suppression in stratiform and convective precipitation

    Directory of Open Access Journals (Sweden)

    A. J. McDonald

    2006-03-01

    Full Text Available Previous studies have indicated that VHF clear-air radar return strengths are reduced during periods of precipitation. This study aims to examine whether the type of precipitation, stratiform and convective precipitation types are identified, has any impact on the relationships previously observed and to examine the possible mechanisms which produce this phenomenon. This study uses a combination of UHF and VHF wind-profiler data to define periods associated with stratiform and convective precipitation. This identification is achieved using an algorithm which examines the range squared corrected signal to noise ratio of the UHF returns for a bright band signature for stratiform precipitation. Regions associated with convective rainfall have been defined by identifying regions of enhanced range corrected signal to noise ratio that do not display a bright band structure and that are relatively uniform until a region above the melting layer.

    This study uses a total of 68 days, which incorporated significant periods of surface rainfall, between 31 August 2000 and 28 February 2002 inclusive from Aberystwyth (52.4° N, 4.1° W. Examination suggests that both precipitation types produce similar magnitude reductions in VHF signal power on average. However, the frequency of occurrence of statistically significant reductions in VHF signal power are very different. In the altitude range 2-4 km stratiform precipitation is related to VHF signal suppression approximately 50% of the time while in convective precipitation suppression is observed only 27% of the time. This statistical result suggests that evaporation, which occurs more often in stratiform precipitation, is important in reducing the small-scale irregularities in humidity and thereby the radio refractive index. A detailed case study presented also suggests that evaporation reducing small-scale irregularities in humidity may contribute to the observed VHF signal

  6. VHF signal power suppression in stratiform and convective precipitation

    Directory of Open Access Journals (Sweden)

    A. J. McDonald

    2006-03-01

    Full Text Available Previous studies have indicated that VHF clear-air radar return strengths are reduced during periods of precipitation. This study aims to examine whether the type of precipitation, stratiform and convective precipitation types are identified, has any impact on the relationships previously observed and to examine the possible mechanisms which produce this phenomenon. This study uses a combination of UHF and VHF wind-profiler data to define periods associated with stratiform and convective precipitation. This identification is achieved using an algorithm which examines the range squared corrected signal to noise ratio of the UHF returns for a bright band signature for stratiform precipitation. Regions associated with convective rainfall have been defined by identifying regions of enhanced range corrected signal to noise ratio that do not display a bright band structure and that are relatively uniform until a region above the melting layer. This study uses a total of 68 days, which incorporated significant periods of surface rainfall, between 31 August 2000 and 28 February 2002 inclusive from Aberystwyth (52.4° N, 4.1° W. Examination suggests that both precipitation types produce similar magnitude reductions in VHF signal power on average. However, the frequency of occurrence of statistically significant reductions in VHF signal power are very different. In the altitude range 2-4 km stratiform precipitation is related to VHF signal suppression approximately 50% of the time while in convective precipitation suppression is observed only 27% of the time. This statistical result suggests that evaporation, which occurs more often in stratiform precipitation, is important in reducing the small-scale irregularities in humidity and thereby the radio refractive index. A detailed case study presented also suggests that evaporation reducing small-scale irregularities in humidity may contribute to the observed VHF signal suppression.

  7. Analysis of EPR and FISH studies of radiation doses in persons who lived in the upper reaches of the Techa River

    Energy Technology Data Exchange (ETDEWEB)

    Degteva, M.O.; Shagina, N.B.; Shishkina, E.A.; Vozilova, A.V.; Volchkova, A.Y.; Vorobiova, M.I. [Urals Research Center for Radiation Medicine, Chelyabinsk (Russian Federation); Wieser, A. [Helmholtz Centrum Munich, Neuherberg (Germany); Fattibene, P.; Della Monaca, S. [Instituto Superiore di Sanita, Rome (Italy); Ainsbury, E.; Moquet, J. [Public Health England, Chilton, Didcot (United Kingdom); Anspaugh, L.R. [University of Utah, Salt Lake City, UT (United States); Napier, B.A. [Pacific Northwest National Laboratory, Richland, WA (United States)

    2015-11-15

    Waterborne radioactive releases into the Techa River from the Mayak Production Association in Russia during 1949-1956 resulted in significant doses to about 30,000 persons who lived in downstream settlements. The residents were exposed to internal and external radiation. Two methods for reconstruction of the external dose are considered in this paper, electron paramagnetic resonance (EPR) measurements of teeth, and fluorescence in situ hybridization (FISH) measurements of chromosome translocations in circulating lymphocytes. The main issue in the application of the EPR and FISH methods for reconstruction of the external dose for the Techa Riverside residents was strontium radioisotopes incorporated in teeth and bones that act as a source of confounding local exposures. In order to estimate and subtract doses from incorporated {sup 89,90}Sr, the EPR and FISH assays were supported by measurements of {sup 90}Sr-body burdens and estimates of {sup 90}Sr concentrations in dental tissues by the luminescence method. The resulting dose estimates derived from EPR to FISH measurements for residents of the upper Techa River were found to be consistent: The mean values vary from 510 to 550 mGy for the villages located close to the site of radioactive release to 130-160 mGy for the more distant villages. The upper bound of individual estimates for both methods is equal to 2.2-2.3 Gy. The EPR- and FISH-based dose estimates were compared with the doses calculated for the donors using the most recent Techa River Dosimetry System (TRDS). The TRDS external dose assessments are based on the data on contamination of the Techa River floodplain, simulation of air kerma above the contaminated soil, age-dependent lifestyles and individual residence histories. For correct comparison, TRDS-based doses were calculated from two sources: external exposure from the contaminated environment and internal exposure from {sup 137}Cs incorporated in donors' soft tissues. It is shown here that the

  8. ANALYSIS OF EPR AND FISH STUDIES OF RADIATION DOSES IN PERSONS WHO LIVED IN THE UPPER REACHES OF THE TECHA RIVER

    Energy Technology Data Exchange (ETDEWEB)

    Degteva, M. O.; Shagina, N. B.; Shishkina, Elena A.; Vozilova, Alexandra; Volchkova, A. Y.; Vorobiova, M. I.; Wieser, Albrecht; Fattibene, Paola; Della Monaca, S.; Ainsbury, E.; Moquet, J.; Anspaugh, L. R.; Napier, Bruce A.

    2015-07-24

    Waterborne radioactive releases into the Techa River from the Mayak Production Association in Russia during 1949–1956 resulted in significant doses to about 30,000 persons who lived in downstream settlements. The residents were exposed to internal and external radiation. Two methods for reconstruction of the external dose are considered in this paper, electron paramagnetic resonance (EPR) measurements of teeth and fluorescence in situ hybridization (FISH) measurements of chromosome translocations in circulating lymphocytes. The main issue in the application of the EPR and FISH methods for reconstruction of the external dose for the Techa Riverside residents was strontium radioisotopes incorporated in teeth and bones that served as a source of confounding local exposures. In order to estimate and subtract doses from incorporated 89,90Sr, the EPR and FISH assays were supported by measurements of 90Sr-body burdens and estimates of 90Sr concentrations in dental tissues by the luminescence method. The resulting dose estimates derived from EPR and FISH measurements for residents of the upper Techa River were found to be consistent: the mean values vary from 510 – 550 mGy for the villages located close to the site of radioactive release to 130 – 160 mGy for the more distant villages. The upper bound of individual estimates for both methods is equal to 2.2 – 2.3 Gy. The EPR- and FISH-based dose estimates were compared with the doses calculated for the donors using the Techa River Dosimetry System (TRDS). The TRDS external dose assessments were based on the data on contamination of the Techa River floodplain, simulation of ai r kerma above the contaminated soil, age-dependent life-styles and individual residence histories. For correct comparison TRDS-based doses were calculated from two sources: external exposure from the contaminated environment and internal exposure from 137Cs incorporated in donors’ soft tissues. The TRDS-based absorbed doses in tooth enamel

  9. EPR: the nuclear impasse; EPR: l'impasse nucleaire

    Energy Technology Data Exchange (ETDEWEB)

    Marillier, F. [Association Ecologiste Greenpeace (France)

    2008-07-01

    The questions relative to the climatic change constitute crucial challenges for the next ten years. In this context the author aims to show how the EPR project illustrates the nuclear french ''autism''. He presents and analyzes the international and environmental impacts of this obsolete technology, as a project useless and dangerous. (A.L.B.)

  10. From VHF to UHF CMOS-MEMS Monolithically Integrated Resonators

    DEFF Research Database (Denmark)

    Teva, Jordi; Berini, Abadal Gabriel; Uranga, A.

    2008-01-01

    This paper presents the design, fabrication and characterization of microresonators exhibiting resonance frequencies in the VHF and UHF bands, fabricated using the available layers of the standard and commercial CMOS technology, AMS-0.35mum. The resonators are released in a post-CMOS process cons...

  11. Measurements methodology for evaluation of Digital TV operation in VHF high-band

    Science.gov (United States)

    Pudwell Chaves de Almeida, M.; Vladimir Gonzalez Castellanos, P.; Alfredo Cal Braz, J.; Pereira David, R.; Saboia Lima de Souza, R.; Pereira da Soledade, A.; Rodrigues Nascimento Junior, J.; Ferreira Lima, F.

    2016-07-01

    This paper describes the experimental setup of field measurements carried out for evaluating the operation of the ISDB-TB (Integrated Services Digital Broadcasting, Terrestrial, Brazilian version) standard digital TV in the VHF-highband. Measurements were performed in urban and suburban areas in a medium-sized Brazilian city. Besides the direct measurements of received power and environmental noise, a measurement procedure involving the injection of Gaussian additive noise was employed to achieve the signal to noise ratio threshold at each measurement site. The analysis includes results of static reception measurements for evaluating the received field strength and the signal to noise ratio thresholds for correct signal decoding.

  12. EPR structure of the gamma irradiated alanine spectrum

    Energy Technology Data Exchange (ETDEWEB)

    Cabral P, A.; Jimenez D, H.; Urena N, F.; Galindo, S.; Bosch, P

    1992-03-15

    In this study is shown that the broadened five-line EPR pattern of the gamma irradiated alanine possibly decomposes into a more complex pattern when the recorded spectrum is subject to an operation of deconvolution. The EPR powder spectra of gamma irradiated DL- and L-alanine with and without binders are analysed. In all recorded spectra, each observed line is resolved into an asymmetrical triplet when a Gaussian distribution of 8.2 gauss width is removed, by deconvolution, from the observed spectrum. On the other hand, from a simple fitting analysis carried out on the original data, one encounters that some calculated relations between characteristic parameters, such as intensity ratios, deviate consistently from assumed height ratios. Both, from deconvolution and fitting results, a different structure is suggested for the observed broadened five-line EPR pattern of {gamma}-irradiated powder DL- and L-alanine. (Author)

  13. Retrospective dosimetry using EPR and TL techniques: a status report

    Energy Technology Data Exchange (ETDEWEB)

    Haskell, E.H.

    1996-12-31

    Methods of retrospective dosimetry, including luminescence and electron paramagnetic resonance spectroscopy (EPR), rely on measurement of accident dose absorbed by naturally occurring materials - ceramics in the case of both thermoluminescence (TL) and optically stimulated luminescence (OSL) and organic materials and bio- minerals in the case of EPR. Each of these methods relies on measurement of radiation defects resulting from accidental exposure. Since defects also result from natural sources of radiation over the lifetime of a sample, analysis is usually restricted to materials for which the natural dose may be determined and subtracted from the measured cumulative dose. Luminescence dating techniques rely heavily on an accurate assessment of cumulative dose from natural radiation sources, and dating research has provided us with the bulk of our knowledge in this area. Virtually all of the work on natural dose determination can be directly applied to retrospective techniques. With EPR techniques the cumulative dose from diagnostic x- rays is also of importance.

  14. Thermodynamic Basis of Electron Transfer in Dihydroorotate Dehydrogenase B from Lactococcus lactis:  Analysis by Potentiometry, EPR Spectroscopy, and ENDOR Spectroscopy

    DEFF Research Database (Denmark)

    Mohnsen, Al-Walid A.; Rigby, Stephen E. J.; Jensen, Kaj Frank

    2004-01-01

    for the FMN couples in DHODB. During reductive titration of DHODB, small amounts of the neutral blue semiquinone are observed at 630 nm, consistent with the measured midpoint reduction potentials of the flavins. An ENDOR spectrum of substrate-reduced DHODB identifies hyperfine couplings to proton nuclei......-visible spectroscopy and further identify an unusual EPR signal with very small rhombic anisotropy and g values of 2.02, 1.99, and 1.96. This unusual signal is assigned to the formation of a spin interacting state between the FMN semiquinone species and the reduced 2Fe-2S center. Reduction of DHODB using an excess...

  15. VHF digital ultrasound three-dimensional scanning in the diagnosis of myopic regression after corneal refractive surgery.

    Science.gov (United States)

    Reinstein, Dan Z; Ameline, Barbara; Puech, Michel; Montefiore, Guy; Laroche, Laurent

    2005-01-01

    To perform VHF digital ultrasound scanning and analysis of a case of high-myopic undercorrection in an eye that had undergone multiple surgical interventions for the correction of an initial refraction of -12.00 diopters (D). A 49-year-old woman was evaluated after undergoing three surgical interventions for correction of an initial refraction of -12.00 D in the left eye. Automated lamellar keratoplasty (ALK) was followed by arcuate keratotomy (for induced astigmatism) and surface photorefractive keratectomy (PRK). The residual ametropia on presentation was -6.75 -3.50 x 95 degrees. VHF digital ultrasound scanning and analysis was performed. On ultrasound, the ALK interface was clearly visible. Residual stromal thickness beneath the cap was at least 275 microm. The absence of Bowman's layer indicated the region of PRK. New stroma and nascent stromal layers were differentiated within the flap. Neo stromal deposition and central epithelial hyperplasia were determined to be responsible for the myopic shift, as opposed to biomechanical changes. In this case, refraction, slit-lamp examination, and topography were unable to provide a diagnosis for regression following multiple corneal refractive procedures. By providing layered anatomical mapping, VHF digital ultrasound scanning was able to exclude a diagnosis of ectasia and provide anatomical diagnostic information to explain the clinical observations.

  16. Disturbances in VHF/UHF telemetry links as a possible effect of the 2003 Hokkaido Tokachi-oki earthquake

    Directory of Open Access Journals (Sweden)

    H. Nagamoto

    2008-08-01

    Full Text Available The data on radio telemetry links (for water information at VHF/UHF in Hokkaido are used to investigate the rate of disturbances on radio links (or connection failure and its association with a huge earthquake, Tokachi-oki earthquake on 26 September 2003. Especially, the telemetry links at the Tokachi region closest to the earthquake epicenter, showed a significant increase in disturbances on radio links two weeks to a few days before the earthquake on the basis of analysis during a long interval from 1 June 2002 to 3 November 2007 (over 5 years. We suggest that these severe disturbances in VHF/UHF telemetry links are attributed to the generation of seismogenic VHF/UHF radio noises (emissions. Based on this idea, we have estimated that the intensity of these seismogenic emissions is on the order of 10–19 dB μV/m. Finally, the present result was compared with other physical parameters already obtained for this earthquake.

  17. PMSE Observations With the Tri-Static EISCAT VHF Radars

    Science.gov (United States)

    Mann, I.; Tjulin, A.; Häggström, I.

    2013-12-01

    The polar mesospheric summer echoes (PMSE) are generated in the ionosphere at roughly 80 to 90 altitude by electron irregularities in the presence of charged solid particles and PMSE are most likely observed when ice particles form onto nanodust. PMSE formation is an important part in understanding mesospheric processes, but is also an interesting example for dusty plasma phenomena occurring in space. To investigate the phenomena that lead to formation of PMSE it is helpful to study the radar reflectivity of the mesosphere at different angles. PMSE were previously studied at different aspect angles in order to better understand the scattering process. Another way is observing PMSE from multiple sites simultaneously. During this summer the EISCAT radars that are located in Northern Scandinavia could for the first time be used for tri-static observations in the VHF band and we carried out observations during three subsequent days in June 2013. The radar signal was transmitted in zenith direction with the EISCAT VHF antenna near Tromsø (69.59 deg N, 19.23 deg E) and the scattered signal was measured from Tromsø, Kiruna (67.86 deg N, 20.44 deg E) and Sodankylä (67.36 deg N, 26.63 deg E). Zenith observations were simultaneously carried out with the Tromsø UHF radar (933 MHz). Other groups have previously reported the observations of PMSE simultaneously with the EISCAT VHF and UHF radars, but with a much lower occurrence rate for the UHF. UHF observations made during this campaign are dominated by incoherent scatter. The VHF system in Tromsø detected PMSE for a large fraction of the observation time. The VHF receivers in Kiruna and Sodankylä were pointed at typical PMSE heights above the Tromsø transmitter and detected radar reflections at the same time and altitude as the Tromsø radar. These observations are among the first tri-static observations of PMSE. Preliminary results from the campaign will be presented and discussed.

  18. EPR of exchange coupled systems

    CERN Document Server

    Bencini, Alessandro

    2012-01-01

    From chemistry to solid state physics to biology, the applications of Electron Paramagnetic Resonance (EPR) are relevant to many areas. This unified treatment is based on the spin Hamiltonian approach and makes extensive use of irreducible tensor techniques to analyze systems in which two or more spins are magnetically coupled. This edition contains a new Introduction by coauthor Dante Gatteschi, a pioneer and scholar of molecular magnetism.The first two chapters review the foundations of exchange interactions, followed by examinations of the spectra of pairs and clusters, relaxation in oligon

  19. Orbital Configuration of the Valence Electrons, Ligand Field Symmetry, and Manganese Oxidation States of the Photosynthetic Water Oxidizing Complex: Analysis of the S(2) State Multiline EPR Signals.

    Science.gov (United States)

    Zheng, Ming; Dismukes, G. Charles

    1996-05-22

    A theoretical framework is presented for analysis of all three "multiline" EPR spectra (MLS) arising from the tetramanganese (Mn(4)) cluster in the S(2) oxidation state of the photosynthetic water oxidizing complex (WOC). Accurate simulations are presented which include anisotropy of the g and (four) (55)Mn hyperfine tensors, chosen according to a database of (55)Mn(III) and (55)Mn(IV) hyperfine tensors obtained previously using unbiased least-squares spectral fitting routines. In view of the large (30%) anisotropy common to Mn(III) hyperfine tensors in all complexes, previous MLS simulations which have assumed isotropic hyperfine constants have required physically unrealistic parameters. A simple model is found which offers good simulations of both the native "19-21-line" MLS and the "26-line" NH(3)-bound form of the MLS. Both a dimer-of-dimers and distorted-trigonal magnetic models are examined to describe the symmetry of the Heisenberg exchange interactions within the Mn(4) cluster and thus define the initial electronic basis states of the cluster. The effect of rhombic symmetry distortions is explicitly considered. Both magnetic models correspond to one of several possible structural models for the Mn(4) cluster proposed independently from Mn EXAFS studies. Simulated MLS were constructed for each of the eight (or seven) doublet states of the Mn(4) cluster in the WOC for the two viable oxidation models (3Mn(III)-1Mn(IV) or 3Mn(IV)-1Mn(III)), and using a wide range of axial Mn hyperfine tensors, with either coaxial or orthogonal tensor alignments. We find accurate simulations using the 3Mn(III)-1Mn(IV) oxidation model. In the dimer-of-dimers coupling model, the spin state conversion between two doublet states |S(12),S(34),S(T)|(7)/(2),4,(1)/(2)> and |(7)/(2),3,(1)/(2)> is found to explain the large (25%) contraction in the hyperfine splitting observed upon conversion from the native MLS to the NH(3)-bound MLS. Stabilization of this excited state as the new ground

  20. EPR Dosimetry - Present and Future

    Energy Technology Data Exchange (ETDEWEB)

    Regulla, D.F. [GSF - National Research Centre for Environment and Health, Institute of Radiation Protection, 85764 Neuherberg (Germany)

    1999-07-01

    In the past, IAEA has played a central role in stipulating research and development in EPR high-dose standardisation as well as in coordinating and organising international dose intercomparison programs, within the Member States of the United Nations from the mid-seventies till today. The future tasks of EPR dosimetry seem to tend towards different subjects such as bio markers, biological radiation effects, post-accident dose reconstruction in the environment, and retrospective human dosimetry. The latter may be considered a promising tool for epidemiology on the way to re-define radiation risk of man for chronicle radiation exposures, based on e.g. South Ural civil population and radiation workers. There are on-going international activities in the field of standardising high-level dosimetry by the American Standards on Testing and Materials (Astm), and by the International Organisation of Standards (ISO). The International Commission on Radiation Units and Measurements (ICRU) is considering the establishment of relevant recommendations concerning industrial radiation processing, but also human dose reconstruction. (Author)

  1. Manganese Binding Properties of Human Calprotectin Under Conditions of High and Low Calcium: X-ray Crystallographic and Advanced EPR Spectroscopic Analysis

    Science.gov (United States)

    Gagnon, Derek M.; Brophy, Megan Brunjes; Bowman, Sarah E. J.; Stich, Troy A.; Drennan, Catherine L.; Britt, R. David; Nolan, Elizabeth M.

    2015-01-01

    The antimicrobial protein calprotectin (CP), a hetero-oligomer of the S100 family members S100A8 and S100A9, is the only identified mammalian Mn(II)-sequestering protein. Human CP uses Ca(II) ions to tune its Mn(II) affinity at a biologically unprecedented hexahistidine site that forms at the S100A8/S100A9 interface, and the molecular basis for this phenomenon requires elucidation. Herein, we investigate the remarkable Mn(II) coordination chemistry of human CP using X-ray crystallography as well as continuous wave (CW) and pulse electron paramagnetic resonance (EPR) spectroscopies. An X-ray crystallographic structure of Mn(II)-CP containing one Mn(II), two Ca(II), and two Na(I) ions per CP heterodimer is reported. The CW EPR spectrum of Ca(II)- and Mn(II)-bound CP prepared with a 10:0.9:1 Ca(II):Mn(II):CP ratio is characterized by an unusually low zero-field splitting of 485 MHz (E/D = 0.30) for the S = 5/2 Mn(II) ion, consistent with the high symmetry of the His6 binding site observed crystallographically. Results from electron spin-echo envelope modulation and electron nuclear double resonance experiments reveal that the six Mn(II)-coordinating histidine residues of Ca(II)- and Mn(II)-bound CP are spectroscopically equivalent. The observed 15N (I = 1/2) hyperfine couplings (A) arise from two distinct classes of nitrogen atoms: the coordinating ε-nitrogen of the imidazole ring of each histidine ligand (A = [3.45, 3.71, 5.91] MHz) and the distal δ-nitrogen (A = [0.11, 0.18, 0.42] MHz). In the absence of Ca(II), the binding affinity of CP for Mn(II) drops by ca. two orders of magnitude and coincides with Mn(II) binding at the His6 site as well as other sites. This study demonstrates the role of Ca(II) in enabling high-affinity and specific binding of Mn(II) to the His6 site of human calprotectin. PMID:25597447

  2. The first operation and results of the Chung-Li VHF radar

    Science.gov (United States)

    Chao, J. K.; Kuo, F. S.; Chu, Y. S.; Fu, I. J.; Rottger, J.; Liu, C. H.

    1986-01-01

    The Chung-Li Very High Frequency (VHF) radar is used in the dual-mode operations, applying Doppler beam-swinging as well as the spaced-antenna-drift method. The design of the VHF radar is examined. Results of performance tests are discussed.

  3. Multifrequency Pulsed EPR Studies of Biologically Relevant Manganese(II) Complexes

    OpenAIRE

    Stich, T. A.; Lahiri, S.; Yeagle, G.; Dicus, M.; Brynda, M.; Gunn, A; Aznar, C.; DeRose, V.J.; Britt, R. D.

    2007-01-01

    Electron paramagnetic resonance studies at multiple frequencies (MF EPR) can provide detailed electronic structure descriptions of unpaired electrons in organic radicals, inorganic complexes, and metalloenzymes. Analysis of these properties aids in the assignment of the chemical environment surrounding the paramagnet and provides mechanistic insight into the chemical reactions in which these systems take part. Herein, we present results from pulsed EPR studies performed at three different fre...

  4. Very Compact and Broadband Active Antenna for VHF Band Applications

    Directory of Open Access Journals (Sweden)

    Y. Taachouche

    2012-01-01

    Full Text Available An active receiving antenna with small size consisting of a monopole loaded with a transistor bipolar is presented in this paper. A transistor is used in order to miniaturize the receiving active antenna size in VHF band. The vertical size of the structure is equal to λ/175, where λ is the wavelength at the lower frequency of the bandwidth. Despite the very small size of the antenna, the frequency bandwidth is very wide and the gain is suitable for FM application with sensitive receivers.

  5. Nitrosyl hemoglobins: EPR above 80 K

    Energy Technology Data Exchange (ETDEWEB)

    Wajnberg, E.; Bemski, G.; El-Jaick, L.J.; Alves, O.C.

    1995-03-01

    The EPR spectra of nitrosyl hemoglobin and myoglobin in different conditions (native, denatured and lyophilized), as well as of hematin-NO were obtained in the temperature range of 80 K-280 K. There is a substantial and reversible.decrease of the areas of the EPR spectra of all the hemoglobin samples above 150 K. The interpretation of the results implies the existence of two conformational states in thermal equilibrium only one of which is EPR detectable. Thermodynamical parameters are determined for the hexa and penta-coordinated cases. (author). 25 refs, 3 figs.

  6. Homogeneity and EPR metrics for assessment of regular grids used in CW EPR powder simulations

    Science.gov (United States)

    Crăciun, Cora

    2014-08-01

    CW EPR powder spectra may be approximated numerically using a spherical grid and a Voronoi tessellation-based cubature. For a given spin system, the quality of simulated EPR spectra depends on the grid type, size, and orientation in the molecular frame. In previous work, the grids used in CW EPR powder simulations have been compared mainly from geometric perspective. However, some grids with similar homogeneity degree generate different quality simulated spectra. This paper evaluates the grids from EPR perspective, by defining two metrics depending on the spin system characteristics and the grid Voronoi tessellation. The first metric determines if the grid points are EPR-centred in their Voronoi cells, based on the resonance magnetic field variations inside these cells. The second metric verifies if the adjacent Voronoi cells of the tessellation are EPR-overlapping, by computing the common range of their resonance magnetic field intervals. Beside a series of well known regular grids, the paper investigates a modified ZCW grid and a Fibonacci spherical code, which are new in the context of EPR simulations. For the investigated grids, the EPR metrics bring more information than the homogeneity quantities and are better related to the grids’ EPR behaviour, for different spin system symmetries. The metrics’ efficiency and limits are finally verified for grids generated from the initial ones, by using the original or magnetic field-constraint variants of the Spherical Centroidal Voronoi Tessellation method.

  7. SimLabel: a graphical user interface to simulate continuous wave EPR spectra from site-directed spin labeling experiments.

    Science.gov (United States)

    Etienne, E; Le Breton, N; Martinho, M; Mileo, E; Belle, V

    2017-08-01

    Site-directed spin labeling (SDSL) combined with continuous wave electron paramagnetic resonance (cw EPR) spectroscopy is a powerful technique to reveal, at the residue level, structural transitions in proteins. SDSL-EPR is based on the selective grafting of a paramagnetic label on the protein under study, followed by cw EPR analysis. To extract valuable quantitative information from SDSL-EPR spectra and thus give reliable interpretation on biological system dynamics, numerical simulations of the spectra are required. Such spectral simulations can be carried out by coding in MATLAB using functions from the EasySpin toolbox. For non-expert users of MATLAB, this could be a complex task or even impede the use of such simulation tool. We developed a graphical user interface called SimLabel dedicated to run cw EPR spectra simulations particularly coming from SDSL-EPR experiments. Simlabel provides an intuitive way to visualize, simulate, and fit such cw EPR spectra. An example of SDSL-EPR spectra simulation concerning the study of an intrinsically disordered region undergoing a local induced folding is described and discussed. We believe that this new tool will help the users to rapidly obtain reliable simulated spectra and hence facilitate the interpretation of their results. Copyright © 2017 John Wiley & Sons, Ltd. Copyright © 2017 John Wiley & Sons, Ltd.

  8. EPR and optical absorption spectral studies on sphalerite mineral

    Science.gov (United States)

    Seshamaheswaramma, K.; Reddy, G. Udayabhaskara; Reddy, A. Varada; Lakshmi Reddy, S.; Frost, R. L.; Endo, Tamio

    2011-10-01

    The mineral sphalerite (Zn,Fe)S has been characterized by a combination of X-ray diffraction, EPR and NIR spectroscopy. The optical absorption spectrum of mineral sphalerite is due to an iron impurity only, which is in a distorted octahedral environment. The g = 2.2 is attributed to iron and g and A value observed in the spectrum 1.999 and 6.0 mT are assigned to Mn(II) impurity in the mineral. These results indicate that iron and Mn(II) impurity have entered the lattice by substitution. The EPR results confirm the presence of manganese in a distorted octahedral environment. It is evident from the chemical analysis that iron is present in higher concentrations. NIR results are due to the presence of water and sulphide fundamentals which also support the formula of the mineral. No sulphate in the sphalerite mineral was observed.

  9. EPR Spectroscopy in Environmental Lichen-Indication

    Science.gov (United States)

    Bondarenko, P. V.; Nguyet, Le Thi Bich; Zhuravleva, S. E.; Trukhan, E. M.

    2017-09-01

    The paramagnetic properties of lichens were investigated using EPR spectroscopy and Xanthoria parietina (L.) Th. Fr. as a case study. It was found that the concentration of paramagnetic centers in lichen thalli increased as the air-pollution level increased. Possible formation mechanisms of the paramagnetic centers in lichens were discussed. The efficiency of using EPR spectroscopy to study lichens as environmental quality indicators was demonstrated.

  10. Applications of EPR in radiation research

    CERN Document Server

    Lund, Anders

    2014-01-01

    Applications of EPR in Radiation Research is a multi-author contributed volume presented in eight themes: I. Elementary radiation processes (in situ and low temperature radiolysis, quantum solids); II: Solid state radiation chemistry (crystalline, amorphous and heterogeneous systems); III: Biochemistry, biophysics and biology applications (radicals in biomaterials, spin trapping, free-radical-induced DNA damage); IV: Materials science (polymeric and electronic materials, materials for treatment of nuclear waste, irradiated food); V: Radiation metrology (EPR-dosimetry, retrospective and medical

  11. Recent Comparisons of VHF Lightning Mapping Using Interferometry and Time-of-Arrival Techniques

    Science.gov (United States)

    Lojou, J.; Cummins, K. L.

    2005-12-01

    As part of Vaisala's technology and applications test bed in the Dallas-Fort Worth area in Texas, we have been operating two overlapping Total Lightning detection networks. One network employs VHF Interferometry (both 2- and 3-timensional instrumentation) and the other employs VHF 3-dimensional Time-Of-Arrival (TOA) techniques. For the first time, these two technologies can be compared and contrasted in a common region where they both exhibit good performance. The aim of the work presented is to evaluate the spatial and temporal "description" of lightning flashes provided by these two techniques, and to compare and contrast the relative strengths of these two approaches for Total Lightning mapping. This study employs data acquired during the summer of 2005. The analysis set includes data obtained by these two networks, as well as cloud-to-ground location data from the U.S. National Lightning Detection Network (NLDN). The spatial extent and vertical profile of sources from individual in-cloud and cloud-to-ground flashes are compared for various storm conditions, with both technologies clearly contributing supplemental information not provided by the other. Leader propagation velocities show a substantially unimodal distribution centered at about 105 m/s for TOA-derived sources, whereas the velocity distribution for sources detected using interferometry exhibit a bimodal distribution with the second mode at about 107 m/s. The most-probable interval-between-sources for TOA-derived sources seems to be a few milliseconds, whereas interferometry produces large populations with intervals near 100 microseconds and 100 milliseconds.

  12. TL, EPR and optical absorption in natural grossular crystal

    Energy Technology Data Exchange (ETDEWEB)

    Yauri, J.M. [Institute of Physics, University of Sao Paulo, Rua do Matao, Travessa R, 187, CEP 05508-900, Sao Paulo (Brazil); Department of Physics, University of San Agustin, Av. Independencia S/N, Arequipa (Peru); Cano, N.F. [Institute of Physics, University of Sao Paulo, Rua do Matao, Travessa R, 187, CEP 05508-900, Sao Paulo (Brazil)], E-mail: nilocano@dfn.if.usp.br; Watanabe, S. [Institute of Physics, University of Sao Paulo, Rua do Matao, Travessa R, 187, CEP 05508-900, Sao Paulo (Brazil)

    2008-10-15

    Grossular is one of six members of silicate Garnet group. Two samples GI and GII have been investigated concerning their luminescence thermally stimulated (TL). EPR and optical absorption and the measurements were carried out to find out whether or not same point defects are responsible for all three properties. Although X-rays diffraction analysis has shown that both GI and GII have practically the same crystal structure of a standard grossular crystal, they presented different behavior in many aspects. The TL glow curve shape, TL response to radiation dose, the effect of annealing at high temperatures before irradiation, the dependence of UV bleaching parameters on peak temperature, all of them differ going from GI to GII. The EPR signals around g=2.0 as well as at g=4.3 and 6.0 have much larger intensity in GI than in GII. Very high temperature (>800 deg. C) annealing causes large increase in the bulk background absorption in GI, however, only very little in GII. In the cases of EPR and optical absorption, the difference in their behavior can be attributed to Fe{sup 3+} ions; however, in the TL case one cannot and the cause was not found as yet.

  13. Coordination modes between copper(II) and N-acetylneuraminic (sialic) acid from a 2D-simulation analysis of EPR spectra. Implications for copper mediation of sialoglycoconjugate chemistry relevant to human biology.

    Science.gov (United States)

    Fainerman-Melnikova, Marina; Szabó-Plánka, Terézia; Rockenbauer, Antal; Codd, Rachel

    2005-04-04

    The equilibrium distribution of species formed between Cu(II) and N-acetylneuraminic (sialic) acid (I, LH) at 298 K has been determined using a two-dimensional (2D) simulation analysis of electron paramagnetic resonance (EPR) spectra. In acidic solutions (pH values 11. It is proposed that [CuL]+ most likely features I coordinated via the deprotonated carboxylic acid group (O1) and the endocyclic oxygen atom (OR) forming a five-membered chelate ring. Select Cu(II)-I species of the form [CuLH-1] may feature I acting as a dianionic tridentate chelate, via oxygen atoms derived from O1, OR, and one deprotonated hydroxy group (O7 or O8) from the glycerol tail. Alternatively, I may coordinate Cu(II) in a bidentate fashion as the tert-2-hydroxycarboxylato (O1,O2) dianion. Spectra predicted for Cu(II)-I complexes in which I is coordinated in either a O1,OR {I1-} or O1,O2 {I2-} bidentate fashion {e.g., [CuL]+ (O1,O R), [CuL2] (bis-O1,O R), [CuLH-1] (isomer: O1, O2), [CuL2H-1]- (O1, O R; O1, O2), and [CuL2H-2]2- (isomer: bis-O1, O2)} have "irregular" EPR spectra that are ascribed to the existence of Cu(II)-I(monomer) Cu(II)-I(polymer) equilibria. The formation of polymeric Cu(II)-I species will be favored in these complexes because the glycerol-derived hydroxyl groups at the complex periphery (O, 7O, 8O9) are available for further Cu(II) binding. The presence of polymeric Cu(II)-I species is supported by EPR spectral data from solutions of Cu(II) and the homopolymer of I, colominic acid (Ipoly). Conversely, spectra predicted for Cu(II)-I complexes where I is coordinated in a {I2-} tridentate {e.g., [CuLH-1] (isomer: O1, O R, O7, or O8) and [CuL2H-2]2- (isomer: bis-O1,O R,O7, or O8)} or tetradentate fashion {I3-} {e.g., [CuLH-3]2- (O1, O R, O, 8O9)} are typical for mononuclear tetragonally elongated Cu(II) octahedra. In this latter series of complexes, the tendency toward the formation of polymeric Cu(II)-I analogues is small because the polydentate I effectively wraps up the

  14. Miniaturization for ultrathin metamaterial perfect absorber in the VHF band

    Science.gov (United States)

    Khuyen, Bui Xuan; Tung, Bui Son; Yoo, Young Joon; Kim, Young Ju; Kim, Ki Won; Chen, Liang-Yao; Lam, Vu Dinh; Lee, Youngpak

    2017-03-01

    An efficient resolution for ultrathin metamaterial perfect absorber (MPA) is proposed and demonstrated in the VHF radio band (30-300 MHz). By adjusting the lumped capacitors and the through vertical interconnects, the absorber is miniaturized to be only λ/816 and λ/84 for its thickness and periodicity with respect to the operating wavelength (at 102 MHz), respectively. The detailed simulation and calculation show that the MPA can maintain an absorption rate over 90% in a certain range of incident angle and with a wide variation of capacitance. Additionally, we utilized the advantages of the initial single-band structure to realize a nearly perfect dual-band absorber in the same range. The results were confirmed by both simulation and experiment at oblique incidence angles up to 50°. Our work is expected to contribute to the actualization of future metamaterial-based devices working at radio frequency.

  15. Extraction of forest stand parameters from CARABAS VHF SAR images

    Energy Technology Data Exchange (ETDEWEB)

    Walter, Fredrik [Swedish Univ. of Agricultural Sciences, Uppsala (Sweden). Centre for Image Analysis

    1999-10-01

    Methods for extracting stand-wise forest parameters from CARABAS VHF SAR images have been developed and evaluated. CARABAS is a unique airborne synthetic aperture radar (SAR), developed by the Swedish Defence Research Establishment. It differs a lot from ordinary microwave radars by using wavelengths between 3.3 and 15 m, making the image intensity highly correlated to stem volume. Furthermore, by providing its own illumination source, the sensor operates independently of daylight and weather conditions. Empirical regression models have been developed for relating backscattering amplitude to stem volume, stem diameter, and tree height. To make comparison between CARABAS image data and forest parameters effective, a fully automatic geo-coding algorithm was developed. Image texture features have also been investigated. By using the variogram as a discriminating feature, CARABAS images and aerial images were segmented into homogeneous regions. Furthermore, a method for discriminating recently clear felled areas from forested areas, combining information from Almaz-1 SAR images and SPOT panchromatic data has also been developed, serving as a comparison to the main work of this thesis. For forest stands at near-horizontal ground, the results for estimating stem volume, stem diameter, and tree height from CARABAS image data are very satisfactory. The root mean square errors for the estimates are comparable to subjective ground-based inventories for dense forest stands. The methods and algorithms described in this thesis have been developed towards an operational remote sensing tool. Altogether, significant potential for mapping of forest characteristics exists using the CARABAS VHF SAR sensor 57 refs, 14 figs, 7 tabs

  16. EPR (Electronic Patient Record Laboratory - Simulated Environment to Learn about a Hospital EPR System

    Directory of Open Access Journals (Sweden)

    Kazuko Yamamoto

    2011-03-01

    Full Text Available The “Electronic Patient Record (EPR Laboratory” is a computer based self-learning system developed for students to acquire practical skills and knowledge required to deal with EPRs. The system is designed to supplement conventional lectures on health information systems given as part of our undergraduate curriculum. Using the Laboratory, the students may learn not only operations of EPR systems but also the subjects connected with patient information handling, including privacy, security and health information ethics. The EPR Laboratory is composed of an eLearing system and an EPR system. The learning materials are arranged in units in the eLearning system, and in each unit, the student learns the materials and the EPR operations through practice. Tests are given at each end of unit, and if a student failed a test, the system shows which questions were answered incorrectly and indicates which parts of the unit he/she should review. For this purpose, we introduced a structure to the learning materials based on an information model. In this paper, the overview of the system, the simulated environment to learn patient flow, information flow and hospital workflow, fundamental EPR operations, and structured learning materials for the test and review cycle are described.

  17. Investigation of radical locations in various sesame seeds by CW EPR and 9-GHz EPR imaging.

    Science.gov (United States)

    Nakagawa, K; Hara, H

    2015-01-01

    We investigated the location of radical in various sesame seeds using continuous-wave (CW) electron paramagnetic resonance (EPR) and 9-GHz EPR imaging. CW EPR detected persistent radicals (single line) for various sesame seeds. The EPR linewidth of black sesame seeds was narrower than that of the irradiated white sesame seeds. A very small signal was detected for the white sesame seeds. Two-dimensional (2D) imaging using a 9-GHz EPR imager showed that radical locations vary for various sesame seeds. The paramagnetic species in black sesame seeds were located on the seed coat (skin) and in the hilum region. The signal with the highest intensity was obtained from the hilum part. A very low-intensity image was observed for the white sesame seeds. In addition, the 2D imaging of the irradiated white sesame seeds showed that free radicals were located throughout the entire seed. For the first time, CW EPR and 9-GHz EPR imaging showed the exact location of radical species in various sesame seeds.

  18. Computational and instrumental methods in EPR

    CERN Document Server

    Bender, Christopher J

    2006-01-01

    Computational and Instrumental Methods in EPR Prof. Bender, Fordham University Prof. Lawrence J. Berliner, University of Denver Electron magnetic resonance has been greatly facilitated by the introduction of advances in instrumentation and better computational tools, such as the increasingly widespread use of the density matrix formalism. This volume is devoted to both instrumentation and computation aspects of EPR, while addressing applications such as spin relaxation time measurements, the measurement of hyperfine interaction parameters, and the recovery of Mn(II) spin Hamiltonian parameters via spectral simulation. Key features: Microwave Amplitude Modulation Technique to Measure Spin-Lattice (T1) and Spin-Spin (T2) Relaxation Times Improvement in the Measurement of Spin-Lattice Relaxation Time in Electron Paramagnetic Resonance Quantitative Measurement of Magnetic Hyperfine Parameters and the Physical Organic Chemistry of Supramolecular Systems New Methods of Simulation of Mn(II) EPR Spectra: Single Cryst...

  19. Mast-sipping in EPR trademark plants

    Energy Technology Data Exchange (ETDEWEB)

    Langenberger, Jan [AREVA NP GmbH, Erlangen (Germany). Fuel Service; Schienbein, Marcel; Geier, Roland [AREVA NP GmbH, Erlangen (Germany). Radiochemical Lab.

    2010-05-15

    For more than 20 years, AREVA applies and develops different sipping techniques to identify fuel assemblies with leaking fuel rods. For the EPR trademark reactors a Mast Sipping System with newest developments will be implemented considering radiation protection and latest standards requirements. The innovative EPR trademark Sipping System differs from previous systems in many ways. One of the main innovations is that all the necessary processes of the Sipping system have been fully digitized. Second, several ALARA design modifications have been implemented to meet the current radiation protection requirements. An additional implementable multilingual assistance program facilitates the handling of the system and helps to prevent incorrect operation. (orig.)

  20. Identification of irradiated crab using EPR

    Energy Technology Data Exchange (ETDEWEB)

    Maghraby, A. [Radiation Dosimetry Department, National Institute for Standards (NIS), Ministry of Scientific Research, Haram, 12211- Giza, P.O. Box: 136 (Egypt)]. E-mail: maghrabism@yahoo.com

    2007-02-15

    EPR spectroscopy is a fast and powerful technique for the identification of irradiated food. Crab exoskeleton was divided into six parts: dactyl, cheliped, carapace, apron, swimming legs, and walking legs. Samples of the exoskeleton were prepared and irradiated to Cs-137 gamma radiation in the range (1.156-5.365 kGy). EPR spectra of unirradiated as well as irradiated samples were recorded and analyzed. Response to gamma radiation was plotted for each part of the exoskeleton, dactyl was found to be the most sensitive part, followed by the apron (38%), cheliped (37%), walking legs (30%), swimming legs (24%), and carapace (21%) relative to the dactyl response.

  1. TL and EPR dating: some applications

    Energy Technology Data Exchange (ETDEWEB)

    Watanabe, S. [Institute of Physics, University of Sao Paulo, Sao Paulo (Brazil)

    2006-07-01

    The intensity of thermoluminescence light emitted by a crystal is a function of radiation dose. The number of defects or of radicals in a crystal or organic substances is also a function of radiation dose. Since such defects or radicals present EPR signals, the EPR intensity is also a function of radiation dose. These facts are basis for radiation dosimetry and can be applied in dating of archaeological potteries or other materials, as well as in dating geological substances such as sediments, caves speleothemes, animal teeth and bones. Recent investigation on sensitized quartz based dosimeters and dating calcite covering ancient wall painting to find early settlers in Brazil will be presented. (Author)

  2. Harmonization of dosimetric information obtained by different EPR methods: Experience of the Techa river study

    Energy Technology Data Exchange (ETDEWEB)

    Volchkova, A. [Urals Research Center for Radiation Medicine, 68A, Vorovsky Str., 454076 Chelyabinsk (Russian Federation); Shishkina, E.A., E-mail: ElenaA.Shishkina@gmail.com [Urals Research Center for Radiation Medicine, 68A, Vorovsky Str., 454076 Chelyabinsk (Russian Federation); Ivanov, D. [Institute of Metal Physics, Russian Academy of Sciences, 18, S. Kovalevskoy Str., 620041 Yekaterinburg (Russian Federation); Timofeev, Yu. [Urals Research Center for Radiation Medicine, 68A, Vorovsky Str., 454076 Chelyabinsk (Russian Federation); Fattibene, P.; Della Monaca, S. [Istituto Superiore di Sanita and Istituto Nazionale di Fisica Nucleare, Viale Regina Elena 299, 00161 Rome (Italy); Wieser, A. [Helmholtz Zentrum Muenchen, German Research Centre for Environmental Health, D-85764 Neuherberg (Germany); Degteva, M.O. [Urals Research Center for Radiation Medicine, 68A, Vorovsky Str., 454076 Chelyabinsk (Russian Federation)

    2011-09-15

    Between 1949 and 1956 the Techa River (Southern Urals, Russia) was contaminated as a result of releases of radioactive waste by the Mayak Production Association. EPR dosimetry with tooth enamel has been used to estimate the external exposure of Techa riverside residents over the last 17 years. The database 'Tooth' of the Urals Research Center for Radiation Medicine (URCRM) has accumulated about 1000 EPR measurements of tooth enamel from the rural population of the Urals region. The teeth were investigated by laboratories of Russia, USA, Germany and Italy. Most of the enamel samples were measured several times in different laboratories. Each laboratory used different equipment and its own methods for sample preparation and EPR spectra analysis. Even measurements performed at the same laboratory over 10-15 years may not be assumed as uniform: methods change with time, and equipment is subject to aging. These two factors influenced EPR performance. The purpose of this study is, therefore, the harmonization of EPR data accumulated during long-term dosimetric investigations in the Southern Urals for further pooled analysis. The results will be used for external dose evaluation in the Techa River region.

  3. EPR-dosimetry of ionizing radiation

    Science.gov (United States)

    Popova, Mariia; Vakhnin, Dmitrii; Tyshchenko, Igor

    2017-09-01

    This article discusses the problems that arise during the radiation sterilization of medical products. It is propose the solution based on alanine EPR-dosimetry. The parameters of spectrometer and methods of absorbed dose calculation are given. In addition, the problems that arise during heavy particles irradiation are investigated.

  4. The EPR Paradox: Einstein Scrutinises Quantum Mechanics

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 5; Issue 4. The EPR Paradox: Einstein Scrutinises Quantum Mechanics. Arvind. General Article Volume 5 Issue 4 April 2000 pp 28-36. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/005/04/0028-0036 ...

  5. EPR spin trapping of protein radicals

    DEFF Research Database (Denmark)

    Davies, Michael Jonathan; Hawkins, Clare Louise

    2004-01-01

    Electron paramagnetic resonance (EPR) spin trapping was originally developed to aid the detection of low-molecular-mass radicals formed in chemical systems. It has subsequently found widespread use in biology and medicine for the direct detection of radical species formed during oxidative stress...

  6. EPR and ENDOR spectroscopic study of the reactions of aromatic azides with gallium trichloride.

    Science.gov (United States)

    Bencivenni, Giorgio; Cesari, Riccardo; Nanni, Daniele; El Mkami, Hassane; Walton, John C

    2010-11-21

    The reactions of gallium trichloride with phenyl and deuterio-phenyl azides, as well as with 4-methoxyphenyl azide and deuterium isotopomers, were examined by product analysis, CW EPR spectroscopy and pulsed ENDOR spectroscopy. The products included the corresponding anilines together with 4-aminodiphenylamine type dimers, and polyanilines. Complex CW EPR spectra of the radical cations of the dimers [ArNHC(6)H(4)NH(2)](+)˙ and trimers [ArNHC(6)H(4)NHC(6)H(4)NH(2)](+)˙ were obtained. These EPR spectra were analysed with the help of data from the deuterium-substituted analogues as well as the pulse Davies ENDOR spectra. DFT computations of the radical cations provided corroborating evidence and suggested the unpaired electrons were accommodated in extensive π-delocalised orbitals. A mechanism to account for the reductive conversion of aromatic azides to the corresponding anilines and thence to the dimers and trimers is proposed.

  7. EPR study of Mn-implanted single crystal TiO{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Gueler, S; Rameev, B [Department of Physics, Gebze Institute of Technology, 41400 Gebze-Kocaeli (Turkey); Khaibullin, R I; Aktas, B [Lab. of Radiation Physics, Kazan Physical-Technical Institute, 420029 Kazan (Russian Federation); Lopatin, O N, E-mail: sumeyra@gyte.edu.t [Faculty of Geology, Kazan State University, 420008 Kazan (Russian Federation)

    2009-03-01

    Single crystals of manganese-implanted TiO{sub 2} rutile have been investigated by electron paramagnetic resonance (EPR) technique at room temperature. ESR spectra have been interpreted to correspond to the transitions among the spin multiplet (S=3/2) of the paramagnetic Mn{sup 4+} ion. Characteristic six-line hyper-fine splitting of the ESR spectra resulting from the spin I=5/2 of the Mn{sup 55} nucleus has been observed. Analysis of EPR spectra shows that manganese in TiO{sub 2} rutile host substitutes for Ti{sup 4+} ions. Two equivalent Mn{sup 4+} centers have been observed in the EPR spectra in correspondence with two equivalent octahedral positions of Ti ions in the rutile structure. Parameters of the crystal field of orthorhombic symmetry on the Mn{sup 4+} centers have been obtained as result of computer modelling.

  8. EPR study of Mn-implanted single crystal TiO2

    Science.gov (United States)

    Güler, S.; Rameev, B.; Khaibullin, R. I.; Lopatin, O. N.; Aktaş, B.

    2009-03-01

    Single crystals of manganese-implanted TiO2 rutile have been investigated by electron paramagnetic resonance (EPR) technique at room temperature. ESR spectra have been interpreted to correspond to the transitions among the spin multiplet (S=3/2) of the paramagnetic Mn4+ ion. Characteristic six-line hyper-fine splitting of the ESR spectra resulting from the spin I=5/2 of the Mn55 nucleus has been observed. Analysis of EPR spectra shows that manganese in TiO2 rutile host substitutes for Ti4+ ions. Two equivalent Mn4+ centers have been observed in the EPR spectra in correspondence with two equivalent octahedral positions of Ti ions in the rutile structure. Parameters of the crystal field of orthorhombic symmetry on the Mn4+ centers have been obtained as result of computer modelling.

  9. EPR and optical absorption studies on VO 2+ ions in calcium fumarate trihydrate single crystals

    Science.gov (United States)

    Kripal, Ram; Mishra, Indrajeet; Gupta, S. K.; Arora, Manju

    2010-01-01

    Electron Paramagnetic Resonance (EPR) studies of VO 2+ ions in calcium fumarate trihydrate single crystals have been done at room temperature. EPR analysis indicates the presence of two magnetically inequivalent VO 2+ sites. For the two sites the spin Hamiltonian parameters are, Site I: g x = 1.9689 ,g y = 2.0087 ,g z = 1.9344, A x = 73 ,A y = 88 ,A z = 202; Site II: g x = 1.9675 ,g y = 2.0100 ,g z = 1.9346 ,A x = 75 ,A y = 90, A z = 206 (×10 -4) cm -1. The optical absorption study is also carried out at room temperature. By correlating EPR and optical data the nature of bonding in the crystal is discussed. The three-line superhyperfine structure has been attributed to two protons.

  10. Letter to the Editor: Complete maps of the aspect sensitivity of VHF atmospheric radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    1999-08-01

    Full Text Available Using the MU radar at Shigaraki, Japan (34.85°N, 136.10°E, we measure the power distribution pattern of VHF radar echoes from the mid-troposphere. The large number of radar beam-pointing directions (320 allows the mapping of echo power from 0° to 40° from zenith, and also the dependence on azimuth, which has not been achieved before at VHF wavelengths. The results show how vertical shear of the horizontal wind is associated with a definite skewing of the VHF echo power distribution, for beam angles as far as 30° or more from zenith, so that aspect sensitivity cannot be assumed negligible at any beam-pointing angle that most existing VHF radars are able to use. Consequently, the use of VHF echo power to calculate intensity of atmospheric turbulence, which assumes only isotropic backscatter at large beam zenith angles, will sometimes not be valid.Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; turbulence; instruments and techniques

  11. Design and Development of VHF Antennas for Space Borne Signal of Opportunity Receivers for Cubesat Platforms

    Science.gov (United States)

    Deshpande, Manohar; Piepmeier, Jeffrey

    2015-01-01

    Design and Development of VHF Antennas for Space Borne Signal of Opportunity Receivers for Cubesat Platforms. Space borne microwave remote sensors at VHF/UHF frequencies are important instruments to observe reflective properties of land surfaces through thick and heavy forestation on a global scale. One of the most cost effective ways of measuring land reflectivity at VHF/UHF frequencies is to use signals transmitted by existing communication satellites (operating at VHF/UHF band) as a signal of opportunity (SoOp) signal and passive receivers integrated with airborne/space borne platforms operating in the Low Earth Orbit (LEO). One of the critical components of the passive receiver is two antennas (one to receive only direct signal and other to receive only reflected signal) which need to have ideally high (>30dB) isolation. However, because of small size of host platforms and broad beam width of dipole antennas, achieving adequate isolation between two channels is a challenging problem and need to be solved for successful implementation of space borne SoOp technology for remote sensing. In this presentation a novel enabling VHF antenna technology for Cubesat platforms is presented to receive direct as well as reflected signal with needed isolation. The novel scheme also allows enhancing the gain of individual channels by factor of 2 without use of reflecting ground plane

  12. Characterization of KCNE1 inside Lipodisq Nanoparticles for EPR Spectroscopic Studies of Membrane Proteins.

    Science.gov (United States)

    Sahu, Indra D; Zhang, Rongfu; Dunagan, Megan M; Craig, Andrew F; Lorigan, Gary A

    2017-06-01

    EPR spectroscopic studies of membrane proteins in a physiologically relevant native membrane-bound state are extremely challenging due to the complexity observed in inhomogeneity sample preparation and dynamic motion of the spin-label. Traditionally, detergent micelles are the most widely used membrane mimetics for membrane proteins due to their smaller size and homogeneity, providing high-resolution structure analysis by solution NMR spectroscopy. However, it is often difficult to examine whether the protein structure in a micelle environment is the same as that of the respective membrane-bound state. Recently, lipodisq nanoparticles have been introduced as a potentially good membrane mimetic system for structural studies of membrane proteins. However, a detailed characterization of a spin-labeled membrane protein incorporated into lipodisq nanoparticles is still lacking. In this work, lipodisq nanoparticles were used as a membrane mimic system for probing the structural and dynamic properties of the integral membrane protein KCNE1 using site-directed spin labeling EPR spectroscopy. The characterization of spin-labeled KCNE1 incorporated into lipodisq nanoparticles was carried out using CW-EPR titration experiments for the EPR spectral line shape analysis and pulsed EPR titration experiment for the phase memory time (Tm) measurements. The CW-EPR titration experiment indicated an increase in spectral line broadening with the addition of the SMA polymer which approaches close to the rigid limit at a lipid to polymer weight ratio of 1:1, providing a clear solubilization of the protein-lipid complex. Similarly, the Tm titration experiment indicated an increase in Tm values with the addition of SMA polymer and approaches ∼2 μs at a lipid to polymer weight ratio of 1:2. Additionally, CW-EPR spectral line shape analysis was performed on six inside and six outside the membrane spin-label probes of KCNE1 in lipodisq nanoparticles. The results indicated significant

  13. Range imaging observations of PMSE using the EISCAT VHF radar: Phase calibration and first results

    Directory of Open Access Journals (Sweden)

    J. R. Fernandez

    2005-01-01

    Full Text Available A novel phase calibration technique for use with the multiple-frequency Range IMaging (RIM technique is introduced based on genetic algorithms. The method is used on data collected with the European Incoherent SCATter (EISCAT VHF radar during a 2002 experiment with the goal of characterizing the vertical structure of Polar Mesosphere Summer Echoes (PMSE over northern Norway. For typical Doppler measurements, the initial phases of the transmitter and receiver are not required to be the same. The EISCAT receiver systems exploit this fact, allowing a multi-static configuration. However, the RIM method relies on the small phase differences between closely spaced frequencies. As a result, the high-resolution images produced by the RIM method can be significantly degraded if not properly calibrated. Using an enhanced numerical radar simulator, in which data from multiple sampling volumes are simultaneously generated, the proposed calibration method is validated. Subsequently, the method is applied to preliminary data from the EISCAT radar, providing first results of RIM images of PMSE. Data using conventional analysis techniques, and confirmed by RIM, reveal an often-observed double-layer structure with higher stability in the lower layer. Moreover, vertical velocity oscillations exhibit a clear correlation with the apparent motion of the layers shown in the echo power plots.

  14. Frequency domain interferometry mode observations of PMSE using the EISCAT VHF radar

    Directory of Open Access Journals (Sweden)

    P. B. Chilson

    2000-12-01

    Full Text Available During the summer of 1997 investigations into the nature of polar mesosphere summer echoes (PMSE were conducted using the European incoherent scatter (EISCAT VHF radar in Norway. The radar was operated in a frequency domain interferometry (FDI mode over a period of two weeks to study the frequency coherence of the returned radar signals. The operating frequencies of the radar were 224.0 and 224.6 MHz. We present the first results from the experiment by discussing two 4-h intervals of data collected over two consecutive nights. During the first of the two days an enhancement of the FDI coherence, which indicates the presence of distinct scattering layers, was found to follow the lower boundary of the PMSE. Indeed, it is not unusual to observe that the coherence values are peaked around the heights corresponding to both the lower- and upper-most boundaries of the PMSE layer and sublayers. A Kelvin-Helmholtz mechanism is offered as one possible explanation for the layering structure. Additionally, our analysis using range-time-pseudocolor plots of signal-to-noise ratios, spectrograms of Doppler velocity, and estimates of the positions of individual scattering layers is shown to be consistent with the proposition that upwardly propagating gravity waves can become steepened near the mesopause.Key words: Ionosphere (polar ionosphere · Meteorology and Atmospheric Dynamics (middle atmosphere dynamics · Radio Science (Interferometry

  15. Frequency domain interferometry mode observations of PMSE using the EISCAT VHF radar

    Directory of Open Access Journals (Sweden)

    P. B. Chilson

    Full Text Available During the summer of 1997 investigations into the nature of polar mesosphere summer echoes (PMSE were conducted using the European incoherent scatter (EISCAT VHF radar in Norway. The radar was operated in a frequency domain interferometry (FDI mode over a period of two weeks to study the frequency coherence of the returned radar signals. The operating frequencies of the radar were 224.0 and 224.6 MHz. We present the first results from the experiment by discussing two 4-h intervals of data collected over two consecutive nights. During the first of the two days an enhancement of the FDI coherence, which indicates the presence of distinct scattering layers, was found to follow the lower boundary of the PMSE. Indeed, it is not unusual to observe that the coherence values are peaked around the heights corresponding to both the lower- and upper-most boundaries of the PMSE layer and sublayers. A Kelvin-Helmholtz mechanism is offered as one possible explanation for the layering structure. Additionally, our analysis using range-time-pseudocolor plots of signal-to-noise ratios, spectrograms of Doppler velocity, and estimates of the positions of individual scattering layers is shown to be consistent with the proposition that upwardly propagating gravity waves can become steepened near the mesopause.

    Key words: Ionosphere (polar ionosphere · Meteorology and Atmospheric Dynamics (middle atmosphere dynamics · Radio Science (Interferometry

  16. PENUMBUHAN LAPISAN TIPIS SILIKON MIKROKRISTAL TERHIDROGENASI DENGAN TEKNIK HWC-VHF-PECVD

    Directory of Open Access Journals (Sweden)

    Ida Usman

    2012-02-01

    Full Text Available Telah dikembangkan teknik HWC-VHF-PECVD (Hot Wire Cell Very High Frequency Plasma Enhanced Chemical Vapor Deposition untuk menumbuhkan lapisan tipis silikon mikrokristal terhidrogenasi (mc-Si:H. Dari hasil penumbuhan lapisan tipis yang dilakukan, teknik HWC-VHF-PECVD memperlihatkan laju deposisi yang lebih tinggi dibandingkan laju deposisi lapisan tipis yang diperoleh dari teknik PECVD maupun teknik VHF-PECVD konvensional. Berdasarkan hasil pengukuran XRD dan SEM, lapisan yang diperoleh pada temperatur filamen yang rendah masih berstruktur amorf. Indikasi yang mengarah pada pembentukan lapisan tipis berstruktur mikrokristalin mulai terlihat pada temperatur filamen ≥ 500oC, dimana puncak-puncak di fraksi spektrum XRD untuk orientasi kristalin tertentu mulai terbentu, sejalan dengan pembentukan butiran-butiran kristalin dari hasil foto SEM permukaan lapisan-lapisan tersebut.

  17. EPR and FTIR Characterization of Paramagnetic Transition Metal Ions in Fossil Fuels: Tar Sands

    Science.gov (United States)

    Shepherd, Robert Anthony

    The techniques of EPR and FTIR spectroscopy have been applied to the bitumen and mineral fractions of a tar sand sample originating from Circle Cliffs, Utah to detect and identify paramagnetic transition metal ions present, indicate whether or not they are organically bound, and determine the identities of the complexes in which they occur. An EPR spectrum of the bitumen reveals the presence of V('4+) at a site of axial symmetry. Fitting the spectrum to the second order perturbation solution of the spin Hamiltonian indicates that the spectrum originates from vanadyl etioporphyrin. An EPR spectrum characteristic of Mn('2+) in a carbonate lattice was observed for the mineral component. A quantitative analysis of the mineral components, conducted using FTIR spectroscopy, shows the tar sand mineral fraction consists of the two clays, kaolinite and illite, quartz, gypsum, and one carbonate, dolomite. A computer simulation of the EPR spectrum positively identifies the Mn('2+) host as polycrystalline dolomite, shows the ions are at two crystallographically distinct sites in the dolomite lattice, and gives the relative population at each site. A second feature observed in the EPR spectrum of the mineral fraction is a broad line at g = 4.2 which is attributed to Fe('3+) in kaolinite. A third and final feature observed in the EPR spectrum of the tar sand mineral fraction is a broad line at g = 2. The temperature-dependent behavior of this line suggests that it is due to Fe('3+) in amorphous iron oxides and wustite, two compounds that commonly coat kaolinite surfaces.

  18. Full cycle rapid scan EPR deconvolution algorithm

    Science.gov (United States)

    Tseytlin, Mark

    2017-08-01

    Rapid scan electron paramagnetic resonance (RS EPR) is a continuous-wave (CW) method that combines narrowband excitation and broadband detection. Sinusoidal magnetic field scans that span the entire EPR spectrum cause electron spin excitations twice during the scan period. Periodic transient RS signals are digitized and time-averaged. Deconvolution of absorption spectrum from the measured full-cycle signal is an ill-posed problem that does not have a stable solution because the magnetic field passes the same EPR line twice per sinusoidal scan during up- and down-field passages. As a result, RS signals consist of two contributions that need to be separated and postprocessed individually. Deconvolution of either of the contributions is a well-posed problem that has a stable solution. The current version of the RS EPR algorithm solves the separation problem by cutting the full-scan signal into two half-period pieces. This imposes a constraint on the experiment; the EPR signal must completely decay by the end of each half-scan in order to not be truncated. The constraint limits the maximum scan frequency and, therefore, the RS signal-to-noise gain. Faster scans permit the use of higher excitation powers without saturating the spin system, translating into a higher EPR sensitivity. A stable, full-scan algorithm is described in this paper that does not require truncation of the periodic response. This algorithm utilizes the additive property of linear systems: the response to a sum of two inputs is equal the sum of responses to each of the inputs separately. Based on this property, the mathematical model for CW RS EPR can be replaced by that of a sum of two independent full-cycle pulsed field-modulated experiments. In each of these experiments, the excitation power equals to zero during either up- or down-field scan. The full-cycle algorithm permits approaching the upper theoretical scan frequency limit; the transient spin system response must decay within the scan

  19. EPR investigations of gamma-irradiated ground black pepper

    Science.gov (United States)

    Polovka, Martin; Brezová, Vlasta; Staško, Andrej; Mazúr, Milan; Suhaj, Milan; Šimko, Peter

    2006-02-01

    The γ-radiation treatment of ground black pepper samples resulted in the production of three paramagnetic species ( GI- GIII) which arise from a different origin and have different thermal behavior and stability. The axially symmetric spectra can be characterized by the spin Hamiltonian parameters: GI ( g⊥=2.0060, g∥=2.0032; A⊥=0.85 mT, A∥=0.70 mT) and GII ( g⊥=2.0060, g∥=2.0050; A⊥=0.50 mT, A∥=0.40 mT) assigned to carbohydrate radical structures. The parameters of EPR signal GIII ( g⊥=2.0029, g∥=2.0014; A⊥=3.00 mT, A∥=1.80 mT) possessed features characteristic of cellulose radical species. The activation energies, evaluated by Arrhenius analysis, are in order Ea( GI)black pepper, where a decrease of ˜13% was found. The influence of γ-radiation treatment on the radical-scavenging activities of aqueous and ethanol extracts of black pepper were investigated by both an EPR spin trapping technique and DPPH assay. No changes were detected in either the water or ethanol extracts for a γ-irradiation dose of 10 kGy.

  20. EPR-Bohr and Quantum Trajectories: Entaglement and Nonlocality

    OpenAIRE

    Floyd, Edward R.

    2010-01-01

    Quantum trajectories are used to investigate the EPR-Bohr debate in a modern sense by examining entanglement and nonlocality. We synthesize a single "entanglement molecule" from the two scattered particles of the EPR experiment. We explicitly investigate the behavior of the entanglement molecule rather than the behaviors of the two scattered particles to gain insight into the EPR-Bohr debate. We develop the entanglement molecule's wave function in polar form and its reduced action, both of wh...

  1. Clinical Electron Paramagnetic Resonance (EPR) Oximetry using India Ink

    OpenAIRE

    Williams, Benjamin B.; Khan, Nadeem; Zaki, Bassem; Hartford, Alan; Ernstoff, Marc S.; Swartz, Harold M.

    2010-01-01

    Electron paramagnetic resonance (EPR) oximetry can be used to provide direct absolute measurements of pO2 in living tissue using India ink as an O2 reporter. In vivo measurements are made using low frequency (1.2GHz) EPR spectroscopy and surface loop resonators, which enable measurements to be made at superficial sites through a non-invasive (after placing the ink in the tissues) and repeatable measurement procedure. Ongoing EPR oximetry studies in human subjects include measurement of subcut...

  2. EPR spectroscopy of the manganese cluster of photosystem II.

    Science.gov (United States)

    Haddy, Alice

    2007-06-01

    Electron paramagnetic resonance (EPR) spectroscopy is a valuable tool for understanding the oxidation state and chemical environment of the Mn4Ca cluster of photosystem II. Since the discovery of the multiline signal from the S2 state, EPR spectroscopy has continued to reveal details about the catalytic center of oxygen evolution. At present EPR signals from nearly all of the S-states of the Mn4Ca cluster, as well as from modified and intermediate states, have been observed. This review article describes the various EPR signals obtained from the Mn4Ca cluster, including the metalloradical signals due to interaction of the cluster with a nearby organic radical.

  3. EPR study on gamma-irradiated fruits dehydrated via osmosis

    Energy Technology Data Exchange (ETDEWEB)

    Yordanov, N.D. [Laboratory EPR, Institute of Catalysis, Bulgarian Academy of Sciences, 1113 Sofia (Bulgaria)]. E-mail: ndyepr@bas.bg; Aleksieva, K. [Laboratory EPR, Institute of Catalysis, Bulgarian Academy of Sciences, 1113 Sofia (Bulgaria)

    2007-06-15

    The shape and time stability of the electron paramagnetic resonance (EPR) spectra of non- and {gamma}-irradiated papaya, melon, cherry and fig samples dehydrated via osmosis are reported. It is shown that non-irradiated samples are generally EPR silent whereas {gamma}-irradiated exhibit 'sugar-like' EPR spectra. The recorded EPR spectra are monitored for a period of 7 months after irradiation (stored at low humidity and in the dark). The results suggest longer period of unambiguous identification of the radiation processing of osmose dehydrated fruits. Therefore, the Protocol EN 13708,2001 issued by CEN is fully applicable for the studied fruit samples.

  4. Multifrequency Pulsed EPR Studies of Biologically Relevant Manganese(II) Complexes.

    Science.gov (United States)

    Stich, T A; Lahiri, S; Yeagle, G; Dicus, M; Brynda, M; Gunn, A; Aznar, C; Derose, V J; Britt, R D

    2007-03-01

    Electron paramagnetic resonance studies at multiple frequencies (MF EPR) can provide detailed electronic structure descriptions of unpaired electrons in organic radicals, inorganic complexes, and metalloenzymes. Analysis of these properties aids in the assignment of the chemical environment surrounding the paramagnet and provides mechanistic insight into the chemical reactions in which these systems take part. Herein, we present results from pulsed EPR studies performed at three different frequencies (9, 31, and 130 GHz) on [Mn(II)(H(2)O)(6)](2+), Mn(II) adducts with the nucleotides ATP and GMP, and the Mn(II)-bound form of the hammerhead ribozyme (MnHH). Through line shape analysis and interpretation of the zero-field splitting values derived from successful simulations of the corresponding continuous-wave and field-swept echo-detected spectra, these data are used to exemplify the ability of the MF EPR approach in distinguishing the nature of the first ligand sphere. A survey of recent results from pulsed EPR, as well as pulsed electron-nuclear double resonance and electron spin echo envelope modulation spectroscopic studies applied to Mn(II)-dependent systems, is also presented.

  5. Design VHF Antennas for Space Borne Receivers for SmallSats

    Science.gov (United States)

    Deshpande, Manohar

    2017-01-01

    Space borne microwave remote sensors at VHF/UHF frequencies are important instruments to observe reflective properties of land surfaces through thick and heavy forestation on a global scale. One of the most cost effective ways of measuring land reflectivity at VHF/UHF frequencies is to use signals transmitted by existing communication satellites (operating at VHF/UHF band) as a signal of opportunity (SoOp) signal and passive receivers integrated with airborne/space borne platforms operating in the Low Earth Orbit (LEO). One of the critical components of the passive receiver is two antennas (one to receive only direct signal and other to receive only reflected signal) which need to have ideally high (>30dB) isolation. However, because of small size of host platforms and broad beam width of dipole antennas, achieving adequate isolation between two channels is a challenging problem and need to be solved for successful implementation of space borne SoOp technology for remote sensing. In this presentation a novel enabling VHF antenna technology for Cubesat platforms is presented to receive direct as well as reflected signal with needed isolation. The novel scheme also allows enhancing the gain of individual channels by factor of 2 without use of reflecting ground plane.

  6. First wind shear observation in PMSE with the tristatic EISCAT VHF radar

    Science.gov (United States)

    Mann, I.; Häggström, I.; Tjulin, A.; Rostami, S.; Anyairo, C. C.; Dalin, P.

    2016-11-01

    The Polar Summer Mesosphere has the lowest temperatures that occur in the entire Earth system. Water ice particles below the optically observable size range participate there in the formation of strong radar echoes (Polar Mesospheric Summer Echoes, PMSE). To study PMSE we carried out observations with the European Incoherent Scatter (EISCAT) VHF and EISCAT UHF radar simultaneously from a site near Tromsø (69.58°N, 19.2272°E) and observed VHF backscattering also with the EISCAT receivers in Kiruna (67.86°N, 20.44°E) and Sodankylä (67.36°N, 26.63°E). This is one of the first tristatic measurements with EISCAT VHF, and we therefore describe the observations and geometry in detail. We present observations made on 26 June 2013 from 7:00 to 13:00 h UT where we found similar PMSE patterns with all three VHF receivers and found signs of wind shear in PMSE. The observations suggest that the PMSE contains sublayers that move in different directions horizontally, and this points to Kelvin-Helmholtz instability possibly playing a role in PMSE formation. We find no signs of PMSE in the UHF data. The electron densities that we derive from observed incoherent scatter at UHF are at PMSE altitudes close to the noise level but possibly indicate reduced electron densities directly above the PMSE.

  7. Locations of radical species in black pepper seeds investigated by CW EPR and 9 GHz EPR imaging

    Science.gov (United States)

    Nakagawa, Kouichi; Epel, Boris

    2014-10-01

    In this study, noninvasive 9 GHz electron paramagnetic resonance (EPR)-imaging and continuous wave (CW) EPR were used to investigate the locations of paramagnetic species in black pepper seeds without further irradiation. First, lithium phthalocyanine (LiPC) phantom was used to examine 9 GHz EPR imaging capabilities. The 9 GHz EPR-imager easily resolved the LiPC samples at a distance of ∼2 mm. Then, commercially available black pepper seeds were measured. We observed signatures from three different radical species, which were assigned to stable organic radicals, Fe3+, and Mn2+ complexes. In addition, no EPR spectral change in the seed was observed after it was submerged in distilled H2O for 1 h. The EPR and spectral-spatial EPR imaging results suggested that the three paramagnetic species were mostly located at the seed surface. Fewer radicals were found inside the seed. We demonstrated that the CW EPR and 9 GHz EPR imaging were useful for the determination of the spatial distribution of paramagnetic species in various seeds.

  8. EPR Spectroscopy of Different Sol Concentration Synthesized Nanocrystalline-ZnO Thin Films

    Directory of Open Access Journals (Sweden)

    Manju Arora

    2015-01-01

    Full Text Available Nanocrystalline zinc oxide (nc-ZnO thin films were grown on p-type silicon substrate through spin coating by sol-gel process using different sol concentrations (10 wt.%, 15 wt.%, and 25 wt.%. These films were characterized by high resolution nondestructive X-ray diffraction (XRD, scanning electron microscopy (SEM with energy dispersive X-ray analysis (EDS attachment, and electron paramagnetic resonance (EPR techniques to understand variations in structural, morphological, and oxygen vacancy with respect to sol concentration. The film surface morphology changes from nanowall to nanorods on increasing sol concentration. EPR spectra revealed the systematic variation from ferromagnetic to paramagnetic nature in these nc-ZnO films. The broad EPR resonance signal arising from the strong dipolar-dipolar interactions among impurity defects present in nc-ZnO film deposited from 10 wt.% sol has been observed and a single strong narrow resonance signal pertaining to oxygen vacancies is obtained in 25 wt.% sol derived nc-ZnO film. The concentrations of impurity defects and oxygen vacancies are evaluated from EPR spectra, necessary for efficient optoelectronic devices development.

  9. EPR: what has it taught us

    Energy Technology Data Exchange (ETDEWEB)

    Stapp, H.P.

    1985-05-01

    This symposium commemorating the fiftieth anniversary of the paper of Einstein, Podolsky, and Rosen is a fitting place to review what that work and its sequels have taught us. Prima facie, the EPR paper appears to have been exceedingly counter-productive for the following reasons: (1) The work was quickly rebutted by Bohr, and this rebuttal was apparently accepted by most workers in the field. (2) Scientists who adopted the position advocated by Bohr have produced, in the intervening fifty years, a marvelous body of useful theory, whereas those following the course suggested by EPR have produced nothing of any certified practical value. (3) It has been shown by Bell that the conclusion reached by EPR is incompatible with their assumptions. Chemists and physicists have recently begun to examine the behavior of quantum mechanical systems that are very small, yet large enough to influence their environment in ways that appreciably modify their own behavior, vis-a-vis the behavior they would have if isolated. Because these systems are neither small enough to be treated as isolated (or as residing in a classically described environment) between preparation and detection, nor large enough to be treated classically, they do not conform to the format demanded by the Copenhagen interpretation. Indeed, the behavior of these systems depends on ontological considerations that were irrelevant in the situations covered by the Copenhagen interpretation, and that were systematically ignored in that interpretation. Scientists now face the task of enlarging the scope of quantum theory to cover these new situations, and comparing the empirical consequences of various ontological assumptions. 17 refs.

  10. Testing VHF/GPS collar design and safety in the study of free-roaming horses.

    Directory of Open Access Journals (Sweden)

    Gail H Collins

    Full Text Available Effective and safe monitoring techniques are needed by U.S. land managers to understand free-roaming horse behavior and habitat use and to aid in making informed management decisions. Global positioning system (GPS and very high frequency (VHF radio collars can be used to provide high spatial and temporal resolution information for detecting free-roaming horse movement. GPS and VHF collars are a common tool used in wildlife management, but have rarely been used for free-roaming horse research and monitoring in the United States. The purpose of this study was to evaluate the design, safety, and detachment device on GPS/VHF collars used to collect free-roaming horse location and movement data. Between 2009 and 2010, 28 domestic and feral horses were marked with commercial and custom designed VHF/GPS collars. Individual horses were evaluated for damage caused by the collar placement, and following initial observations, collar design was modified to reduce the potential for injury. After collar modifications, which included the addition of collar length adjustments to both sides of the collar allowing for better alignment of collar and neck shapes, adding foam padding to the custom collars to replicate the commercial collar foam padding, and repositioning the detachment device to reduce wear along the jowl, we observed little to no evidence of collar wear on horses. Neither custom-built nor commercial collars caused injury to study horses, however, most of the custom-built collars failed to collect data. During the evaluation of collar detachment devices, we had an 89% success rate of collar devices detaching correctly. This study showed that free-roaming horses can be safely marked with GPS and/or VHF collars with minimal risk of injury, and that these collars can be a useful tool for monitoring horses without creating a risk to horse health and wellness.

  11. Molecular Switching in Confined Spaces: Effects of Encapsulating the DHA/VHF Photo-Switch in Cucurbiturils

    DEFF Research Database (Denmark)

    Petersen, Michael Å.; Rasmussen, Brian; Andersen, Nicolaj N.

    2017-01-01

    complexes, the kinetics of the thermal VHF-to-DHA back-reaction is accelerated, while in CB8 inclusion complexes, the kinetics is slowed down as compared to the free photo-switch. The effect of the CB encapsulation of the photo-switch can be effectively canceled by introducing a guest that binds the CB more...... strongly. According to DFT calculations, a stabilization of the reactive s-cis VHF conformer relative to the s-trans VHF appears to be a contributing factor responsible for the accelerated back-reaction when encapsulated in CB7....

  12. Teaching the EPR paradox at high school?

    Science.gov (United States)

    Pospiech, Gesche

    1999-09-01

    The discovery of quantum mechanics at the beginning of our century led to a revolution of the physical world view. Modern experiments, made possible by new techniques on the border of the classical and the quantum regimes, offer new insights and better understanding of the quantum world and have an impact on new technological development. Therefore it seems important that students at university and in the final years of high school gain an appreciation of the principles of quantum mechanics. A suitable way seems to be through treatment of the EPR gedanken experiment (thought experiment).

  13. High resolution EPR applications to metalloenzymes and metals in medicine

    CERN Document Server

    Berliner, Lawrence

    2009-01-01

    EPR spectroscopy has an important role in the geometric structural characterization of the redox cofactors in metalloproteins and their electronic structure, as this is crucial for their reactivity. This title covers high-resolution EPR methods, iron proteins, nickel and copper enzymes, and metals in medicine.

  14. EPR and NMR spectroscopy on spin-labeled proteins

    NARCIS (Netherlands)

    Finiguerra, Michelina Giuseppina

    2011-01-01

    Spin labeling and electron paramagnetic resonance (EPR) have been employed to study structure and dynamics of proteins. The surface polarity of four single cysteine mutants of the Zn-azurin in frozen solution were studied using 275 GHz EPR (J-band), with the advantage compared to 9 GHz (X-band) and

  15. Phase transitions reflected in HF-EPR spectra

    NARCIS (Netherlands)

    Horst, Eric van der

    2006-01-01

    EPR is a technique limited to unpaired electrons. Current state of the art set-ups operate at frequencies of 130 GHz or higher. The benefits are increased resolution and the ability to measure large D systems. Using EPR data combined with other techniques systems in which (magnetic) phase

  16. EPR study on tomatoes before and after gamma-irradiation

    Science.gov (United States)

    Aleksieva, K.; Georgieva, L.; Tzvetkova, E.; Yordanov, N. D.

    2009-09-01

    The results from the EPR studies on fresh, air-dried and lyophilized tomato samples before and after gamma-irradiation are reported. Before irradiation fresh and air-dried tomatoes exhibit one singlet EPR line characterized with common g-factor of 2.0048±0.0005, whereas freeze-dried tomato does not show any EPR spectrum. After irradiation, a typical "cellulose-like" triplet EPR spectrum appears in all samples, attributed to cellulose free radicals, generated by gamma-irradiation. It consists of intense central line with g=2.0048±0.0005 and two weak satellite lines separated ca. 3 mT left and right of it. In air-dried and lyophilized tomatoes the "cellulose-like" EPR spectrum is superimposed by an additional partly resolved carbohydrate spectrum. Fading measurements of the radiation-induced EPR signals indicate that the intensity of the EPR spectra of air-dried and freeze-dried tomato are reduced to about 50% after 50 days, whereas those of fresh irradiated tomatoes kept at 4 °C fade completely in 15 days. The reported results unambiguously show that the presence of two satellite lines in the EPR "cellulose-like" spectra of tomato samples can be used for identification of radiation processing.

  17. Use of the Frank sequence in pulsed EPR

    DEFF Research Database (Denmark)

    Tseitlin, Mark; Quine, Richard W.; Eaton, Sandra S.

    2011-01-01

    The Frank polyphase sequence has been applied to pulsed EPR of triarylmethyl radicals at 256MHz (9.1mT magnetic field), using 256 phase pulses. In EPR, as in NMR, use of a Frank sequence of phase steps permits pulsed FID signal acquisition with very low power microwave/RF pulses (ca. 1.5m......W in the application reported here) relative to standard pulsed EPR. A 0.2mM aqueous solution of a triarylmethyl radical was studied using a 16mm diameter cross-loop resonator to isolate the EPR signal detection system from the incident pulses. Keyword: Correlation spectroscopy,Multi-pulse EPR,Low power pulses...

  18. A system for mapping sources of VHF and electric field pulses from in-cloud lightning at KSC

    Science.gov (United States)

    Thomson, Ewen M.; Medelius, Pedro J.

    1991-01-01

    The literature concerning VHF radiation and wideband electric fields from in-cloud lightning is reviewed. VHF location systems give impressive radio images of lightning in clouds with high spatial and temporal resolution. Using systems based on long and short baseline time-or-arrival and interferometry, workers have detected VHF sources that move at speeds of 10(exp 5) to 10(exp 8) m/s. The more slowly moving sources appear to be associated with channel formation but the physical basis for the higher speeds is not clear. In contrast, wideband electric fields are directly related to physical parameters such as current and tortuosity. A long baseline system is described to measure simultaneously VHF radiation and wideband electric fields at five stations at Kennedy Space Center. All signals are detected over remote, isolated ground planes with fiber optics for data transmission. The modification of this system to map rapidly varying dE/dt pulses is discussed.

  19. Investigation into the Effects of VHF and UHF Band Radiation on Hewlett-Packard (HP) Cesium Beam Frequency Standards

    National Research Council Canada - National Science Library

    Dickens, Andrew

    1994-01-01

    This paper documents an investigation into reports which have indicated that exposure to VHF and UHF band radiation has adverse effects on the frequency stability of HP cesium beam frequency standards...

  20. Investigation into the effects of VHF and UHF band radiation on Hewlett-Packard (HP) Cesium Beam Frequency Standards

    Science.gov (United States)

    Dickens, Andrew

    1995-01-01

    This paper documents an investigation into reports which have indicated that exposure to VHF and UHF band radiation has adverse effects on the frequency stability of HP cesium beam frequency standards. Tests carried out on the basis of these reports show that sources of VHF and UHF radiation such as two-way hand held police communications devices do cause reproducible adverse effects. This investigation examines reproducible effects and explores possible causes.

  1. Broadband VHF observations for lightning impulses from a small satellite SOHLA-1 (Maido 1)

    Science.gov (United States)

    Morimoto, T.; Kikuchi, H.; Ushio, T.; Kawasaki, Z.; Hidekazu, H.; Aoki, T.

    2009-12-01

    Lightning Research Group of Osaka University (LRG-OU) has been developing VHF Broadband Digital Interferometer (DITF) to image precise lightning channels and monitor lightning activity widely. The feature of broadband DITF is its ultrawide bandwidth (from 25MHz to 100MHz) and implicit redundancy for estimating VHF source location. LRG-OU considers an application of the broadband DITF to the spaceborne measurement system and joins the SOHLA (Space Oriented Higashi-Osaka Leading Associate) satellite project. The SOHLA satellite project represents a technology transfer program to expand the range of the space development community in Japan. The objective is to get SMEs (Small and Medium sized manufacturing Enterprises) involved in small space projects and new space technologies. Under the cooperative agreement, JAXA (Japan Aerospace Exploration Agency) intends to contribute to socio-economic development by returning its R&D results to society, and SOHLA tries to revitalize the local economy through the commercialization of versatile small satellites. According to the agreement, JAXA provides SOHLA its technical information on small satellites and other technical assistance for the development of the small satellites, SOHLA-1. The prime objective of the SOHLA-1 program is to realize low-cost and short term development of a microsatellite which utilizes the components and bus technologies of JAXA’s MicroLabSat. SOHLA-1 is a spin-stabilized microsatellite of MicroLabSat heritage (about 50 kg). The spin axis is fixed to inertial reference frame. The spin axis (z-axis) lies in the plane containing the solar direction and the normal to the orbital plane. LRG-OU takes responsibility for a science mission of SOHLA-1. To examine the feasibility of the DITF receiving VHF lightning impulses in space, LRG-OU proposes the BMW (Broadband Measurement of Waveform for VHF Lightning Impulses). BMW consists of a single pair of an antenna, a band-pass filter, an amplifier, and an

  2. EPR paradox, quantum nonlocality and physical reality

    Science.gov (United States)

    Kupczynski, M.

    2016-03-01

    Eighty years ago Einstein, Podolsky and Rosen demonstrated that instantaneous reduction of wave function, believed to describe completely a pair of entangled physical systems, led to EPR paradox. The paradox disappears in statistical interpretation of quantum mechanics (QM) according to which a wave function describes only an ensemble of identically prepared physical systems. QM predicts strong correlations between outcomes of measurements performed on different members of EPR pairs in far-away locations. Searching for an intuitive explanation of these correlations John Bell analysed so called local realistic hidden variable models and proved that correlations consistent with these models satisfy Bell inequalities which are violated by some predictions of QM and by experimental data. Several different local models were constructed and inequalities proven. Some eminent physicists concluded that Nature is definitely nonlocal and that it is acting according to a law of nonlocal randomness. According to these law perfectly random, but strongly correlated events, can be produced at the same time in far away locations and a local and causal explanation of their occurrence cannot be given. We strongly disagree with this conclusion and we prove the contrary by analysing in detail some influential finite sample proofs of Bell and CHSH inequalities and so called Quantum Randi Challenges. We also show how one can win so called Bell's game without violating locality of Nature. Nonlocal randomness is inconsistent with local quantum field theory, with standard model in elementary particle physics and with causal laws and adaptive dynamics prevailing in the surrounding us world. The experimental violation of Bell-type inequalities does not prove the nonlocality of Nature but it only confirms a contextual character of quantum observables and gives a strong argument against counterfactual definiteness and against a point of view according to which experimental outcomes are produced

  3. Comparison study of Lightning VHF interferometric and LF time-of-arival maps

    Science.gov (United States)

    Kudo, A.; Stock, M.; Kawasaki, Z.; Ushio, T.

    2016-12-01

    Lightning discharges radiate broad band frequency electromagnetic waves from ULF to UHF. Using sensors which detect this radiation is an effective technique to detect lightning flashes, even if they are in a cloud. If multiple sensors are present, a lightning flash can be located using various techniques. At low frequencies, the power radiated by lightning is very high, but because the wavelengths are long, the location resolution is somewhat low. At very high frequencies, the wavelengths are much shorter allowing for much better location resolution, but the power radiation is also much lower, making it more difficult to detect. The VHF band is a good compromise between good location resolution, and good detection efficiency. One technique to locate VHF signals from lightning is interferometry. Using this technique, the signals arriving at three or more VHF broadband antennas are coherently combined to produce an image of the lightning flash. The current generation broadband lightning interferometer being developed in Japan by RAIRAN and the University of Osaka called Lightning Interferometer via VHF Emission (LIVE). Currently, LIVE is installed in Kaizuka, a city to the south of Osaka, near Osaka Bay to observe Japanese summer lightning. In the current study, we are comparing the high detail, 2-dimensional lightning maps produced by LIVE to the lower detail, 3-dimensional maps produced by a low frequency time-of-arrival system called the Broadband Observation network for Lightning and Thunderstorms (BOLT). In order to better compare the data, a new GPS timing device is being developed for LIVE to allow high absolute timing accuracy without sacrificing one of the 4 high speed digitizer channels. The objectives of the study are to better understand Japanese summer lightning, and to prepare for a future campaign as part of the GLM validation study.

  4. Bias-Voltage Stabilizer for HVHF Amplifiers in VHF Pulse-Echo Measurement Systems

    Directory of Open Access Journals (Sweden)

    Hojong Choi

    2017-10-01

    Full Text Available The impact of high-voltage–high-frequency (HVHF amplifiers on echo-signal quality is greater with very-high-frequency (VHF, ≥100 MHz ultrasound transducers than with low-frequency (LF, ≤15 MHz ultrasound transducers. Hence, the bias voltage of an HVHF amplifier must be stabilized to ensure stable echo-signal amplitudes. We propose a bias-voltage stabilizer circuit to maintain stable DC voltages over a wide input range, thus reducing the harmonic-distortion components of the echo signals in VHF pulse-echo measurement systems. To confirm the feasibility of the bias-voltage stabilizer, we measured and compared the deviations in the gain of the HVHF amplifier with and without a bias-voltage stabilizer. Between −13 and 26 dBm, the measured gain deviations of a HVHF amplifier with a bias-voltage stabilizer are less than that of an amplifier without a bias-voltage stabilizer. In order to confirm the feasibility of the bias-voltage stabilizer, we compared the pulse-echo responses of the amplifiers, which are typically used for the evaluation of transducers or electronic components used in pulse-echo measurement systems. From the responses, we observed that the amplitudes of the echo signals of a VHF transducer triggered by the HVHF amplifier with a bias-voltage stabilizer were higher than those of the transducer triggered by the HVHF amplifier alone. The second, third, and fourth harmonic-distortion components of the HVHF amplifier with the bias-voltage stabilizer were also lower than those of the HVHF amplifier alone. Hence, the proposed scheme is a promising method for stabilizing the bias voltage of an HVHF amplifier, and improving the echo-signal quality of VHF transducers.

  5. First wind shear observation in PMSE with the tristatic EISCAT VHF radar

    OpenAIRE

    Mann, Ingrid; Häggström, I.; Tjulin, A; Rostami, S; Anyairo, CC; Dalin, P

    2016-01-01

    (c) American Geophysical Union, reprinted with permission. Article also available at source: https://doi.org/10.1002/2016JA023080 The Polar Summer Mesosphere has the lowest temperatures that occur in the entire Earth system. Water ice particles below the optically observable size range participate there in the formation of strong radar echoes (Polar Mesospheric Summer Echoes, PMSE). To study PMSE we carried out observations with the European Incoherent Scatter (EISCAT) VHF and EIS...

  6. Bias-Voltage Stabilizer for HVHF Amplifiers in VHF Pulse-Echo Measurement Systems.

    Science.gov (United States)

    Choi, Hojong; Park, Chulwoo; Kim, Jungsuk; Jung, Hayong

    2017-10-23

    The impact of high-voltage-high-frequency (HVHF) amplifiers on echo-signal quality is greater with very-high-frequency (VHF, ≥100 MHz) ultrasound transducers than with low-frequency (LF, ≤15 MHz) ultrasound transducers. Hence, the bias voltage of an HVHF amplifier must be stabilized to ensure stable echo-signal amplitudes. We propose a bias-voltage stabilizer circuit to maintain stable DC voltages over a wide input range, thus reducing the harmonic-distortion components of the echo signals in VHF pulse-echo measurement systems. To confirm the feasibility of the bias-voltage stabilizer, we measured and compared the deviations in the gain of the HVHF amplifier with and without a bias-voltage stabilizer. Between -13 and 26 dBm, the measured gain deviations of a HVHF amplifier with a bias-voltage stabilizer are less than that of an amplifier without a bias-voltage stabilizer. In order to confirm the feasibility of the bias-voltage stabilizer, we compared the pulse-echo responses of the amplifiers, which are typically used for the evaluation of transducers or electronic components used in pulse-echo measurement systems. From the responses, we observed that the amplitudes of the echo signals of a VHF transducer triggered by the HVHF amplifier with a bias-voltage stabilizer were higher than those of the transducer triggered by the HVHF amplifier alone. The second, third, and fourth harmonic-distortion components of the HVHF amplifier with the bias-voltage stabilizer were also lower than those of the HVHF amplifier alone. Hence, the proposed scheme is a promising method for stabilizing the bias voltage of an HVHF amplifier, and improving the echo-signal quality of VHF transducers.

  7. UV/Vis, MCD and EPR Spectra of Mononuclear Manganese and Molybdenum Complexes

    OpenAIRE

    Westphal, Anne

    2012-01-01

    This PhD thesis deals with the spectroscopic characterization of the electronic structures of mononuclear manganese and molybdenum complexes. At this, in addition to UV/Vis absorption spectroscopy, electron paramagnetic resonance (EPR) and magnetic circular dichroism (MCD) spectroscopy were applied in this work. Additionally, new procedures for the general analysis of MCD C-term intensities were developed within the scope of this thesis. It is divided into four parts. Following a general p...

  8. Membrane remodeling by amyloidogenic and non-amyloidogenic proteins studied by EPR

    Science.gov (United States)

    Varkey, Jobin; Langen, Ralf

    2017-07-01

    The advancement in site-directed spin labeling of proteins has enabled EPR studies to expand into newer research areas within the umbrella of protein-membrane interactions. Recently, membrane remodeling by amyloidogenic and non-amyloidogenic proteins has gained a substantial interest in relation to driving and controlling vital cellular processes such as endocytosis, exocytosis, shaping of organelles like endoplasmic reticulum, Golgi and mitochondria, intracellular vesicular trafficking, formation of filopedia and multivesicular bodies, mitochondrial fusion and fission, and synaptic vesicle fusion and recycling in neurotransmission. Misregulation in any of these processes due to an aberrant protein (mutation or misfolding) or alteration of lipid metabolism can be detrimental to the cell and cause disease. Dissection of the structural basis of membrane remodeling by proteins is thus quite necessary for an understanding of the underlying mechanisms, but it remains a formidable task due to the difficulties of various common biophysical tools in monitoring the dynamic process of membrane binding and bending by proteins. This is largely since membranes generally complicate protein structure analysis and this problem is amplified for structural analysis in the presence of different types of membrane curvatures. Recent EPR studies on membrane remodeling by proteins show that a significant structural information can be generated to delineate the role of different protein modules, domains and individual amino acids in the generation of membrane curvature. These studies also show how EPR can complement the data obtained by high resolution techniques such as X-ray and NMR. This perspective covers the application of EPR in recent studies for understanding membrane remodeling by amyloidogenic and non-amyloidogenic proteins that is useful for researchers interested in using or complimenting EPR to gain better understanding of membrane remodeling. We also discuss how a single

  9. Reconfiguring Cooperative Work by Visualizing EPR on Large Projected Screens

    DEFF Research Database (Denmark)

    Simonsen, Jesper

    Simonsen, J. (2006): Reconfiguring Cooperative Work by Visualizing EPR on Large Projected Screens, Paper presented at the PDC 2006 workshop on: Reconfiguring Healthcare: Issues in Computer Supported Cooperative Work in Healthcare Environments. Participatory Design Conference, Trento, Italy, August...

  10. Detection of nanodiamonds in biological samples by EPR spectrometry.

    Science.gov (United States)

    Inzhevatkin, E V; Baron, A V; Maksimov, N G; Volkova, M B; Puzyr, A P; Bondar, V S

    2017-11-01

    In model experiments in vitro, the applicability of the EPR spectrometry method for the detection of modified nanodiamonds (MNDs) in blood and homogenates of mouse organs has been established. A characteristic signal (g = 2.003, ΔH ≈ 10 G) is observed in the samples of biomaterials containing MNDs, the intensity of which increases linearly with the concentration of nanoparticles in the range of 1.6-200 μg MNDs per 1 mL of the sample. The EPR method in biomaterials reveals the presence of intrinsic paramagnetic centers, signals from which are superimposed on the signal from the MNDs. However, the intensity of these signals is small, which makes it possible to register the MNDs using EPR spectrometry with the necessary accuracy. The data obtained open up the prospects of using the EPR method for studies of the interorgan distribution, accumulation, and elimination of MNDs during their intravenous injection into experimental animals.

  11. Structure, optical properties and thermal stability of HfErO films deposited by simultaneous RF and VHF magnetron sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, H.Y. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Nanjing University of Posts and Telecommunications, School of Tongda, Nanjing (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); He, H.J.; Zhang, Z.; Jin, C.G.; Yang, Y.; Wang, Y.Y.; Ye, C. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Zhuge, L.J. [Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Soochow University, Analysis and Testing Center, Suzhou (China); Wu, X.M. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Chinese Academy of Sciences, State Key Laboratory of Functional Materials for Informatics, Shanghai Institute of Microsystem and Information Technology, Shanghai (China)

    2015-01-23

    HfErO films are deposited on Si substrates by simultaneous radio frequency (RF) and very high frequency (VHF) magnetron sputtering technique. The content of the doped ingredient of Er and the body composition of HfO{sub x} are, respectively, controlled through the VHF and RF powers. Low content of Er doping in the HfErO films can be achieved, because the VHF source of 27.12 MHz has higher ion energy and lower ion flux than the RF source resulting in low sputtering rate in the magnetron sputtering system. The structure, optical properties and thermal stability of the HfErO films are investigated in this work. Results show that the doped content of Er is independently controlled by the VHF power. The oxygen vacancies are created by the Er incorporation. The hafnium in the HfErO films forms mixed valence of Hf{sup 2+} and Hf{sup 4+}. The HfErO films are composed with the structures of HfO{sub 2}, HfO and ErO{sub x}, which can be optimized through the VHF power. At high VHF power, the Hf-Er-O bonds are formed, which demonstrates that the Er atoms are doped into the lattice of HfO{sub 2} in the HfErO films. The HfErO films have bad thermal stability as the crystallization temperature decreases from 900 to 800 C. After thermal annealing, cubic phase of HfO{sub 2} are stabilized, which is ascribed to the oxygen vacancies creation by the Er incorporation. The optical properties such as the refractive index and the optical band gap of the HfErO films are optimized by the VHF power. (orig.)

  12. EPR studies of carbonaceous compounds deposited on Al-MCM-41

    Energy Technology Data Exchange (ETDEWEB)

    Nowak, L.; Lezanska, M.; Rozwadowski, M.; Rozploch, F.; Marciniak, W

    2002-11-30

    Electron paramagnetic resonance (EPR) spectroscopy was used to investigate carbonaceous compounds deposited on aluminosilicate mesoporous molecular sieves of the MCM-41 type during conversion of cyclohexene at various temperatures. The amount of the deposited coke grew with the increasing Al content of the catalysts and with the decreasing reaction temperature. The deposits caused a reduction in both the surface area and pore volume of the Al-MCM-41 materials. The measurements showed that the EPR lines were complex. The performed analysis revealed a hyperfine structure the envelope of which was of the Gaussian shape. It was found that the spin concentration increased and the peak-to-peak width ({delta}B{sub pp}) decreased with the increasing reaction temperature.

  13. EPR investigation on radiation-induced graft copolymerization of styrene onto polyethylene: Energy transfer effects

    Energy Technology Data Exchange (ETDEWEB)

    Salih, M.A. [Dipartimento di Chimica Generale, Universita di Pavia, 27100 Pavia (Italy); Buttafava, A. [Dipartimento di Chimica Generale, Universita di Pavia, 27100 Pavia (Italy); Ravasio, U. [Dipartimento di Chimica Generale, Universita di Pavia, 27100 Pavia (Italy); Dipartimento di Ingegneria Nucleare, Politecnico di Milan (Italy); Mariani, M. [Dipartimento di Ingegneria Nucleare, Politecnico di Milan (Italy); Faucitano, A. [Dipartimento di Chimica Generale, Universita di Pavia, 27100 Pavia (Italy)]. E-mail: antonio.faucitano@unipv.it

    2007-08-15

    In this paper, energy transfer phenomena concerning the in-source graft copolymerization of styrene onto LDPE were investigated through the EPR analysis of the radical intermediates. The model solution experiments have shown a substantial deviation of the experimental G (radicals) values with respect to the additivity law, which reflect the negative effect of the styrene monomer concentration on the initiation rate of the graft copolymerization. The EPR measurements performed on polyethylene-co-styrene graft copolymers of various composition following low-temperature vacuum gamma irradiation have confirmed the decrease of the total radical yields with increasing the styrene concentration. The effect was partly attributed to the heterogeneity of the graft copolymer matrix and to the lack of molecular mobility in the solid state at low temperature, which prevents the attainment of the favourable geometrical configurations in intermolecular energy and charge transfer events.

  14. EPR-based distance measurements at ambient temperature

    Science.gov (United States)

    Krumkacheva, Olesya; Bagryanskaya, Elena

    2017-07-01

    Pulsed dipolar (PD) EPR spectroscopy is a powerful technique allowing for distance measurements between spin labels in the range of 2.5-10.0 nm. It was proposed more than 30 years ago, and nowadays is widely used in biophysics and materials science. Until recently, PD EPR experiments were limited to cryogenic temperatures (T biomolecules, the influence of a linker between the spin probe and biomolecule, and future opportunities.

  15. Lorentz symmetry breaking effects on relativistic EPR correlations

    Energy Technology Data Exchange (ETDEWEB)

    Belich, H. [Universidade Federal do Espirito Santo, Departamento de Fisica e Quimica, Vitoria, ES (Brazil); Furtado, C.; Bakke, K. [Universidade Federal da Paraiba, Departamento de Fisica, Caixa Postal 5008, Joao Pessoa, PB (Brazil)

    2015-09-15

    Lorentz symmetry breaking effects on relativistic EPR (Einstein-Podolsky-Rosen) correlations are discussed. From the modified Maxwell theory coupled to gravity, we establish a possible scenario of the Lorentz symmetry violation and write an effective metric for the Minkowski spacetime. Then we obtain the Wigner rotation angle via the Fermi-Walker transport of spinors and consider the WKB (Wentzel-Kramers-Brillouin) approximation in order to study the influence of Lorentz symmetry breaking effects on the relativistic EPR correlations. (orig.)

  16. ER=EPR, GHZ, and the Consistency of Quantum Measurements

    OpenAIRE

    Susskind, Leonard

    2014-01-01

    This paper illustrates various aspects of the ER=EPR conjecture.It begins with a brief heuristic argument, using the Ryu-Takayanagi correspondence, for why entanglement between black holes implies the existence of Einstein-Rosen bridges. The main part of the paper addresses a fundamental question: Is ER=EPR consistent with the standard postulates of quantum mechanics? Naively it seems to lead to an inconsistency between observations made on entangled systems by different observers. The resolu...

  17. EPR and NMR studies of amorphous aluminum borates

    NARCIS (Netherlands)

    Simon, S.; Pol, A. van der; Reijerse, E.J.; Kentgens, A.P.M.; Moorsel, G.J.M.P. van; Boer, E. de

    1994-01-01

    Amorphous aluminium borates, Al2(1–x)B2xO3 with O [less-than-or-eq]x[less-than-or-eq] 0.5, prepared from mixtures of aluminium nitrate, boric acid and glycerol, have been studied by EPR and 27Al MASNMR as a function of composition and heat-treatment temperature (Tt[less-than-or-eq] 860 °C). EPR

  18. Beyond the EPR: Complementary roles of the hospital-wide electronic health record and clinical departmental systems

    Science.gov (United States)

    2009-01-01

    Background Many hospital departments have implemented small clinical departmental systems (CDSs) to collect and use patient data for documentation as well as for other department-specific purposes. As hospitals are implementing institution-wide electronic patient records (EPRs), the EPR is thought to be integrated with, and gradually substitute the smaller systems. Many EPR systems however fail to support important clinical workflows. Also, successful integration of systems has proven hard to achieve. As a result, CDSs are still in widespread use. This study was conducted to see which tasks are supported by CDSs and to compare this to the support offered by the EPR. Methods Semi-structured interviews with users of 16 clinicians using 15 different clinical departmental systems (CDS) at a Medium-sized University hospital in Norway. Inductive analysis of transcriptions from the audio taped interviews. Results The roles of CDSs were complementary to those of the hospital-wide EPR system. The use of structured patient data was a characteristic feature. This facilitated quality development and supervision, tasks that were poorly supported by the EPR system. The structuring of the data also improved filtering of information to better support clinical decision-making. Because of the high value of the structured patient data, the users put much effort in maintaining their integrity and representativeness. Employees from the departments were also engaged in the funding, development, implementation and maintenance of the systems. Conclusion Clinical departmental systems are vital to the activities of a clinical hospital department. The development, implementation and clinical use of such systems can be seen as bottom-up, user-driven innovations. PMID:19523198

  19. EPR study on non- and gamma-irradiated herbal pills

    Science.gov (United States)

    Aleksieva, K.; Lagunov, O.; Dimov, K.; Yordanov, N. D.

    2011-06-01

    The results of EPR studies on herbal pills of marigold, hawthorn, yarrow, common balm, tutsan, nettle and thyme before and after gamma-irradiation are reported. Before irradiation all samples exhibit one weak singlet EPR line with a g-factor of 2.0048±0.0005. After irradiation herbal pills could be separated in two groups according to their EPR spectra. Radiation-induced free radicals in pills of marigold, yarrow, nettle, tutsan and thyme could be attributed mainly to saccharide excipients. Tablets of hawthorn and common balm show "cellulose-like" EPR spectrum, superimposed on partly resolved carbohydrate spectrum, due to the active part (herb) and inulin, which is present in the pills as an excipient. Fading study of the radiation-induced EPR signals confirms that sugar radicals are more stable than cellulose species. The reported results show that the presence of characteristic EPR spectra of herbal pills due to excipients or active part can be used as unambiguous proof of radiation processing within 35 or more days after irradiation.

  20. EPR study on non- and gamma-irradiated herbal pills

    Energy Technology Data Exchange (ETDEWEB)

    Aleksieva, K., E-mail: katerina_bas@abv.b [Institute of Catalysis, Bulgarian Academy of Sciences, 1113 Sofia (Bulgaria); Lagunov, O. [Institute of Catalysis, Bulgarian Academy of Sciences, 1113 Sofia (Bulgaria); Dimov, K. [Institute of Cryobiology and Food Technologies, 1162 Sofia (Bulgaria); Yordanov, N.D. [Institute of Catalysis, Bulgarian Academy of Sciences, 1113 Sofia (Bulgaria)

    2011-06-15

    The results of EPR studies on herbal pills of marigold, hawthorn, yarrow, common balm, tutsan, nettle and thyme before and after gamma-irradiation are reported. Before irradiation all samples exhibit one weak singlet EPR line with a g-factor of 2.0048{+-}0.0005. After irradiation herbal pills could be separated in two groups according to their EPR spectra. Radiation-induced free radicals in pills of marigold, yarrow, nettle, tutsan and thyme could be attributed mainly to saccharide excipients. Tablets of hawthorn and common balm show 'cellulose-like' EPR spectrum, superimposed on partly resolved carbohydrate spectrum, due to the active part (herb) and inulin, which is present in the pills as an excipient. Fading study of the radiation-induced EPR signals confirms that sugar radicals are more stable than cellulose species. The reported results show that the presence of characteristic EPR spectra of herbal pills due to excipients or active part can be used as unambiguous proof of radiation processing within 35 or more days after irradiation.

  1. Combining EPR spectroscopy and X-ray crystallography to elucidate the structure and dynamics of conformationally constrained spin labels in T4 lysozyme single crystals.

    Science.gov (United States)

    Consentius, Philipp; Gohlke, Ulrich; Loll, Bernhard; Alings, Claudia; Heinemann, Udo; Wahl, Markus C; Risse, Thomas

    2017-08-09

    Electron paramagnetic resonance (EPR) spectroscopy in combination with site-directed spin labeling is used to investigate the structure and dynamics of conformationally constrained spin labels in T4 lysozyme single crystals. Within a single crystal, the oriented ensemble of spin bearing moieties results in a strong angle dependence of the EPR spectra. A quantitative description of the EPR spectra requires the determination of the unit cell orientation with respect to the sample tube and the orientation of the spin bearing moieties within the crystal lattice. Angle dependent EPR spectra were analyzed by line shape simulations using the stochastic Liouville equation approach developed by Freed and co-workers and an effective Hamiltonian approach. The gain in spectral information obtained from the EPR spectra of single crystalline samples taken at different frequencies, namely the X-band and Q-band, allows us to discriminate between motional models describing the spectra of isotropic solutions similarly well. In addition, it is shown that the angle dependent single crystal spectra allow us to identify two spin label rotamers with very similar side chain dynamics. These results demonstrate the utility of single crystal EPR spectroscopy in combination with spectral line shape simulation techniques to extract valuable dynamic information not readily available from the analysis of isotropic systems. In addition, it will be shown that the loss of electron density in high resolution diffraction experiments at room temperature does not allow us to conclude that there is significant structural disorder in the system.

  2. PMSE observations with the EISCAT VHF- and UHF-radars: Ice particles and their effect on ambient electron densities

    Science.gov (United States)

    Li, Qiang; Rapp, Markus

    2013-11-01

    It is now well understood that the occurrence of PMSE is closely connected to the presence of ice particles. These ice particles modify the ambient electron density by electron attachment which occasionally leads to large electron density depletions which have also been called ‘biteouts’. There has been some debate in the literature regarding the relative depth of such depletions which is usually expressed by the parameter Λ=|ZA|NA/ne. Here, |ZA|NA is the charge number density of ice particles and ne is the electron density. In this paper, we present, for the first time, the statistical distribution of Λ using measurements with the EISCAT VHF- and UHF-radars. Based on 25 h of simultaneous observations, we derived a total of 757 Λ values based on 15 min of data each. In each of these cases, PMSE were observed with the EISCAT VHF-radar but not with the UHF-radar and the UHF-measurement were hence used to determine the electron density profile. From these 757 cases, there are 699 cases with Λ⪡1, and only 33 cases with Λ>0.5 (21 cases with Λ>1). A correlation analysis of Λ versus PMSE volume reflectivities further reveals that there is no strong dependence between the two parameters. This is in accordance with current PMSE-theory based on turbulence in combination with a large Schmidt-number. The maxima of Λ from each profile show a negative relationship with the undisturbed electron densities deduced at the same altitudes. This reveals that the variability of Λ mainly depends on the variability of the electron densities. In addition, variations of aerosol number densities may also play a role. Although part of the observations were conducted during the HF heating experiments, the so-called overshoot effects did not significantly bias our statistical results. In order to avoid missing biteouts because of a superposition of coherent and incoherent scatter in the UHF-data, we finally calculated spectral parameters n by applying a simple fit to auto

  3. EPR study of gamma-irradiated amphi-phenylglyoxime single crystals

    Energy Technology Data Exchange (ETDEWEB)

    Dereli, O., E-mail: odereli@selcuk.edu.t [A. Kelesoglu Education Faculty, Department of Physics, Selcuk University, Meram, 42090, Konya (Turkey); Tuerkkan, E. [A. Kelesoglu Education Faculty, Department of Physics, Selcuk University, Meram, 42090, Konya (Turkey); Ozmen, A.; Yueksel, H. [Science Faculty, Department of Physics, Selcuk University, Selcuklu, 42079, Konya (Turkey)

    2011-06-15

    Gamma-irradiated single crystals of Amphi-phenylglyoxime (APGO) were investigated using electron paramagnetic resonance (EPR) at different orientations in a magnetic field at room temperature (298 K). Considering the chemical structure and the experimental spectra of the irradiated single-crystals of APGO, we assumed that two different paramagnetic species, labeled as R{sup *} and R{sup **}, are either two iminoxy radicals formed by the abstraction of a H atom from different oxime branches or are different conformations of an iminoxy radical. Pursuant to this assumption, RA- and RB-type iminoxy radicals were modeled by the abstraction of H atoms from different oxime branches, and conformational analysis of these modeled radicals was performed using the semi-empirical AM1 and B3LYP/6-31+G(d,p) methods. EPR parameters were calculated for the modeled radicals using the B3LYP method and EPR-III basis set. Theoretically calculated values of the most stable conformers (RA-1 and RB-1) of the modeled radicals are in good agreement with the experimental EPR parameters determined from the spectra (differences in isotropic hyperfine coupling constant values <5%, and differences in isotropic g values fall into 1 ppt). Thus, from the findings of the present study, we strongly suggest that the experimentally observed R{sup *} and R{sup **} radicals in the single crystal of amphi-phenylglyoxime are the most stable conformers of RA- and RB-type modeled iminoxy radicals, respectively. The experimental g factors and hyperfine coupling constants were found to be anisotropic, with average values of g=2.0052, A({sup 14}N)=29.50 G, A({sup 1}H)=25.30 G for R{sup *}, and g=2.0057, A({sup 14}N)=34.50 G for R{sup **}.

  4. Delocalisation of photoexcited triplet states probed by transient EPR and hyperfine spectroscopy

    Science.gov (United States)

    Richert, Sabine; Tait, Claudia E.; Timmel, Christiane R.

    2017-07-01

    Photoexcited triplet states play a crucial role in photochemical mechanisms: long known to be of paramount importance in the study of photosynthetic reaction centres, they have more recently also been shown to play a major role in a number of applications in the field of molecular electronics. Their characterisation is crucial for an improved understanding of these processes with a particular focus on the determination of the spatial distribution of the triplet state wavefunction providing information on charge and energy transfer efficiencies. Currently, active research in this field is mostly focussed on the investigation of materials for organic photovoltaics (OPVs) and organic light emitting diodes (OLEDs). As the properties of triplet states and their spatial extent are known to have a major impact on device performance, a detailed understanding of the factors governing triplet state delocalisation is at the basis of the further development and improvement of these devices. Electron Paramagnetic Resonance (EPR) has proven a valuable tool in the study of triplet state properties and both experimental methods as well as data analysis and interpretation techniques have continuously improved over the last few decades. In this review, we discuss the theoretical and practical aspects of the investigation of triplet states and triplet state delocalisation by transient continuous wave and pulse EPR and highlight the advantages and limitations of the presently available techniques and the current trends in the field. Application of EPR in the study of triplet state delocalisation is illustrated on the example of linear multi-porphyrin chains designed as molecular wires.

  5. Free Radical Scavenging Activity of Drops and Spray Containing Propolis-An EPR Examination.

    Science.gov (United States)

    Olczyk, Pawel; Komosinska-Vassev, Katarzyna; Ramos, Pawel; Mencner, Lukasz; Olczyk, Krystyna; Pilawa, Barbara

    2017-01-13

    The influence of heating at a temperature of 50 °C and UV-irradiation of propolis drops and spray on their free radical scavenging activity was determined. The kinetics of interactions of the propolis samples with DPPH free radicals was analyzed. Interactions of propolis drops and propolis spray with free radicals were examined by electron paramagnetic resonance spectroscopy. A spectrometer generating microwaves of 9.3 GHz frequency was used. The EPR spectra of the model DPPH free radicals were compared with the EPR spectra of DPPH in contact with the tested propolis samples. The antioxidative activity of propolis drops and propolis spray decreased after heating at the temperature of 50 °C. A UV-irradiated sample of propolis drops more weakly scavenged free radicals than an untreated sample. The antioxidative activity of propolis spray increased after UV-irradiation. The sample of propolis drops heated at the temperature of 50 °C quenched free radicals faster than the unheated sample. UV-irradiation weakly changed the kinetics of propolis drops or spray interactions with free radicals. EPR analysis indicated that propolis drops and spray should not be stored at a temperature of 50 °C. Propolis drops should not be exposed to UV-irradiation.

  6. Structural Characterization of Polymer-Clay Nanocomposites Prepared by Co-Precipitation Using EPR Techniques

    Directory of Open Access Journals (Sweden)

    Udo Kielmann

    2014-02-01

    Full Text Available Polymer-clay nanocomposites (PCNCs containing either a rubber or an acrylate polymer were prepared by drying or co-precipitating polymer latex and nanolayered clay (synthetic and natural suspensions. The interface between the polymer and the clay nanoparticles was studied by electron paramagnetic resonance (EPR techniques by selectively addressing spin probes either to the surfactant layer (labeled stearic acid or the clay surface (labeled catamine. Continuous-wave (CW EPR studies of the surfactant dynamics allow to define a transition temperature T* which was tentatively assigned to the order-disorder transition of the surfactant layer. CW EPR studies of PCNC showed that completely exfoliated nanoparticles coexist with agglomerates. HYSCORE spectroscopy in PCNCs showed couplings within the probe −assigned with DFT computations− and couplings with nuclei of the environment, 1H and 23Na for the surfactant layer probe, and 29Si, 7Li, 19F and 23Na for the clay surface probe. Analysis of these couplings indicates that the integrity of the surfactant layer is conserved and that there are sizeable ionic regions containing sodium ions directly beyond the surfactant layer. Simulations of the very weak couplings demonstrated that the HYSCORE spectra are sensitive to the composition of the clay and whether or not clay platelets stack.

  7. The measurement of oxygen in vivo using EPR techniques

    Energy Technology Data Exchange (ETDEWEB)

    Swartz, Harold M. [Dartmouth Medical School, Hanover, NH 03755 (United States); Clarkson, Robert B. [College of Veterinary Medicine, University of Illinois, Urbana, IL 61801 (United States)

    1998-07-01

    The measurement of pO{sub 2} in vivo using EPR has some features which have already led to very useful applications and this approach is likely to have increasingly wide and effective use. It is based on the effect of oxygen on EPR spectra which provides a sensitive and accurate means to measure pO{sub 2} quantitatively. The development of oxygen-sensitive paramagnetic materials which are very stable, combined with instrumental developments, has been crucial to the in vivo applications of this technique. The physical basis and biological applications of in vivo EPR oximetry are reviewed, with particular emphasis on the use of EPR spectroscopy at 1 GHz using particulate paramagnetic materials for the repetitive and non-invasive measurement of pO{sub 2} in tissues. In vivo EPR has already produced some very useful results which have contributed significantly to solving important biological problems. The characteristics of EPR oximetry which appear to be especially useful are often complementary to existing techniques for measuring oxygen in tissues. These characteristics include the capability of making repeated measurements from the same site, high sensitivity to low levels of oxygen, and non-invasive options. The existing techniques are especially useful for studies in small animals, where the depth of measurements is not an overriding issue. In larger animals and potentially in human subjects, non-invasive techniques seem to be immediately applicable to study phenomena very near the surface (within 10 mm) while invasive techniques have some very promising uses. The clinical uses of EPR oximetry which seem especially promising and likely to be undertaken in the near future are long-term monitoring of the status and response to treatment of peripheral vascular disease and optimizing cancer therapy by enabling it to be modified on the basis of the pO{sub 2} measured in the tumour. (author)

  8. EPR of transition metal ions in NZP ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Yegor`kova, O.; Kryukova-Orlova, A.I. [Univ. of Nizhnii Novgorod (Russian Federation); Stefanovsky, S.V. [SIA Radon, Moscow (Russian Federation)

    1995-12-31

    NZP-ceramics have been produced by different methods such as sol-gel, flux melting and sintering of dry salts or phosphates. Formation of NZP and related phases was confirmed by X-ray diffraction analysis. Electron paramagnetic resonance (EPR) was applied to evaluate a structure positions of paramagnetic ions and nature of radiation-induced centers. EPR responses from transition metal ions Fe{sup 3+} and Mn{sup 2+} with electron configuration 3d{sup 5} (ground state {sup 6}S{sub 5/2}) which occurred as impurities in raw materials were registered in powders of NZP-ceramics. Fine structure arising due to high spin iron complexes is well resolved. A part of Fe{sup 3+} ions substitutes for Zr{sup 4+} and another part of one substitutes for Na{sup +} ions in six-fold coordinated positions. A great value of hyperfine structure (hfs) constant (9.3 mT) shows a high ionic character of Mn-O bonds in the first coordination sphere. A coordination number is close to 6. Fine structure of Mn{sup 2+} ions are not well resolved. A comparison of the spectra of samples containing various alkali cations shows the substitution for cations in series of Li-Na-K-Rb-Cs does not result in fundamental variation in spectra except for CZP ceramics where the response with g=4.3 due to Fe{sup 3+} in strong ligand field rather than response with g=2.0 due to Fe{sup 3+} in weak field is observed. An investigation of some samples doped by 0.1...0.5 mole % of Fe{sup 3+} or Gd{sup 3+} has been carried out and principal spin-Hamiltonian parameters have been determined. The increase of Fe and Gd ions content as compared to impurity substituting for Zr and possibly Na in their own structural positions results in noticeable site distortion. Gamma irradiation of NZP ceramics results in formation of radiation-induced paramagnetic centers connected to phosphorus-oxygen. The nature and concentration of these centers depend on production method. The lowest defect concentration is in hot-pressed ceramics.

  9. Forming and detection of digital watermarks in the System for Automatic Identification of VHF Transmissions

    Directory of Open Access Journals (Sweden)

    О. В. Шишкін

    2013-07-01

    Full Text Available Forming and detection algorithms for digital watermarks are designed for automatic identification of VHF radiotelephone transmissions in the maritime and aeronautical mobile services. An audible insensitivity and interference resistance of embedded digital data are provided by means of OFDM technology jointly with normalized distortions distribution and data packet detection by the hash-function. Experiments were carried out on the base of ship’s radio station RT-2048 Sailor and USB ADC-DAC module of type Е14-140M L-CARD in the off-line processing regime in Matlab medium

  10. Luminous phenomena and electromagnetic VHF wave emission originated from earthquake-related radon exhalation

    Science.gov (United States)

    Seki, A.; Tobo, I.; Omori, Y.; Muto, J.; Nagahama, H.

    2013-12-01

    Anomalous luminous phenomena and electromagnetic wave emission before or during earthquakes have been reported (e.g., the 1965 Matsushiro earthquake swarm). However, their mechanism is still unsolved, in spite of many models for these phenomena. Here, we propose a new model about luminous phenomena and electromagnetic wave emission during earthquake by focusing on atmospheric radon (Rn-222) and its daughter nuclides (Po-218 and Po-214). Rn-222, Po-218 and Po-214 are alpha emitters, and these alpha particles ionize atmospheric molecules. A light emission phenomenon, called 'the air luminescence', is caused by de-excitation of the ionized molecules of atmospheric nitrogen due to electron impact ionization from alpha particles. The de-excitation is from the second positive system of neutral nitrogen molecules and the first negative system of nitrogen molecule ion. Wavelengths of lights by these transitions include the visible light wavelength. So based on this mechanism, we proposed a new luminous phenomenon model before or during earthquake: 1. The concentration of atmospheric radon and its daughter nuclides increase anomalously before or during earthquakes, 2. Nitrogen molecules and their ions are excited by alpha particles emitted from Rn-222, Po-218 and Po-214, and air luminescence is generated by their de-excitation. Similarly, electromagnetic VHF wave emission can be explained by ionizing effect of radon and its daughter nuclides. Boyarchuk et al. (2005) proposed a model that electromagnetic VHF wave emission is originated when excited state of neutral clusters changes. Radon gas ionizes atmosphere and forms positively and negatively charged heavy particles. The process of ion hydration in ordinary air can be determined by the formation of complex chemically active structures of the various types of ion radicals. As a result of the association of such hydration radical ions, a neutral cluster, which is dipole quasi-molecules, is formed. A neutral cluster

  11. Observations of Mesospheric Turbulence by Rocket Probe and VHF Radar, Part 2.4A

    Science.gov (United States)

    Royrvik, O.; Smith, L. G.

    1984-01-01

    Data from the Jicamarca VHF radar and from a Languir probe fine-structure on a Nike Orion rocket launched from Punto Lobos, Peru, have been compared. A single mesospheric scattering layer was observed by the radar. The Langmuir probe detected irregularities in the electron-density profile in a narrow region between 85.2 and 86.6 km. It appears from a comparison between these two data sets that turbulence in the neutral atmosphere is the mechanism generating the refractive index irregularities.

  12. EPR and optical absorption studies of VO{sup 2+} ion doped magnesium citrate decahydrate single crystals

    Energy Technology Data Exchange (ETDEWEB)

    Dwivedi, Prashant [Department of Physics, Kali Charan Nigam Institute of Technology, Banda 210001, UP (India); Kripal, Ram, E-mail: ram_kripal2001@rediffmail.co, E-mail: prashant_kcnit@rediffmail.co [EPR Laboratory, Department of Physics, University of Allahabad, Allahabad 211002 (India)

    2010-10-15

    An X-band electron paramagnetic resonance (EPR) study of VO{sup 2+} ions in magnesium citrate decahydrate single crystals was done at room temperature. Detailed EPR analysis indicated the presence of two magnetically inequivalent VO{sup 2+} sites. Both the vanadyl complexes were found to take up substitutional positions. The angular variation of the EPR spectra in three planes a{sup *}b, bc and ca{sup *} were used to determine principal g and A tensors. For the two sites the spin Hamiltonian parameters are site I: g{sub x}=2.0976, g{sub y}=1.9093, g{sub z}=1.9505, |A{sub x}|=73, |A{sub y}|=115, |A{sub z}|=237x10{sup -4} cm{sup -1}; site II: g{sub x}=2.0735, g{sub y}=1.9235, g{sub z}=1.9699, |A{sub x}|=72, |A{sub y}|=111, |A{sub z}|=233x10{sup -4} cm{sup -1}. An optical absorption study was also performed at room temperature, and absorption bands were assigned to various transitions. The theoretical band positions were estimated using energy expressions, and good agreement with experimental values was found. By correlating EPR and optical data, different molecular orbital coefficients were evaluated; the nature of the bonding in the crystal is discussed.

  13. Testing and linearity calibration of films of phenol compounds exposed to thermal neutron field for EPR dosimetry.

    Science.gov (United States)

    Gallo, S; Panzeca, S; Longo, A; Altieri, S; Bentivoglio, A; Dondi, D; Marconi, R P; Protti, N; Zeffiro, A; Marrale, M

    2015-12-01

    This paper reports the preliminary results obtained by Electron Paramagnetic Resonance (EPR) measurements on films of IRGANOX® 1076 phenols with and without low content (5% by weight) of gadolinium oxide (Gd2O3) exposed in the thermal column of the Triga Mark II reactor of LENA (Laboratorio Energia Nucleare Applicata) of Pavia (Italy). Thanks to their size, the phenolic films here presented are good devices for the dosimetry of beams with high dose gradient and which require accurate knowledge of the precise dose delivered. The dependence of EPR signal as function of neutron dose was investigated in the fluence range between 10(11) cm(-2) and 10(14) cm(-2). Linearity of EPR response was found and the signal was compared with that of commercial alanine films. Our analysis showed that gadolinium oxide (5% by weight) can enhance the thermal neutron sensitivity more than 18 times. Irradiated dosimetric films of phenolic compound exhibited EPR signal fading of about 4% after 10 days from irradiation. Copyright © 2015 Elsevier Ltd. All rights reserved.

  14. EPR and optical absorption studies of Cu{sup 2+} ions doped magnesium citrate decahydrate single crystals

    Energy Technology Data Exchange (ETDEWEB)

    Dwivedi, Prashant, E-mail: prashant_kcnit@rediffmail.co [Department of Physics, Kali Charan Nigam Institute of Technology, Banda (U.P.) 210001 (India); Kripal, Ram, E-mail: ram_kripal2001@rediffmail.co [EPR Laboratory, Department of Physics, University of Allahabad, 22/5A Katra Road, Allahabad, 211002 (India); Misra, Madan Gopal [EPR Laboratory, Department of Physics, University of Allahabad, 22/5A Katra Road, Allahabad, 211002 (India)

    2010-06-04

    X-band electron paramagnetic resonance (EPR) studies of Cu{sup 2+} ions in magnesium citrate decahydrate single crystals are done at room temperature. Detailed EPR analysis indicates the presence of only one Cu{sup 2+} site. Cu{sup 2+} is found to take up substitutional position at Mg site. The angular variation of the EPR spectra in three planes a*b, bc and ca* are used to determine principal g and A tensors. The spin Hamiltonian parameters are: g{sub x} = 2.0346, g{sub y} = 2.1400, g{sub z} = 2.3874, A{sub x} = 57, A{sub y} = 76, A{sub z} = 99 (x10{sup -4}) cm{sup -1}. The optical absorption study is also carried out at room temperature and absorption bands are assigned to various transitions. The theoretical band positions are estimated using energy expressions and a good agreement is obtained with the experimental values. By correlating EPR and optical data, different molecular orbital coefficients are evaluated and the nature of bonding in the complex is discussed.

  15. Identification and dosimetry of irradiated walnuts (Juglans regia) using EPR

    Science.gov (United States)

    Maghraby, A.; Salama, E.; Sami, A.; Mansour, A.; El-Sayed, M.

    2012-03-01

    Electron paramagnetic resonance (EPR) is an easy, fast, and reliable tool for identification of irradiated food. Untreated nuts may encounter hazards of carrying several pathogens or microbial contamination; walnuts are of specific importance due to their nutritional and medicinal values, and hence walnut processing via gamma irradiation is a necessary step. EPR was employed for the identification and dosimetry of Cs-137 gamma-irradiated walnuts (shells and kernels). Several important parameters were studied, such as spectral features, microwave power dependence of signal intensities, and short- and long-term time dependences. Responses of walnut shells and kernels to different radiation doses in the range 0-10 kGy were investigated. Results confirmed that EPR is a suitable tool for the identification and dosimetry of irradiated walnuts using either their shells or only kernels.

  16. ER=EPR, GHZ, and the consistency of quantum measurements

    Energy Technology Data Exchange (ETDEWEB)

    Susskind, Leonard [Stanford Institute for Theoretical Physics and Department of Physics, Stanford University, Stanford, CA (United States)

    2016-01-15

    This paper illustrates various aspects of the ER=EPR conjecture. It begins with a brief heuristic argument, using the Ryu-Takayanagi correspondence, for why entanglement between black holes implies the existence of Einstein-Rosen bridges. The main part of the paper addresses a fundamental question: Is ER=EPR consistent with the standard postulates of quantum mechanics? Naively it seems to lead to an inconsistency between observations made on entangled systems by different observers. The resolution of the paradox lies in the properties of multiple black holes, entangled in the Greenberger-Horne-Zeilinger pattern. The last part of the paper is about entanglement as a resource for quantum communication. ER=EPR provides a way to visualize protocols like quantum teleportation. In some sense teleportation takes place through the wormhole, but as usual, classical communication is necessary to complete the protocol. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  17. Development of fire protection standards for the EPR project

    Energy Technology Data Exchange (ETDEWEB)

    Frank, H.J. [Nuclear Power International, Paris (France); Kaercher, M. [Electricite de France (EDF), 69 - Villeurbanne (France); Wittmann, R. [Siemens AG Energieerzeugung KWU, Erlangen (Germany)

    2000-05-01

    In 1989 Framatome and Siemens decided by setting up their joint subsidiary NPI (Nuclear Power International) to co-operate in designing a new European Pressurised Water Reactor, the EPR. French and German utilities decided to participate in this project. In parallel to the co-operation on supplier's and utility's side, the French and German safety authorities and safety experts wanted to work closely together in order to harmonise and further develop the outstanding safety standards in France and Germany. An organisation has been set up to elaborate common codes related to the EPR design, at the level of the French design and construction rules (RCC) of the German KTA safety standards and DIN standards for nuclear technology, the so-called EPR technical codes (ETC). In this context the decision was made to develop a new fire protection code, the ETC-F, which should be harmonised between France and Germany. The article gives an insight in the developing process of the ETC-F and an outlook on existing and perhaps further national activities. (orig.) [German] Mit der Gruendung der NPI (Nuclear Power International) im Jahr 1989 haben Framatome und Siemens ihre Zusammenarbeit bei der Entwicklung eines neuen Europaeischen Druckwasser-Reaktors (EPR) vereinbart und fuer dieses Projekt eine Beteiligung von Energieversorgungsunternehmen aus Frankreich und Deutschland erreicht. Zeitgleich hierzu haben sich atomrechtliche Genehmigungsbehoerden und Gutachter beider Laender abgesprochen, ebenfalls eng zusammen zu arbeiten, um ihre zukuenftigen Anforderungen nach Moeglichkeit zu harmonisieren. Fuer den EPR sollten deshalb gemeinsame Vorschriften, sog. 'EPR technical codes (ETCs)' erarbeitet werden, welche einen vergleichbaren Tiefgang, wie die bestehenden franzoesischen (RCC) und deutschen (KTA) sicherheitstechnischen Regeln sowie die deutschen kerntechnischen Industrienormen (DIN) haben sollten. Hierzu gehoerte auch eine Brandschutzvorschrift, der ETC

  18. An HF and lower VHF spectrum assessment system exploiting instantaneously wideband capture

    Science.gov (United States)

    Barnes, Rod I.; Singh, Malkiat; Earl, Fred

    2017-09-01

    We report on a spectral environment evaluation and recording (SEER) system, for instantaneously wideband spectral capture and characterization in the HF and lower VHF band, utilizing a direct digital receiver coupled to a data recorder. The system is designed to contend with a wide variety of electromagnetic environments and to provide accurately calibrated spectral characterization and display from very short (ms) to synoptic scales. The system incorporates a novel RF front end involving automated gain and equalization filter selection which provides an analogue frequency-dependent gain characteristic that mitigates the high dynamic range found across the HF and lower VHF spectrum. The system accurately calibrates its own internal noise and automatically subtracts this from low variance, external spectral estimates, further extending the dynamic range over which robust characterization is possible. Laboratory and field experiments demonstrate that the implementation of these concepts has been effective. Sensitivity to varying antenna load impedance of the internal noise reduction process has been examined. Examples of software algorithms to provide extraction and visualization of spectral behavior over narrowband, wideband, short, and synoptic scales are provided. Application in HF noise spectral density monitoring, spectral signal strength assessment, and electromagnetic interference detection is possible with examples provided. The instantaneously full bandwidth collection provides some innovative applications, and this is demonstrated by the collection of discrete lightning emissions, which form fast ionograms called "flashagrams" in power-delay-frequency plots.

  19. Measurements and simulation of ionospheric scattering on VHF and UHF radar signals: Channel scattering function

    Science.gov (United States)

    Rogers, Neil C.; Cannon, Paul S.; Groves, Keith M.

    2009-02-01

    The design and operation of transionospheric VHF and UHF radars requires knowledge of amplitude and phase scintillation due to ionospheric scattering. Phase coherence is of particular importance where long coherent integration periods and large bandwidths are required. A thin phase screen, parabolic equation based, Trans-Ionospheric Radio Propagation Simulator (TIRPS) is described. Modeled channel scattering functions (CSFs) are compared to experimental VHF and UHF data derived from the Advanced Research Projects Agency Long-range Tracking and Instrumentation Radar on Kwajalein Island (9.4°N, 166.8°E). TIRPS quantitatively reproduces the experimental results, including the quasi-parabolic profile observed in the measured CSFs under strong turbulence conditions. Variations in the simulated CSF with ionospheric phase screen parameters are also presented. Under conditions of high integrated strength of turbulence (CkL), a low phase spectral index (p = 1), indicating relatively dense small-scale irregularities, produces pronounced range spreading. Conversely, when the spectral index is high (p = 4), indicative of strong focusing/defocusing by large-scale irregularities, there is increased Doppler spreading and, when the outer scale of irregularities is large, a greater likelihood of asymmetry of the CSF about the zero Doppler axis.

  20. PMSE strength during enhanced D region electron densities: Faraday rotation and absorption effects at VHF frequencies

    Science.gov (United States)

    Chau, Jorge L.; Röttger, Jürgen; Rapp, Markus

    2014-10-01

    In this paper we study the effects of absorption and Faraday rotation on measurements of polar mesosphere summer echoes (PMSE). We found that such effects can produce significant reduction of signal-to-noise ratio (SNR) when the D region electron densities (Ne) are enhanced, and VHF radar systems with linearly polarized antennas are used. In particular we study the expected effects during the strong solar proton event (SPE) of July 2000, also known as the Bastille day flare event. During this event, a strong anti-correlation between the PMSE SNR and the D-region Ne was found over three VHF radar sites at high latitudes: Andøya, Kiruna, and Svalbard. This anti-correlation has been explained (a) in terms of transport effects due to strong electric fields associated to the SPE and (b) due to a limited amount of aerosol particles as compared to the amount of D-region electrons. Our calculations using the Ne profiles used by previous researchers explain most, if not all, of the observed SNR reduction in both time (around the SPE peak) and altitude. This systematic effect, particularly the Faraday rotation, should be recognized and tested, and possibly avoided (e.g., using circular polarization), in future observations during the incoming solar maximum period, to contribute to the understanding of PMSE during enhanced D region Ne.

  1. VHF/UHF radar observations of tropical mesoscale convective systems over southern India

    Directory of Open Access Journals (Sweden)

    K. Kishore Kumar

    2005-07-01

    Full Text Available Several campaigns have been carried out to study the convective systems over Gadanki (13.5° N, 79.2° E, a tropical station in India, using VHF and UHF radars. The height-time sections of several convective systems are investigated in detail to study reflectivity, turbulence and vertical velocity structure. Structure and dynamics of the convective systems are the main objectives of these campaigns. The observed systems are classified into single- and multi-cell systems. It has been observed that most of the convective systems at this latitude are multi-cellular in nature. Simultaneous VHF and UHF radar observations are used to classify the observed precipitating systems as convective, intermediary and stratiform regions. Composite height profiles of vertical velocities in these regions were obtained and the same were compared with the profiles obtained at other geographical locations. These composite profiles of vertical velocity in the convective regions have shown their peaks in the mid troposphere, indicating that the maximum latent heat is being released at those heights. These profiles are very important for numerical simulations of the convective systems, which vary significantly from one geographical location to the other. Keywords. Meteorology and atmospheric dynamics (Mesoscale meteorology; Convective processes – Radio science (Remote sensing

  2. Characterizing EPR-mediated passive drug targeting using contrast-enhanced functional ultrasound imaging

    NARCIS (Netherlands)

    Theek, B.; Gremse, F.; Kunjachan, S.; Fokong, S.; Pola, R.; Pechar, M.; Deckers, R.; Storm, Gerrit; Ehling, J.; Kiessling, F.; Lammers, Twan Gerardus Gertudis Maria

    2014-01-01

    The Enhanced Permeability and Retention (EPR) effect is extensively used in drug delivery research. Taking into account that EPR is a highly variable phenomenon, we have here set out to evaluate if contrast-enhanced functional ultrasound (ceUS) imaging can be employed to characterize EPR-mediated

  3. High-frequency EPR on high-spin transition-metal sites

    NARCIS (Netherlands)

    Mathies, Guinevere

    2012-01-01

    The electronic structure of transition-metal sites can be probed by electron-paramagnetic-resonance (EPR) spectroscopy. The study of high-spin transition-metal sites benefits from EPR spectroscopy at frequencies higher than the standard 9.5 GHz. However, high-frequency EPR is a developing field. In

  4. A secure effective dynamic group password-based authenticated key agreement scheme for the integrated EPR information system

    Directory of Open Access Journals (Sweden)

    Vanga Odelu

    2016-01-01

    Full Text Available With the rapid growth of the Internet, a lot of electronic patient records (EPRs have been developed for e-medicine systems. The security and privacy issues of EPRs are important for the patients in order to understand how the hospitals control the use of their personal information, such as name, address, e-mail, medical records, etc. of a particular patient. Recently, Lee et al. proposed a simple group password-based authenticated key agreement protocol for the integrated EPR information system (SGPAKE. However, in this paper, we show that Lee et al.’s protocol is vulnerable to the off-line weak password guessing attack and as a result, their scheme does not provide users’ privacy. To withstand this security weakness found in Lee et al.’s scheme, we aim to propose an effective dynamic group password-based authenticated key exchange scheme for the integrated EPR information system, which retains the original merits of Lee et al.’s scheme. Through the informal and formal security analysis, we show that our scheme provides users’ privacy, perfect forward security and known-key security, and also protects online and offline password guessing attacks. Furthermore, our scheme efficiently supports the dynamic group password-based authenticated key agreement for the integrated EPR information system. In addition, we simulate our scheme for the formal security verification using the widely-accepted AVISPA (Automated Validation of Internet Security Protocols and Applications tool and show that our scheme is secure against passive and active attacks.

  5. Molecular Switching in Confined Spaces: Effects of Encapsulating the DHA/VHF Photo-Switch in Cucurbiturils.

    Science.gov (United States)

    Petersen, Michael Å; Rasmussen, Brian; Andersen, Nicolaj N; Sauer, Stephan P A; Nielsen, Mogens Brøndsted; Beeren, Sophie R; Pittelkow, Michael

    2017-09-18

    Confinement of reactive chemical species uniquely affects chemical reactivity by restricting the physical space available and by restricting access to interactions with the solvent. In Nature, for example, confined protein binding pockets govern processes following photoisomerization reactions and the isomerizations themselves. Here we describe the first example of a dihydroazulene/vinylheptafulvene (DHA/VHF) photo-switch functioning in water, and we show how its switching behavior is strongly influenced by supramolecular interactions with a series of cucurbit[n]uril (CB) host molecules. In CB7 inclusion complexes, the kinetics of the thermal VHF-to-DHA back-reaction is accelerated, while in CB8 inclusion complexes, the kinetics is slowed down as compared to the free photo-switch. The effect of the CB encapsulation of the photo-switch can be effectively canceled by introducing a guest that binds the CB more strongly. According to DFT calculations, a stabilization of the reactive s-cis VHF conformer relative to the s-trans VHF appears to be a contributing factor responsible for the accelerated back-reaction when encapsulated in CB7. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  6. Study of dental enamel and synthetic hydroxyapatite irradiated by EPR at K-band

    Energy Technology Data Exchange (ETDEWEB)

    Santos, A.B. [Departamento Fisica e Matematica, FFCLRP, Universidade de Sao Paulo, 14040-901 Ribeirao Preto, SP (Brazil); Universidade Federal do Tocantins, 77020-120 Palmas, Tocantins (Brazil)]. E-mail: adevailton@uft.edu.br; Rossi, A.M. [Centro Brasileiro de Pesquisas Fisicas, 22290 180 Rio de Janeiro, RJ (Brazil); Baffa, O. [Departamento Fisica e Matematica, FFCLRP, Universidade de Sao Paulo, 14040-901 Ribeirao Preto, SP (Brazil)

    2005-02-01

    In this preliminary work the EPR spectra of a small dental enamel block and a synthetic B-type hydroxyapatite in powder form, both irradiated with gamma rays, were analyzed in K-band. The spectra of the dental enamel block allow the analysis of independent components with different angular orientations, while the study of the dosimetric properties of the synthetic hydroxyapatites showed good performance of this spectrometer. K-band spectra show better resolution when compared to X-band, while using significantly less sample material.

  7. Study of dental enamel and synthetic hydroxyapatite irradiated by EPR at K-band.

    Science.gov (United States)

    Santos, A B; Rossi, A M; Baffa, O

    2005-02-01

    In this preliminary work the EPR spectra of a small dental enamel block and a synthetic B-type hydroxyapatite in powder form, both irradiated with gamma rays, were analyzed in K-band. The spectra of the dental enamel block allow the analysis of independent components with different angular orientations, while the study of the dosimetric properties of the synthetic hydroxyapatites showed good performance of this spectrometer. K-band spectra show better resolution when compared to X-band, while using significantly less sample material.

  8. Magnetic, catalytic, EPR and electrochemical studies on binuclear ...

    Indian Academy of Sciences (India)

    Unknown

    Spectral, catalytic, magnetic, EPR and electrochemical studies have been ... attention in recent years, particularly to understand the redox function of copper ... Binuclear Cu(II) complexes with 3,4-disubstituted phenol. 3. 2.2 Materials. All solvents and reagents were obtained from commercial source. Ethanol and methanol.

  9. Copenhagen vs Everett, Teleportation, and ER=EPR

    OpenAIRE

    Susskind, Leonard

    2016-01-01

    Quantum gravity may have as much to tell us about the foundations and interpretation of quantum mechanics as it does about gravity. The Copenhagen interpretation of quantum mechanics and Everett's Relative State Formulation are complementary descriptions which in a sense are dual to one another. My purpose here is to discuss this duality in the light of the of ER=EPR conjecture.

  10. The EPR Paradox: Einstein Scrutinises Quantum Mechanics -28 ...

    Indian Academy of Sciences (India)

    he detailed the Copenhagen interpretation of quantum mechanics. He argued that the EPR paradox does not prove the incompleteness of quantum theory and that the statement "in no way disturbing the system" has to be interpreted differently in quantum mechanics. A measurement on particle P1 changes the very circum-.

  11. Electrical transport and EPR investigations: A comparative study for ...

    Indian Academy of Sciences (India)

    A detailed comparative study of electron paramagnetic resonance (EPR) in conjunction with d.c. electrical conductivity has been undertaken to know about the charge transport mechanism in polyaniline (PANI) doped with monovalent and multivalent protonic acids. This work is in continuation of our previous work for further ...

  12. Which Parts of a Clinical Process EPR Needs Special Configuration

    DEFF Research Database (Denmark)

    Barlach, Anders; Simonsen, Jesper

    2007-01-01

    which screen types in a clinical process that can be standard configured and which are subject to initial as well as on-going re-configuration. Methods and results: A pilot-project implementing a fully functional clinical process EPR was configured and used at a neurological ward, replacing all paper...

  13. Antioxidant Capacity: Experimental Determination by EPR Spectroscopy and Mathematical Modeling.

    Science.gov (United States)

    Polak, Justyna; Bartoszek, Mariola; Chorążewski, Mirosław

    2015-07-22

    A new method of determining antioxidant capacity based on a mathematical model is presented in this paper. The model was fitted to 1000 data points of electron paramagnetic resonance (EPR) spectroscopy measurements of various food product samples such as tea, wine, juice, and herbs with Trolox equivalent antioxidant capacity (TEAC) values from 20 to 2000 μmol TE/100 mL. The proposed mathematical equation allows for a determination of TEAC of food products based on a single EPR spectroscopy measurement. The model was tested on the basis of 80 EPR spectroscopy measurements of herbs, tea, coffee, and juice samples. The proposed model works for both strong and weak antioxidants (TEAC values from 21 to 2347 μmol TE/100 mL). The determination coefficient between TEAC values obtained experimentally and TEAC values calculated with proposed mathematical equation was found to be R(2) = 0.98. Therefore, the proposed new method of TEAC determination based on a mathematical model is a good alternative to the standard EPR method due to its being fast, accurate, inexpensive, and simple to perform.

  14. Complementary code and digital filtering for detection of weak VHF radar signals from the mesoscale. [SOUSY-VHF radar, Harz Mountains, Germany

    Science.gov (United States)

    Schmidt, G.; Ruster, R.; Czechowsky, P.

    1983-01-01

    The SOUSY-VHF-Radar operates at a frequency of 53.5 MHz in a valley in the Harz mountains, Germany, 90 km from Hanover. The radar controller, which is programmed by a 16-bit computer holds 1024 program steps in core and controls, via 8 channels, the whole radar system: in particular the master oscillator, the transmitter, the transmit-receive-switch, the receiver, the analog to digital converter, and the hardware adder. The high-sensitivity receiver has a dynamic range of 70 dB and a video bandwidth of 1 MHz. Phase coding schemes are applied, in particular for investigations at mesospheric heights, in order to carry out measurements with the maximum duty cycle and the maximum height resolution. The computer takes the data from the adder to store it in magnetic tape or disc. The radar controller is programmed by the computer using simple FORTRAN IV statements. After the program has been loaded and the computer has started the radar controller, it runs automatically, stopping at the program end. In case of errors or failures occurring during the radar operation, the radar controller is shut off caused either by a safety circuit or by a power failure circuit or by a parity check system.

  15. Kinetics of elimination and distribution in blood and liver of biocompatible ferrofluids based on Fe{sub 3}O{sub 4} nanoparticles: An EPR and XRF study

    Energy Technology Data Exchange (ETDEWEB)

    Gamarra, L.F. [Instituto de Ensino e Pesquisa, Hospital Israelita Albert Einstein, Sao Paulo 05651-901 (Brazil); Instituto de Fisica, Universidade de Sao Paulo, Sao Paulo 05315-970 (Brazil)], E-mail: lgamarra@if.usp.br; Pontuschka, W.M. [Instituto de Fisica, Universidade de Sao Paulo, Sao Paulo 05315-970 (Brazil); Amaro, E. [Instituto de Ensino e Pesquisa, Hospital Israelita Albert Einstein, Sao Paulo 05651-901 (Brazil); Instituto de Radiologia, Faculdade de Medicina, Universidade de Sao Paulo, Sao Paulo 05403-001 (Brazil); Costa-Filho, A.J. [Instituto de Fisica de Sao Carlos, Universidade de Sao Paulo, Sao Carlos 13560-970 (Brazil); Brito, G.E.S. [Instituto de Fisica, Universidade de Sao Paulo, Sao Paulo 05315-970 (Brazil); Vieira, E.D. [Instituto de Fisica de Sao Carlos, Universidade de Sao Paulo, Sao Carlos 13560-970 (Brazil); Carneiro, S.M. [Laboratorio de Biologia Celular, Instituto Butantan, Sao Paulo 05503-900 (Brazil); Escriba, D.M. [Instituto de Fisica, Universidade de Sao Paulo, Sao Paulo 05315-970 (Brazil); Falleiros, A.M.F. [Centro de Ciencias Biologicas, Universidade Estadual de Londrina 86051-990 (Brazil); Salvador, V.L. [Centro de aplicacoes e Lasers, IPEN, Sao Paulo 05508-000 (Brazil)

    2008-05-01

    In this study, we evaluated the biodistribution and the elimination kinetics of a biocompatible magnetic fluid, Endorem{sup TM}, based on dextran-coated Fe{sub 3}O{sub 4} nanoparticles endovenously injected into Winstar rats. The iron content in blood and liver samples was recorded using electron paramagnetic resonance (EPR) and X-ray fluorescence (XRF) techniques. The EPR line intensity at g = 2.1 was found to be proportional to the concentration of magnetic nanoparticles and the best temperature for spectra acquisition was 298 K. Both EPR and XRF analysis indicated that the maximum concentration of iron in the liver occurred 95 min after the ferrofluid administration. The half-life of the magnetic nanoparticles (MNP) in the blood was (11.6 {+-} 0.6) min measured by EPR and (12.6 {+-} 0.6) min determined by XRF. These results indicate that both EPR and XRF are very useful and appropriate techniques for the study of kinetics of ferrofluid elimination and biodistribution after its administration into the organism.

  16. EPR Imaging at a Few Megahertz Using SQUID Detectors

    Science.gov (United States)

    Hahn, Inseob; Day, Peter; Penanen, Konstantin; Eom, Byeong Ho

    2010-01-01

    An apparatus being developed for electron paramagnetic resonance (EPR) imaging operates in the resonance-frequency range of about 1 to 2 MHz well below the microwave frequencies used in conventional EPR. Until now, in order to obtain sufficient signal-to-noise radios (SNRs) in conventional EPR, it has been necessary to place both detectors and objects to be imaged inside resonant microwave cavities. EPR imaging has much in common with magnetic resonance imaging (MRI), which is described briefly in the immediately preceding article. In EPR imaging as in MRI, one applies a magnetic pulse to make magnetic moments (in this case, of electrons) precess in an applied magnetic field having a known gradient. The magnetic moments precess at a resonance frequency proportional to the strength of the local magnetic field. One detects the decaying resonance-frequency magnetic- field component associated with the precession. Position is encoded by use of the known relationship between the resonance frequency and the position dependence of the magnetic field. EPR imaging has recently been recognized as an important tool for non-invasive, in vivo imaging of free radicals and reduction/oxidization metabolism. However, for in vivo EPR imaging of humans and large animals, the conventional approach is not suitable because (1) it is difficult to design and construct resonant cavities large enough and having the required shapes; (2) motion, including respiration and heartbeat, can alter the resonance frequency; and (3) most microwave energy is absorbed in the first few centimeters of tissue depth, thereby potentially endangering the subject and making it impossible to obtain adequate signal strength for imaging at greater depth. To obtain greater penetration depth, prevent injury to the subject, and avoid the difficulties associated with resonant cavities, it is necessary to use lower resonance frequencies. An additional advantage of using lower resonance frequencies is that one can use

  17. Layered Polar Mesospheric Summer Echoes Observed with the Tri-Static Eiscat VHF

    Science.gov (United States)

    Mann, I.; Anyairo, C.; Häggström, I.; Tjulin, A.

    2014-12-01

    Polar mesospheric summer echoes (PMSE) are strong radar echoes that are typically observed at 50 to 500 MHz. They are often discussed in the context of dusty plasma studies and linked to e.g. the existence of charged ice particles, neutral atmospheric turbulence and atmospheric stratification. The PMSE are observed at mesospheric temperature minimum when ice particles form, though the exact path of formation is still a topic for research. Mesospheric smoke particles that are assumed to form after or during the meteor ablation process possibly contribute to the formation of the ice particles. For understanding the formation of the radar echoes their variation with scattering angle is an important parameter. We analyze PMSE observations with the tri-static EISCAT VHF radar (224 MHz) during one day in June when PMSE were observed almost continuously from 7:00 to 13:00 UT. The radar signal was transmitted and received in zenith direction with the EISCAT VHF antenna near Tromsø. The receivers in Kiruna and Sodankylä were pointed at typical PMSE heights above the Tromsø transmitter and detected radar reflections at the same time and altitude as the Tromsø radar. The altitude of the PMSE changed with time and the extension of the echoes in altitude was smaller toward the end of the observation. These observations are among the first tri-static observations of PMSE. The observations suggest that the scattering process underlying the PMSE occurs over a broad range of scattering angles. Based on the observations we will show that the spectral width of the received echoes is most likely determined by the variations within the observed volume rather than by the scattering process. The observed frequency shifts suggest a layer structure and horizontal motions that vary with altitude. UHF (933 MHz) radar observations were carried out in parallel, they display predominantly incoherent scatter and an electron density typical for the altitude. Some other studies, have in

  18. Multifrequency EPR study on freeze-dried fruits before and after X-ray irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Yordanov, N.D. [Laboratory EPR, Institute of Catalysis, Bulgarian Academy of Sciences, 1113 Sofia (Bulgaria)]. E-mail: ndyepr@bas.bg; Aleksieva, K. [Laboratory EPR, Institute of Catalysis, Bulgarian Academy of Sciences, 1113 Sofia (Bulgaria); Dimitrova, A. [Laboratory EPR, Institute of Catalysis, Bulgarian Academy of Sciences, 1113 Sofia (Bulgaria); Georgieva, L. [Institute of Cryobiology and Food Technologies, 1162 Sofia (Bulgaria); Tzvetkova, E. [Institute of Cryobiology and Food Technologies, 1162 Sofia (Bulgaria)

    2006-09-15

    X-, K- and Q-band EPR studies on lyophilized whole pulp parts of blue plum, apricot, peach, melon as well as achens and pulp separately of strawberry before and after X-ray irradiation are reported. Before irradiation all samples show in X band a weak singlet EPR line with g=2.0030+/-0.0005, except melon, which is EPR silent. Immediately after irradiation all samples exhibit complex fruit-depending spectra, which decay with time and change to give, in ca. 50days, an asymmetric singlet EPR line with g=2.0041+/-0.0005. Only apricot pulp gave a typical ''sugar-like'' EPR spectrum. Singlet EPR lines recorded after irradiation in X -band are K- and Q-band resolved as typical anisotropic EPR spectra with g{sub ||}=2.0023+/-0.0003 and g{sub -}bar =2.0041+/-0.0005. In addition, K- and Q-band EPR spectra of all samples show a superposition with the six EPR lines of Mn{sup 2+} naturally present in the fruits. The saturation behavior of the EPR spectra of achens of lyophilized and fresh strawberry is also studied. The differences in g factors of samples before and after X-ray irradiation might be used for the identification of radiation processing of fruits in the case of pulp and the differences in the EPR saturation behavior might be used for the achens of strawberry.

  19. Disturbance-induced responses of VHF and satellite tagged harbour seals

    DEFF Research Database (Denmark)

    Andersen, Signe May; Teilmann, Jonas; Dietz, Rune

    2014-01-01

    ABSTRACT 1. The response of individual harbour seals (Phoca vitulina) to controlled and sporadic disturbances when hauled out in the Anholt seal reserve, Denmark, was studied. Sporadic disturbances from pedestrians, boats, low-flying aeroplanes and grey seals (Halichoerus grypus) were observed...... in or near the reserve. VHF and satellite transmitters were attached to eight harbour seals to determine post-disturbance and undisturbed behaviour during the pre-breeding period (25 April to 21 May 2008). 2. Both disturbed and undisturbed seals mostly returned to the haul-out site from dusk and throughout...... within 40 km from the haul-out site. The maximum extent of post-disturbance trips, however, varied among individuals and disturbance types, and was strongly correlated with the duration of trips. 3. Disturbed and undisturbed seals used the same areas, suggesting that these areas represent normal foraging...

  20. Graphene-based tunable non-foster circuit for VHF applications

    Directory of Open Access Journals (Sweden)

    Jing Tian

    2016-06-01

    Full Text Available This paper presents a negative impedance converter (NIC based on graphene field effect transistors (GFETs for VHF applications. The NIC is designed following Linvill’s open circuit stable (OCS topology. The DC modelling parameters of GFET are extracted from a device measured by Meric et al. [IEEE Electron Devices Meeting, 23.2.1 (2010] Estimated parasitics are also taken into account. Simulation results from Keysight Advanced Design System (ADS show good NIC performance up to 200 MHz and the value of negative capacitance is directly proportional to the capacitive load. In addition, it has been shown that by varying the supply voltage the value of negative capacitance can also be tuned. The NIC stability has been tested up to 2 GHz (10 times the maximum operation frequency using Nyquist stability criterion to ensure there are no oscillation issues.

  1. Final environmental assessment for vegetation control at VHF stations, microwave stations, electrical substations, and pole yards

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-10-13

    Southwestern Power Adm. operates very high frequency (VHF) and microwave radio stations, electrical substations, and pole yards for electric power transmission throughout AR, MO, and OK. Vegetation growth at the stations must be suppressed for safety of operation and personnel. Southwestern has been using a combination of mechanical/manual and herbicide control for this purpose; Federally- mandated reductions in staff and budgetary resources require Southwestern to evaluate all potentially efficient methods for vegetation control. Three alternatives were examined: no action, mechanical/manual control, and (proposed) a combination of mechanical/manual and herbicide control. Environmental impacts on air and water quality, wetlands, wildlife, endangered species, archaeological and other resources, farmland, human health, transportation, etc. were evaluated.

  2. Simultaneous observation of sporadic E with a rapid-run ionosonde and VHF coherent backscatter radar

    Directory of Open Access Journals (Sweden)

    T. Maruyama

    2006-03-01

    Full Text Available During the SEEK 2 rocket campaign, ionograms were recorded every minute at the Yamagawa Radio Observatory at about 90km west of the region monitored by a VHF (very high frequency coherent backscatter radar. Sporadic E-layer parameters, which include the critical (foEs and blanketing (fbEs frequencies, the layer height (h'Es, and the width of the range spread of sporadic E-traces, were compared with RTI (range-time-intensity plots of VHF quasi-periodic (QP and continuous coherent backscatter echoes. A close relationship was found between the appearance of QP echoes in the RTI plots and the level of spatial inhomogeneity in sporadic E plasma, signified here by the difference between foEs and fbEs. During QP echo events, foEs increased while fbEs decreased, so that the difference foEs-fbEs was enhanced, indicating the development of strong spatial structuring in electron density within a sporadic E-layer. On the other hand, increases in sporadic E range spreading also correlated with the occurrence of QP echoes but the degree of correlation varied from event to event. Continuous radar echoes were observed in association with low altitude sporadic E-layers, located well below 100 km and at times as low as 90 km. During the continuous echo events, both foEs and fbEs were less variable, and the difference foEs-fbEs was small and not as dynamic as in the QP echoes. On the other hand, the Es-layer spread intensified during continuous echoes, which means that some patchiness or corrugation in those low altitude layers is also necessary for the continuous backscatter echoes to take place.

  3. Simultaneous observation of sporadic E with a rapid-run ionosonde and VHF coherent backscatter radar

    Directory of Open Access Journals (Sweden)

    T. Maruyama

    2006-03-01

    Full Text Available During the SEEK 2 rocket campaign, ionograms were recorded every minute at the Yamagawa Radio Observatory at about 90km west of the region monitored by a VHF (very high frequency coherent backscatter radar. Sporadic E-layer parameters, which include the critical (foEs and blanketing (fbEs frequencies, the layer height (h'Es, and the width of the range spread of sporadic E-traces, were compared with RTI (range-time-intensity plots of VHF quasi-periodic (QP and continuous coherent backscatter echoes. A close relationship was found between the appearance of QP echoes in the RTI plots and the level of spatial inhomogeneity in sporadic E plasma, signified here by the difference between foEs and fbEs. During QP echo events, foEs increased while fbEs decreased, so that the difference foEs-fbEs was enhanced, indicating the development of strong spatial structuring in electron density within a sporadic E-layer. On the other hand, increases in sporadic E range spreading also correlated with the occurrence of QP echoes but the degree of correlation varied from event to event. Continuous radar echoes were observed in association with low altitude sporadic E-layers, located well below 100 km and at times as low as 90 km. During the continuous echo events, both foEs and fbEs were less variable, and the difference foEs-fbEs was small and not as dynamic as in the QP echoes. On the other hand, the Es-layer spread intensified during continuous echoes, which means that some patchiness or corrugation in those low altitude layers is also necessary for the continuous backscatter echoes to take place.

  4. Lipid peroxidation and water penetration in lipid bilayers: a W-band EPR study.

    Science.gov (United States)

    Conte, Elena; Megli, Francesco Maria; Khandelia, Himanshu; Jeschke, Gunnar; Bordignon, Enrica

    2013-02-01

    Lipid peroxidation plays a key role in the alteration of cell membrane's properties. Here we used as model systems multilamellar vesicles (MLVs) made of the first two products in the oxidative cascade of linoleoyl lecithin, namely 1-palmitoyl-2-(13-hydroperoxy-9,11-octadecanedienoyl)-lecithin (HpPLPC) and 1-palmitoyl-2-(13-hydroxy-9,11-octadecanedienoyl)-lecithin (OHPLPC), exhibiting a hydroperoxide or a hydroxy group at position 13, respectively. The two oxidized lipids were used either pure or in a 1:1 molar ratio mixture with untreated 1-palmitoyl-2-linoleoyl-lecithin (PLPC). The model membranes were doped with spin-labeled lipids to study bilayer alterations by electron paramagnetic resonance (EPR) spectroscopy. Two different spin-labeled lipids were used, bearing the doxyl ring at position (n) 5 or 16: γ-palmitoyl-β-(n-doxylstearoyl)-lecithin (n-DSPPC) and n-doxylstearic acid (n-DSA). Small changes in the acyl chain order in the sub-polar region and at the methyl-terminal induced by lipid peroxidation were detected by X-band EPR. Concomitantly, the polarity and proticity of the membrane bilayer in those regions were investigated at W band in frozen samples. Analysis of the g(xx) and A(zz) parameters revealed that OHPLPC, but mostly HpPLPC, induced a measurable increase in polarity and H-bonding propensity in the central region of the bilayer. Molecular dynamics simulation performed on 16-DSA in the PLPC-HpPLPC bilayer revealed that water molecules are statistically favored with respect to the hydroperoxide groups to interact with the nitroxide at the methyl-terminal, confirming that the H-bonds experimentally observed are due to increased water penetration in the bilayer. The EPR and MD data on model membranes demonstrate that cell membrane damage by oxidative stress cause alteration of water penetration in the bilayer. Copyright © 2012 Elsevier B.V. All rights reserved.

  5. SPIDYAN, a MATLAB library for simulating pulse EPR experiments with arbitrary waveform excitation

    Science.gov (United States)

    Pribitzer, Stephan; Doll, Andrin; Jeschke, Gunnar

    2016-02-01

    Frequency-swept chirp pulses, created with arbitrary waveform generators (AWGs), can achieve inversion over a range of several hundreds of MHz. Such passage pulses provide defined flip angles and increase sensitivity. The fact that spectra are not excited at once, but single transitions are passed one after another, can cause new effects in established pulse EPR sequences. We developed a MATLAB library for simulation of pulse EPR, which is especially suited for modeling spin dynamics in ultra-wideband (UWB) EPR experiments, but can also be used for other experiments and NMR. At present the command line controlled SPin DYnamics ANalysis (SPIDYAN) package supports one-spin and two-spin systems with arbitrary spin quantum numbers. By providing the program with appropriate spin operators and Hamiltonian matrices any spin system is accessible, with limits set only by available memory and computation time. Any pulse sequence using rectangular and linearly or variable-rate frequency-swept chirp pulses, including phase cycling can be quickly created. To keep track of spin evolution the user can choose from a vast variety of detection operators, including transition selective operators. If relaxation effects can be neglected, the program solves the Liouville-von Neumann equation and propagates spin density matrices. In the other cases SPIDYAN uses the quantum mechanical master equation and Liouvillians for propagation. In order to consider the resonator response function, which on the scale of UWB excitation limits bandwidth, the program includes a simple RLC circuit model. Another subroutine can compute waveforms that, for a given resonator, maintain a constant critical adiabaticity factor over the excitation band. Computational efficiency is enhanced by precomputing propagator lookup tables for the whole set of AWG output levels. The features of the software library are discussed and demonstrated with spin-echo and population transfer simulations.

  6. SPIDYAN, a MATLAB library for simulating pulse EPR experiments with arbitrary waveform excitation.

    Science.gov (United States)

    Pribitzer, Stephan; Doll, Andrin; Jeschke, Gunnar

    2016-02-01

    Frequency-swept chirp pulses, created with arbitrary waveform generators (AWGs), can achieve inversion over a range of several hundreds of MHz. Such passage pulses provide defined flip angles and increase sensitivity. The fact that spectra are not excited at once, but single transitions are passed one after another, can cause new effects in established pulse EPR sequences. We developed a MATLAB library for simulation of pulse EPR, which is especially suited for modeling spin dynamics in ultra-wideband (UWB) EPR experiments, but can also be used for other experiments and NMR. At present the command line controlled SPin DYnamics ANalysis (SPIDYAN) package supports one-spin and two-spin systems with arbitrary spin quantum numbers. By providing the program with appropriate spin operators and Hamiltonian matrices any spin system is accessible, with limits set only by available memory and computation time. Any pulse sequence using rectangular and linearly or variable-rate frequency-swept chirp pulses, including phase cycling can be quickly created. To keep track of spin evolution the user can choose from a vast variety of detection operators, including transition selective operators. If relaxation effects can be neglected, the program solves the Liouville-von Neumann equation and propagates spin density matrices. In the other cases SPIDYAN uses the quantum mechanical master equation and Liouvillians for propagation. In order to consider the resonator response function, which on the scale of UWB excitation limits bandwidth, the program includes a simple RLC circuit model. Another subroutine can compute waveforms that, for a given resonator, maintain a constant critical adiabaticity factor over the excitation band. Computational efficiency is enhanced by precomputing propagator lookup tables for the whole set of AWG output levels. The features of the software library are discussed and demonstrated with spin-echo and population transfer simulations. Copyright © 2016

  7. Measuring precarious employment in times of crisis: the revised Employment Precariousness Scale (EPRES) in Spain.

    Science.gov (United States)

    Vives, Alejandra; González, Francisca; Moncada, Salvador; Llorens, Clara; Benach, Joan

    2015-01-01

    This study examines the psychometric properties of the revised Employment Precariousness Scale (EPRES-2010) in a context of economic crisis and growing unemployment. Data correspond to salaried workers with a contract (n=4,750) from the second Psychosocial Work Environment Survey (Spain, 2010). Analyses included acceptability, scale score distributions, Cronbach's alpha coefficient and exploratory factor analysis. Response rates were 80% or above, scores were widely distributed with reductions in floor effects for temporariness among permanent workers and for vulnerability. Cronbach's alpha coefficients were 0.70 or above; exploratory factor analysis confirmed the theoretical allocation of 21 out of 22 items. The revised version of the EPRES demonstrated good metric properties and improved sensitivity to worker vulnerability and employment instability among permanent workers. Furthermore, it was sensitive to increased levels of precariousness in some dimensions despite decreases in others, demonstrating responsiveness to the context of the economic crisis affecting the Spanish labour market. Copyright © 2015 SESPAS. Published by Elsevier Espana. All rights reserved.

  8. Frequency modulation effects in EPR and dynamic nuclear polarisation

    CERN Document Server

    Kiselev, Yu F

    1996-01-01

    We elaborate on new effects in electron paramagnetic resonance and dynamic nuclear polarisation, recently discovered in the large polarized target of SMC at CERN, and validate our theoretical concepts by experiment. The phenomena, called by us 'frequency modulation effects', appear in a target cavity in the presence of strong frequency modulated microwave field which excites the electron magnetic dipole transitions. The system exhibits properties similar to an optical interferometer, whose arms can be adjusted by a steady magnetic field. The EPR spectrum of the cavity intensity shows satellites at monochromatic irradiation; these satellites disappear when the microwave frequency is modulated. It is shown that on the edges of the EPR line the absorption of the frequency modulated field is strongly enchanced due to a new mechanism of magnetic losses. This contributes also to the average dynamic deuteron polarization which is increased by a dramatic factor of 1.7 giving the highest ever deuteron polarization exc...

  9. Identification and dose assessment of irradiated cumin by EPR spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Abdel-Fattah, A.A. E-mail: atef_fattah@hotmail.com

    2002-03-01

    The use of electron paramagnetic resonance spectroscopy to accurately distinguish irradiated from unirradiated cumin and assess the absorbed dose to radiation-processed cumin is examined. The results were successful for identifying both irradiated and unirradiated cumin. Additive reirradiation of the cumin produces a reproducible dose response function, which can be used to assess the initial dose by back-extrapolation. Third-degree polynomial and exponential functions were used to fit the EPR signal/dose curves. It was found that the 3rd degree polynomial function provides satisfactory results without correction for decay of free radicals. The exponential fit to the data cannot be used without correction of decay of free radicals. The stability of the radiation-induced EPR signal of irradiated cumin was studied over a storage period of 6 months. The additive reirradiation of some samples was carried out at different storage times (10, 20 and 30 days) after initial irradiation.

  10. state hybrid hemoglobins as revealed by optical, EPR and ...

    Indian Academy of Sciences (India)

    Unknown

    EPR examinations of these hybrids show that both in R state-[Cu(II)-Fe(II)] and T state-[Cu(II)-Ni(II)] hybrids at neutral pH and in the absence of IHP, CuPPIX, ... ion environment: Species 1, a five-coordinated Cu2+ complex with strong proximal histidine bond and spe- .... with those of copper and nickel-reconstituted hemo-.

  11. EPR = ER, scattering amplitude and entanglement entropy change

    Energy Technology Data Exchange (ETDEWEB)

    Seki, Shigenori, E-mail: sigenori@hanyang.ac.kr [Research Institute for Natural Science, Hanyang University, Seoul 133-791 (Korea, Republic of); Sin, Sang-Jin, E-mail: sjsin@hanyang.ac.kr [Department of Physics, Hanyang University, Seoul 133-791 (Korea, Republic of)

    2014-07-30

    We study the causal structure of the minimal surface of the four-gluon scattering, and find a world-sheet wormhole parametrized by Mandelstam variables, thereby demonstrate the EPR = ER relation for gluon scattering. We also propose that scattering amplitude is the change of the entanglement entropy by generalizing the holographic entanglement entropy of Ryu–Takayanagi to the case where two regions are divided in space–time.

  12. EPR study of spermine interaction with multilamellar phosphatidylcholine liposomes.

    Science.gov (United States)

    Momo, F; Wisniewska, A; Stevanato, R

    1995-11-22

    The interaction of spermine with egg-yolk phosphatidylcholine liposomes was investigated. The EPR spin labeling technique evidenced that spermine induces modifications of some membrane functions of biological interest like water permeability and is a possible modulator of diffusion processes for charged and polar molecules. The association constant for a hypothesized complex between spermine and the phosphate group of phosphatidylcholine was evaluated by enzymatic methods.

  13. Copenhagen vs Everett, teleportation, and ER=EPR

    Energy Technology Data Exchange (ETDEWEB)

    Susskind, Leonard [Stanford Institute for Theoretical Physics and Department of Physics, Stanford University, Stanford, CA (United States)

    2016-06-15

    Quantum gravity may have as much to tell us about the foundations and interpretation of quantum mechanics as it does about gravity. The Copenhagen interpretation of quantum mechanics and Everett's Relative State Formulation are complementary descriptions which in a sense are dual to one another. My purpose here is to discuss this duality in the light of the of ER=EPR conjecture. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  14. Clinical electron paramagnetic resonance (EPR) oximetry using India ink.

    Science.gov (United States)

    Williams, Benjamin B; Khan, Nadeem; Zaki, Bassem; Hartford, Alan; Ernstoff, Marc S; Swartz, Harold M

    2010-01-01

    Electron paramagnetic resonance (EPR) oximetry can be used to provide direct absolute measurements of pO(2) in living tissue using India ink as an O(2) reporter. In vivo measurements are made using low frequency (1.2 GHz) EPR spectroscopy and surface loop resonators, which enable measurements to be made at superficial sites through a non-invasive (after placing the ink in the tissues) and repeatable measurement procedure. Ongoing EPR oximetry studies in human subjects include measurement of subcutaneous pO(2) in the feet of healthy volunteers to develop procedures that could be used in the treatment of peripheral vascular disease and oximetry in tumors during courses of radiation and chemotherapy, to follow pO(2) so oxygen-dependent therapies can be optimized. In each case, we aim to provide quantitative measurements of tissue pO(2) which will aid physicians in the characterization of disease status and the effects of therapeutic measures, so that treatments can be applied with optimal effectiveness by taking into account the oxygen-dependent aspects of the therapy. The overall goal is to enhance clinical outcomes. Oximetry measurements of subcutaneous tissue on dorsal and plantar foot surfaces have been made in 9 volunteers, with measurements ongoing for each and the longest set of measurements carried out successfully over the last 5 years. Tumor oximetry measurements have been performed in tumor tissues of 10 patients during courses of radiation and chemotherapy. Tumor types include melanoma, basal cell, soft tissue sarcoma, and lymphoma, and measurement sites have ranged from the feet to the scalp. These studies demonstrate the feasibility of EPR oximetry in a clinical setting and the potential for more widespread use in the treatment of these and other oxygen-dependent diseases.

  15. Karl R. Popper, 1992: About the EPR controversy

    Science.gov (United States)

    Combourieu, Marie-Christine

    1992-10-01

    Sir K. R. Popper's experimental schemes challenge the Copenhagen interpretation of quantum theory, principally Heisenberg's indeterminacy relations and the EPR paradox. “The so-called Einstein-Podolsky-Rosen paradox is not a paradox. It is a theoretical statement in expectation of an interpretation,” says K. R. Popper in this interview. “My experiment ought to be a classical experiment. It is very simple and free from any additional assumption. It should really be done.”

  16. VHF volume-imaging radar observation of aspect-sensitive scatterers tilted in mountain waves above a convective boundary layer

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    2005-06-01

    Full Text Available Thin stable atmospheric layers cause VHF radars to receive increased echo power from near zenith. Layers can be tilted from horizontal, for instance by gravity waves, and the direction of VHF "glinting" is measurable by spatial domain interferometry or many-beam Doppler beam swinging (DBS. This paper uses the Middle and Upper atmosphere (MU radar, Shigaraki, Japan as a volume-imaging radar with 64-beam DBS, to show tilting of layers and air flow in mountain waves. Tilt of aspect-sensitive echo power from horizontal is nearly parallel to air flow, as assumed in earlier measurements of mountain-wave alignment. Vertical-wind measurements are self-consistent from different beam zenith angles, despite the combined effects of aspect sensitivity and horizontal-wind gradients.

  17. EPR investigation of some traditional oriental irradiated spices

    Energy Technology Data Exchange (ETDEWEB)

    Duliu, Octavian G. [University of Bucharest, Department of Atomic and Nuclear Physics, Magurele, C.P. MG-11, RO-077125 Bucharest (Romania)]. E-mail: duliu@pcnet.ro; Georgescu, Rodica [National Institute for Physics and Nuclear Engineering -Horia Hulubei, C.P. MG-6, RO-077125 Bucharest (Romania); Ali, Shaban Ibrahim [University of Bucharest, Department of Atomic and Nuclear Physics, Magurele, C.P. MG-11, RO-077125 Bucharest (Romania)

    2007-06-15

    The 9.50 GHz electron paramagnetic resonance (EPR) spectra of unirradiated and {sup 60}Co {gamma}-ray irradiated cardamom (Elettaria cardamomum L. Maton, Zingiberaceae), ginger ((Zingiber officinale Rosc., Zingiberaceae), and saffron (Crocus sativus L., Iridaceae) have been investigated at room temperature. All unirradiated spices presented a weak resonance line with g-factors around free-electron ones. After {gamma}-ray irradiation at an absorbed dose of up to 11.3 kGy, the presence of EPR spectra whose amplitude increase monotonously with the absorbed dose has been noticed with all spices. A 100 {sup o}C isothermal annealing of 11.3 kGy irradiated samples has shown a differential reduction of amplitude of various components that compose initial spectra, but even after 3.6 h of thermal treatment, the remaining amplitude represents no less then 30% of the initial ones. The same peculiarities have been noticed after 83 days storage at room temperature but after 340 days storage at ambient conditions only irradiated ginger displays a weak signal that differs from those of unirradiated sample. All these factors could be taken into account in establishing at which extent the EPR is suitable to evidence any irradiation treatment applied to these spices.

  18. EPR investigation of some traditional oriental irradiated spices

    Science.gov (United States)

    Duliu, Octavian G.; Georgescu, Rodica; Ali, Shaban Ibrahim

    2007-06-01

    The 9.50 GHz electron paramagnetic resonance (EPR) spectra of unirradiated and 60Co γ-ray irradiated cardamom ( Elettaria cardamomum L. Maton, Zingiberaceae), ginger (( Zingiber officinale Rosc., Zingiberaceae), and saffron ( Crocus sativus L., Iridaceae) have been investigated at room temperature. All unirradiated spices presented a weak resonance line with g-factors around free-electron ones. After γ-ray irradiation at an absorbed dose of up to 11.3 kGy, the presence of EPR spectra whose amplitude increase monotonously with the absorbed dose has been noticed with all spices. A 100 °C isothermal annealing of 11.3 kGy irradiated samples has shown a differential reduction of amplitude of various components that compose initial spectra, but even after 3.6 h of thermal treatment, the remaining amplitude represents no less then 30% of the initial ones. The same peculiarities have been noticed after 83 days storage at room temperature but after 340 days storage at ambient conditions only irradiated ginger displays a weak signal that differs from those of unirradiated sample. All these factors could be taken into account in establishing at which extent the EPR is suitable to evidence any irradiation treatment applied to these spices.

  19. Meteor head echo altitude distributions and the height cutoff effect studied with the EISCAT HPLA UHF and VHF radars

    Directory of Open Access Journals (Sweden)

    A. Westman

    2004-04-01

    Full Text Available Meteor head echo altitude distributions have been derived from data collected with the EISCAT VHF (224MHz and UHF (930MHz high-power, large-aperture (HPLA radars. At the high-altitude end, the distributions cut off abruptly in a manner reminiscent of the trail echo height ceiling effect observed with classical meteor radars. The target dimensions are shown to be much smaller than both the VHF and the UHF probing wavelengths, but the cutoff heights for the two systems are still clearly different, the VHF cutoff being located several km above the UHF one. A single-collision meteor-atmosphere interaction model is used to demonstrate that meteors in the (1.3–7.2µg mass range will ionise such that critical electron density at 224MHz is first reached at or around the VHF cutoff altitude and critical density at 930MHz will be reached at the UHF cutoff altitude. The observed seasonal variation in the cutoff altitudes is shown to be a function of the seasonal variation of atmospheric density with altitude. Assuming that the electron density required for detection is in the order of the critical density, the abrupt altitude cutoffs can be explained as a consequence of the micrometeoroid joint size-speed distribution dropping off so fast at the large-mass, high-velocity end that above a certain altitude the number of detectable events becomes vanishingly small. Conversely, meteors at the low-mass end of the distribution will be gradually retarded such that the ionisation they generate never reaches critical density. These particles will remain unobservable.Key words. Radio science (instruments and techniques – Interplatery physics (interplanetary dust – General or miscellaneous (new fields

  20. Synthesis, XRD, TEM, EPR, and Optical Absorption Spectral Studies of CuZnO2 Nanocompound

    Directory of Open Access Journals (Sweden)

    T. Ravindra Reddy

    2014-01-01

    Full Text Available Synthesis of nano CuZnO2 compound is carried out by thermal decomposition method. The crystalline phase of the material is characterized by XRD. The calculated unit cell constants are a=3.1 Å and c=3.4786 Å and are of tetragonal structure. The unit cell constants are different from wurtzite (hexagonal which indicate that a nanocompound is formed. Further TEM images reveal that the metal ion is in tetragonal structure with oxygen ligands. The prepared CuZnO2 is then characterized for crystallite size analysis by employing transmission electron microscopy (TEM. The size is found to be 100 nm. Uniform bright rings are noticed in the TEM picture suggesting that the nanocrystals have preferential instead of random orientations. The selected-area electron diffraction (SAED pattern clearly indicates the formation of CuO-ZnO nanocompound. The nature of bonding is studied by electron paramagnetic resonance (EPR. The covalency character is about 0.74 and thus the compound is electrically less conductive. Optical absorption spectral studies suggest that Cu(II is placed in tetragonal elongation crystal field. The spin-orbit coupling constant, λ, is calculated using the EPR and optical absorption spectral results suggest some covalent bond between metal and ligand. Near infrared (NIR spectra are due to hydroxyl and water fundamentals.

  1. Growth, optical and EPR studies of {sup 151}Eu{sup 2+}:YAG single crystals

    Energy Technology Data Exchange (ETDEWEB)

    Petrosyan, A.G., E-mail: pet@ipr.sci.am [Institute for Physical Research, National Academy of Sciences, Ashtarak, 0203 (Armenia); Asatryan, H.R. [Ioffe Physical-Technical Institute, Politekhnicheskaya ul. 26, St. Petersburg, 194021 (Russian Federation); Hovhannesyan, K.L.; Derdzyan, M.V. [Institute for Physical Research, National Academy of Sciences, Ashtarak, 0203 (Armenia); Feofilov, S.P. [Ioffe Physical-Technical Institute, Politekhnicheskaya ul. 26, St. Petersburg, 194021 (Russian Federation); Eganyan, A.V.; Sargsyan, R.S. [Institute for Physical Research, National Academy of Sciences, Ashtarak, 0203 (Armenia)

    2017-01-01

    Single crystals of {sup 151}Eu:YAG were grown by the vertical Bridgman method using Eu{sub 2}O{sub 3} with isotopic enrichment of {sup 151}Eu of 97.5%. Additional Hf{sup 4+}or Si{sup 4+} ions were introduced to favor a high concentrations of Eu{sup 2+}. As compared to Eu:YAG with natural isotope composition, the EPR spectra of YAG doped with {sup 151}Eu isotope show a reduced number of hyperfine structure components and a well-resolved structure of a bigger number of electronic transitions. Optical properties of obtained crystals and the effects of heat treatments under oxidizing and reducing conditions are reported. Based on the analysis of Eu{sup 3+} distribution in oxidized Eu,Hf:YAG, in comparison to that in Eu:YAG, the concentration of Eu{sup 2+} in as-grown Eu,Hf:YAG is determined. - Highlights: • YAG:Eu,Hf single crystals containing only {sup 151}Eu isotopes were prepared. • isotopic enriched crystals gave a well-resolved EPR hyperfine structure of Eu{sup 2+} centers. • the redox ratio was followed through the Eu{sup 2+} associated absorption band at 250 nm. • the band intensities at 378 nm correlate with the Eu{sup 2+} concentration.

  2. Consistent simulation of X- and Q-band EPR spectra of an unsymmetric dinuclear Mn2(II,III) complex.

    Science.gov (United States)

    Huang, Ping; Shaikh, Nizamuddin; Anderlund, Magnus F; Styring, Stenbjörn; Hammarström, Leif

    2006-05-01

    Simulation of X- and Q-band electron paramagnetic resonance (EPR) spectra of an unsymmetric dinuclear [Mn(2)(II,III)L(mu-OAc)(2)]ClO(4) complex (1), (L is the dianion of 2-{[N,N-bis(2-pyridylmethyl)amino]methyl}-6-{[N-(3,5-di-tert-butyl-2-hydroxybenzyl)-N-(2-pyridylmethyl)amino]methyl}-4-methylphenol) was performed using one consistent set of simulation parameters. Rhombic g-tensors and hyperfine tensors were necessary to obtain satisfactory simulation of the EPR spectra. The anisotropy of the effective hyperfine tensors of each individual (55)Mn ion was further analyzed in terms of intrinsic hyperfine tensors. Detailed analysis shows that the hyperfine anisotropy of the Mn(III) ion is a result of the Jahn-Teller effect and thus an inherent character. In contrast, the anomalous hyperfine anisotropy of the Mn(II) ion is attributed as being transferred from the Mn(III) ion through the spin exchange interaction. The anisotropy parameter for the Mn(II) is deduced as D(II)=-1.26+/-0.2cm(-1). This is the first reported D(II) value for a Mn(II) ion in a weakly exchange coupled mixed-valence Mn(2)(II,III) complex with a bis-mu-acetato-bridge. The [see text] electronic configuration of the Mn(III) ion in 1 is revealed by the negative sign of its intrinsic hyperfine tensor anisotropy, Deltaa(III)=a(z)-a(x,y)=-46cm(-1). Lower spectral resolution of the Q-band EPR spectrum as compared to the X-band EPR spectrum is associated to large line width broadening of the x- and y-components in contrast to the z-component. The origins of the unequal distribution of line width between the z- and x-, y-components are discussed.

  3. Single crystals of DPPH grown from diethyl ether and carbon disulfide solutions - crystal structures, IR, EPR and magnetization studies.

    Science.gov (United States)

    Zilić, Dijana; Pajić, Damir; Jurić, Marijana; Molčanov, Krešimir; Rakvin, Boris; Planinić, Pavica; Zadro, Krešo

    2010-11-01

    Single crystals of the free radical 2,2-diphenyl-1-picrylhydrazyl (DPPH) obtained from diethyl ether (ether) and carbon disulfide (CS₂) were characterized by the X-ray diffraction, IR, EPR and SQUID magnetization techniques. The X-ray structural analysis and IR spectra showed that the DPPH form crystallized from ether (DPPH1) is solvent free, whereas that one obtained from CS₂ (DPPH2) is a solvate of the composition 4DPPH·CS₂. Principal values of the g-tensor were estimated by the X-band EPR spectroscopy at room and low (10 K) temperatures. Magnetization studies revealed the presence of antiferromagnetically coupled dimers in both types of crystals. However, the way of dimerization as well as the strength of exchange couplings are different in the two DPPH samples, which is in accord with their crystal structures. The obtained results improved parameters accuracy and enabled better understanding of properties of DPPH as a standard sample in the EPR spectrometry. Copyright © 2010 Elsevier Inc. All rights reserved.

  4. Public debate about the EPR nuclear power plant at Flamanville; Debat public sur la centrale nucleaire EPR a Flamanville

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    The project of building of he EPR reactor at Flamanville (Manche, France) has been submitted to the public debate. This document includes a presentation of the project and of the rules of the public debate, a synthesis of the file made by the prime contractor (EDF), a synthesis of the collective book of national actors concerned by the project (a group of associations for environment protection, Areva company, the ministries of economy and ecology, Global Chance, association of pro-nuclear ecologists (AEPN), 'Sortir du Nucleaire' (out-of nuclear) network, group of scientists for the information about nuclear (GSIEN), association for the promotion of the Flamanville site (Proflam), French nuclear energy society (SFEN) in association with 'Sauvons le Climat' (let's save climate), regional collective association 'EPR non merci, ni ailleurs, ni ici' (EPR, no thanks, neither elsewhere, nor here), NegaWatt), and 5 detailed books of actors: ACRO (association for the control of radioactivity in Western France), CFDT and CGT syndicates, the economic and social council of Basse Normandie region, and Proflam. (J.S.)

  5. In Vivo Imaging of Tissue Physiological Function using EPR Spectroscopy | NCI Technology Transfer Center | TTC

    Science.gov (United States)

    Electron paramagnetic resonance (EPR) is a technique for studying chemical species that have one or more unpaired electrons.  The current invention describes Echo-based Single Point Imaging (ESPI), a novel EPR image formation strategy that allows in vivo imaging of physiological function.  The National Cancer Institute's Radiation Biology Branch is seeking statements of capability or interest from parties interested in in-licensing an in vivo imaging using Electron paramagnetic resonance (EPR) to measure active oxygen species.

  6. First results from an iron lidar and a VHF radar at Davis, Antarctica

    Science.gov (United States)

    Luebken, F.; Morris, R. J.; Hoeffner, J.; Kaifler, B.; Viehl, T.

    2012-12-01

    We present temperature measurements at Davis, Antarctica (69°S, 78°E), and compare with simultaneous and co-located radar measurements of polar mesosphere summer echoes (PMSE). The mobile scanning iron lidar of the IAP in Kuehlungsborn was installed at Davis in December 2010. It measures iron densities, vertical winds, and temperatures in the iron layer, i. e. from approximately 80 to 100 km. It is based on probing the Doppler broadened resonance line of iron atoms at 386 nm and can operate under daylight conditions. Typical values for temperature uncertainty, altitude and time resolution are 3-5 K, 1 km, and 1 hour, respectively. The lidar also measures neutral air densities and temperatures in the stratosphere and lower mesosphere. At Davis the lidar has up to now achieved approximately 2700 hours of data which is presumably the largest nearly continuous data set in Antarctica. The mesopause altitude changes throughout the summer season by several kilometers, significantly different from the northern hemisphere summer. Depending on altitude, temperatures can be warmer or colder compared to the NH summer. Temperatures at Davis near 86 km are rather similar to the NH, but they are much colder at higher altitudes. The thermal structure around the mesopause at Davis is closely related to the general circulation in the stratosphere, namely to the transition from winter to summer conditions. Different from expectations we sometimes find the mesopause significantly higher and colder(!) compared to the NH. Furthermore, we find large thermal tides in the summer months with amplitudes of up to 6-7~K, which is much larger than expected from models. The Australien Antarctic Division operates a 55 MHz VHF radar at Davis since February 2003. We report first simultaneous measurements of PMSE and temperatures by the Fe lidar. PMSE are strong radar echoes related to ice particles and therefore require atmospheric temperatures being lower than the frost point temperature

  7. Research on EPR measurement methods of sucrose used in radiation accident dose reconstruction.

    Science.gov (United States)

    Ding, Yanqiu; Jiao, Ling; Zhang, Wenyi; Zhou, Li; Zhang, Xiaodong; Zhang, Liang'an

    2010-03-01

    Sucrose is a convenient, common, tissue-equivalent material suitable for electron paramagnetic resonance (EPR) dosimetry of ionising radiation. A number of publications have reported on the dosimetric properties of sucrose and their use in radiation accident dose reconstruction. However, previous studies did not include specially the description of measurement methods of sucrose by EPR. The aim of this work is to introduce particularly the EPR measurement methods of sucrose. In this regard, practical considerations of sample size, microwave power, modulation amplitude, EPR spectrum and signal stability are discussed.

  8. Eksplorativ analyse av EPR-spektre av alanin og Gorilla® Glass

    OpenAIRE

    Jåstad, Eirik Ogner

    2016-01-01

    Elektron Paramagnetisk Resonans (EPR) spektroskopi er en måleteknikk som tar opp spektre som kan brukes til å estimere absorbert stråledose, såkalt EPR-dosimetri. EPR-dosimetri måler mengden frie radikaler i et materiale, som er proporsjonalt med den absorberte dosen. De fleste frie radikaler er kortlivede ved romtemperatur, dette er en utfordring ved EPR-dosimetri. Et materiale som ofte brukes i dosimetri er aminosyren L-α-alanin. Alanin egner seg for planlagte eksponeringer, men ikke nødven...

  9. Alternative chitosan-based EPR dosimeter applicable for a relatively wide range of gamma radiation doses

    Science.gov (United States)

    Piroonpan, Thananchai; Katemake, Pichayada; Panritdam, Eagkapong; Pasanphan, Wanvimol

    2017-12-01

    Chitosan biopolymer is proposed as an alternative EPR dosimeter. Its ability to be EPR dosimeter was studied in comparison with the conventional alanine, sugars (i.e., glucose and sucrose), formate derivatives (i.e., lithium (Li), magnesium (Mg), and calcium (Ca) formate). Ethylene vinyl acetate (EVA) and paraffin were used as binder for the preparation of composite EPR dosimeter. Dose responses of all materials were investigated in a wide dose range of radiation doses, i.e., low-level (0-1 kGy), medium-level (1-10 kGy) and high-level (10-100 kGy). The EPR dosimeter properties were studied under different parameters, i.e., microwave power, materials contents, absorbed doses, storage conditions and post-irradiation effects. Li-formate showed a simple EPR spectrum and exhibited superior radiation response for low-dose range; whereas chitosan and sucrose exhibited linear dose response in all studied dose ranges. The EPR signals of chitosan exhibited similar stability as glucose, Li-formate and alanine at ambient temperature after irradiation as long as a year. All EPR signals of the studied materials were affected post-irradiation temperature and humidity after gamma irradiation. The EPR signal of chitosan exhibited long-term stability and it was not sensitive to high storage temperatures and humidity values after irradiation. Chitosan has a good merit as the alternative bio-based material for a stable EPR dosimeter in a wide range of radiation-absorbed doses.

  10. Host material induced hyperfine structure of F{sup +} centres EPR spectra in CaS

    Energy Technology Data Exchange (ETDEWEB)

    Seeman, Viktor, E-mail: viktor.seeman@ut.ee; Dolgov, Sergei; Maaroos, Aarne

    2017-05-15

    The hyperfine structure (HFS) of F{sup +} centres in CaS single crystals due to the interaction with {sup 33}S and {sup 43}Ca nuclei was observed in EPR spectra for the first time. Angular variations of the HFS were measured for rotation of magnetic field in {100} and {110} crystallographic planes. Using measured orientation-dependent EPR spectra and the EPR NMR program, the parameters of the spin Hamiltonian were determined. In case of {sup 33}S nucleus there is a strong dependence of the F{sup +} centre EPR spectrum on the quadrupole term whereas for {sup 43}Ca nucleus this dependence is insignificant.

  11. A Regional PD Strategy for EPR Systems: Evidence-Based IT Development

    DEFF Research Database (Denmark)

    Simonsen, Jesper; Hertzum, Morten

    2006-01-01

    One of the five regions in Denmark has initiated a remark-able and alternative strategy for the development of Elec-tronic Patient Record (EPR) systems. This strategy is driven by Participatory Design (PD) experiments and based on evidence of positive effects on the clinical practice when using EPR...... systems. We present this PD strategy and our related research on evidence-based IT development. We report from a newly completed PD experiment with EPR in the region conducted through a close collaboration compris-ing a neurological stroke unit, the region’s EPR unit, the vendor, as well as the authors....

  12. An advanced EPR stopped-flow apparatus based on a dielectric ring resonator

    Science.gov (United States)

    Lassmann, Günter; Schmidt, Peter Paul; Lubitz, Wolfgang

    2005-02-01

    A novel EPR stopped-flow accessory is described which allows time-dependent cw-EPR measurements of rate constants of reactions involving paramagnetic species after rapid mixing of two liquid reagents. The EPR stopped-flow design represents a state-of-the-art, computer controlled fluid driving system, a miniresonant EPR structure with an integrated small ball mixer, and a stopping valve. The X-band EPR detection system is an improved version of that reported by Sienkiewicz et al. [Rev. Sci. Instr. 65 (1994) 68], and utilizes a resonator with two stacked ceramic dielectric rings separated by a variable spacer. The resonator with the mode TE( H) 011 is tailored particularly for conditions of fast flowing and rapidly stopped aqueous solutions, and for a high time resolution. The short distance between the ball mixer and the small EPR active volume (1.8 μl) yields a measured dead time of 330 μs. A compact assembly of all parts results in minimization of disturbing microphonics. The computer controlled driving system from BioLogic with two independent stepping motors was optimized for EPR stopped-flow with a hard-stop valve. Performance tests on the EPR spectrometer ESP 300E from BRUKER using redox reactions of nitroxide radicals revealed the EPR stopped-flow accessory as an advanced, versatile, and reliable instrument with high reproducibility.

  13. CW EPR and 9 GHz EPR imaging investigation of stable paramagnetic species and their antioxidant activities in dry shiitake mushroom (Lentinus edodes).

    Science.gov (United States)

    Nakagawa, Kouichi; Hara, Hideyuki

    2016-01-01

    We investigated the antioxidant activities and locations of stable paramagnetic species in dry (or drying) shiitake mushroom (Lentinus edodes) using continuous wave (CW) electron paramagnetic resonance (EPR) and 9 GHz EPR imaging. CW 9 GHz EPR detected paramagnetic species (peak-to-peak linewidth (ΔHpp) = 0.57 mT) in the mushroom. Two-dimensional imaging of the sharp line using a 9 GHz EPR imager showed that the species were located in the cap and shortened stem portions of the mushroom. No other location of the species was found in the mushroom. However, radical locations and concentrations varied along the cap of the mushroom. The 9 GHz EPR imaging determined the exact location of stable paramagnetic species in the shiitake mushroom. Distilled water extracts of the pigmented cap surface and the inner cap of the mushroom showed similar antioxidant activities that reduced an aqueous solution of 0.1 mM 4-hydroxy-2,2,6,6-tetramethylpiperidin-1-oxyl. The present results suggest that the antioxidant activities of the edible mushroom extracts are much weaker than those of ascorbic acid. Thus, CW EPR and EPR imaging revealed the location and distribution of stable paramagnetic species and the antioxidant activities in the shiitake mushroom for the first time.

  14. Long-period unstable gravity-waves and associated VHF radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    Full Text Available VHF atmospheric radar is used to measure the wind velocity and radar echo power related to long-period wind perturbations, including gravity waves, which are observed commonly in the lower stratosphere and tropopause region, and sometimes in the troposphere. These wind structures have been identified previously as either inertia-gravity waves, often associated with jet streams, or mountain waves. At heights of peak wind shear, imbalances are found between the echo powers of a symmetric pair of radar beams, which are expected to be equal. The largest of these power differences are found for conditions of simultaneous high wind shear and high aspect sensitivity. It is suggested that the effect might arise from tilted specular reflectors or anisotropic turbulent scatterers, a result of, for example, Kelvin-Helmholtz instabilities generated by the strong wind shears. This radar power-difference effect could offer information about the onset of saturation in long-period waves, and the formation of thin layers of turbulence.

  15. Anisotropy of Doppler spectral parameters in the VHF radar observations at MU and White Sands

    Directory of Open Access Journals (Sweden)

    G. D. Nastrom

    2001-08-01

    Full Text Available Significant differences are found between the mean spectral widths from beams in the meridional plane and in the zonal plane at both the MU and the White Sands VHF radars. The spectral width in the beam directed perpendicular to the prevailing wind is greater than that in the beam parallel to the wind. The magnitudes of the differences in spectral width show a linear relationship with wind speed, with the greatest differences at the greatest wind speeds. The differences in spectral width show a positive correlation with the differences in backscattered power. The anisotropy in backscattered power is well-known and is usually attributed to aspect sensitivity effects. However, the anisotropy in spectral width does not appear to be due to the same mechanism, and while several hypotheses to account for this are considered, including finite range-volume effects, effects from the tilting of isentropic layers, and anisotropic turbulence effects, it is seen that each of these suggestions has its shortcomings.Key words. Meteorology and atmospheric dynamics (turbulence; instruments and techniques

  16. Anisotropy of Doppler spectral parameters in the VHF radar observations at MU and White Sands

    Directory of Open Access Journals (Sweden)

    G. D. Nastrom

    Full Text Available Significant differences are found between the mean spectral widths from beams in the meridional plane and in the zonal plane at both the MU and the White Sands VHF radars. The spectral width in the beam directed perpendicular to the prevailing wind is greater than that in the beam parallel to the wind. The magnitudes of the differences in spectral width show a linear relationship with wind speed, with the greatest differences at the greatest wind speeds. The differences in spectral width show a positive correlation with the differences in backscattered power. The anisotropy in backscattered power is well-known and is usually attributed to aspect sensitivity effects. However, the anisotropy in spectral width does not appear to be due to the same mechanism, and while several hypotheses to account for this are considered, including finite range-volume effects, effects from the tilting of isentropic layers, and anisotropic turbulence effects, it is seen that each of these suggestions has its shortcomings.

    Key words. Meteorology and atmospheric dynamics (turbulence; instruments and techniques

  17. Study of CNT growth using nanocatalyst Ag precursor by HWC-VHF-PECVD

    Energy Technology Data Exchange (ETDEWEB)

    Eliyana, Ajeng; Rosikin, Ahmad; Winata, Toto, E-mail: toto@fi.itb.ac.id [Physics of Electronics Material Research Division, Physics Programme, Faculty of Mathematics and Natural Sciences, Institut Teknologi Bandung, Jl. Ganesha 10, Bandung 40132, West Java (Indonesia)

    2015-04-16

    The study of CNT growth has been done by using silver (Ag) nanocatalyst as a guide precursor on corning glass 7059 substrate. The silver catalyst was prepared by the evaporation method by varying deposition time for 50, 25, and 14 seconds. The silver films were then annealed at temperature of 400°C for 4 hours. From Scanning Electron Microscope (SEM) and Energy Dispersive X-ray Spectroscopy (EDX) results the grain sizes are 65 nm, 57 nm, and 33 nm, and also the atomic compositions are 6,06%, 4,52%, and 3,73% for 14, 25 and 50 seconds samples, respectively. The 33 nm samples were then used for CNT growth by using Hot Wire Cell (HWC) – Very High Frequency (VHF) – Plasma Enhanced Chemical Vapor Deposition (PECVD) at 275 ° C deposition temperature and pressure of 300 mTorr. The rf power was varied from 8 to 20 watts, with deposition time for 60 minutes. The methane (CH4) 99.999% was used as Carbon sources. Hydrogen gas (H2) was used to etch the oxide layer formed during the pre-deposition process. The diameter and length for the CNT are 125 nm and 1.650 to 2.989 nm respectively.

  18. On the VHF source retrieval errors associated with Lightning Mapping Arrays (LMAs)

    Science.gov (United States)

    Koshak, W. J.

    2016-12-01

    A common method for retrieving the lightning Very High Frequency (VHF) radio source (x, y, z, t) emission is to minimize a (reduced) chi-squared function that indicates how well the model arrival times associated with the model source represent the arrival time measurements at each Lightning Mapping Array (LMA) site. The Levenberg-Marquardt (LM) algorithm is usually employed to find the minimum of the chi-squared function, and the model source producing this minimum is considered to be the optimal source solution. Because the chi-squared mathematical surface is nonlinear, it is important to feed the LM algorithm an accurate initial guess (xo, yo, zo, to) in parameter space to avoid parameter searches that terminate at a relative minima of the chi-squared surface. Source initialization is commonly performed using a linear retrieval algorithm first introduced in Koshak and Solakiewicz (1996), and further applied in Koshak et al. (2004). Monte Carlo simulations and theoretical inferences both show that source retrieval errors (particularly source altitude errors) increase with horizontal source range. In the present study, the effect of modifying certain elements of the retrieval (i. e., the LMA site locations, the number of sites employed, and the retrieval algorithm characteristics) are examined to assess and quantify associated improvements in retrieval results.

  19. Signal processing techniques for phase-coded HF-VHF radars

    Directory of Open Access Journals (Sweden)

    J. A. Baskaradas

    2003-06-01

    Full Text Available HF-VHF radar techniques are easy to employ and commonly used in geophysical applications. They include deep radio soundings, used for probing the ionosphere, stratosphere-mesosphere measurement, weather forecast and radio-glaciology. Fast algorithms and powerful processors facilitate the development of several kinds of low power radars, but the reduction of the transmitted power has to be compensated by on-line processing of an encoded signal to maintain a favorable signal-to-noise ratio suitable for detection. Moreover, radars have to reconstruct return echoes with different travel times due to various origins (multi-path, adjacent objects, etc.. Such needs can be accomplished by means of signal phase coding and one of the most attractive is the reversal phase code. The composite echo signal must be processed to extract the physical information useful for the measurement considered. In this paper some algorithms used for on-line processing of phase-coded signals will be described, both in time and frequency domain.

  20. Semiquantum secure direct communication using EPR pairs

    Science.gov (United States)

    Zhang, Ming-Hui; Li, Hui-Fang; Xia, Zhao-Qiang; Feng, Xiao-Yi; Peng, Jin-Ye

    2017-05-01

    Quantum secure direct communication can transmit a secret message directly through quantum channels without first generating a shared secret key. In the most of the existing protocols, quantum secure direct communication is possible only when both communicating participants have quantum capabilities. So what happens if either party of two participants just has classical capabilities? In this paper, we propose a semiquantum secure direct communication protocol with Einstein-Podolsky-Rosen photon pairs in which the classical sender Bob transmits a secret message to quantum Alice directly. After checking the security of quantum channels, Bob encodes his secret message on Alice's code sequence. Then, quantum Alice extracts Bob's secret message by measuring her home qubits and the received code qubits, respectively. In addition, we demonstrate the security of the proposed protocol against some individual eavesdropping attacks. The efficiency analysis shows that our protocol can provide higher efficiency.

  1. EPR dosimetry of radiation background in the Urals region

    Energy Technology Data Exchange (ETDEWEB)

    Shishkina, E.A.; Degteva, M.O.; Shved, V.A. [Urals Research Center for Radiation Medicine, 48-A Vorovsky, Chelyabinsk 454076 (Russian Federation); Fattibene, P.; Onori, S. [Istituto Superiore di Sanita and Istituto Nazionale di Fisica Nucleare (Italy); Wieser, A. [GSF, Forschungszentrum fuer Umwelt und Gesundheit, Ingolstaedter Landstr (Germany); Ivanov, D.V.; Bayankin, S.N. [Institute of Metal Physics, Russian Academy of Sciences (Russian Federation); Knyazev, V.A.; Vasilenko, E.I.; Gorelov, M. [ZAO, Closed Corporation ' Company GEOSPETSECOLOGIA' (Russian Federation)

    2006-07-01

    Method of Electron Paramagnetic Resonance is extensively applied to individual retrospective dosimetry. The background dose is unavoidable component of cumulative absorbed dose in the tooth enamel accumulated during the lifetime of donor. Estimation of incidental radiation dose using tooth enamel needs in extraction of background dose. Moreover, the variation of background doses in the population is a limited factor for reliable detection of additional irradiation especially for low dose level. Therefore the accurate knowledge of the natural background radiation dose is a critical element of EPR studies of exposed populations. In the Urals region the method applies for such two large cohorts as the workers of Mayak (Ozersk citizens) and Techa River riverside inhabitants (rural population). Current study aimed to investigate the Urals radiation background detected by EPR spectrometry. For this aim two group of unexposed Urals residents were separated, viz: citizens of Ozersk and rural inhabitants of Chelyabinsk region. Comparison of two investigated territories has demonstrated that from the point of view of radiation background it is impossible to assume the Urals population as uniform. The reliable difference between the urban and rural residents has been found. The average background doses of Ozersk donors is in average 50 mGy higher than those detected for rural residents. The individual variability of background doses for Osersk has been higher than in the rural results. The difference in background dose levels between two population results in different limits of accidental dose detection and individualization. The doses for 'Mayak' workers (Ozyorsk citizens) can be classed as anthropogenic if the EPR measurements exceed 120 mGy for teeth younger than 40 years, and 240 mGy for teeth older than 70 years. The anthropogenic doses for Techa River residents (rural population) would be higher than 95 mGy for teeth younger than 50 years and 270 mGy for

  2. EPR Characterization of the Triheme Cytochrome from Geobacter sulfurreducens.

    Science.gov (United States)

    Ponomarenko, Nina; Niklas, Jens; Pokkuluri, Phani Raj; Poluektov, Oleg G; Tiede, David Michael

    2018-01-03

    Periplasmic cytochrome A (PpcA) is a representative of a broad class of multi-heme cytochromes functioning as protein "nanowires" for storage and extracellular transfer of multiple electrons in the δ-proteobacterium Geobacter sulfurreducens. PpcA contains three bis-His coordinated hemes held in a spatial arrangement that is highly conserved among the multi-heme cytochromes c3 and c7 families, carries low potential hemes and is notable for having one of the lowest number of amino acids utilized to maintain a characteristic protein fold and site specific heme function. Low temperature X-band EPR spectroscopy has been used to characterize the electronic configuration of the Fe(III) and the ligation mode for each heme. The three sets of EPR signals are assigned to individual hemes in the 3D crystal structure. The relative energy levels of the Fe(III) 3d orbitals for individual hemes was estimated from the principal g values. The observed g tensor anisotropy was used as a probe of electronic structure of each heme and differences were determined by specifics of axial ligation. To ensure unambiguous assignment of highly anisotropic low spin (HALS) signal to individual hemes, EPR analyses of iron atom electronic configurations have been supplemented with investigation of porphyrin macrocycles by 1D 1H NMR chemical shift patterns for the methyl substituents. Within optimized geometry of hemes in PpcA the magnetic interactions between hemes were found to be minimal, similar to c3 family of tetraheme cytochromes.

  3. EPR oximetry of tumors in vivo in cancer therapy

    Science.gov (United States)

    Šentjurc, Marjeta; Čemažar, Maja; Serša, Gregor

    2004-05-01

    The partial oxygen pressure ( pO 2) in tumors is considered to be one of important factors that affect the response of tumors to different treatment. Therefore, we anticipate that the information about the variation of oxygen concentration in tumors can be used as a guide for individualizing radiotherapy, chemotherapy, and especially the combined therapies. There is thus a need to obtain quantitative data on the effects of different therapies on tumor oxygenation under in vivo conditions. One of the methods, which enable these measurements is EPR oximetry. In this work basic principles of the method will be described as well as some examples of tumor oxygenation changes after application of chemotherapeutic drugs (vinblastine, cisplatin, bleomycin) or electric pulses in combination with cisplatin or bleomycin to fibrosarcoma SA-1 tumors in mice. A paramagnetic probe, a char of Bubinga tree, was implanted into the tumor (center and periphery) and in the muscle or subcutis. EPR spectra line-width, which is proportional to oxygen concentration, was measured with time after the treatments. Tumor oxygenation was reduced for 58% of pretreatment value 1 h after intraperitoneal injection of 2.5 mg kg -1 VLB and returned to pretreatment level within 24 h. Reduction in oxygenation of muscle and subcutis was much smaller and returned to pretreatment value faster as in tumors. With cisplatin (4 mg kg -1) and bleomicyn (1 mg kg -1) the reduction was less than 15%, but increases in combined therapy to 70%. Similar reduction was observed also with electric pulses alone (eight pulses, 1300 V cm -1, 100 μs, 1 Hz) with fast recovery of 8 h. After electrochemotherapy the recovery was slower and occurs only after 48 h. This study demonstrates that EPR oximetry is a sensitive method for monitoring changes in tissue oxygenation after different treatments, which may have implications in controlling side effects of therapy and in the planning of combined treatments.

  4. EPR study on copper- and vanadium complexes with substituted phthalocyanines

    Energy Technology Data Exchange (ETDEWEB)

    Shklyaev, A.A.; Selyutin, G.E.; Shakot' ko, N.I.; Mikhalenko, S.A. (Nauchno-Issledovatel' skij Inst. Organicheskikh Poluproduktov i Krasitelej, Moscow (USSR))

    1984-06-01

    The structure of binuclear associates of substituted vanadyl- and copper-phthalocyanines is investigated. The EPR study has shown that metal phthalocyanine protonation in acid media (CH/sub 2/Cl/sub 2/, Py, H/sub 2/SO/sub 4/, toluence, etc) is accompanied by destabilization of bonds of the central ion with a polycyclic ligand. Substituted copper- and vanadyl phthalocyanines form dimerized associates where M-M interatmic distance varies in a wide range from 4.1 to 12 A.

  5. EPR study of deoxygenated high-temperature superconductors

    Indian Academy of Sciences (India)

    Abstract. High-Tc superconductors are EPR silent but on a little deoxygenation of the high-Tc materials and their constituents, they yield rich but complex spectra. Spectra of (1) CuO, (2) BaCuO2,. (3) CaCuO2, (4) Y2Cu2O5, (5) La2CuO4, (6) La2−x Mx CuO4 (M = Sr, Ba), (7) Y based-123, (8) Bi based-2201, 2212, 2223, ...

  6. Medical reference dosimetry using EPR measurements of alanine

    DEFF Research Database (Denmark)

    Helt-Hansen, Jakob; Rosendal, F.; Kofoed, I.M.

    2009-01-01

    Background. Electron spin resonance (EPR) is used to determine the absorbed dose of alanine dosimeters exposed to clinical photon beams in a solid-water phantom. Alanine is potentially suitable for medical reference dosimetry, because of its near water equivalence over a wide energy spectrum, low...... methods the proposed algorithm can be applied without normalisation of phase shifts caused by changes in the g-value of the cavity. The study shows that alanine dosimetry is a suitable candidate for medical reference dosimetry especially for quality control applications....

  7. Characterization of Bifunctional Spin Labels for Investigating the Structural and Dynamic Properties of Membrane Proteins Using EPR Spectroscopy.

    Science.gov (United States)

    Sahu, Indra D; Craig, Andrew F; Dunagum, Megan M; McCarrick, Robert M; Lorigan, Gary A

    2017-10-05

    Site-directed spin labeling (SDSL) coupled with electron paramagnetic resonance (EPR) spectroscopy is a very powerful technique to study structural and dynamic properties of membrane proteins. The most widely used spin label is methanthiosulfonate (MTSL). However, the flexibility of this spin label introduces greater uncertainties in EPR measurements obtained for determining structures, side-chain dynamics, and backbone motion of membrane protein systems. Recently, a newer bifunctional spin label (BSL), 3,4-bis(methanethiosulfonylmethyl)-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-1-yloxy, has been introduced to overcome the dynamic limitations associated with the MTSL spin label and has been invaluable in determining protein backbone dynamics and inter-residue distances due to its restricted internal motion and fewer size restrictions. While BSL has been successful in providing more accurate information about the structure and dynamics of several proteins, a detailed characterization of the spin label is still lacking. In this study, we characterized BSLs by performing CW-EPR spectral line shape analysis as a function of temperature on spin-labeled sites inside and outside of the membrane for the integral membrane protein KCNE1 in POPC/POPG lipid bilayers and POPC/POPG lipodisq nanoparticles. The experimental data revealed a powder pattern spectral line shape for all of the KCNE1-BSL samples at 296 K, suggesting the motion of BSLs approaches the rigid limit regime for these series of samples. BSLs were further utilized to report for the first time the distance measurement between two BSLs attached on an integral membrane protein KCNE1 in POPC/POPG lipid bilayers at room temperature using dipolar line broadening CW-EPR spectroscopy. The CW dipolar line broadening EPR data revealed a 15 ± 2 Å distance between doubly attached BSLs on KCNE1 (53/57-63/67) which is consistent with molecular dynamics modeling and the solution NMR structure of KCNE1 which yielded a

  8. EPR of photochromic Mo3+ in SrTiO3

    NARCIS (Netherlands)

    Kool, Th.W.

    2010-01-01

    In single crystals of SrTiO_3, a paramagnetic center, characterized by S = 3/2 and hyperfine interaction with an I = 5/2 nuclear spin has been observed in the temperature range 4.2K-77K by means of EPR. The impurity center is attributed to Mo3+. No additional line splitting in the EPR spectrum due

  9. EPR study of positive holes on phenylene vinylene chains : from dimer to polymer

    NARCIS (Netherlands)

    Zezin, AA; Feldman, [No Value; Warman, JM; Wildeman, J; Hadziioannou, G

    2004-01-01

    Isolated radical cations of substituted oligomers and polymers of phenylene vinylenes (PV) produced by irradiation in glassy toluene solutions were characterized by EPR. It was shown that the linewidth of the EPR signal from radical cations in oligomers decreased with increasing the number of repeat

  10. Analyzing three-player quantum games in an EPR type setup.

    Science.gov (United States)

    Chappell, James M; Iqbal, Azhar; Abbott, Derek

    2011-01-01

    We use the formalism of Clifford Geometric Algebra (GA) to develop an analysis of quantum versions of three-player non-cooperative games. The quantum games we explore are played in an Einstein-Podolsky-Rosen (EPR) type setting. In this setting, the players' strategy sets remain identical to the ones in the mixed-strategy version of the classical game that is obtained as a proper subset of the corresponding quantum game. Using GA we investigate the outcome of a realization of the game by players sharing GHZ state, W state, and a mixture of GHZ and W states. As a specific example, we study the game of three-player Prisoners' Dilemma.

  11. Analyzing three-player quantum games in an EPR type setup.

    Directory of Open Access Journals (Sweden)

    James M Chappell

    Full Text Available We use the formalism of Clifford Geometric Algebra (GA to develop an analysis of quantum versions of three-player non-cooperative games. The quantum games we explore are played in an Einstein-Podolsky-Rosen (EPR type setting. In this setting, the players' strategy sets remain identical to the ones in the mixed-strategy version of the classical game that is obtained as a proper subset of the corresponding quantum game. Using GA we investigate the outcome of a realization of the game by players sharing GHZ state, W state, and a mixture of GHZ and W states. As a specific example, we study the game of three-player Prisoners' Dilemma.

  12. On the Correlation between EPR and Positron Annihilation Measurements on gamma-Irradiated Acetyl Methionine

    DEFF Research Database (Denmark)

    Eldrup, Morten Mostgaard; Lund-Thomsen, E.; Mogensen, O. E.

    1972-01-01

    The dose dependence of the relative EPR signal intensity and positron lifetime spectrum was measured for γ‐irradiated acetyl methionine in the dose range from 0 to 30 Mrad. Angular correlation measurements were performed for the doses 0 and 30 Mrad. The result of the irradiation was the creation...... of EPR centers and inhibition of positronium formation. For one sample, irradiated with a dose of 30 Mrad, EPR and positron lifetime spectra were followed over a period of 50 days after the irradiation. The inhibiting effect and the EPR signal intensity decreased with time. No simple correlation could...... be established between the number of EPR centers and the positron annihilation data, but other possible explanations are discussed....

  13. Design and testing of a 750MHz CW-EPR digital console for small animal imaging.

    Science.gov (United States)

    Sato-Akaba, Hideo; Emoto, Miho C; Hirata, Hiroshi; Fujii, Hirotada G

    2017-11-01

    This paper describes the development of a digital console for three-dimensional (3D) continuous wave electron paramagnetic resonance (CW-EPR) imaging of a small animal to improve the signal-to-noise ratio and lower the cost of the EPR imaging system. A RF generation board, an RF acquisition board and a digital signal processing (DSP) & control board were built for the digital EPR detection. Direct sampling of the reflected RF signal from a resonator (approximately 750MHz), which contains the EPR signal, was carried out using a band-pass subsampling method. A direct automatic control system to reduce the reflection from the resonator was proposed and implemented in the digital EPR detection scheme. All DSP tasks were carried out in field programmable gate array ICs. In vivo 3D imaging of nitroxyl radicals in a mouse's head was successfully performed. Copyright © 2017 Elsevier Inc. All rights reserved.

  14. Preliminary study for precision dosimetry using electron paramagnetic resonance (EPR) in radiotherapy applications

    Energy Technology Data Exchange (ETDEWEB)

    Shehzadi, N. N.; Kim, I. J.; Yi, C. Y. [Center for Ionizing Radiation, Korea Research for Standards and Science, Daejeon (Korea, Republic of)

    2015-10-15

    EPR (Electron paramagnetic resonance) dosimetry for radiotherapy dose range (1-10 Gy) is still being established.Alanine is an important material for EPR dosimetry because in terms of density and radiation absorption properties, it is water equivalent. High repeatability and high reproducibility of alanine spectrum measurement makes it possible to estimate the irradiation dose accurately. This baseline study has been carried out to establish precision EPR dosimetry in therapeutic photon range. For that purpose, an EPR dosimetry system has been setup and repeatability as well as reproducibility of measurements using alanine dosimeter have been evaluated. Effect of anisotropy of alanine dosimeter in spectrometer cavity has also been observed. EPR dosimetry system is set up at KRISS. It is found that reproducibility of the system at therapeutic photon range is 1.5 % - 6.6 %.

  15. Phenylbutazone Oxidation via Cu,Zn-SOD Peroxidase Activity: An EPR Study.

    Science.gov (United States)

    Aljuhani, Naif; Whittal, Randy M; Khan, Saifur R; Siraki, Arno G

    2015-07-20

    We investigated the effect of Cu,Zn-superoxide dismutase (Cu,Zn-SOD)-peroxidase activity on the oxidation of the nonsteroidal anti-inflammatory drug phenylbutazone (PBZ). We utilized electron paramagnetic resonance (EPR) spectroscopy to detect free radical intermediates of PBZ, UV-vis spectrophotometry to monitor PBZ oxidation, oxygen analysis to determine the involvement of C-centered radicals, and LC/MS to determine the resulting metabolites. Using EPR spectroscopy and spin-trapping with 5,5-dimethyl-1-pyrroline-N-oxide (DMPO), we found that the spin adduct of CO3(•-) (DMPO/(•)OH) was attenuated with increasing PBZ concentrations. The resulting PBZ radical, which was assigned as a carbon-centered radical based on computer simulation of hyperfine splitting constants, was trapped by both DMPO and MNP spin traps. Similar to Cu,Zn-SOD-peroxidase activity, an identical PBZ carbon-centered radical was also detected with the presence of both myeloperoxidase (MPO/H2O2) and horseradish peroxidase (HRP/H2O2). Oxygen analysis revealed depletion in oxygen levels when PBZ was oxidized by SOD peroxidase-activity, further supporting carbon radical formation. In addition, UV-vis spectra showed that the λmax for PBZ (λ = 260 nm) declined in intensity and shifted to a new peak that was similar to the spectrum for 4-hydroxy-PBZ when oxidized by Cu,Zn-SOD-peroxidase activity. LC/MS evidence supported the formation of 4-hydroxy-PBZ when compared to that of a standard, and 4-hydroperoxy-PBZ was also detected in significant yield. These findings together indicate that the carbonate radical, a product of SOD peroxidase activity, appears to play a role in PBZ metabolism. Interestingly, these results are similar to findings from heme peroxidase enzymes, and the context of this metabolic pathway is discussed in terms of a mechanism for PBZ-induced toxicity.

  16. Dosimetry of stereotactic radiosurgery using lithium formate EPR dosimeters

    Science.gov (United States)

    Waldeland, Einar; Hörling, Magnus; Olaug Hole, Eli; Sagstuen, Einar; Malinen, Eirik

    2010-04-01

    Small lithium formate EPR (electron paramagnetic resonance) dosimeters (diameter 3 mm, height 2 mm) were produced and employed for 2D dosimetry of stereotactic radiosurgery (SRS). An anthropomorphic head phantom with an in-house made insert holding 45 lithium formate dosimeters was used. A spherical target was outlined centrally in planning CT images of the head and an SRS dose plan with three arcs was made using the iPlan planning system. Beam collimation was achieved with the BrainLAB m3 micro-MLC. The minimum target dose was 15 Gy. The planned dose distribution was compared to measurements. For dosimetry, a dosimeter calibration series was generated with doses from 1 to 20 Gy. At the treatment unit, three replicate measurement series were performed. The measurements gave on average 2.2% lower dose at the plateau of the dose distribution compared to the dose plan. Larger differences were seen in the penumbra, where the dose plan underestimated the dose gradients. By repeated measurements, the systematic and random error in the SRS delivery was estimated to less than 1 mm. In conclusion, the planning system produced an intracranial dose distribution with tolerable accuracy. Furthermore, small lithium formate EPR dosimeters were useful for measuring SRS dose distributions.

  17. New Developments in Spin Labels for Pulsed Dipolar EPR

    Directory of Open Access Journals (Sweden)

    Alistair J. Fielding

    2014-10-01

    Full Text Available Spin labelling is a chemical technique that enables the integration of a molecule containing an unpaired electron into another framework for study. Given the need to understand the structure, dynamics, and conformational changes of biomacromolecules, spin labelling provides a relatively non-intrusive technique and has certain advantages over X-ray crystallography; which requires high quality crystals. The technique relies on the design of binding probes that target a functional group, for example, the thiol group of a cysteine residue within a protein. The unpaired electron is typically supplied through a nitroxide radical and sterically shielded to preserve stability. Pulsed electron paramagnetic resonance (EPR techniques allow small magnetic couplings to be measured (e.g., <50 MHz providing information on single label probes or the dipolar coupling between multiple labels. In particular, distances between spin labels pairs can be derived which has led to many protein/enzymes and nucleotides being studied. Here, we summarise recent examples of spin labels used for pulse EPR that serve to illustrate the contribution of chemistry to advancing discoveries in this field.

  18. Identification of irradiated food by EPR-spectroscopy and tomography

    Energy Technology Data Exchange (ETDEWEB)

    Groth, N. (KAI e.V., Tomographie-Labor, Berlin (Germany)); Anders, B. (Technische Fachhochschule Berlin (Germany). Fachbereich Mathematik/Physik); Maerzke, A. (Forschungsstelle fuer Ortsaufloesende Messtechnik e.V., Berlin (Germany)); Nitschke, S. (KAI e.V., Tomographie-Labor, Berlin (Germany)); Schlawe, R. (Forschungsstelle fuer Ortsaufloesende Messtechnik e.V., Berlin (Germany)); Herrling, T. (KAI e.V., Tomographie-Labor, Berlin (Germany))

    1993-01-01

    Food irradiation is used to kill harmful microorganisms (e.g. salmonella), this improving food safety and extending the shelf-life. The electron paramagnetic resonance (EPR) detection of stable, radiation-induced free radicals within the matrix of calcified tissue is well established. An extention of this technique to food provides in suitable cases one of the most promissing methods for detecting that irradiation has been performed. It provides an excellent method for the identification of irradiated foods containing bones or calcified cuticle even in the absence of unirradiated controls. Bones of chicken, pepper grains and lentils were also identified as irradiated some weeks after radiation treatment. The method is rapid and can detect very low doses. With EPR - Tomography the 2D spatial distribution of the irradiation induced stable radicals in the cross section of a chicken bone was measured. The use of ionising radiation to treat certain foodstuffs is increasingly of interest and there is a need to determine wether irradiation has occured, and to what extent. (orig.)

  19. EPR dosimetric properties of nano-barium sulfate

    Science.gov (United States)

    Aboelezz, E.; Hassan, G. M.; Sharaf, M. A.; El-Khodary, A.

    2015-01-01

    Nano/micro BaSO4 were prepared through the co-precipitation method to measure ionizing radiation doses using electron paramagnetic resonance (EPR). The nano-BaSO4 sample was characterized using X-ray diffraction (XRD), and transmission electron microscopy (TEM) techniques. The dose response and fading properties of nano- and micro-phase BaSO4 were compared in EPR spectra. The prepared nano- and micro-BaSO4 samples have the same hole and electron centers, which may be attributed to SO4- and SO3-, respectively. The dosimetric signals for prepared nano- and micro-BaSO4 have spectroscopic splitting factor (g) with values 2.0025±0.0006 and 2.0027±0.0006, respectively. The nanocrystalline sample has a linear γ-ray dose response over the range 0.4 Gy-1 kGy. The performance parameters which including detection limit and critical level calculated from weighted and unweighted least-squares fitting. The sensitivity of nano-BaSO4 to γ-ray is one and a half times more than alanine. The lifetime and activation energy for nano-BaSO4 were estimated by conducting a thermal stability study, and were 5.7±1.1×104 years and 0.73±0.14 eV, respectively. The combined and expanded uncertainties accompanying measurements were ±3.89% and ±7.78%, respectively.

  20. Identification of irradiated oysters by EPR measurements on shells

    Energy Technology Data Exchange (ETDEWEB)

    Della Monaca, S., E-mail: sara.dellamonaca@iss.it [Istituto Superiore di Sanita, viale Regina Elena, 299 Rome (Italy); Fattibene, P.; Boniglia, C.; Gargiulo, R.; Bortolin, E. [Istituto Superiore di Sanita, viale Regina Elena, 299 Rome (Italy)

    2011-09-15

    In this paper the EPR spectra of the radicals induced in oyster shells after irradiation to (0.5-2) kGy ionizing radiation doses are analyzed. EPR spectra of irradiated shells showed the complex radical composition of biocarbonates, characterized by the presence of SO{sub 2}{sup -}, SO{sub 3}{sup -} and CO{sub 2}{sup -} radicals with different symmetries. In particular, the radiation-induced line at g = 2.0038, due to the g{sub x} component of the orthorhombic SO{sub 3}{sup -}, was well distinguishable from the rest of the spectrum. The g{sub x} component of the orthorhombic SO{sub 3}{sup -} was found to be intense and stable enough to allow the identification at least for the whole shelf life of the oyster. Furthermore, it is still well visible at low microwave powers for which the other signals are weak or non-visible and has a linear dose response in the (0.5-2) kGy range. A possible procedure protocol for the identification of irradiated oysters, can be based on acquisitions of the spectrum at low microwave power values (tenths of milliWatt) and low modulation amplitude values (0.03-0.05 mT) and on the identification of the g = 2.0038 signal as a proof of the ionizing radiation treatment performed on the sample.

  1. SIMULACIÓN DEL ESPECTRO EPR DEL RADICAL CO2-

    Directory of Open Access Journals (Sweden)

    Eduar Enrique Carvajal Taborda

    2013-09-01

    Full Text Available La  dosimetría EPR se basa en el hecho de que las radiaciones ionizantes interaccionan con el tejido mineralizado, en este caso es esmalte dental y tejido óseo, generan los radicales CO2- estables a temperatura ambiente y de larga vida cuya concentración depende de la dosis recibida. La cuantificación de estos radicales libres se hace por EPR, cuyo espectro característico consta de dos líneas, una muy intensa y otra de menor intensidad. En este trabajo identificamos teóricamente estas dos líneas solucionando el Hamiltoniano de espín electrónico y  simulando el espectro experimental, encontramos que el espectro ERP del radical CO2- es producido por la interacción del espín del electrón desapareado con el campo magnético externo y que el radical CO2- está ubicado en una simetría local axial.

  2. Effect of solar and magnetic activity on VHF scintillations near the equatorial anomaly crest

    Directory of Open Access Journals (Sweden)

    R. P. Singh

    2004-09-01

    Full Text Available The VHF amplitude scintillation recorded during the period January 1991 to December 1993 in the declining phase of a solar cycle and April 1998 to December 1999 in the ascending phase of the next solar cycle at Varanasi (geogr. lat.=25.3°, long.=83.0°, dip=37°N have been analyzed to study the behavior of ionospheric irregularities during active solar periods and magnetic storms. It is shown that irregularities occur at arbitrary times and may last for <30min. A rise in solar activity increases scintillations during winter (November-February and near equinoxes (March-April; September-October, whereas it depresses the scintillations during the summer (May-July. In general, the role of magnetic activity is to suppress scintillations in the pre-midnight period and to increase it in the post-midnight period during equinox and winter seasons, whilst during summer months the effect is reversed. The pre-midnight scintillation is sometimes observed when the main phase of Dst corresponds to the pre-midnight period. The annual variation shows suppression of scintillations on disturbed days, both during pre-midnight and post-midnight period, which becomes more effective during years of high solar activity. It is observed that for magnetic storms for which the recovery phase starts post-midnight, the probability of occurrence of irregularities is enhanced during this time. If the magnetic storm occurred during daytime, then the probability of occurrence of scintillations during the night hours is decreased. The penetration of magnetospheric electric fields to the magnetic equator affects the evolution of low-latitude irregularities. A delayed disturbance dynamo electric field also affects the development of irregularities.

  3. Simulation of Controller Pilot Data Link Communications over VHF Digital Link Mode 3

    Science.gov (United States)

    Bretmersky, Steven C.; Murawski, Robert; Nguyen, Thanh C.; Raghavan, Rajesh S.

    2004-01-01

    The Federal Aviation Administration (FAA) has established an operational plan for the future Air Traffic Management (ATM) system, in which the Controller Pilot Data Link Communications (CPDLC) is envisioned to evolve into digital messaging that will take on an ever increasing role in controller to pilot communications, significantly changing the way the National Airspace System (NAS) is operating. According to FAA, CPDLC represents the first phase of the transition from the current analog voice system to an International Civil Aviation Organization (ICAO) compliant system in which digital communication becomes the alternate and perhaps primary method of routine communication. The CPDLC application is an Air Traffic Service (ATS) application in which pilots and controllers exchange messages via an addressed data link. CPDLC includes a set of clearance, information, and request message elements that correspond to existing phraseology employed by current Air Traffic Control (ATC) procedures. These message elements encompass altitude assignments, crossing constraints, lateral deviations, route changes and clearances, speed assignments, radio frequency assignments, and various requests for information. The pilot is provided with the capability to respond to messages, to request clearances and information, to report information, and to declare/rescind an emergency. A 'free text' capability is also provided to exchange information not conforming to defined formats. This paper presents simulated results of the aeronautical telecommunication application Controller Pilot Data Link Communications over VHF Digital Link Mode 3 (VDL Mode 3). The objective of this simulation study was to determine the impact of CPDLC traffic loads, in terms of timely message delivery and capacity of the VDL Mode 3 subnetwork. The traffic model is based on and is used for generating air/ground messages with different priorities. Communication is modeled for the en route domain of the Cleveland

  4. Seasonal and diurnal changes in wind variability from Flatland VHF profiler observations

    Energy Technology Data Exchange (ETDEWEB)

    Nastrom, G.D. [Saint Cloud State Univ., MN (United States). Dept. of Earth Sci.; Clark, W.L. [National Oceanic and Atmospheric Administration, Boulder, CO (United States). Aeronomy Lab.; Zandt, T.E. van [National Oceanic and Atmospheric Administration, Boulder, CO (United States). Aeronomy Lab.; Warnock, J.M. [National Oceanic and Atmospheric Administration, Boulder, CO (United States). Aeronomy Lab.

    1996-02-01

    Climatological results are presented on the hourly variance of the wind observed in the mid-troposphere (3 to 9 km MSL). This quantity roughly indicates the energy in the atmospheric wind field for variations with periods roughly less than 1 hour. Observations are from the Flatland VHF research wind profiler, located near Champaign/Urbana, Illinois, well away from significant orographic features. The period of record covers two years, September 1990 through August 1992. The values of the variance of the winds along vertical and oblique (15 degrees from zenith in the cardinal directions) beams are presented versus height, season, time-of-day, and beam pointing direction. It is found that the hourly variance values have approximately lognormal frequency distribution. The mean hourly variance is significantly larger for the oblique wind observations than for the vertical. Mean wind variances also tend to be larger in the east/west steering plane than in the north/south plane. The mean variance generally increases with height, but faster than would be expected if it were due solely to the decrease in atmospheric density, implying the presence of local source/sinks of wind energy. The rate of change with height is noticeably different for the vertical and oblique beams, being much less for the vertical beam, in some seasons even decreasing with height. With respect to season, the mean hourly variance is smallest in the summer and largest in the winter. With respect to diurnal changes, the variance is maximum during the afternoon for spring, summer, and autumn, with the maximum up to a factor of two larger than the minimum. In winter, the diurnal change is much smaller, with little indication of an afternoon maximum. (orig.)

  5. VHF radar observations of turbulent structures in the polar mesopause region

    Directory of Open Access Journals (Sweden)

    P. Czechowsky

    Full Text Available The mobile SOUSY VHF Radar was operated in the summer of 1987 during the MAC/SINE campaign in northern Norway to study the polar mesosphere summer echoes (PMSE. Measurements of the spectral width indicate that two types of structures occur. In general mesospheric layers are bifurcated exhibiting a narrow spectral width and a well-defined aspect sensitivity. However, for about 10% of the observation time cells of enhanced turbulence characterized by extremely broad spectral widths appear predominantly in the upper sublayer above 86 km. Identification and separation of beam and shear broadening allows a determination of the turbulence-induced component of the spectral width. This case study reveals that during several events these cloud-like structures of enhanced turbulence move with an apparent velocity of several tens of meters per second which is almost identical with the phase trace velocity of simultaneously observed waves. Since, at that time, the Richardson number was less than a quarter, it was concluded that these turbulent cells were generated by a Kelvin-Helmholtz mechanism. The horizontal extent of these structures was calculated to be less than 40 km. A general relation between spectral width and echo power was not detected. The turbulent component of the spectral width was used to calculate typical values of the energy dissipation rate at times where narrow spectral width dominates and during periods of enhanced turbulence. In addition, the outer scale of the inertial subrange (buoyancy scale was estimated. For the first time the occurrence and motion of this type of structures of enhanced spectral width is analyzed and discussed in detail.

  6. VHF radar observations of turbulent structures in the polar mesopause region

    Directory of Open Access Journals (Sweden)

    P. Czechowsky

    1997-08-01

    Full Text Available The mobile SOUSY VHF Radar was operated in the summer of 1987 during the MAC/SINE campaign in northern Norway to study the polar mesosphere summer echoes (PMSE. Measurements of the spectral width indicate that two types of structures occur. In general mesospheric layers are bifurcated exhibiting a narrow spectral width and a well-defined aspect sensitivity. However, for about 10% of the observation time cells of enhanced turbulence characterized by extremely broad spectral widths appear predominantly in the upper sublayer above 86 km. Identification and separation of beam and shear broadening allows a determination of the turbulence-induced component of the spectral width. This case study reveals that during several events these cloud-like structures of enhanced turbulence move with an apparent velocity of several tens of meters per second which is almost identical with the phase trace velocity of simultaneously observed waves. Since, at that time, the Richardson number was less than a quarter, it was concluded that these turbulent cells were generated by a Kelvin-Helmholtz mechanism. The horizontal extent of these structures was calculated to be less than 40 km. A general relation between spectral width and echo power was not detected. The turbulent component of the spectral width was used to calculate typical values of the energy dissipation rate at times where narrow spectral width dominates and during periods of enhanced turbulence. In addition, the outer scale of the inertial subrange (buoyancy scale was estimated. For the first time the occurrence and motion of this type of structures of enhanced spectral width is analyzed and discussed in detail.

  7. The relationship between VHF radar auroral backscatter amplitude and Doppler velocity: a statistical study

    Directory of Open Access Journals (Sweden)

    B. A. Shand

    1996-08-01

    Full Text Available A statistical investigation of the relationship between VHF radar auroral backscatter intensity and Doppler velocity has been undertaken with data collected from 8 years operation of the Wick site of the Sweden And Britain Radar-auroral Experiment (SABRE. The results indicate three different regimes within the statistical data set; firstly, for Doppler velocities <200 m s–1, the backscatter intensity (measured in decibels remains relatively constant. Secondly, a linear relationship is observed between the backscatter intensity (in decibels and Doppler velocity for velocities between 200 m s–1 and 700 m s–1. At velocities greater than 700 m s–1 the backscatter intensity saturates at a maximum value as the Doppler velocity increases. There are three possible geophysical mechanisms for the saturation in the backscatter intensity at high phase speeds: a saturation in the irregularity turbulence level, a maximisation of the scattering volume, and a modification of the local ambient electron density. There is also a difference in the dependence of the backscatter intensity on Doppler velocity for the flow towards and away from the radar. The results for flow towards the radar exhibit a consistent relationship between backscatter intensity and measured velocities throughout the solar cycle. For flow away from the radar, however, the relationship between backscatter intensity and Doppler velocity varies during the solar cycle. The geometry of the SABRE system ensures that flow towards the radar is predominantly associated with the eastward electrojet, and flow away is associated with the westward electrojet. The difference in the backscatter intensity variation as a function of Doppler velocity is attributed to asymmetries between the eastward and westward electrojets and the geophysical parameters controlling the backscatter amplitude.

  8. Statistics of 150-km echoes over Jicamarca based on low-power VHF observations

    Directory of Open Access Journals (Sweden)

    J. L. Chau

    2006-07-01

    Full Text Available In this work we summarize the statistics of the so-called 150-km echoes obtained with a low-power VHF radar operation at the Jicamarca Radio Observatory (11.97 S, 76.87 W, and 1.3 dip angle at 150-km altitude in Peru. Our results are based on almost four years of observations between August 2001 and July 2005 (approximately 150 days per year. The majority of the observations have been conducted between 08:00 and 17:00 LT. We present the statistics of occurrence of the echoes for each of the four seasons as a function of time of day and altitude. The occurrence frequency of the echoes is ~75% around noon and start decreasing after 15:00 LT and disappear after 17:00 LT in all seasons. As shown in previous campaign observations, the 150-echoes appear at a higher altitude (>150 km in narrow layers in the morning, reaching lower altitudes (~135 km around noon, and disappear at higher altitudes (>150 km after 17:00 LT. We show that although 150-km echoes are observed all year long, they exhibit a clear seasonal variability on altitudinal coverage and the percentage of occurrence around noon and early in the morning. We also show that there is a strong day-to-day variability, and no correlation with magnetic activity. Although our results do not solve the 150-km riddle, they should be taken into account when a reasonable theory is proposed.

  9. The relationship between VHF radar auroral backscatter amplitude and Doppler velocity: a statistical study

    Directory of Open Access Journals (Sweden)

    B. A. Shand

    Full Text Available A statistical investigation of the relationship between VHF radar auroral backscatter intensity and Doppler velocity has been undertaken with data collected from 8 years operation of the Wick site of the Sweden And Britain Radar-auroral Experiment (SABRE. The results indicate three different regimes within the statistical data set; firstly, for Doppler velocities <200 m s–1, the backscatter intensity (measured in decibels remains relatively constant. Secondly, a linear relationship is observed between the backscatter intensity (in decibels and Doppler velocity for velocities between 200 m s–1 and 700 m s–1. At velocities greater than 700 m s–1 the backscatter intensity saturates at a maximum value as the Doppler velocity increases. There are three possible geophysical mechanisms for the saturation in the backscatter intensity at high phase speeds: a saturation in the irregularity turbulence level, a maximisation of the scattering volume, and a modification of the local ambient electron density. There is also a difference in the dependence of the backscatter intensity on Doppler velocity for the flow towards and away from the radar. The results for flow towards the radar exhibit a consistent relationship between backscatter intensity and measured velocities throughout the solar cycle. For flow away from the radar, however, the relationship between backscatter intensity and Doppler velocity varies during the solar cycle. The geometry of the SABRE system ensures that flow towards the radar is predominantly associated with the eastward electrojet, and flow away is associated with the westward electrojet. The difference in the backscatter intensity variation as a function of Doppler velocity is attributed to asymmetries between the eastward and westward electrojets and the geophysical parameters controlling the backscatter amplitude.

  10. Cut-off low monitoring by the French VHF-ST-radar network during the ESTIME campaign

    Science.gov (United States)

    Caccia, J.-L.; Bertin, F.; Campistron, B.; Klaus, V.; Pointin, Y.; van Baelen, J.; Wilson, R.

    2000-05-01

    In order to investigate mesoscale strato-tropospheric exchanges, the field campaign `Echanges Stratosphère-Troposphère: Investigations à Moyenne Echelle' was conducted in France from late 1993 to mid 1995 and focused on cut-off low events. It involved the French research network of five VHF (Very High Frequency) ST (Strato-Tropospheric) radars deployed in southern France. Observations corresponding to three Intensive Observing Periods are reported here. The radar data analyzed and discussed are time-height diagrams of the aspect ratio (AR), that is, the vertical to oblique beam-returned power ratio, used for monitoring three cut-off low events. In order to discuss the validity of the method, 506 h of radar AR data were compared with time-height diagrams of the static stability and the humidity obtained from synoptic European Center for Medium-range Weather Forecasts model analyses. A dataset corresponding to 297 h of observations is analyzed and discussed here. It is concluded that the AR is a good tracer to document cut-off low events, including tropopause folding identification and the detection of tropospheric air masses of enhanced stability, in dry or weakly humid cases. On the other hand, although the effects of the specific humidity and its gradients on VHF radar echo power could not be extensively investigated, our results suggest that the same parameter cannot be used at mid- and lower-tropospheric levels when the effects of specific humidity significantly reinforce the moist static stability. It is important to take into account these insights in the context of future observing campaigns in which a network of VHF-ST-radars will be involved, and where their role will be to observe and to document the evolution of upper-level features or potential vorticity streamers, or more generally stratospheric-tropospheric exchanges.

  11. Spectroscopic characterization and EPR spectral studies on transition metal complexes with a novel tetradentate, 12-membered macrocyclic ligand

    Science.gov (United States)

    Gupta, Lokesh Kumar; Chandra, Sulekh

    2006-11-01

    Complexes of Cr(III), Mn(II), Co(II), Ni(II) and Cu(II) containing a tetradentate macrocyclic N-donor ligand have been prepared via template reaction of 2,3-pentanedione, ethylene-di-ammine and transition metal ions. The complexes have been characterized on the basis of the elemental analysis, molar conductance, magnetic moment susceptibility, IR, electronic and EPR spectral studies. The complexes are of high spin type and possess four coordinate tetrahedral five coordinate square pyramidal and six coordinated octahedral/tetragonal geometry.

  12. Solute distribution and stability in emulsion-based delivery systems: an EPR study.

    Science.gov (United States)

    Yucel, Umut; Elias, Ryan J; Coupland, John N

    2012-07-01

    Oil-in-water emulsions and related systems are often used to deliver hydrophobic solutes in foods, personal care products, and pharmaceuticals. Recent work has considered the use of crystalline lipid carrier particles (i.e., solid lipid nanoparticles, SLN) to control the availability of the solute; however, there is little direct evidence for the localization of small molecules in these systems. Alkanes (10 wt.% tetradecane or eicosane) containing the spin probe 4-phenyl-2,2,5,5-tetramethyl-3-imidazoline-1-oxyl (PTMIO, 200 ppm) were homogenized into sodium caseinate solution (1 wt.%) to produce fine or coarse droplets (0.2 μm or 1.3 μm, respectively) and cooled to 21.5 °C where eicosane is crystalline and tetradecane is liquid. Analysis of the resulting EPR spectra revealed populations of probe in two discrete environments (i.e., aqueous and lipid). PTMIO is largely hydrophobic with 77% and 70% present in the coarse and fine liquid lipid droplets (i.e., tetradecane droplets), respectively. In the solid droplets (i.e., eicosane), all of the probe was excluded from the droplets into the aqueous environment. In all cases, the mobility of the probe in both lipid and aqueous environments was affected by the droplet surface; thus, we hypothesize that the majority of the probe molecules are associated with the droplet interface. The PTMIO was reduced to an EPR-silent form by the addition of iron/ascorbate to the aqueous phase, and the apparent rate constant of the reaction was proportional to the fraction of the spin probe in the aqueous phase. Based on these findings, we propose that droplet crystallization excludes solute molecules from the droplet core to the aqueous environment where they interact with the droplet surface. Copyright © 2012 Elsevier Inc. All rights reserved.

  13. Structure and dynamics of a conformationally constrained nitroxide side chain and applications in EPR spectroscopy.

    Science.gov (United States)

    Fleissner, Mark R; Bridges, Michael D; Brooks, Evan K; Cascio, Duilio; Kálai, Tamás; Hideg, Kálmán; Hubbell, Wayne L

    2011-09-27

    A disulfide-linked nitroxide side chain (R1) is the most widely used spin label for determining protein topology, mapping structural changes, and characterizing nanosecond backbone motions by site-directed spin labeling. Although the internal motion of R1 and the number of preferred rotamers are limited, translating interspin distance measurements and spatial orientation information into structural constraints is challenging. Here, we introduce a highly constrained nitroxide side chain designated RX as an alternative to R1 for these applications. RX is formed by a facile cross-linking reaction of a bifunctional methanethiosulfonate reagent with pairs of cysteine residues at i and i + 3 or i and i + 4 in an α-helix, at i and i + 2 in a β-strand, or with cysteine residues in adjacent strands in a β-sheet. Analysis of EPR spectra, a crystal structure of RX in T4 lysozyme, and pulsed electron-electron double resonance (ELDOR) spectroscopy on an immobilized protein containing RX all reveal a highly constrained internal motion of the side chain. Consistent with the constrained geometry, interspin distance distributions between pairs of RX side chains are narrower than those from analogous R1 pairs. As an important consequence of the constrained internal motion of RX, spectral diffusion detected with ELDOR reveals microsecond internal motions of the protein. Collectively, the data suggest that the RX side chain will be useful for distance mapping by EPR spectroscopy, determining spatial orientation of helical segments in oriented specimens, and measuring structural fluctuations on the microsecond time scale.

  14. The nature of the exchange coupling between high-spin Fe(III) heme o3 and CuBII in Escherichia coli quinol oxidase, cytochrome bo3: MCD and EPR studies.

    Science.gov (United States)

    Cheesman, Myles R; Oganesyan, Vasily S; Watmough, Nicholas J; Butler, Clive S; Thomson, Andrew J

    2004-04-07

    Fully oxidized cytochrome bo3 from Escherichia coli has been studied in its oxidized and several ligand-bound forms using electron paramagnetic resonance (EPR) and magnetic circular dichroism (MCD) spectroscopies. In each form, the spin-coupled high-spin Fe(III) heme o3 and CuB(II) ion at the active site give rise to similar fast-relaxing broad features in the dual-mode X-band EPR spectra. Simulations of dual-mode spectra are presented which show that this EPR can arise only from a dinuclear site in which the metal ions are weakly coupled by an anisotropic exchange interaction of J 1 cm-1. A variable-temperature and magnetic field (VTVF) MCD study is also presented for the cytochrome bo3 fluoride and azide derivatives. New methods are used to extract the contribution to the MCD of the spin-coupled active site in the presence of strong transitions from low-spin Fe(III) heme b. Analysis of the MCD data, independent of the EPR study, also shows that the spin-coupling within the active site is weak with J approximately 1 cm-1. These conclusions overturn a long-held view that such EPR signals in bovine cytochrome c oxidase arise from an S' = 2 ground state resulting from strong exchange coupling (J > 10(2) cm-1) within the active site.

  15. Spin-mapping of coal structures with ESE and ENDOR

    Energy Technology Data Exchange (ETDEWEB)

    Belford, R.L.; Clarkson, R.B.

    1990-12-01

    To ENDOR and ESE we have added another advanced EPR technique. VHF-EPR, as a tool with which to observe coal molecular structure, especially organic sulfur. We have constructed a unique VHF EPR instrument operating at the W-band (96 Ghz), one of only two such instruments in the world, and the only one studying coal. We are employing this instrument, as well as collaborating with scientists at Cornell University, who have a 250 GHz spectrometer, to develop a clearer understanding of the relationships between the VHF EPR spectra we observe from Illinois coal and the organic sulfur species present in it. Efforts in this quarter focussed on three area: recruitment of personnel (especially a new postdoctoral fellow) to join the coal research team work on improving the W-band spectrometer, and studies of vitrinite, sporinite, and fusinite macerals at G-band (250 GHz). All three areas have shown good progress. This report will discuss in detail the main features of the W-band instrument, stressing its unique engineering features as well as comparing it to the few other instruments in the world operating in the VHF frequency range (90--250 GHz). Preliminary analysis of the 250 GHz data on macerals obtained by density gradient centrifugation from an Illinois {number sign}6 coal gives the first indication that at the very highest frequencies, there may be a separation of the heteroatom VHF EPR signals into a sulfur and on oxygen-containing component. 15 refs., 9 figs., 1 tab.

  16. Effect of microwave power on EPR spectra of natural and synthetic dental biocompatible materials

    Directory of Open Access Journals (Sweden)

    Adamczyk Jakub

    2015-07-01

    Full Text Available Paramagnetic centers in the two exemplary synthetic and natural dental biocompatible materials applied in implantology were examined by the use of an X-band (9.3 GHz electron paramagnetic resonance (EPR spectroscopy. The EPR spectra were measured in the range of microwave power 2.2–70 mW. The aims of this work were to compare paramagnetic centers concentrations in different dental biocompatible materials and to determine the effect of microwave power on parameters of their EPR spectra. It is the very first and innovatory examination of paramagnetic centers in these materials. It was pointed out that paramagnetic centers existed in both natural (~1018 spin/g and synthetic (~1019 spin/g dental biocompatible materials, but the lower free radical concentration characterized the natural sample. Continuous microwave saturation of EPR spectra indicated that faster spin-lattice relaxation processes existed in synthetic dental biocompatible materials than in natural material. Linewidths (ΔBpp of the EPR spectra of the natural dental material slightly increased for the higher microwave powers. Such effect was not observed for the synthetic material. The broad EPR lines (ΔBpp: 2.4 mT, 3.9 mT, were measured for the natural and synthetic dental materials, respectively. Probably strong dipolar interactions between paramagnetic centers in the studied samples may be responsible for their line broadening. EPR spectroscopy is the useful experimental method in the examination of paramagnetic centers in dental biocompatible materials.

  17. EPR spectral investigation of radiation-induced radicals of gallic acid

    Energy Technology Data Exchange (ETDEWEB)

    Tuner, Hasan [Balikesir University, Department of Physics, Faculty of Art and Science, Balikesir (Turkey)

    2017-11-15

    In the present work, spectroscopic features of the radiation-induced radicals of gallic acid compounds were investigated using electron paramagnetic resonance (EPR) spectroscopy. While un-irradiated samples presented no EPR signal, irradiated samples exhibited an EPR spectrum consisting of an intense resonance line at the center and weak lines on both sides. Detailed microwave saturation investigations were carried out to determine the origin of the experimental EPR lines. It is concluded that the two side lines of the triplet satellite originate from forbidden ''spin-flip'' transitions. The spectroscopic and structural features of the radiation-induced radicals were determined using EPR spectrum fittings. The experimental EPR spectra of the two gallic acid compounds were consistent with the calculated EPR spectroscopic features of the proposed radicals. It is concluded that the most probable radicals are the cyclohexadienyl-type, O(OH){sub 2}C{sub 6}H{sub 2}COOH radicals for both compounds. (orig.)

  18. Lightning VHF radiation location system based on short-baseline TDOA technique — Validation in rocket-triggered lightning

    Science.gov (United States)

    Sun, Zhuling; Qie, Xiushu; Liu, Mingyuan; Cao, Dongjie; Wang, Dongfang

    2013-07-01

    A lightning VHF radiation location system based on short-baseline time-difference of arrival (TDOA) technology is newly developed. Based on the orthogonal 10 m-baseline antenna array with four identical broadband flat plane antennas, this system receives the lightning broadband VHF radiation signals and calculates TDOA between antennas in order to determine the location of lightning radiation sources in two dimensions (elevation and azimuth). To reduce noise and improve estimation accuracy of time delay, a general correlation time delay estimation algorithm based on direct correlation method and wavelet transform is proposed. Moreover, parabolic interpolation algorithm is used in the fractional delay estimation to improve the time resolution of the positioning system. In this paper, a rocket-triggered lightning discharge and a cloud lightning discharge are analyzed respectively, combining with simultaneous observations of high-speed camera and fast/slow electric field changes. The results indicate that the TDOA location system could effectively map the lightning radiation sources in 2 dimensions and are in a good agreement with the high-speed video camera images.

  19. Radar efficiency and the calculation of decade-long PMSE backscatter cross-section for the Resolute Bay VHF radar

    Directory of Open Access Journals (Sweden)

    N. Swarnalingam

    2009-04-01

    Full Text Available The Resolute Bay VHF radar, located in Nunavut, Canada (75.0° N, 95.0° W and operating at 51.5 MHz, has been used to investigate Polar Mesosphere Summer Echoes (PMSE since 1997. PMSE are a unique form of strong coherent radar echoes, and their understanding has been a challenge to the scientific community since their discovery more than three decades ago. While other high latitude radars have recorded strong levels of PMSE activities, the Resolute Bay radar has observed relatively lower levels of PMSE strengths. In order to derive absolute measurements of PMSE strength at this site, a technique is developed to determine the radar efficiency using cosmic (sky noise variations along with the help of a calibrated noise source. VHF radars are only rarely calibrated, but determination of efficiency is even less common. Here we emphasize the importance of efficiency for determination of cross-section measurements. The significant advantage of this method is that it can be directly applied to any MST radar system anywhere in the world as long as the sky noise variations are known. The radar efficiencies for two on-site radars at Resolute Bay are determined. PMSE backscatter cross-section is estimated, and decade-long PMSE strength variations at this location are investigated. It was noticed that the median of the backscatter cross-section distribution remains relatively unchanged, but over the years a great level of variability occurs in the high power tail of the distribution.

  20. Meteoroid Fragmentation as Revealed in Head- and Trail-Echoes Observed with the Arecibo UHF and VHF Radars

    Science.gov (United States)

    Mathews, J. D.; Malhorta, A.

    2011-01-01

    We report recent 46.8/430 MHz (VHF/UHF) radar meteor observations at Arecibo Observatory (AO) that reveal many previously unreported features in the radar meteor return - including flare-trails at both UHF and VHF - that are consistent with meteoroid fragmentation. Signature features of fragmentation include strong intra-pulse and pulse-to-pulse fading as the result of interference between or among multiple meteor head-echo returns and between head-echo and impulsive flare or "point" trail-echoes. That strong interference fading occurs implies that these scatterers exhibit well defined phase centers and are thus small compared with the wavelength. These results are consistent with and offer advances beyond a long history of optical and radar meteoroid fragmentation studies. Further, at AO, fragmenting and flare events are found to be a large fraction of the total events even though these meteoroids are likely the smallest observed by the major radars. Fragmentation is found to be a major though not dominate component of the meteors observed at other HPLA radars that are sensitive to larger meteoroids.

  1. EPR pairing dynamics in Hubbard model with resonant U.

    Science.gov (United States)

    Zhang, X Z; Song, Z

    2016-01-05

    We study the dynamics of the collision between two fermions in Hubbard model with on-site interaction strength U. The exact solution shows that the scattering matrix for two-wavepacket collision is separable into two independent parts, operating on spatial and spin degrees of freedom, respectively. The S-matrix for spin configuration is equivalent to that of Heisenberg-type pulsed interaction with the strength depending on U and relative group velocity vr. This can be applied to create distant EPR pair, through a collision process for two fermions with opposite spins in the case of |vr/U| = 1, without the need for temporal control and measurement process. Multiple collision process for many particles is also discussed.

  2. Quantum secure direct communication by EPR pairs and entanglement swapping

    CERN Document Server

    Gao, T; Yan, F L; 10.1393/ncb/i2004-10090-1

    2004-01-01

    We present, a quantum secure direct communication scheme achieved by swapping quantum entanglement. In this scheme a set of ordered Einstein-Podolsky-Rosen (HPIl) pairs is used as a quantum information channel for sending secret messages directly. After insuring the safety of the quantum channel, the sender Alice encodes the secret messages directly by applying a series local operations on her particle sequences according to their stipulation. Using three EPR pairs, three bits of secret classical information can be faithfully transmitted from Alice to remote Bob without revealing any information to a potential eavesdropper. By both Alice and Bob's GHZ state measurement results, Bob is able to read out the encoded secret messages directly. The protocol is completely secure if perfect quantum channel is used, because there is not a transmission of the qubits carrying the secret message between Alice and Bob in the public channel.

  3. N-player quantum games in an EPR setting.

    Science.gov (United States)

    Chappell, James M; Iqbal, Azhar; Abbott, Derek

    2012-01-01

    The N-player quantum games are analyzed that use an Einstein-Podolsky-Rosen (EPR) experiment, as the underlying physical setup. In this setup, a player's strategies are not unitary transformations as in alternate quantum game-theoretic frameworks, but a classical choice between two directions along which spin or polarization measurements are made. The players' strategies thus remain identical to their strategies in the mixed-strategy version of the classical game. In the EPR setting the quantum game reduces itself to the corresponding classical game when the shared quantum state reaches zero entanglement. We find the relations for the probability distribution for N-qubit GHZ and W-type states, subject to general measurement directions, from which the expressions for the players' payoffs and mixed Nash equilibrium are determined. Players' N x N payoff matrices are then defined using linear functions so that common two-player games can be easily extended to the N-player case and permit analytic expressions for the Nash equilibrium. As a specific example, we solve the Prisoners' Dilemma game for general N ≥ 2. We find a new property for the game that for an even number of players the payoffs at the Nash equilibrium are equal, whereas for an odd number of players the cooperating players receive higher payoffs. By dispensing with the standard unitary transformations on state vectors in Hilbert space and using instead rotors and multivectors, based on Clifford's geometric algebra (GA), it is shown how the N-player case becomes tractable. The new mathematical approach presented here has wide implications in the areas of quantum information and quantum complexity, as it opens up a powerful way to tractably analyze N-partite qubit interactions.

  4. N-player quantum games in an EPR setting.

    Directory of Open Access Journals (Sweden)

    James M Chappell

    Full Text Available The N-player quantum games are analyzed that use an Einstein-Podolsky-Rosen (EPR experiment, as the underlying physical setup. In this setup, a player's strategies are not unitary transformations as in alternate quantum game-theoretic frameworks, but a classical choice between two directions along which spin or polarization measurements are made. The players' strategies thus remain identical to their strategies in the mixed-strategy version of the classical game. In the EPR setting the quantum game reduces itself to the corresponding classical game when the shared quantum state reaches zero entanglement. We find the relations for the probability distribution for N-qubit GHZ and W-type states, subject to general measurement directions, from which the expressions for the players' payoffs and mixed Nash equilibrium are determined. Players' N x N payoff matrices are then defined using linear functions so that common two-player games can be easily extended to the N-player case and permit analytic expressions for the Nash equilibrium. As a specific example, we solve the Prisoners' Dilemma game for general N ≥ 2. We find a new property for the game that for an even number of players the payoffs at the Nash equilibrium are equal, whereas for an odd number of players the cooperating players receive higher payoffs. By dispensing with the standard unitary transformations on state vectors in Hilbert space and using instead rotors and multivectors, based on Clifford's geometric algebra (GA, it is shown how the N-player case becomes tractable. The new mathematical approach presented here has wide implications in the areas of quantum information and quantum complexity, as it opens up a powerful way to tractably analyze N-partite qubit interactions.

  5. Investigations for the EPR-concept - KAPOOL and KATS experiments

    Energy Technology Data Exchange (ETDEWEB)

    Engel, G.; Eppinger, B.; Fieg, G.; Schmidt-Stiefel, S. [Forschungszentrum Karlsruhe GmbH Technik und Umwelt (Germany). Inst. fuer Kern- und Energietechnik; Messainguiral, C.; Prothmann, N.; Raupp, D.; Schuetz, W. [Forschungszentrum Karlsruhe GmbH Technik und Umwelt (Germany). Inst. fuer Reaktorsicherheit; Stegmaier, U. [Forschungszentrum Karlsruhe GmbH Technik und Umwelt (Germany). Inst. fuer Materialforschung 1 - Angewandte Werkstoffphysik; Massier, H. [Forschungszentrum Karlsruhe GmbH Technik und Umwelt (Germany). Inst. fuer Hochleistungsimpuls- und Mikrowellentechnik; Stern, G.; Veser, A. [Fa. Pro-Science (Germany)

    2000-08-01

    The objective of the KAPOOL and KATS experiments is to investigate basic phenomena in connection with the EPR melt spreading and cooling concept. High-temperature Al{sub 2}O{sub 3}- and Fe-melts produced by the thermite reaction are used to simulate the oxidic and metallic components of the core melt. Two KAPOOL tests have been performed to study the interaction of the oxidic melt with the release gate which is situated between the cavity and the spreading compartment. These tests have been analyzed with the HEATING-5 code and compared with the experimental results. With test KATS-17 (spreading onto dry concrete for the oxide melt, spreading onto concrete with 1 mm water level for the metallic melt) the series of two-dimensional spreading experiments has been finished. KATS-15 (2-dim spreading on dry ceramics) has been analyzed with the code CORFLOW. (orig.) [German] In den KAPOOL- und KATS-Experimenten werden grundlegende Phaenomene des EPR-Konzepts zur Ausbreitung und Kuehlung der Kernschmelze untersucht. Die oxidische und metallische Komponente der Kernschmelze werden dabei durch mittels der Thermit-Reaktion erzeugte Al{sub 2}O{sub 3}- und Fe-Schmelzen simuliert. In zwei KAPOOL-Tests wurde die Wechselwirkung der oxidischen Schmelze mit dem Schmelztor untersucht, das den Ausbreitungsraum von der Kaverne trennt. Diese Experimente wurden mit Hilfe des HEATING-5 Codes analysiert und mit den experimentellen Resultaten verglichen. Mit KATS-17 (2-dim Ausbreitung der Oxidschmelze auf trockenen Beton, 2-dim Ausbreitung der metallischen Schmelze auf Beton mit einer 1 mm Wasserschicht) wurde die Serie der zwei-dimensionalen Ausbreitungsexperimente abgeschlossen. KATS-15 (2-dim Ausbreitung auf einer trockenen Keramikflaeche) wurde mit Hilfe des CORFLOW-Codes analysiert. (orig.)

  6. Single crystal EPR study of the dinuclear Cu(II) complex [Cu(tda)(phen)](2)·H(2)tda (tda = thiodiacetate, phen = phenanthroline): influence of weak interdimeric magnetic interactions.

    Science.gov (United States)

    Neuman, Nicolás I; Perec, Mireille; González, Pablo J; Passeggi, Mario C G; Rizzi, Alberto C; Brondino, Carlos D

    2010-12-23

    We report powder and single crystal EPR measurements of [Cu(tda)(phen)](2)·H(2)tda (tda = thiodiacetate, phen = phenanthroline) at 9.7 GHz. This compound consists of centrosymmetric copper(II) ion dimers, weakly ferromagnetically exchange-coupled (J = +3.2 cm(-1)), in which the dimeric units are linked by hydrophobic chemical paths involving the phen molecules. EPR revealed that the triplet spectra are collapsed by interdimeric exchange interactions mediated by that chemical path. Analysis and simulation of the single crystal EPR spectra were performed using Anderson's exchange narrowing model, together with statistical arguments. This approach allowed us to interpret the spectra modulated by the interdimeric interactions in situations of weak, intermediate, and strong exchange. We evaluated an interdimeric exchange constant J' = 0.0070(3) cm(-1), indicating that hydrophobic paths can transmit weak exchange interactions between centers at relatively long distances of the order of ∼10 Å.

  7. User acceptance by individuals of health telematics from distributed EPRs associated with knowledge couplers.

    Science.gov (United States)

    Scherrer, J R; Spahni, S; Boyer, C

    2000-01-01

    The patient in a hospital bed is also a private individual that might access his or her own Electronic Patient Record (EPR) in association with additional tools that are able to show critical up-to-date knowledge about diagnoses, clinical investigations or treatments. The distributed EPRs are shown here in full production with the DOMED application of DIOGENE 2. Besides, in order to facilitate an easier understanding of the EPRs by the patient, the HON Web Site services are at his or her disposal in this respect at the same terminal.

  8. Identification of irradiated fruit from the pectin-derived EPR signal

    Energy Technology Data Exchange (ETDEWEB)

    Deighton, N.; Glidewell, S.M.; Goodman, B.A.; McMillan, G.P.; Perombelon, M.C.M. [Scottish Crop Research Inst., Dundee (United Kingdom)

    1996-12-31

    An EPR method based upon the observation of an unidentified multiline spectrum has been reported for the detection of irradiated fruit (dried papaya, banana, dates). A similar long-lived EPR spectrum after irradiation of dried amorphous apple pectin (BDH, 6% methyl ester) suggesting that pectin might be the origin of the signal in the dried fruit. Compositions of pectins vary greatly according to source and also with the age of the fruit itself. Therefore, a series of pectins of citrus fruit and potato tuber origin have been investigated to examine the effects of different levels of esterification on the irradiation-induced EPR signal. (author).

  9. EPR investigation of some desiccated Ascomycota and Basidiomycota gamma-irradiated mushrooms

    Energy Technology Data Exchange (ETDEWEB)

    Bercu, V., E-mail: vbercu@gmail.co [University of Bucharest, Department of Atomic and Nuclear Physics, P.O. Box MG-11, 077125 Magurele (Ilfov) (Romania); Negut, C.D., E-mail: dnegut@nipne.r [University of Bucharest, Department of Atomic and Nuclear Physics, P.O. Box MG-11, 077125 Magurele (Ilfov) (Romania); Horia Hulubei National Institute for Physics and Nuclear Engineering, P.O. Box MG-6, 077125 Magurele (Ilfov) (Romania); Duliu, O.G., E-mail: duliu@b.astral.r [University of Bucharest, Department of Atomic and Nuclear Physics, P.O. Box MG-11, 077125 Magurele (Ilfov) (Romania)

    2010-12-15

    The suitability of the EPR spectroscopy for detection of {gamma}-irradiation in five species of dried mushroom, currently used in gastronomy: yellow morel-Morchella esculenta, (L.) Pers. (Phylum Ascomycota), button mushroom-Agaricus bisporus (J.E.Lange), Agaricus haemorrhoidarius Fr., golden chantarelle-Cantharellus cibarius Fr., as well as oyster mushroom-Pleurotus ostreatus (Jacq. ex Fr.) (Phylum Basidiomycota) is presented and discussed. Although after irradiation at doses up to 11 kGy, all specimens presented well defined EPR spectra, only A. bisporus EPR signal was enough stable to make detection possible after 18 months.

  10. EPR investigation of some desiccated Ascomycota and Basidiomycota gamma-irradiated mushrooms

    Science.gov (United States)

    Bercu, V.; Negut, C. D.; Duliu, O. G.

    2010-12-01

    The suitability of the EPR spectroscopy for detection of γ-irradiation in five species of dried mushroom, currently used in gastronomy: yellow morel— Morchella esculenta, (L.) Pers. (Phylum Ascomycota), button mushroom— Agaricus bisporus (J.E.Lange), Agaricus haemorrhoidarius Fr., golden chantarelle— Cantharellus cibarius Fr., as well as oyster mushroom— Pleurotus ostreatus (Jacq. ex Fr.) (Phylum Basidiomycota) is presented and discussed. Although after irradiation at doses up to 11 kGy, all specimens presented well defined EPR spectra, only A. bisporus EPR signal was enough stable to make detection possible after 18 months.

  11. EPR Structural Investigations on Ag2O-B2O3-CaO-P2O5 Vitreous System

    Directory of Open Access Journals (Sweden)

    Razvan Stefan

    2011-10-01

    Full Text Available Glass samples from vitreous system 1.5Ag2O98.5%[0.47B2O3(0.53-xCaOxP2O5] with 0  x  0.08 have been obtained by undercooled method. The magnetic species existing in glass powders have been highlighting by mean of electronic paramagnetic resonance (EPR. The resonance linewidth analysis reveal the interactions between magnetic ions.

  12. Substitutional and surface Mn2+ centers in cubic ZnS:Mn nanocrystals. A correlated EPR and photoluminescence study

    Science.gov (United States)

    Stefan, M.; Nistor, S. V.; Ghica, D.; Mateescu, C. D.; Nikl, M.; Kucerkova, R.

    2011-01-01

    The EPR, radioluminescence, and photoluminescence of cubic ZnS (cZnS) nanocrystals (NCs) with a narrow size distribution centered at 2 nm, doped with 0.1, 0.2, and 0.5at.% Mn2+ ions were investigated. Besides the main lines from substitutional Mn2+ ions localized in the core of the NCs next to a stacking defect, the EPR spectra exhibited two broader hyperfine sextets, attributed to the so-called Mn(II) and Mn(III) surface centers, which could be separated by adequate thermal treatments. The contribution to the photoluminescence from the Mn2+ ions at various sites was further determined from the analysis of the steady-state and time-resolved photoluminescence data from cZnS:Mn NCs subjected to thermal treatments and from cZnS:Mn single crystals. Thus, the main emission consisting of two intense overlapping bands peaking at 596 and 630 nm was attributed to the 4T1-6A1 transition of the substitutional Mn2+ ions in the core of the cZnS nanocrystals and to residual aggregated Mn2+ ions, respectively, the last ones being responsible for a broad EPR line observed in the X-band spectrum. The Mn(II) and Mn(III) centers, consisting of Mn2+ ions in the oxidized and hydrolyzed surface layer of the NCs, respectively, are only indirectly involved in the energy transfer to the substitutional Mn2+ centers, very likely through pairs interaction.

  13. A secure and robust password-based remote user authentication scheme using smart cards for the integrated EPR information system.

    Science.gov (United States)

    Das, Ashok Kumar

    2015-03-01

    An integrated EPR (Electronic Patient Record) information system of all the patients provides the medical institutions and the academia with most of the patients' information in details for them to make corrective decisions and clinical decisions in order to maintain and analyze patients' health. In such system, the illegal access must be restricted and the information from theft during transmission over the insecure Internet must be prevented. Lee et al. proposed an efficient password-based remote user authentication scheme using smart card for the integrated EPR information system. Their scheme is very efficient due to usage of one-way hash function and bitwise exclusive-or (XOR) operations. However, in this paper, we show that though their scheme is very efficient, their scheme has three security weaknesses such as (1) it has design flaws in password change phase, (2) it fails to protect privileged insider attack and (3) it lacks the formal security verification. We also find that another recently proposed Wen's scheme has the same security drawbacks as in Lee at al.'s scheme. In order to remedy these security weaknesses found in Lee et al.'s scheme and Wen's scheme, we propose a secure and efficient password-based remote user authentication scheme using smart cards for the integrated EPR information system. We show that our scheme is also efficient as compared to Lee et al.'s scheme and Wen's scheme as our scheme only uses one-way hash function and bitwise exclusive-or (XOR) operations. Through the security analysis, we show that our scheme is secure against possible known attacks. Furthermore, we simulate our scheme for the formal security verification using the widely-accepted AVISPA (Automated Validation of Internet Security Protocols and Applications) tool and show that our scheme is secure against passive and active attacks.

  14. High-Rate Fabrication of a-Si-Based Thin-Film Solar Cells Using Large-Area VHF PECVD Processes

    Energy Technology Data Exchange (ETDEWEB)

    Deng, Xunming [University of Toledo; Fan, Qi Hua

    2011-12-31

    The University of Toledo (UT), working in concert with it’s a-Si-based PV industry partner Xunlight Corporation (Xunlight), has conducted a comprehensive study to develop a large-area (3ft x 3ft) VHF PECVD system for high rate uniform fabrication of silicon absorber layers, and the large-area VHF PECVD processes to achieve high performance a-Si/a-SiGe or a-Si/nc-Si tandem junction solar cells during the period of July 1, 2008 to Dec. 31, 2011, under DOE Award No. DE-FG36-08GO18073. The project had two primary goals: (i) to develop and improve a large area (3 ft × 3 ft) VHF PECVD system for high rate fabrication of > = 8 Å/s a-Si and >= 20 Å/s nc-Si or 4 Å/s a-SiGe absorber layers with high uniformity in film thicknesses and in material structures. (ii) to develop and optimize the large-area VHF PECVD processes to achieve high-performance a-Si/nc-Si or a-Si/a-SiGe tandem-junction solar cells with >= 10% stable efficiency. Our work has met the goals and is summarized in “Accomplishments versus goals and objectives”.

  15. Radiation protection on EPR: comparative approach of the French and Finnish regulatory reviewing process and optimization at the design phase; La radioprotection sur EPR: presentation comparee des instructions francaises et finlandaises et des demarches d'optimisation a la conception

    Energy Technology Data Exchange (ETDEWEB)

    Arial, E.; Couasnon, O.; Latil-querrec, N. [IRSN, Unite d' Expertise en radioprotection des travailleurs et de la population, DRPH/SER/UETP, 92 - Fontenay-aux-Roses (France); Evrard, J.M. [IRSN, Direction scientifique, DS, 92 - Fontenay-aux-Roses (France); Herviou, K. [IRSN, Direction de la surete des reacteurs, DSR, 92 - Fontenay-aux-Roses (France); Riihiluoma, V. [Radiation and Nuclear Safety Authority (STUK), Helsinki (Finland); Beneteau, Y.; Foret, J.L. [Electricite de France-CNEN (EDF), 92 - Montrouge (France)

    2010-10-15

    Taking the opportunity to evaluate the preliminary safety report of the French EPR reactor built in Flamanville, the IRSN proposes to assess the history of EPR, from the decision to implement studies in the 90's to the French and German cooperation, and finally to the construction of a unit in Finland and in France, and to make a synthesis of the assessment of radiation protection arrangements. This assessment presents the dose targets (calculated reference doses) planned by the nuclear operators in the design phase as well as the global radiation protection optimization process and a comparison of French and Finnish analyses. In France, for example, EDF performed a detailed optimization analysis of selected tasks known to have a major contribution to the annual average collective dose (thermal insulation, logistics, valve maintenance, opening/closing of the vessel, preparation and checks of steam generators, on-site spent fuel management, and waste management). The optimization process is based (in France) on an iterative method. A comparison between the EPR collective dose target and doses received in other pressurized water reactors that are close to the EPR design (Konvoi of German design, French existing units, etc.) is also presented. This synthesis was carried out by the IRSN, the expert body of the French nuclear safety authority, in association with Electricite de France (EDF), the French operator, and the authority for nuclear safety in Finland (STUK). It summarizes more than 15 years of studies and partnership, focusing on radiation protection, in the design phase of the EPR. (authors)

  16. USE OF-EPR-DL FIELD TEST EQUIPMENT FOR DETECTION OF SIGMA PHASE

    Directory of Open Access Journals (Sweden)

    Abraão Danilo Gomes Barreto

    2014-06-01

    Full Text Available This work has objective to correlate the intergranular corrosion susceptibility test named EPR-DL (Electrochemical Potentiokinetic Reactivation of Double Loop with the sigma phase formation and other phases. It has been used samples from a UNS S32760 steel pipe for conducting various aging heat treatments. Held isothermal heat treatment at 850°C for 1 min, 10 min, 30 min, 1 h, 1h30min and 10 h. Each heat treated sample and as received were tested using the electrochemical polarization reactivation of double loop technique (EPR-DL. It was possible the detection of deleterious phases with DL-EPR portable cell. The EPR-DL test of some samples showed a second peak of reactivation in which the results showed that this peak might be associated with ferrite or be related to the presence of chi phase

  17. Wormhole and entanglement (non-)detection in the ER=EPR correspondence

    Energy Technology Data Exchange (ETDEWEB)

    Bao, Ning [Institute for Quantum Information and Matter, California Institute of Technology,Pasadena, CA 91125 (United States); Walter Burke Institute for Theoretical Physics, California Institute of Technology,Pasadena, CA 91125 (United States); Pollack, Jason; Remmen, Grant N. [Walter Burke Institute for Theoretical Physics, California Institute of Technology,Pasadena, CA 91125 (United States)

    2015-11-19

    The recently proposed ER=EPR correspondence postulates the existence of wormholes (Einstein-Rosen bridges) between entangled states (such as EPR pairs). Entanglement is famously known to be unobservable in quantum mechanics, in that there exists no observable (or, equivalently, projector) that can accurately pick out whether a generic state is entangled. Many features of the geometry of spacetime, however, are observables, so one might worry that the presence or absence of a wormhole could identify an entangled state in ER=EPR, violating quantum mechanics, specifically, the property of state-independence of observables. In this note, we establish that this cannot occur: there is no measurement in general relativity that unambiguously detects the presence of a generic wormhole geometry. This statement is the ER=EPR dual of the undetectability of entanglement.

  18. Radicals as EPR probes of magnetization of gadolinium stearate Langmuir-Blodgett film

    DEFF Research Database (Denmark)

    Koksharov, Y.A.; Bykov, I.V.; Malakho, A.P.

    2002-01-01

    the Gd and Y stearate LB films. Placing the small BDPA crystal on the film surface we have found that for the Gd LB sample the effective g-value of the radical's resonance depends on the film orientation in respect to the external magnetic field direction. The relative shift of the EPR signal......In the present work we have applied the method of the EPR spin probes which allows performing simultaneously EPR and magnetization measurements to the investigation of magnetism of the Cid stearate Langmuir-Blodgett (LB) films. For this purpose we have prepared and studied by the EPR technique...... corresponded to the magnetization of the film along the field direction. Such effect has not been observed for the Y stearate LB film. The data obtained give an experimental proof for the room temperature. magnetic ordering in the! gadolinium stearate LB film....

  19. EPR investigations of silicon carbide nanoparticles functionalized by acid doped polyaniline

    Science.gov (United States)

    Karray, Fekri; Kassiba, Abdelhadi

    2012-06-01

    Nanocomposites (SiC-PANI) based on silicon carbide nanoparticles (SiC) encapsulated in conducting polyaniline (PANI) are synthesized by direct polymerization of PANI on the nanoparticle surfaces. The conductivity of PANI and the nanocomposites was modulated by several doping levels of camphor sulfonic acid (CSA). Electron paramagnetic resonance (EPR) investigations were carried out on representative SiC-PANI samples over the temperature range [100-300 K]. The features of the EPR spectra were analyzed taking into account the paramagnetic species such as polarons with spin S=1/2 involved in two main environments realized in the composites as well as their thermal activation. A critical temperature range 200-225 K was revealed through crossover changes in the thermal behavior of the EPR spectral parameters. Insights on the electronic transport properties and their thermal evolutions were inferred from polarons species probed by EPR and the electrical conductivity in doped nanocomposites.

  20. Comparative EPR studies of free radicals in melanin synthesized by Bacillus weihenstephanensis soil strains

    Science.gov (United States)

    Zdybel, Magdalena; Pilawa, Barbara; Drewnowska, Justyna M.; Swiecicka, Izabela

    2017-07-01

    EPR spectroscopy was used to examine the properties of and free radical concentrations in atypical water-soluble melanin-like pigments from Bacillus weihenstephanensis strains. The same EPR spectral shape was observed in bacterial melanins as in eumelanin. The EPR lines were homogeneously broadened. Continuous microwave saturation of the EPR lines indicated slow spin-lattice relaxation processes in the samples. Strong dipolar interactions characterized the tested melanin samples. Higher free radical concentrations were found in bacterial melanin than in synthetic melanin. The free radical concentrations in melanin from B. weihenstephanensis increased in the following order: strain JAS 81/4 < JAS 83/3 < JAS 86/1 < JAS 39/1.

  1. EPR spectra induced by gamma-irradiation of some dry medical herbs

    Science.gov (United States)

    Yordanov, N. D.; Lagunov, O.; Dimov, K.

    2009-04-01

    The radiation-induced EPR spectra in some medical herbs are reported. The samples studied are: (i) leaves of nettle, common balm, peppermint and thyme; (ii) stalks of common balm, thyme, milfoil, yarrow and marigold; (iii) blossoms of yarrow and marigold; (iv) blossoms and leaves of hawthorn and tutsan; and (v) roots of common valerian, nettle, elecampane (black and white), restharrows and carlina. Before irradiation all samples exhibit one weak anisotropic singlet EPR line with effective g-value of 2.0050±0.0002. The radiation-induced spectra fall into three groups. EPR spectra of irradiated blossoms of yarrow and marigold, stalks of common balm, thyme, tutsan and yarrow as well as roots of common valerian, nettle and elecampane (black and white) show "cellulose-like" EPR spectrum typical for irradiated plants. It is characterized by one intense central line with g=2.0050±0.0005 and two weak satellite lines situated ca. 30 G left and right to it. EPR spectra of gamma-irradiated restharrows and carlina are complex. They may be represented by one triplet corresponding to the "cellulose-like" EPR spectrum, one relatively intense singlet, situated in the center of the spectrum, and five weak additional satellite lines left and right to the center. The last spectrum was assigned as "carbohydrate-like" type. Only one intense EPR singlet with g=2.0048±0.0005 was recorded after irradiation of leaves of nettle and common balm. The lifetime of the radiation-induced EPR spectra was followed for a period of 3 months.

  2. EPR spectra induced by gamma-irradiation of some dry medical herbs

    Energy Technology Data Exchange (ETDEWEB)

    Yordanov, N.D. [Laboratory EPR, Institute of Catalysis, Bulgarian Academy of Sciences, 1113 Sofia (Bulgaria)], E-mail: ndyepr@bas.bg; Lagunov, O. [Laboratory EPR, Institute of Catalysis, Bulgarian Academy of Sciences, 1113 Sofia (Bulgaria); Dimov, K. [Institute of Cryobiology and Food technology, 1162 Sofia (Bulgaria)

    2009-04-15

    The radiation-induced EPR spectra in some medical herbs are reported. The samples studied are: (i) leaves of nettle, common balm, peppermint and thyme; (ii) stalks of common balm, thyme, milfoil, yarrow and marigold; (iii) blossoms of yarrow and marigold; (iv) blossoms and leaves of hawthorn and tutsan; and (v) roots of common valerian, nettle, elecampane (black and white), restharrows and carlina. Before irradiation all samples exhibit one weak anisotropic singlet EPR line with effective g-value of 2.0050{+-}0.0002. The radiation-induced spectra fall into three groups. EPR spectra of irradiated blossoms of yarrow and marigold, stalks of common balm, thyme, tutsan and yarrow as well as roots of common valerian, nettle and elecampane (black and white) show 'cellulose-like' EPR spectrum typical for irradiated plants. It is characterized by one intense central line with g=2.0050{+-}0.0005 and two weak satellite lines situated ca. 30 G left and right to it. EPR spectra of gamma-irradiated restharrows and carlina are complex. They may be represented by one triplet corresponding to the 'cellulose-like' EPR spectrum, one relatively intense singlet, situated in the center of the spectrum, and five weak additional satellite lines left and right to the center. The last spectrum was assigned as 'carbohydrate-like' type. Only one intense EPR singlet with g=2.0048{+-}0.0005 was recorded after irradiation of leaves of nettle and common balm. The lifetime of the radiation-induced EPR spectra was followed for a period of 3 months.

  3. FPGA based digital signal processing for EPR spectroscopy with an application to MRI

    OpenAIRE

    Duraiswamy, Punithavathi

    2011-01-01

    Electron Paramagnetic Resonance (EPR), a magnetic resonance technique similar to nuclear magnetic resonance, detects paramagnetic species such as free radicals. Like Magnetic Resonance Imaging (MRI), EPR can be implemented as an imaging technique for small animals and potentially human applications both in pulsed and continuous wave mode. Typical frequencies used for in vivo applications are about 300 MHz with a corresponding static magnetic field of about 100 G (10mT). As demonstrated with h...

  4. Experimental demonstration of frequency-degenerate bright EPR beams with a self-phase-locked OPO.

    Science.gov (United States)

    Keller, G; D'Auria, V; Treps, N; Coudreau, T; Laurat, J; Fabre, C

    2008-06-23

    We report the first experimental observation of bright EPR beams produced by a type-II optical parametric oscillator operating above threshold at frequency degeneracy. The degenerate operation is obtained by introducing a birefringent plate inside the cavity resulting in phase locking. After filtering the pump noise, which plays a critical role, continuous-variable EPR correlations between the orthogonally polarized signal and idler beams are demonstrated.

  5. Preparation and applicability of fresh fruit samples for the identification of radiation treatment by EPR

    Energy Technology Data Exchange (ETDEWEB)

    Yordanov, Nicola D. [Laboratory EPR, Institute of Catalysis, Bulgarian Academy of Sciences, 1113 Sofia (Bulgaria)], E-mail: ndyepr@bas.bg; Aleksieva, Katerina [Laboratory EPR, Institute of Catalysis, Bulgarian Academy of Sciences, 1113 Sofia (Bulgaria)

    2009-03-15

    The results of electron paramagnetic resonance (EPR) study on fresh fruits (whole pulp of pears, apples, peaches, apricots, avocado, kiwi and mango) before and after gamma-irradiation are reported using two drying procedures before EPR investigation. In order to remove water from non-irradiated and irradiated samples of the first batch, the pulp of fresh fruits is pressed, and the solid residue is washed with alcohol and dried at room temperature. The fruits of the second batch are pressed and dried in a standard laboratory oven at 40 deg. C. The results obtained with both drying procedures are compared. All samples under study show a singlet EPR line with g=2.0048{+-}0.0005 before irradiation. Irradiation gives rise to typical 'cellulose-like' EPR spectrum featuring one intensive line with g=2.0048{+-}0.0005 and two very weak satellite lines situated 3 mT at left and right of the central line. Only mango samples show a singlet line after irradiation. The fading kinetics of radiation-induced EPR signal is studied for a period of 50 days after irradiation. When the irradiated fruit samples are stored in their natural state and dried just before each EPR measurement, the satellite lines are measurable for less than 17 days of storage. Irradiated fruit samples, when stored dried, lose for 50 days ca. 40% of their radiation-induced radicals if treated with alcohol or ca. 70% if dried in an oven. The reported results unambiguously show that the presence of the satellite lines in the EPR spectra could be used for identification of radiation processing of fresh fruits, thus extending the validity of European Protocol EN 1787 (2000). Foodstuffs-Detection of Irradiated Food Containing Cellulose by EPR Spectroscopy. European Committee for Standardisation. Brussels for dry herbs.

  6. Vesicle to micelle transition in the ternary mixture of L121/SDS/D2O: NMR, EPR and SANS studies.

    Science.gov (United States)

    Prameela, G K S; Phani Kumar, B V N; Reddy, R Ravikanth; Pan, A; Subramanian, J; Kumar, Sugam; Aswal, V K; Kohlbrecher, Joachim; Mandal, A B; Moulik, S P

    2017-12-06

    Subtle changes in the microstructure and dynamics of the triblock copolymer L121, (ethylene oxide) 5 (propylene oxide) 68 (ethylene oxide) 5 i.e., E 5 P 68 E 5 , and sodium dodecylsulfate (SDS) system in aqueous medium were investigated using high-resolution nuclear magnetic resonance (NMR), electron paramagnetic resonance (EPR) and small-angle neutron scattering (SANS) methods. NMR self-diffusion measurements helped us to understand the nature of binding of SDS with L121, and the formation of their mixed aggregates. These results showed that even at low [SDS] (∼2 mM), the addition of L121 stabilized the dynamics of SDS. Furthermore, the increase in [SDS] resulted in progressive changes in the diffusion behavior of both SDS and L121. 13 C chemical shift analysis revealed that preferential binding of L121 occurred on the SDS micelle surface. Deuterium ( 2 H) NMR spin-relaxation data evidenced that the formed mixed aggregates were non-spherical in terms of relaxation rate changes, and slowed the dynamics. The rotational correlation times of mixed aggregates were estimated from EPR analysis. A SANS study indicated the presence of uni- and multi-lamellar vesicles of L121 at low [SDS]. The vesicles transformed to mixed L121-SDS micelles in the presence of a higher [SDS]. This was supported by the measurements of 2 H NMR spin-relaxation and EPR rotational correlation times.

  7. EPR safety. Consideration of the internal and external hazards in the safety studies; Surete du reacteur EPR. Prise en compte des agressions internes et externes dans les etudes de surete EPR

    Energy Technology Data Exchange (ETDEWEB)

    Gueguin, H. [Electricite de France (EDF-DIN), Centre National d' Equipement Nucleaire, Service Controle Commande, 92 - Montrouge (France)

    2008-04-15

    The author presents the main points of the Preliminary Safety Report of EDF on the EPR reactor safety. It concerns the considerations of the internal (fire, flood, explosions, pipes failures) and external (earthquakes, airplane falls, explosions, exceptional natural disasters, extreme meteorological conditions) damages. It presents how the safety report takes into account the aggression. (A.L.B.)

  8. Transport de paires EPR dans des structures mesoscopiques

    Science.gov (United States)

    Dupont, Emilie

    Dans cette these, nous nous sommes particulierement interesses a la propagation de paires EPR1 delocalisees et localisees, et a l'influence d'un supraconducteur sur le transport de ces paires. Apres une introduction de cette etude, ainsi que du cadre scientifique qu'est l'informatique quantique dans lequel elle s'inscrit, nous allons dans le chapitre 1 faire un rappel sur le systeme constitue de deux points quantiques normaux entoures de deux fils supraconducteurs. Cela nous permettra d'introduire une methode de calcul qui sera reutilisee par la suite, et de trouver egalement le courant Josephson produit par ce systeme transforme en SQUID-dc par l'ajout d'une jonction auxiliaire. Le SQUID permet de mesurer l'etat de spin (singulet ou triplet), et peut etre forme a partir d'autres systemes que nous etudierons ensuite. Dans le chapitre 2, nous rappellerons l'etude detaillee d'un intricateur d'Andreev faite par un groupe de Bale. La matrice T, permettant d'obtenir le courant dans les cas ou les electrons sont separes spatialement ou non, sera etudiee en detail afin d'en faire usage au chapitre suivant. Le chapitre 3 est consacre a l'etude de l'influence du bruit sur le fonctionnement de l'intricateur d'Andreev. Ce bruit modifie la forme du courant jusqu'a aboutir a d'autres conditions de fonctionnement de l'intricateur. En effet, le bruit present sur les points quantiques peut perturber le transport des paires EPR par l'intermediaire des degres de liberte. Nous montrerons que, du fait de l'"intrication" entre la charge de la paire et le bruit, la paire est detruite pour des temps longs. Cependant, le resultat le plus important sera que le bruit perturbe plus le transport des paires delocalisees, qui implique une resonance de Breit-Wigner a deux particules. Le transport parasite n'implique pour sa part qu'une resonance de Breit-Wigner a une particule. Dans le chapitre 4, nous reviendrons au systeme constitue de deux points quantiques entoures de deux fils

  9. Characterization of lithium formate EPR dosimeters for high dose applications – comparison with alanine

    DEFF Research Database (Denmark)

    Waldeland, Einar; Helt-Hansen, Jakob; Malinen, Eirik

    2011-01-01

    Lithium formate and l-α-alanine (alanine) EPR dosimeters were irradiated to doses from 100 Gy to 100 kGy. The irradiations were mainly performed at a Gammacell irradiator with dose rate of approximately 5.5 kGy h−1. Both the peak-to-peak amplitude of the first derivative EPR spectrum and the area...... under the EPR absorption spectrum were extracted, and the resulting dose dependence of these EPR signal intensity parameters were analyzed. The dependence of the peak-to-peak width of the central resonance in the first derivative EPR spectrum on the dose was also elucidated. In addition, the dependence...... on dose rate and irradiation temperature for the two materials was measured. Dosimeters were given doses from 100 Gy to 10 kGy at two different Gammacells with dose rates of 5.5 kGy h−1 and 0.6 kGy h−1, respectively, and the results were compared. Furthermore, the EPR signal intensities for dosimeters...

  10. Using ANN and EPR models to predict carbon monoxide concentrations in urban area of Tabriz

    Directory of Open Access Journals (Sweden)

    Mohammad Shakerkhatibi

    2015-09-01

    Full Text Available Background: Forecasting of air pollutants has become a popular topic of environmental research today. For this purpose, the artificial neural network (AAN technique is widely used as a reliable method for forecasting air pollutants in urban areas. On the other hand, the evolutionary polynomial regression (EPR model has recently been used as a forecasting tool in some environmental issues. In this research, we compared the ability of these models to forecast carbon monoxide (CO concentrations in the urban area of Tabriz city. Methods: The dataset of CO concentrations measured at the fixed stations operated by the East Azerbaijan Environmental Office along with meteorological data obtained from the East Azerbaijan Meteorological Bureau from March 2007 to March 2013, were used as input for the ANN and EPR models. Results: Based on the results, the performance of ANN is more reliable in comparison with EPR. Using the ANN model, the correlation coefficient values at all monitoring stations were calculated above 0.85. Conversely, the R2 values for these stations were obtained <0.41 using the EPR model. Conclusion: The EPR model could not overcome the nonlinearities of input data. However, the ANN model displayed more accurate results compared to the EPR. Hence, the ANN models are robust tools for predicting air pollutant concentrations.

  11. Antibacterial ethylene propylene rubber impregnated with silver nanopowder: AgNP@EPR

    Directory of Open Access Journals (Sweden)

    Marzieh Miranzadeh

    2016-01-01

    Full Text Available Following our interest in reaching for a molded rubber article with possible detergent contact applications, durable silver nanopowder (AgNP is synthesized by arc discharge, then mixed with varying ratios of ethylene propylene rubber (EPR, affording novel AgNP@EPR nanocomposites. X-ray diffraction (XRD patterns of AgNP as well as AgNP@EPR show no trace of impurity, while scanning electron microscopy (SEM indicates an average diameter of 50 nm for the former. Transmission electron microscopy (TEM images while confirm the SEM results, show quite a few 5 nm AgNP particles lying beside some micro crumbs. Our DC arc discharge technique involves explosion of movable silver anode and static cathode by a current pulse between 5 to 10 A cm-2. A solution blending method is employed for preparation of AgNP@EPR nanocomposites. The AgNP is first dispersed in toluene using an ultrasonic homogenizer, and then thoroughly mixed with EPR in the same solvent whose removal gives nanocomposites of 2, 4, 6 and 8 vol% AgNP in EPR,  showing strong antibacterial activity against both Escherichia coli and Staphylococcus aureus.

  12. An X-band Co{sup 2+} EPR study of Zn{sub 1−x}Co{sub x}O (x=0.005–0.1) nanoparticles prepared by chemical hydrolysis methods using diethylene glycol and denaturated alcohol at 5 K

    Energy Technology Data Exchange (ETDEWEB)

    Misra, Sushil K., E-mail: skmisra@alcor.concordia.ca [Physics Department, Concordia University, Montreal, QC, Canada H3G 1M8 (Canada); Andronenko, S.I. [Physics Institute, Kazan Federal University, Kazan 420008 (Russian Federation); Srinivasa Rao, S.; Chess, Jordan; Punnoose, A. [Department of Physics, Boise State University, Boise, ID 83725-1570 (United States)

    2015-11-15

    EPR investigations on two types of dilute magnetic semiconductor (DMS) ZnO nanoparticles doped with 0.5–10% Co{sup 2+} ions, prepared by two chemical hydrolysis methods, using: (i) diethylene glycol ((CH{sub 2}CH{sub 2}OH){sub 2}O) (NC-rod-like samples), and (ii) denatured ethanol (CH{sub 3}CH{sub 2}OH) solutions (QC-spherical samples), were carried out at X-band (9.5 GHz) at 5 K. The analysis of EPR data for NC samples revealed the presence of several types of EPR lines: (i) two types, intense and weak, of high-spin Co{sup 2+} ions in the samples with Co concentration >0.5%; (ii) surface oxygen vacancies, and (iii) a ferromagnetic resonance (FMR) line. QC samples exhibit an intense FMR line and an EPR line due to high-spin Co{sup 2+} ions. FMR line is more intense, than the corresponding line exhibited by NC samples. These EPR spectra varied for sample with different doping concentrations. The magnetic states of these samples as revealed by EPR spectra, as well as the origin of ferromagnetism DMS samples are discussed. - Highlights: • 5 K X band Co{sup 2+} EPR investigations on QC and NC ZnO dilute magnetic semiconductor nanoparticles. • NC and QC samples exhibited high-spin Co{sup 2+} EPR lines and ferromagnetic resonance line. • NC sample also exhibit line due surface oxygen vacancies. • FMR line is more intense in QC than that in NC samples. • Magnetic states and the origin of ferromagnetism are discussed.

  13. Heat flux and thermal conduction in O+ and H+ ion flows deduced from EISCAT-VHF radar observations in the high-latitude topside ionosphere

    Science.gov (United States)

    Wu, Jian; Taieb, Charley

    1994-06-01

    With two periods of EISCAT-VHF radar observations, magnetically quiet and moderately disturbed, we have calculated the H+ and O+ heat fluxes in using formulae of Wu and Taieb (1993), accounting not only for temperature gradients but also for pressure gradients, velocity gradients, and diffusion-thermal effects. They correspond to different physical processes that are calculated and compared between them. Then, the general features of the H+ and O+ ion thermal conductions are studied during the two periods of observation in the high-latitude topside ionosphere. The analysis of the two periods of measurements revealed the following trends, to be confirmed by further observations: (1) During the two periods the H+ heat flux Q2 is always upward in the altitude range from 600 km up to about 1000 km. It is larger during the quiet period than during the disturbed period. (2) The most important dominant mechanism for H+ heat flux is the diffusion-thermal effect due to the H+-O+ collision, with a correcting term due to the H+ temperature gradient. (3) The O+ heat flux is always downward in the same altitude range during the two periods of observations. The absolute value during the disturbed period is slightly larger than that during the quiet period. (4) The dominant mechanism for O+ heat flux is its temperature gradient, corrected by the coupling with the H+ ion. (5) The O+ thermal conduction is less important during the quiet period than during the disturbed period, while for the H+ thermal conduction it is the contrary. (6) The H+ thermal conduction increases with altitude below about 1000 km.

  14. An Improved and Secure Anonymous Biometric-Based User Authentication with Key Agreement Scheme for the Integrated EPR Information System

    Science.gov (United States)

    Kang, Dongwoo; Lee, Donghoon; Won, Dongho

    2017-01-01

    Nowadays, many hospitals and medical institutes employ an authentication protocol within electronic patient records (EPR) services in order to provide protected electronic transactions in e-medicine systems. In order to establish efficient and robust health care services, numerous studies have been carried out on authentication protocols. Recently, Li et al. proposed a user authenticated key agreement scheme according to EPR information systems, arguing that their scheme is able to resist various types of attacks and preserve diverse security properties. However, this scheme possesses critical vulnerabilities. First, the scheme cannot prevent off-line password guessing attacks and server spoofing attack, and cannot preserve user identity. Second, there is no password verification process with the failure to identify the correct password at the beginning of the login phase. Third, the mechanism of password change is incompetent, in that it induces inefficient communication in communicating with the server to change a user password. Therefore, we suggest an upgraded version of the user authenticated key agreement scheme that provides enhanced security. Our security and performance analysis shows that compared to other related schemes, our scheme not only improves the security level, but also ensures efficiency. PMID:28046075

  15. An Improved and Secure Anonymous Biometric-Based User Authentication with Key Agreement Scheme for the Integrated EPR Information System.

    Science.gov (United States)

    Jung, Jaewook; Kang, Dongwoo; Lee, Donghoon; Won, Dongho

    2017-01-01

    Nowadays, many hospitals and medical institutes employ an authentication protocol within electronic patient records (EPR) services in order to provide protected electronic transactions in e-medicine systems. In order to establish efficient and robust health care services, numerous studies have been carried out on authentication protocols. Recently, Li et al. proposed a user authenticated key agreement scheme according to EPR information systems, arguing that their scheme is able to resist various types of attacks and preserve diverse security properties. However, this scheme possesses critical vulnerabilities. First, the scheme cannot prevent off-line password guessing attacks and server spoofing attack, and cannot preserve user identity. Second, there is no password verification process with the failure to identify the correct password at the beginning of the login phase. Third, the mechanism of password change is incompetent, in that it induces inefficient communication in communicating with the server to change a user password. Therefore, we suggest an upgraded version of the user authenticated key agreement scheme that provides enhanced security. Our security and performance analysis shows that compared to other related schemes, our scheme not only improves the security level, but also ensures efficiency.

  16. EPR interpretation, magnetism and biological study of a Cu(II) dinuclear complex assisted by a schiff base precursor.

    Science.gov (United States)

    Das, Kuheli; Patra, Chiranjit; Sen, Chandana; Datta, Amitabha; Massera, Chiara; Garribba, Eugenio; El Fallah, Mohamed Salah; Beyene, Belete B; Hung, Chen-Hsiung; Sinha, Chittaranjan; Askun, Tulin; Celikboyun, Pinar; Escudero, Daniel; Frontera, Antonio

    2017-06-01

    A new Cu(II) dinuclear complex, Cu2L2 (1) was afforded employing the potentially pentatentate Schiff base precursor H2L, a refluxed product of o-vanillin and diethylenetriamine in methanol. Complex 1 was systematically characterized by FTIR, UV-Vis, emission and EPR spectrometry. The single crystal X-ray diffraction analysis of 1 reveals that the copper atom exhibits a distorted square planar geometry, comprising two pairs of phenolato-O and imine-N donors from two different H2L ligands. The temperature dependent magnetic interpretation agrees with the existence of weak antiferromagnetic interactions between the bridging dinuclear Cu(II) ions. A considerable body of experimental evidence has been accumulated to elucidate the magneto-structural relationship in this dinuclear Cu(II) complex by DFT computation. Both the ligand and complex 1 exhibit anti-mycobacterial activity and considerable efficacy on M. tuberculosis H37Ra (ATCC 25177) and M. tuberculosis H37Rv (ATCC 25618) strains. The practical applicability of the ligand and complex 1 has been examined in living cells (African Monkey Vero Cells). The MTT assay proves the non-toxicity of the probe up to 100 mg mL-1. A new homometallic dinuclear Cu(II) complex is afforded with a tetradentate Schiff base precursor. EPR interpretation and temperature dependent magnetic studies show that complex 1 has weak antiferromagnetic coupling and DFT computation is governed to explain the magneto-structural correlation.

  17. Comparison of EPR response of alanine and Gd₂O₃-alanine dosimeters exposed to TRIGA Mainz reactor.

    Science.gov (United States)

    Marrale, M; Schmitz, T; Gallo, S; Hampel, G; Longo, A; Panzeca, S; Tranchina, L

    2015-12-01

    In this work we report some preliminary results regarding the analysis of electron paramagnetic resonance (EPR) response of alanine pellets and alanine pellets added with gadolinium used for dosimetry at the TRIGA research reactor in Mainz, Germany. Two set-ups were evaluated: irradiation inside PMMA phantom and irradiation inside boric acid phantom. We observed that the presence of Gd2O3 inside alanine pellets increases the EPR signal by a factor of 3.45 and 1.24 in case of PMMA and boric acid phantoms, respectively. We can conclude that in the case of neutron beam with a predominant thermal neutron component the addition of gadolinium oxide can significantly improve neutron sensitivity of alanine pellets. Monte Carlo (MC) simulations of both response of alanine and Gd-added alanine pellets with FLUKA code were performed and a good agreement was achieved for pure alanine dosimeters. For Gd2O3-alanine deviations between MC simulations and experimental data were observed and discussed. Copyright © 2015 Elsevier Ltd. All rights reserved.

  18. Arbitrary waveform modulated pulse EPR at 200 GHz

    Science.gov (United States)

    Kaminker, Ilia; Barnes, Ryan; Han, Songi

    2017-06-01

    We report here on the implementation of arbitrary waveform generation (AWG) capabilities at ∼200 GHz into an Electron Paramagnetic Resonance (EPR) and Dynamic Nuclear Polarization (DNP) instrument platform operating at 7 T. This is achieved with the integration of a 1 GHz, 2 channel, digital to analog converter (DAC) board that enables the generation of coherent arbitrary waveforms at Ku-band frequencies with 1 ns resolution into an existing architecture of a solid state amplifier multiplier chain (AMC). This allows for the generation of arbitrary phase- and amplitude-modulated waveforms at 200 GHz with >150 mW power. We find that the non-linearity of the AMC poses significant difficulties in generating amplitude-modulated pulses at 200 GHz. We demonstrate that in the power-limited regime of ω1 10 MHz) spin manipulation in incoherent (inversion), as well as coherent (echo formation) experiments. Highlights include the improvement by one order of magnitude in inversion bandwidth compared to that of conventional rectangular pulses, as well as a factor of two in improvement in the refocused echo intensity at 200 GHz.

  19. Revealing model dependencies in "Assessing the RAFT equilibrium constant via model systems: an EPR study".

    Science.gov (United States)

    Junkers, Thomas; Barner-Kowollik, Christopher; Coote, Michelle L

    2011-12-01

    In a recent article (W. Meiser, M. Buback, Assessing the RAFT Equilibrium Constant via Model Systems: An EPR Study, Macromol. Rapid Commun. 2011, 18, 1490-1494), it is claimed that evidence is found that unequivocally proves that quantum mechanical calculations assessing the equilibrium constant and fragmentation rate coefficients in dithiobenzoate-mediated reversible addition fragmentation transfer (RAFT) systems are beset with a considerable uncertainty. In the present work, we show that these claims made by Meiser and Buback are beset with a model dependency, as a critical key parameter in their data analysis - the addition rate coefficient of the radicals attacking the C=S double bond in the dithiobenzoate - induces a model insensitivity into the data analysis. Contrary to the claims made by Meiser and Buback, their experimental results can be brought into agreement with the quantum chemical calculations if a lower addition rate coefficient of cyanoisopropyl radicals (CIP) to the CIP dithiobenzoate (CPDB) is assumed. To resolve the model dependency, the addition rate coefficient of CIP radicals to CPDB needs to be determined as a matter of priority. Copyright © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  20. Multi-frequency and high-field EPR study of manganese(III) protoporphyrin IX reconstituted myoglobin with an S=2 integer electron spin.

    Science.gov (United States)

    Horitani, Masaki; Yashiro, Haruhiko; Hagiwara, Masayuki; Hori, Hiroshi

    2008-04-01

    We investigate the electronic state of Mn(III) center with an integer electron spin S=2 in the manganese(III) protoporphyrin IX reconstituted myoglobin, Mn(III)Mb, by means of multi-frequency electron paramagnetic resonance (MFEPR) spectroscopy. Using a bimodal cavity resonator, X-band EPR signal from Mn(III) center in the Mn(III)Mb was observed near zero-field region. The temperature dependence of this signal indicates a negative axial zero-field splitting value, DEPR analysis shows that this signal is attributed to the transition between the closely spaced M(s)=+/-2 energy levels for the z-axis, corresponding to the heme normal. To determine the zero-field splitting (ZFS) parameters, EPR experiments on the Mn(III)Mb were performed at various temperatures for some frequencies between 30GHz and 130GHz and magnetic fields up to 14T. We observed several EPR spectra which are analyzed with a spin Hamiltonian for S=2, yielding highly accurate ZFS parameters; D=-3.79cm(-1) and |E|=0.08cm(-1) for an isotropic g=2.0. These ZFS parameters are compared with those in some Mn(III) complexes and Mn(III) superoxide dismutase (SOD), and effects on these parameters by the coordination and the symmetry of the ligands are discussed. To the best of our knowledge, these EPR spectra in the Mn(III)Mb are the very first MFEPR spectra at frequencies higher than Q-band in a metalloprotein with an integer spin.

  1. The evolution of the Italian EPR system for the management of household Waste Electrical and Electronic Equipment (WEEE). Technical and economic performance in the spotlight.

    Science.gov (United States)

    Favot, Marinella; Veit, Raphael; Massarutto, Antonio

    2016-10-01

    In this paper we analyse the Italian collective system for the management of household Waste Electrical and Electronic Equipment (WEEE), and its evolution over time, following the European Directives on WEEE, which include the Extended Producer Responsibility (EPR). The analysis focuses on the technical and economic performance of WEEE compliance organisations (consortia), as they are the key players in the Italian EPR regime. Economic results have not usually been provided in previous studies, due to the lack of available data. This study overcomes this problem by accessing the financial statements for the years 2009-2014 of all consortia. The main conclusions of the study are: The Italian EPR system barely exceeded the technical target of the first WEEE Directive (4kg per capita). Improvements are necessary to achieve the target set for 2019 by the Recast Directive. The economic performance of the Italian EPR regime improved significantly over time. The fees charged per tonne of WEEE collected decreased by almost 43% from 652 Euro per tonne in 2009 to 374 Euro per tonne in 2014, while the fees per tonne put on the market (POM) were 134 Euro in 2009 and 104 Euro in 2014. The results prove the theory which states that, competing consortia use the learning effects to reduce the contribution fees for producers rather than to increase the quantity collected. Municipalities remain the most important actor in WEEE collection operations. Consortia compensate municipalities with a reimbursement that ranges between 28 and 38 Euros per tonne collected. These repayments cover only partially their costs. Additional studies should investigate their role. Copyright © 2016 Elsevier Ltd. All rights reserved.

  2. EPR and UV spectral study of gamma-irradiated white and burned sugar, fructose and glucose

    Science.gov (United States)

    Yordanov, Nicola D.; Georgieva, Elka

    2004-05-01

    The EPR and UV spectral properties of γ-irradiated white and burned sugar, fructose and glucose are studied with the accent on their suitability as dosimetric materials. It is shown that γ-irradiation of solid samples of white sugar and fructose yields stable EPR spectra whereas glucose signal remains time-dependent even 11 months later. Sugar and glucose exhibit linear EPR dose response in the region 0.44-21 kGy and fructose only up to ca. 10 kGy. The relative radiation sensitivity obtained for sugar and fructose is up to 10 kGy and slightly lower for glucose. Burned saccharides provide 2-3 orders of magnitude lower EPR radiation sensitivity making them not suitable for the proposed designation. According to the UV spectra water solutions of γ-irradiated solid white saccharides show well pronounced absorption bands at 267 and 286 nm for sugar and fructose with time-dependent intensities reaching steady values ca. 11 days after dissolution. The intensities of these absorption bands are in linear relation with the absorbed dose of γ-radiation. Glucose shows low sensitively because irradiation with 5.5 kGy yields only a shoulder at about 260-280 nm with decreasing to ca. 40% intensity in the first few days after dissolution. Excellent correlation between the intensities of the EPR- and UV-absorbed dose response is found for sugar and fructose in the region 0.44-10 kGy. This opens new possibilities for independent calibration the EPR dose response. Finally, the comparison suggests sugar as the best, universal material for EPR- and/or UV-dosimetry in the region 0.44-160 kGy.

  3. EPR, TEM and cell viability study of asbestiform zeolite fibers in cell media.

    Science.gov (United States)

    Cangiotti, Michela; Salucci, Sara; Battistelli, Michela; Falcieri, Elisabetta; Mattioli, Michele; Giordani, Matteo; Ottaviani, Maria Francesca

    2018-01-01

    Human monocyte U937 cell line was used as a model to verify the toxicity of erionite and offretite asbestiform zeolite fibers. As a presumed non-toxic reference, a fibrous scolecite zeolite was also used. To analyze the process of fiber ingestion into cells and the cells-fibers interactions, a spin-probe electron paramagnetic resonance (EPR) analysis was performed supported by transmission electron microscopy (TEM) and cell viability measurements as a function of the incubation time. Erionite fibers were fast internalized in the membrane mainly as aggregates with radical-solution drops trapped inside, and were found in the cytosol and at the nucleus. In 24h, first erionite fibers rich in sodium and potassium, and then calcium-rich erionite fibers, induced cell necrosis. The offretite fibers formed rounding electron-dense filaments which transformed in curved filaments, initially perturbing the cell structure and interacting at the external surface more than erionite fibers. Such interactions probably diminished the toxic effect of offretite on cells. Interestingly, the presumed non-toxic scolecite fibers were partially internalized, inducing formation of swollen mitochondria and squared cells. Overall, the toxic effect of the fibrous zeolites was related to fiber morphology, chemical distribution of sites, structural variations and formation of aggregates. Copyright © 2017 Elsevier B.V. All rights reserved.

  4. EPR UNIFORM FIELD SIGNAL ENHANCEMENT BY DIELECTRIC TUBES IN CAVITIES.

    Science.gov (United States)

    Hyde, James S; Mett, Richard R

    2017-12-01

    The dielectric tube resonator (DTR) for EPR spectroscopy is introduced. It is defined as a metallic cylindrical TE011 microwave cavity that contains a dielectric tube centered on the axis of the cylinder. Contour plots of dimensions of the metallic cylinder to achieve resonance at 9.5 GHz are shown for quartz, sapphire, and rutile tubes as a function of wall thickness and average radius. These contour plots were developed using analytical equations and confirmed by finite element modeling. They can be used in two ways: design of the metallic cylinder for use at 9.5 GHz that incorporates a readily available tube such as a sapphire tube intended for NMR, or design of a custom procured tube for optimized performance for specific sample-size constraints. The charts extend to the limiting condition where the dielectric fills the tube. However, the structure at this limit is not a dielectric resonator due to the metal wall and does not radiate. In addition, the uniform field (UF) DTR is introduced. Development of the UF resonator starting with a dielectric tube resonator is shown. The diameter of the tube remains constant along the cavity axis, and the diameter of the cylindrical metallic enclosure increases at the ends of the cavity to satisfy the uniform field condition. This structure has advantages over the previously developed UF TE011 resonators: higher resonator efficiency parameter Λ, convenient overall size when using sapphire tubes, and higher quality data for small samples. The DTR and UF DTR structures fill the gap between free space and dielectric resonator limits in a continuous manner.

  5. Wideband frequency-swept excitation in pulsed EPR spectroscopy

    Science.gov (United States)

    Doll, Andrin; Jeschke, Gunnar

    2017-07-01

    Excitation of electron spins with monochromatic rectangular pulses is limited to bandwidths that are smaller than the spectral widths of most organic radicals and much smaller than the spectral widths of transition and rare earth metal ions. With frequency-swept pulses, bandwidths of up to 800 MHz have previously been attained for excitation and detection of spin packets at frequencies of about 9.6 GHz and bandwidths of up to 2.5 GHz in a polarization transfer experiment at frequencies of about 34 GHz. The remaining limitations, mainly due to resonator bandwidth and due to pulse length restrictions are discussed. Flip angles for state-space rotations on passage of a transition can generally be computed from the critical adiabaticity by the Landau-Zener-Stückelberg-Majorana expression. For hyperbolic secant pulses, the Demkov-Kunike model describes excitation for spin packets within and outside the sweep range. Well within the sweep range, the Bloch-Siegert phase shift is proportional to critical adiabaticity to a very good approximation. Because of the dependence of both flip angle and coherence phase on critical adiabaticity, it is advantageous to use pairs of amplitude and frequency modulation functions that provide such offset-independent adiabaticity. Compensation for the resonator response function should restore offset-independent adiabaticity. Whereas resonance offsets and Bloch-Siegert phase can be refocused at certain pulse length ratios, phase dispersion in coupled spin systems cannot generally be refocused. Based on the bandwidth limitations that arise from spin dynamics, requirements are derived for a spectrometer that achieves precise spin control over wide bands. The design of such a spectrometer and hardware characterization by EPR experiments are discussed.

  6. EPR in functional structures based on doped (nano, meso)-porous silica and titanium dioxide

    Energy Technology Data Exchange (ETDEWEB)

    Kassiba, A [Laboratoire de Physique de l' Etat Condense LPEC, UMRCNRS 6087 Universite du Maine, Avenue Olivier Messiaen 72085 Le Mans Cedex 9 France (France); Makowska-Janusik, M [Institute of Physics, Al Armii Krajowej 13/15, Akademina Im Jana Dlugosz w Czestochowa, 42200 (Poland); Mehdi, A, E-mail: kassiba@univ-lemans.fr [Institut Charles Gerhardt, UMR 5253 Chimie Moleculaire et Organisation du Solide, Universite Montpellier II Place E Bataillon, 34095 Montpellier Cedex 5 (France)

    2011-04-01

    EPR investigations are performed on mesoporous silica (SBA15) functionalized by Nickel-cyclam complexes (1,4,8,11-tetraazacyclotetradecane groups chelating nickel ions) and on mesoporous titanium dioxide with nitrogen doping. For functionalized silica, the magnetic behaviour of organometallic groups, their mutual interactions and dispersion in the host matrices are compared with respect to the doping rates and the synthesis procedures. The relaxation processes were analyzed from the thermal evolution of the paramagnetic spin susceptibilities and EPR line-widths. Particularly, some samples show the formation of clusters where phonon assisted one dimensional (1D) ferromagnetic ordering occurs below 45 K. For the mesoporous TiO{sub 2}, systematic EPR investigations were performed on two main classes of materials with regard to the porosity degrees. The EPR experiments point out the efficiency of EPR method to probe the degree of functionalization of mesoporous silica or the nitrogen doping achievement in TiO{sub 2}, and in general to give a valuable feedback to improve the synthesis routes of smart materials.

  7. Identification of slow relaxing spin components by pulse EPR techniques in graphene-related materials

    Directory of Open Access Journals (Sweden)

    Antonio Barbon

    2017-01-01

    Full Text Available Electron Paramagnetic Resonance (EPR is a powerful technique that is suitable to study graphene-related materials. The challenging ability requested to the spectroscopy is its capability to resolve the variety of structures, relatively similar, that are obtained in materials produced through different methods, but that also coexist inside a single sample. In general, because of the intrinsic inhomogeneity of the samples, the EPR spectra are therefore a superposition of spectra coming from different structures. We show that by pulse EPR techniques (echo-detected EPR, ESEEM and Mims ENDOR we can identify and characterize species with slow spin relaxing properties. These species are generally called molecular states, and are likely small pieces of graphenic structures of limited dimensions, thus conveniently described by a molecular approach. We have studied commercial reduced graphene oxide and chemically exfoliated graphite, which are characterized by different EPR spectra. Hyperfine spectroscopies enabled us to characterize the molecular components of the different materials, especially in terms of the interaction of the unpaired electrons with protons (number of protons and hyperfine coupling constants. We also obtained useful precious information about extent of delocalization of the molecular states.

  8. New developed cylindrical TM010 mode EPR cavity for X-band in vivo tooth dosimetry.

    Directory of Open Access Journals (Sweden)

    Guo Junwang

    Full Text Available EPR tooth in vivo dosimetry is an attractive approach for initial triage after unexpected nuclear events. An X-band cylindrical TM010 mode resonant cavity was developed for in vivo tooth dosimetry and used in EPR applications for the first time. The cavity had a trapezoidal measuring aperture at the exact position of the cavity's cylindrical wall where strong microwave magnetic field H1 concentrated and weak microwave electric field E1 distributed. Theoretical calculations and simulations were used to design and optimize the cavity parameters. The cavity features were evaluated by measuring DPPH sample, intact incisor samples embed in a gum model and the rhesus monkey teeth. The results showed that the cavity worked at designed frequency and had the ability to make EPR spectroscopy in relative high sensitivity. Sufficient modulation amplitude and microwave power could be applied into the aperture. Radiation induced EPR signal could be observed remarkably from 1 Gy irradiated intact incisor within only 30 seconds, which was among the best in scan time and detection limit. The in vivo spectroscopy was also realized by acquiring the radiation induced EPR signal from teeth of rhesus monkey whose teeth was irradiated by dose of 2 Gy. The results suggested that the cavity was sensitive to meet the demand to assess doses of significant level in short time. This cavity provided a very potential option for the development of X-band in vivo dosimetry.

  9. A special JMR issue: Methodological advances in EPR spectroscopy and imaging

    Science.gov (United States)

    2017-07-01

    Since about five decades, EPR spectroscopy provides important insights into the electronic structure of metalloproteins and transition-metal based catalysts. Somewhat later this spectroscopy was also applied to the study of electron transfer processes, often in radical enzymes. The study of diamagnetic proteins and nucleic acids with site-directed spin labeling (SDSL) techniques became really popular in the 1990s and early in the new millennium. The same applies to applications of pulsed EPR techniques to metalloproteins, although the pioneering work in this field by Mims and Peisach dates back to the early 1970s. Pulsed dipolar spectroscopy for the measurement of distance distributions in the nanometer range has become the major EPR-based tool in structural biology during the past 15 years and is still expanding its scope. EPR (or ESR) imaging may appear to be overshadowed by (nuclear) MRI, as it has not yet found clinical application. However, development of EPR-based imaging modalities has recently gained much momentum as they can provide information that is inaccessible by any established imaging technology.

  10. The Epi Info Viral Hemorrhagic Fever (VHF) Application: A Resource for Outbreak Data Management and Contact Tracing in the 2014-2016 West Africa Ebola Epidemic.

    Science.gov (United States)

    Schafer, Ilana J; Knudsen, Erik; McNamara, Lucy A; Agnihotri, Sachin; Rollin, Pierre E; Islam, Asad

    2016-10-15

    The Epi Info Viral Hemorrhagic Fever application (Epi Info VHF) was developed in response to challenges managing outbreak data during four 2012 filovirus outbreaks. Development goals included combining case and contact data in a relational database, facilitating data-driven contact tracing, and improving outbreak data consistency and use. The application was first deployed in Guinea, when the West Africa Ebola epidemic was detected, in March 2014, and has been used in 7 African countries and 2 US states. Epi Info VHF enabled reporting of compatible data from multiple countries, contributing to international Ebola knowledge. However, challenges were encountered in accommodating the epidemic's unexpectedly large magnitude, addressing country-specific needs within 1 software product, and using the application in settings with limited Internet access and information technology support. Use of Epi Info VHF in the West Africa Ebola epidemic highlighted the fundamental importance of good data management for effective outbreak response, regardless of the software used. Published by Oxford University Press for the Infectious Diseases Society of America 2016. This work is written by (a) US Government employee(s) and is in the public domain in the US.

  11. EPR and optical absorption studies on manganese ion doped in mixed alkali cadmium phosphate glasses

    Science.gov (United States)

    Giridhar, G.; Rangacharyulu, M.; Ravikumar, R. V. S. S. N.; Sambasiva Rao, P.

    2009-07-01

    Electron paramagnetic resonance (EPR) spectra of Mn(II) ions in cadmium phosphate glasses are presented with mixed alkali variation as xLi2O + (20 - x) Na2O + 20 CdO + 59.5 P2O5 + 0.5 MnO glass system with 5 EPR spectra of Mn(II) ions doped samples exhibit a sextet centered at g = 2·0. The optical absorption spectrum at room temperature shows three bands for Mn(II) ions in octahedral symmetry. The crystal field (Dq) and Racah parameters (B and C) are evaluated. From EPR and optical spectral studies reveals the nature of the bonding is dominantly ionic and its site symmetry is octahedral. At equal composition of alkali content, i.e. for x = 10 the glass system shows the mixed alkali effect.

  12. EPR, UV-Visible, and Near-Infrared Spectroscopic Characterization of Dolomite

    Directory of Open Access Journals (Sweden)

    S. Lakshmi Reddy

    2008-01-01

    Full Text Available Dolomite mineral samples having white and light green colors of Indian origin have been characterized by EPR, optical, and NIR spectroscopy. The optical spectrum exhibits a number of electronic bands due to presence of Fe(III ions in the mineral. From EPR studies, the parameters of g for Fe(III and g,A, and D for Mn(II are evaluated and the data confirm that the ions are in distorted octahedron. Optical absorption studies reveal that Fe(III is in distorted octahedron. The bands in NIR spectra are due to the overtones and combinations of water molecules. Thus EPR and optical absorption spectral studies have proven useful for the study of the solid state chemistry of dolomite.

  13. EPR and optical absorption characteristics of sodic plagioclase from granite pegmatite in Kadavur, India

    Science.gov (United States)

    Anand, S. Vijay; Pandian, M. S.; Mithira, S.; Ravikumar, R. V. S. S. N.; Sambasiva Rao, P.

    The electron paramagnetic resonance (EPR) spectra of sodic plagioclase from dykes of granitic pegmatite occurring in the Kadavur area, Tamil Nadu, India, were examined at room temperature to identify paramagnetic impurities in a "low plagioclase" using EPR and optical techniques. The EPR spectra showed the presence of Fe(III) and Mn(II) impurities. After heating the plagioclase samples for various durations at 600 °C, it has been observed that the concentration of Mn(II) remained as such in one sample but completely disappeared in another sample, while there was no change in Fe(III) ion concentration after the heat treatment in either sample. Optical absorption spectra also showed Fe(II) and Fe(III) in addition to Ti(III) impurities in sodic plagioclase before heating, while after heating the relative concentration of Fe(II) and Fe(III) changed, accompanied by the disappearance of Ti(III).

  14. Magnetic properties of single crystal alpha-benzoin oxime: An EPR study

    Science.gov (United States)

    Sayin, Ulku; Dereli, Ömer; Türkkan, Ercan; Ozmen, Ayhan

    2012-02-01

    The electron paramagnetic resonance (EPR) spectra of gamma irradiated single crystals of alpha-benzoinoxime (ABO) have been examined between 120 and 440 K. Considering the dependence on temperature and the orientation of the spectra of single crystals in the magnetic field, we identified two different radicals formed in irradiated ABO single crystals. To theoretically determine the types of radicals, the most stable structure of ABO was obtained by molecular mechanic and B3LYP/6-31G(d,p) calculations. Four possible radicals were modeled and EPR parameters were calculated for the modeled radicals using the B3LYP method and the TZVP basis set. Calculated values of two modeled radicals were in strong agreement with experimental EPR parameters determined from the spectra. Additional simulated spectra of the modeled radicals, where calculated hyperfine coupling constants were used as starting points for simulations, were well matched with experimental spectra.

  15. EPR approaches to heterogeneous catalysis. The chemistry of titanium in heterogeneous catalysts and photocatalysts.

    Science.gov (United States)

    Morra, Elena; Giamello, Elio; Chiesa, Mario

    2017-07-01

    Paramagnetic species are often involved in catalytic or photocatalytic reactions occurring at the solid-gas interface of heterogeneous catalysts. In this contribution we will provide an overview of the wealth and breadth of information that can be obtained from EPR in the characterization of paramagnetic species in such systems, illustrating the advantages that modern pulsed EPR methodologies can offer in monitoring the elementary processes occurring within the coordination sphere of surface transition-metal ions. To do so we selected three representative systems, where titanium ions in low oxidation states act as active catalytic sites, trying to outline the methodological approaches which characterize the application of EPR techniques and the questions that can be answered and addressed relative to the characterization of heterogeneous catalytic materials. Copyright © 2017 Elsevier Inc. All rights reserved.

  16. EPR approaches to heterogeneous catalysis. The chemistry of titanium in heterogeneous catalysts and photocatalysts

    Science.gov (United States)

    Morra, Elena; Giamello, Elio; Chiesa, Mario

    2017-07-01

    Paramagnetic species are often involved in catalytic or photocatalytic reactions occurring at the solid-gas interface of heterogeneous catalysts. In this contribution we will provide an overview of the wealth and breadth of information that can be obtained from EPR in the characterization of paramagnetic species in such systems, illustrating the advantages that modern pulsed EPR methodologies can offer in monitoring the elementary processes occurring within the coordination sphere of surface transition-metal ions. To do so we selected three representative systems, where titanium ions in low oxidation states act as active catalytic sites, trying to outline the methodological approaches which characterize the application of EPR techniques and the questions that can be answered and addressed relative to the characterization of heterogeneous catalytic materials.

  17. BCL::MP-Fold: membrane protein structure prediction guided by EPR restraints

    CERN Document Server

    Fischer, Axel Walter; Woetzel, Nils; Karakas, Mert; Weiner, Brian; Meiler, Jens

    2015-01-01

    For many membrane proteins the determination of their topology remains a challenge for methods like X-ray crystallography and nuclear magnetic resonance (NMR) spectroscopy. Electron paramagnetic resonance (EPR) spectroscopy has evolved as an alternative technique to study structure and dynamics of membrane proteins. The present study demonstrates the feasibility of membrane protein topology determination using limited EPR distance and accessibility measurements. The BCL::MP-Fold (BioChemical Library membrane protein fold) algorithm assembles secondary structure elements (SSEs) in the membrane using a Monte Carlo Metropolis (MCM) approach. Sampled models are evaluated using knowledge-based potential functions and agreement with the EPR data and a knowledge-based energy function. Twenty-nine membrane proteins of up to 696 residues are used to test the algorithm. The RMSD100 value of the most accurate model is better than 8{\\AA} for twenty-seven, better than 6{\\AA} for twenty-two and better than 4{\\AA} for fifte...

  18. A password-based user authentication scheme for the integrated EPR information system.

    Science.gov (United States)

    Wu, Zhen-Yu; Chung, Yufang; Lai, Feipei; Chen, Tzer-Shyong

    2012-04-01

    With the rapid development of the Internet, digitization and electronic orientation are required in various applications of our daily life. For e-medicine, establishing Electronic patient records (EPRs) for all the patients has become the top issue during the last decade. Simultaneously, constructing an integrated EPR information system of all the patients is beneficial because it can provide medical institutions and the academia with most of the patients' information in details for them to make correct decisions and clinical decisions, to maintain and analyze patients' health. Also beneficial to doctors and scholars, the EPR system can give them record linkage for researches, payment audits, or other services bound to be developed and integrated into medicine. To tackle the illegal access and to prevent the information from theft during transmission over the insecure Internet, we propose a password-based user authentication scheme suitable for information integration.

  19. EPR persistence measurements of UV-induced melanin free radicals in whole skin

    Energy Technology Data Exchange (ETDEWEB)

    Collins, B.; Poehler, T.O. [Johns Hopkins Univ., Baltimore, MD (United States); Bryden, W.A. [Johns Hopkins Univ., Laurel, MD (United States). Applied Physics Lab.

    1995-09-01

    Electron paramagnetic resonance is used to detect the formation of free radicals caused by exposure to ultraviolet radiation in chemically untreated rabbit skin. A fast jump in EPR signal level, occurring over a few seconds, is observed immediately after a skin sample is exposed to UV. This is followed by a slower increase toward an elevated steady-state signal over a period of hours as the skin is continuously exposed to a UV light source. Upon cessation of UV light exposure, EPR signal levels undergo an abrupt drop followed by a slower decay toward natural levels. Elevated free radical concentrations following UV exposure are found to persist for several hours in whole skin. These results are consistent with time resolved EPR measurements of photoinduced radicals in various natural melanins. (Author).

  20. Crystallite arrangement of hydroxyapatite microcrystals in human tooth cementum as revealed by electron paramagnetic resonance (EPR)

    Energy Technology Data Exchange (ETDEWEB)

    Skaleric, U.; Gaspirc, B. [Univ. of Ljubljana, Jozef Stefan Inst., Center for Dental Research, Ljubljana (Slovenia); Cevc, P.; Schara, M. [Univ. of Ljubljana, Jozef Stefan Inst., EPR Center Ljubljana, Ljubljana (Slovenia)

    1998-08-01

    Human dental cementum was analyzed by electron paramagnetic resonance (EPR). The measured EPR powder spectra of {gamma}-irradiated cementum resembled those of {gamma}irradiated enamel. Both spectra were characterized by the same line shapes and g values. The position of the extreme first derivate peaks can be described by g{sub 1}=2.0023 and g{sub 2}=1.9971{+-}0.0002, and are assignable to the CO{sub 3}{sup 3-} center. The angular dependence of the cementum EPR spectra indicates a different arrangement of the hydroxyapatite microcrystals compared to that of enamel. A corresponding model of cementum micro-crystal alignment has been proposed. The methodology presented can be utilized for studying the mineralization process of root cementum and other mineralized tissues. (au) 14 refs.

  1. "Assessing the RAFT equilibrium constant via model systems: an EPR study"--response to a comment.

    Science.gov (United States)

    Meiser, Wibke; Buback, Michael

    2012-08-14

    We have presented an EPR-based approach for deducing the RAFT equilibrium constant, K(eq), of a dithiobenzoate-mediated system [Meiser, W. and Buback M. Macromol. Rapid Commun. 2011, 32, 1490]. Our value is by four orders of magnitude below K(eq) from ab initio calculations for the identical monomer-free system. Junkers et al. [Macromol. Rapid Commun. 2011, 32, 1891] claim that our EPR approach would be model dependent and our data could be equally well fitted by assuming slow addition of radicals to the RAFT agent and slow fragmentation of the so-obtained intermediate radical as well as high cross-termination rate. By identification of all side products, our EPR-based method is shown to be model independent and to provide reliable K(eq) values, which demonstrate the validity of the intermediate radical termination model. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  2. Multi-photon transitions and Rabi resonance in continuous wave EPR.

    Science.gov (United States)

    Saiko, Alexander P; Fedaruk, Ryhor; Markevich, Siarhei A

    2015-10-01

    The study of microwave-radiofrequency multi-photon transitions in continuous wave (CW) EPR spectroscopy is extended to a Rabi resonance condition, when the radio frequency of the magnetic-field modulation matches the Rabi frequency of a spin system in the microwave field. Using the non-secular perturbation theory based on the Bogoliubov averaging method, the analytical description of the response of the spin system is derived for all modulation frequency harmonics. When the modulation frequency exceeds the EPR linewidth, multi-photon transitions result in sidebands in absorption EPR spectra measured with phase-sensitive detection at any harmonic. The saturation of different-order multi-photon transitions is shown to be significantly different and to be sensitive to the Rabi resonance. The noticeable frequency shifts of sidebands are found to be the signatures of this resonance. The inversion of two-photon lines in some spectral intervals of the out-of-phase first-harmonic signal is predicted under passage through the Rabi resonance. The inversion indicates the transition from absorption to stimulated emission or vice versa, depending on the sideband. The manifestation of the primary and secondary Rabi resonance is also demonstrated in the time evolution of steady-state EPR signals formed by all harmonics of the modulation frequency. Our results provide a theoretical framework for future developments in multi-photon CW EPR spectroscopy, which can be useful for samples with long spin relaxation times and extremely narrow EPR lines. Copyright © 2015 Elsevier Inc. All rights reserved.

  3. Statistical characteristics of low-latitude ionospheric field-aligned irregularities obtained with the Piura VHF radar

    Directory of Open Access Journals (Sweden)

    J. L. Chau

    2002-08-01

    Full Text Available We present a summary of the statistical characteristics of echoes from ionospheric (E- and F-region field-aligned irregularities obtained with the Piura VHF radar. This radar is located at ~ 7.0° dip latitude, just outside the equatorial electrojet (EEJ region. Our results are based on (1 intermittent observations made between 1991 and 1999 just few days a year, and (2 continuous observations made between January 2000 and June 2001. During most of the intermittent observations, simultaneous measurements of EEJ and equatorial spread F (ESF irregularities were performed with the Jicamarca VHF radar. From the continuous measurements, we have obtained the diurnal and seasonal characteristics of a variety of parameters (percentage of occurrence, signal-to-noise ratio and/or Doppler velocities from the lower and upper E-region irregularities and also from F-region irregularities over Piura. For example, we have found that (1 the E-region echoes are stronger and occur more frequently during local summer (i.e. between December and March; (2 between May and June, the E-region echoes are weaker and occur less frequently; moreover, during these months, a semidiurnal wave with large amplitudes is observed in the meridional wind (> 100 ms- 1; (3 there is vertical wavelength of about 20 km in the Doppler velocity, particularly after midnight; (4 the lower (upper E-region Doppler velocities are influenced mainly by meridional winds (equatorial F-region vertical drifts. In addition, we have observed that the seasonal and daily occurrences of Piura F-region irregularities are similar to the occurrence of topside ESF irregularities over Jicamarca. The likelihood of occurrence of F-region irregularities over Piura and, therefore, topside ESF over Jicamarca is greater when there are no E-region irregularities over Piura. On the other hand, there is more probability of observing bottomtype/bottomside ESF irregularities over Jicamarca when E-region irregularities

  4. VHF SoOp (Signal of Opportunity) Technology Demonstration for Soil Moisture Measurement Using Microwave Hydraulic Boom Truck Platform

    Science.gov (United States)

    Joseph, Alicia; Deshpande, Manohar; O'Neill, Peggy; Miles, Lynn

    2017-04-01

    A goal of this research is to test deployable VHF antennas for 6U Cubesat platforms to enable validation of root zone soil moisture (RZSM) estimation algorithms for signal of opportunity (SoOp) remote sensing over the 240-270 MHz frequency band. The proposed work provides a strong foundation for establishing a technology development path for maturing a global direct surface soil moisture (SM) and RZSM measurement system over a variety of land covers. Knowledge of RZSM up to a depth of 1 meter and surface SM up to a depth of 0.05 meter on a global scale, at a spatial resolution of 1-10 km through moderate-to-heavy vegetation, is critical to understanding global water resources and the vertical moisture gradient in the Earth's surface layer which controls moisture interactions between the soil, vegetation, and atmosphere. Current observations of surface SM from space by L-band radiometers (1.4 GHz) and radars (1.26 GHz) are limited to measurements of surface SM up to a depth of 0.05 meter through moderate amounts of vegetation. This limitation is mainly due to the inability of L-band signals to penetrate through dense vegetation and deep into the soil column. Satellite observations of the surface moisture conditions are coupled to sophisticated models which extrapolate the surface SM into the root zone, thus providing an indirect estimate rather than a direct measurement of RZSM. To overcome this limitation, low-frequency airborne radars operating at 435 MHz and 118 MHz have been investigated, since these lower frequencies should penetrate denser vegetation and respond to conditions deeper in the soil. This presentation describes a new and less expensive technique for SM as well as RZSM direct measurement using Signal of Opportunity transmitters. Being less expensive and needing only passive simple RF receiver, the SoOp concept has the potential for being used for space borne applications, thus providing global SM and RZSM measurements. This study will describe

  5. Mass, IR, electronic and EPR spectral studies on transition metal complexes with a new tetradentate 12-membered new macrocyclic ligand

    Science.gov (United States)

    Chandra, Sulekh; Gupta, Lokesh Kumar

    2004-11-01

    Complexes of Cr(III), Co(II), Ni(II) and Cu(II) containing a novel macrocyclic tetradentate nitrogen donor (N 4) ligand prepared via reaction of 2,3-hexanedione and ethylenediamine has been prepared and characterized. The newly synthesized ligand (L) and its complexes have been characterized on the basis of elemental analysis, molar conductance, magnetic moment susceptibility, EI-Mass, IR, Electronic and EPR spectral studies. The complexes are of high-spin type and four coordinated tetrahedral, five coordinated square pyramidal and six coordinated octahedral/tetragonal geometries. The ligand (L) and its soluble transition metal complexes have also been screened against different bacteria and plant pathogenic fungi in vitro.

  6. Optical and EPR studies of iron bearing phosphate minerals: satterlyite and gormanite from Yukon Territory, Canada

    Science.gov (United States)

    Chandrasekhar, A. V.; Ramanaiah, M. Venkata; Reddy, B. J.; Reddy, Y. P.; Rao, P. S.; Ravikumar, R. V. S. S. N.

    2003-07-01

    The iron phosphate minerals satterlyite and gormanite have been investigated by EPR and optical absorption studies. The optical results indicate the presence of ferrous and ferric ions in both minerals. In gormanite the site symmetry of Fe(III) is near octahedral whereas in satterlyite it is tetragonally distorted. On the other hand, the Fe(II) ions are in tetragonally distorted octahedral site in both minerals. In satterlyite the EPR results indicate the presence of the ferric ion in a tetragonally distorted state together with a small percentage of Mn(II). Crystal field (Dq) and interelectronic parameters (B and C) are evaluated.

  7. EPR study of free radicals in some drugs {gamma}-irradiated in the solid state

    Energy Technology Data Exchange (ETDEWEB)

    Ambroz, H.B. E-mail: ambroz@orange.ichtj.waw.pl; Kornacka, E.M.; Marciniec, B.; Ogrodowczyk, M.; Przybytniak, G.K

    2000-06-01

    A range of drugs in the form of microcrystalline powder was exposed to {gamma}-radiation. EPR measurements proved that all of them contained various paramagnetic species after 4 and 8 weeks of storage. We observed following radical concentrations, stable up to 4 weeks: the highest for ifosfamide -- 4.5x10{sup 17} spins per gram and the lowest for nimodipine -- 2.1x10{sup 16} spins per gram. Three drugs exhibited very weak EPR signals before irradiation, not detectable quantitatively. Some spectroscopic properties and suggestions concerning possible structure of the radicals are given in our paper. (author)

  8. EPR study of VO/sup 2 +/ in some paramagnetic Tutton salt single crystals

    Energy Technology Data Exchange (ETDEWEB)

    Upreti, G.C. (Indian Inst. of Tech., Kanpur. Dept. of Physics); Saraswat, R.S. (Indian Inst. of Tech., Kharagpur. Dept. of Physics)

    1984-04-01

    The EPR spectra of VO/sup 2 +/ in single crystals of some paramagnetic salts Me(II)(NH/sub 4/)/sub 2/(SO/sub 4/)/sub 2/x6H/sub 2/O (Me = Co, Fe, or Ni) and NiK/sub 2/(SO/sub 4/)/sub 2/x6H/sub 2/O have been recorded and analyzed. The vanadyl ions doped in Co and Fe double salt crystals showed sharp and well resolved EPR spectra consisting in two sets of eight-line hyperfine patterns. The spin-Hamiltonian parameters and the molecular orbital coefficients are given and the bonding in vanadyl complexes is discussed.

  9. Characterisation of prehnite by EPMA, Mössbauer, optical absorption and EPR spectroscopic methods.

    Science.gov (United States)

    Reddy, N C Gangi; Fayazyddin, S Md; Reddy, R Rama Subba; Reddy, G Siva; Reddy, S Lakshmi; Rao, P Sambasiva; Reddy, B Jagannatha

    2005-11-01

    A sample of prehnite from Rayalaseema zone of Andhra Pradesh, India containing about 2.565 wt.% Fe(2)O(3) is used in the present work. The mineral has been characterized by EPMA, optical absorption, EPR, NIR and Mössbauer techniques. Mössbauer studies confirm the presence of iron as an impurity in two sites. An EPR study on powder sample confirm the presence of Fe(III) impurity in the mineral. Optical absorption spectrum also indicates that Fe(III) impurity is present in two sites with octahedral structure. NIR results are due to water fundamentals.

  10. EPR determination of the mechanism of the oxidation of alkenyl aminophosphites

    Energy Technology Data Exchange (ETDEWEB)

    Il' yasov, A.V.; Kibardin, A.M.; Morozov, V.I.; Gryaznov, P.I.; Vafina, A.A.; Pudovik, A.N.

    1987-10-20

    Aminophosphites that contain a vinyl group on the nitrogen atom are oxidized easily by atmospheric oxygen. Since it is important to clarify the nature of this reaction in order to understand the reactivity of organic phosphites, the authors have made an EPR study of the reaction of these phosphites with oxygen. Unstable intermediate paramagnetic reaction products were trapped in the presence of 2-methyl-nitrosopropane, ..cap alpha..-phenyl-N-tert-butylnitrone, and chloroaniline, compounds that served as spin traps. The hyperfine structure of the EPR spectra can be attributed to the interaction of an unpaired electron with nuclei of hydrogen, nitrogen, and phosphorus atoms.

  11. EFFECT OF CADMIUM(II) ON FREE RADICALS IN DOPA-MELANIN TESTED BY EPR SPECTROSCOPY.

    Science.gov (United States)

    Zdybel, Magdalena; Pilawa, Barbara; Chodurek, Ewa

    2015-01-01

    Electron paramagnetic resonance (EPR) spectroscopy may be applied to examine interactions of melanin with metal ions and drugs. In this work EPR method was used to examination of changes in free radical system of DOPA-melanin--the model eumelanin after complexing with diamagnetic cadmium(II) ions. Cadmium(II) may affect free radicals in melanin and drugs binding by this polymer, so the knowledge of modification of properties and free radical concentration in melanin is important to pharmacy. The effect of cadmium(II) in different concentrations on free radicals in DOPA-melanin was determined. EPR spectra of DOPA-melanin, and DOPA-melanin complexes with cadmium(II) were measured by an X-band (9.3 GHz) EPR spectrometer produced by Radiopan (Poznań, Poland) and the Rapid Scan Unit from Jagmar (Krak6w, Poland). The DOPA (3,4-dihydroxyphenylalanine) to metal ions molar ratios in the reaction mixtures were 2:1, 1:1, and 1: 2. High concentrations of o-semiquinone (g ~2.0040) free radicals (~10(21)-10(22) spin/g) characterize DOPA-melanin and its complexes with cadmium(II). Formation of melanin complexes with cadmium(II) increase free radical concentration in DOPA-melanin. The highest free radical concentration was obtained for DOPA-melanin-cadmium(II) (1:1) complexes. Broad EPR lines with linewidths: 0.37-0.73 mT, were measured. Linewidths increase after binding of cadmium(II) to melanin. Changes of integral intensities and linewidths with increasing microwave power indicate the homogeneous broadening of EPR lines, independently on the metal ion concentration. Slow spin-lattice relaxation processes existed in all the tested samples, their EPR lines saturated at low microwave powers. Cadmium(II) causes fastening of spin-lattice relaxation processes in DOPA-melanin. The EPR results bring to light the effect of cadmium(II) on free radicals in melanin, and probably as the consequence on drug binding to eumelanin.

  12. FTIR and EPR spectroscopic investigation of calcium-silicate glasses with iron and dysprosium

    Science.gov (United States)

    Eniu, D.; Gruian, C.; Vanea, E.; Patcas, L.; Simon, V.

    2015-03-01

    The sol-gel derived 50SiO2ṡ30CaOṡ10Fe2O3ṡ10Dy2O3 system was subjected to heat treatments at 500, 800 and 1200 °C in order to obtain crystalline phases of interest for biomedical applications. The structural changes were investigated by Fourier transform infrared spectroscopy (FTIR) and electron paramagnetic resonance (EPR). Both FTIR and EPR results support the development of wollastonite, hematite and magnetite crystalline phases desirable for samples bioactivity and heating possibility for hyperthermia treatment. Dysprosium addition was considered for subsequent radioactivation of the samples that could extend their application to thermoradiotherapy.

  13. Correlated four-component EPR g-tensors for doublet molecules

    DEFF Research Database (Denmark)

    Vad, M.S.; Pedersen, M.N.; Nørager, A.

    2013-01-01

    The first correlated ab initio four-component calculations of electron paramagnetic resonance (EPR) g-tensors for doublet radicals are reported. We have implemented a first-order degenerate perturbation theory approach based on the four-component Dirac-Coulomb Hamiltonian and fully relativistic...... configuration interaction wave functions in the DIRAC program package. We find that the correlation effects on the g-tensors can be sufficiently well described with manageable basis sets of triple-zeta quality and manageable configuration spaces. The new fully relativistic EPR module in DIRAC should be useful...

  14. Application of jade samples for high-dose dosimetry using the EPR technique

    Energy Technology Data Exchange (ETDEWEB)

    Teixeira, Maria Ines [Instituto de Pesquisas Energeticas e Nucleares/Comissao Nacional de Energia Nuclear Av. Prof. Lineu Prestes 2242, 05508-000, Sao Paulo (Brazil)], E-mail: miteixei@ipen.br; Melo, Adeilson P. [Instituto de Pesquisas Energeticas e Nucleares/Comissao Nacional de Energia Nuclear Av. Prof. Lineu Prestes 2242, 05508-000, Sao Paulo (Brazil); Centro Federal de Educacao Tecnologica de Sergipe, Aracaju (Brazil)], E-mail: adeilson_pessoa_melo@yahoo.com.br; Ferraz, Gilberto M. [Depto. de Fisica Nuclear, Instituto de Fisica, Universidade de Sao Paulo, Sao Paulo (Brazil)], E-mail: gmarconf@if.usp.br; Caldas, Linda V.E. [Instituto de Pesquisas Energeticas e Nucleares/Comissao Nacional de Energia Nuclear Av. Prof. Lineu Prestes 2242, 05508-000, Sao Paulo (Brazil)], E-mail: lcaldas@ipen.br

    2010-04-15

    The dosimeter characteristics of jade samples were studied for application in high-dose dosimetry. Jade is the common denomination of two silicates: jadeite and actinolite. The EPR spectra of different jade samples were obtained after irradiation with absorbed doses of 100 Gy up to 20 kGy. The jade samples present signals that increase with the absorbed dose (g-factors around 2.00); they can be attributed to electron centers. The EPR spectra obtained for the USA jade samples and their main dosimetric properties as reproducibility, calibration curves and energy dependence were investigated.

  15. EPR dosimetry of teeth in past and future accidents: a prospective look at a retrospective method

    Energy Technology Data Exchange (ETDEWEB)

    Haskell, E.H.; Kenner, G.H.; Hayes, R.B. [Utah Univ., Salt Lake City, UT (United States). Center for Applied Dosimetry; Chumak, V.; Shalom, S. [All-Union Scientific Centre of Radiation Medicine, Kiev (Ukraine)

    1996-01-01

    Electron paramagnetic resonance spectroscopy (EPR) of tooth enamel is a relatively new technique for retrospective dosimetry that in the past two years has seen increasing effort towards its development and evaluation. Efforts have centered on determining the accuracy which may be achieved with current measurement techniques as well as the minimum doses detectable. The study was focused on evaluating some factors which influence the accuracy of EPR dosimetry of enamel. Reported are studies on sample intercomparisions, instrumental considerations, and effects of dental x-rays, environmental sunlight and ultraviolet radiation.

  16. Electron paramagnetic resonance (EPR) in characterization of rocks and minerals

    Energy Technology Data Exchange (ETDEWEB)

    Valezi, D.F.; Mauro, E. di [Universidade Estadual de Londrina (UEL), PR (Brazil). Centro de Ciencias Exatas. Lab. de Fluorescencia e Ressonaancia Paramagnetica Eletronica (LAFLURPE); Zaia, D.A.M.; Carneiro, C.E.A. [Universidade Estadual de Londrina (UEL), PR (Brazil). Centro de Ciencias Exatas. Dept. de Quimica; Costa, A.C.S. da [Universidade Estadual de Maringa (UEM), PR (Brazil). Centro de Ciencias Agrarias. Dept. de Agronomia

    2011-07-01

    Full text. his work is based on the study of several stones and minerals from the Parana state, Brazil. They were analyzed by the Electron Paramagnetic Resonance (EPR) technique. The measurements were made on a spectrometer JEOL (JES-PE-3X), operating on X-band and at room temperature, with the exception of the mineral Goethite, which was measured with temperature variation. In all the samples were determined spectroscopic factors (or g factor) and line widths of paramagnetic species. A great number of the samples showed in their spectra, the presence of iron complexes. Phyllite and shale showed a resonance signal with approximately g = 2, and line width with about 1000 Gauss, which indicates the presence of the hematite mineral hematite in these rocks. Shale and coal samples showed the presence of free radical, it was identified as a very intense signal, centered at about g = 2.003. Phyllite sample showed in its spectra a resonance signal between the third and fourth line of the g marker (Mg O:Mn{sup 2+}) used in the measurements, and also a signal at g = 4.3, these characteristics may indicate the presence of Kaolinite in the sample. Limestone showed a signal with line width of about 600 Gauss, centered around g = 2, this signal is probably due to a mixture of ferrihydrite and some other compound, besides the presence of manganese, displaying a spectra with its six peculiar lines, due to hyperfine splitting. The two different types of limestone presented a overlap of two distinct spectra lines for the manganese, in the first limestone sample, rich in calcite, the existence of these different spectra is a result of the manganese substitution in a single site with different orientations of the calcite; the other limestone sample, this one abundant in dolomite, the existence of these different spectra is the result of the manganese substitution in different dolomite sites, taking the place of calcium and or of the magnesium. Now, we are focusing our research in the

  17. A secure and efficient password-based user authentication scheme using smart cards for the integrated EPR information system.

    Science.gov (United States)

    Lee, Tian-Fu; Chang, I-Pin; Lin, Tsung-Hung; Wang, Ching-Cheng

    2013-06-01

    The integrated EPR information system supports convenient and rapid e-medicine services. A secure and efficient authentication scheme for the integrated EPR information system provides safeguarding patients' electronic patient records (EPRs) and helps health care workers and medical personnel to rapidly making correct clinical decisions. Recently, Wu et al. proposed an efficient password-based user authentication scheme using smart cards for the integrated EPR information system, and claimed that the proposed scheme could resist various malicious attacks. However, their scheme is still vulnerable to lost smart card and stolen verifier attacks. This investigation discusses these weaknesses and proposes a secure and efficient authentication scheme for the integrated EPR information system as alternative. Compared with related approaches, the proposed scheme not only retains a lower computational cost and does not require verifier tables for storing users' secrets, but also solves the security problems in previous schemes and withstands possible attacks.

  18. MUC1 (VPM654 and EPR1023) Expression in Mucosa of Fallopian Tubes With Ectopic Pregnancy is Altered.

    Science.gov (United States)

    Brito, Ledamir R; Guedes Neto, Ernesto de P; Furich, Daniele G; Savaris, Ricardo F

    2016-09-01

    MUC1 is a surface glycoprotein that has an external and an internal domain. A recent report has shown that 1 segment of the external domain is reduced in ectopic pregnancy, suggesting that MUC1 may provide a protective mechanism against ectopic pregnancy. The objective of this study was to analyze the protein expression of 4 antibodies against MUC1 in fallopian tubes with or without ectopic pregnancy. Tissue sections of ectopic pregnancies (n=10) and normal tubes (n=16) derived from surgery were analyzed for the intensity of the staining with 3,3'-diaminobenzidine (DAB). Paraffin sections were submitted to immunohistochemical analysis using 4 different antibodies against different epitopes for MUC1: 214D4, EPR1023, HMFG1, and VPM654. Intensity of the immunostaining (DAB) was measured with ImageJ software. Statistical analysis was performed using Student unpaired t test, Mann-Whitney U test, and ANCOVA. The mean intensity of MUC1 [mean±SD, or median (interquartile)] in the mucosa of fallopian tubes with ectopic pregnancy was higher for EPR1023 (23.73±13.63 vs. 8.5±5.1, P=0.006), and reduced for VPM654 [13.7 (13-16.2) vs. 22.5 (19.5-29.7), P=0.005] compared with normal tubes. No difference was found for 214D4 and HMFG1. The immunoexpression of different epitopes (external and cytoplasmic) of MUC1 expression are altered in tubes with ectopic pregnancy compared with normal tubes, suggesting an association to explain its etiology.

  19. Polypropylene/ethylene-propylene rubber (PP/EPR blends for the automotive industry: Basic correlations between EPR-design and shrinkage

    Directory of Open Access Journals (Sweden)

    G. D. Potter

    2014-04-01

    Full Text Available The influence of the phase morphology on the shrinkage of injection molded plates from reactor based PP/EPR blends was investigated using a model series. The morphology of the dispersed phase – in terms of size and shape of the rubber particles as determined from scanning electron microscopy (SEM – was found to correlate fairly well with the shrinkage determined in the flow and transverse direction of injection molded plates. In this respect it turned out to be elementary to consider the anisotropy of the particles rather than their average size alone. Additionally, the effect of the EPR design on the coefficient of linear thermal expansion (CLTE was evaluated and brought into a relationship with the blend morphology.

  20. Characteristics and economy of the European reactor of pressurized water (EPR); Caracteristicas y economia del reactor europeo de agua a presion (EPR)

    Energy Technology Data Exchange (ETDEWEB)

    Ortiz V, J.; Ramirez S, J.R.; Palacios H, J.C. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)]. e-mail: jov@nuclear.inin.mx

    2005-07-01

    The high current costs of the fossil fuels, have propitiated that the industries of electric power generation in the world reconsider the nuclear option as medium of generation. In Europe, the more recently contracted nuclear power plant is that of Olkiluoto-III in Finland that waits it enters in operation at the end of 2009. The reactor that will be installed in this power plant will be a prototype of pressurized water reactor of the companies AREVA and EDF. In this work they are described the reactor EPR and the major components of the nuclear power plant as well as the main characteristics of safety and the flexibility of the operation of the EPR. The supposed costs reported in different sources of information are also described and calculated with information provided by the manufacturer company. (Author)

  1. Sistema de adquisición de datos para la medición de parámetros radioeléctricos en antenas lineales en la banda de TV de VHF y UHF System of acquisition of information for measurement of radioelectric parameters in linear antennas in the band of VHF and UHF’s television

    Directory of Open Access Journals (Sweden)

    María del Pilar Celemín

    2007-06-01

    Full Text Available Este proyecto desarrolla un sistema de adquisición y procesamiento de datos para la medición y ajuste de parámetros radioeléctricos de antenas lineales en las bandas de VHF y UHF. Como señal de prueba se utilizan algunas de las señales de televisión que se encuentran en el espectro radioeléctrico, provenientes de los transmisores que radian señales de canales nacionales. El receptor implementado incluye un sintonizador comercial de televisión que toma como muestra la señal portadora de video. Esta señal es amplificada, filtrada, almacenada y acondicionada, para ser leída por el puerto serial de un computador personal y procesada empleando un programa en Visual Basic, con una interfaz gráfica que permite una interacción amigable con el usuario. Desde acá se interactúa con un microcontrolador que controla el mecanismo de posicionamiento de la antena receptora por medio de una estructura electromecánica, que le permite ejecutar movimientos en dos grados de libertad: en azimut y en elevación. Con esto se logra un sistema capaz de determinar automáticamente el apuntamiento óptimo de la antena de acuerdo al máximo nivel de recepción de señal. Así mismo, se determinan parámetros propios de la antena tales como: el patrón de radiación (tanto en el plano horizontal como vertical, la ganancia directiva de la antena, la ganancia en cada uno de los puntos que conforman el plano principal, y otros parámetros de interés para el análisis de las características reales de antenas lineales.This project develops a data acquisition and processing system for measuring and adjusting lineal-antenna radioelectric parameters in VHF and UHF. Television signals are used as test signal. They can be found in radio electric spectrum, as they come from commercial transmitters that broadcast signals of national channels. The achieved receptor includes a television commercial tuner for obtaining video signal. Later, this signal is conditioning to

  2. Energy indicators for electricity production : comparing technologies and the nature of the indicators Energy Payback Ratio (EPR), Net Energy Ratio (NER) and Cumulative Energy Demand (CED). [Oestfoldforskning AS

    Energy Technology Data Exchange (ETDEWEB)

    Raadal, Hanne Lerche [Ostfold research, Fredrikstad (Norway); Modahl, Ingunn Saur [Ostfold research, Fredrikstad (Norway); Bakken, Tor Haakon [SINTEF Energy, Trondheim (Norway)

    2012-11-01

    CEDREN (Centre for Environmental Design of Renewable Energy) is founded by The Research Council of Norway and energy companies and is one of eight centres that were part of the scheme Centre for Environment-friendly Energy Research (FME) when the scheme was launched in 2009. The main objective of CEDREN is to develop and communicate design solutions for transforming renewable energy sources to the desired energy products, and at the same time address the environmental and societal challenges at local, regional, national and global levels. CEDREN's board initiated in 2011 a pilot project on the topics 'Energy Pay-back Ratio (EPR)', 'Ecosystem services' and 'multi-criteria analysis (MCA)' in order to investigate the possible use of these concepts/indices in the management of regulated river basins and as tools to benchmark strategies for the development of energy projects/resources. The energy indicator part (documented in this report) has aimed at reviewing the applicability of different energy efficiency indicators, as such, in the strategic management and development of energy resources, and to compare and benchmark technologies for production of electricity. The main findings from this pilot study is also reported in a policy memo (in Norwegian), that is available at www.cedren.no. The work carried out in this project will be continued in the succeeding research project EcoManage, which was granted by the Research Council of Norway's RENERGI programme in December 2011. Energy indicators: Several energy indicators for extraction and delivery of an energy product (e.g. transport fuel, heat, electricity etc.) exist today. The main objective of such indicators is to give information about the energy efficiency of the needed extraction and transforming processes throughout the value chain related to the delivered energy product. In this project the indicators Energy Payback Ratio (EPR), Net Energy Ration (NER) and Cumulative

  3. Comparison of wind measurements in the troposphere and mesosphere by VHF/MF radars and in-situ techniques

    Directory of Open Access Journals (Sweden)

    N. Engler

    2008-11-01

    Full Text Available Radar wind observations at frequencies between 1.98 and 53.5 MHz obtained at polar latitudes were compared to in-situ wind measurements by radiosondes at tropospheric altitudes and to winds from falling spheres at mesospheric altitudes. Comparisons are shown for several campaigns of radiosonde and falling sphere observations. The radar wind directions agree well to the radiosonde and falling sphere observations and are highly correlated. The winds estimated from radar measurements are less than the radiosonde data by about 15% for spaced antenna observations and by about 10% for the Doppler beam swinging experiment. At mesospheric altitudes the spaced antenna winds obtained from the wide-beam Andenes MF radar are underestimated in the order of 35% and winds from the narrow-beam Saura MF radar are underestimated by about 20% compared to falling sphere winds at altitudes between 70 and 80 km. Furthermore, the relation between wind measurements using narrow-beam and wide-beam antenna arrangements for the MF radars is discussed and VHF radar observations are compared to the wide-beam MF radar.

  4. Comparison of wind measurements in the troposphere and mesosphere by VHF/MF radars and in-situ techniques

    Science.gov (United States)

    Engler, N.; Singer, W.; Latteck, R.; Strelnikov, B.

    2008-11-01

    Radar wind observations at frequencies between 1.98 and 53.5 MHz obtained at polar latitudes were compared to in-situ wind measurements by radiosondes at tropospheric altitudes and to winds from falling spheres at mesospheric altitudes. Comparisons are shown for several campaigns of radiosonde and falling sphere observations. The radar wind directions agree well to the radiosonde and falling sphere observations and are highly correlated. The winds estimated from radar measurements are less than the radiosonde data by about 15% for spaced antenna observations and by about 10% for the Doppler beam swinging experiment. At mesospheric altitudes the spaced antenna winds obtained from the wide-beam Andenes MF radar are underestimated in the order of 35% and winds from the narrow-beam Saura MF radar are underestimated by about 20% compared to falling sphere winds at altitudes between 70 and 80 km. Furthermore, the relation between wind measurements using narrow-beam and wide-beam antenna arrangements for the MF radars is discussed and VHF radar observations are compared to the wide-beam MF radar.

  5. Observation of polar mesosphere summer echoes with calibrated VHF radars at 69° in the Northern and Southern hemispheres

    Science.gov (United States)

    Latteck, R.; Singer, W.; Morris, R. J.; Holdsworth, D. A.; Murphy, D. J.

    2007-07-01

    Polar Mesosphere Summer Echoes (PMSE) observed in the northern and southern hemisphere were studied using continuous measurements obtained by calibrated VHF radars located at Andenes (69.3°N) and Davis (68.6°S) during the boreal summer 2004 and the austral summer 2004/2005. The PMSE observed at Davis have a lower peak volume reflectivity of approximately 4 . 10-11 m-1 compared with their counterparts (7 . 10-10 m-1) observed at Andenes. The duration of the PMSE season is correlated with the dynamical and thermal state of the mesopause region supported by recent studies using meridional winds and temperatures. PMSE occurred less frequently but with greater variability above Davis. The diurnal variation of PMSE occurrence has a maximum around 11-16 LT in both hemispheres, and a minimum occurs during late evening with a longer duration in the southern hemisphere. The mean PMSE season at both sites started around 34 days before solstice, but the duration of the Davis PMSE season is about 9 days shorter than at Andenes. The maximum occurrence height of PMSE at Davis is 86 km which is about 1 km higher than at Andenes.

  6. Comparison of wind measurements in the troposphere and mesosphere by VHF/MF radars and in-situ techniques

    Energy Technology Data Exchange (ETDEWEB)

    Engler, N.; Singer, W.; Latteck, R.; Strelnikov, B. [Rostock Univ., Kuehlungsborn (Germany). Leibniz Inst. of Atmospheric Physics

    2008-07-01

    Radar wind observations at frequencies between 1.98 and 53.5 MHz obtained at polar latitudes were compared to in-situ wind measurements by radiosondes at tropospheric altitudes and to winds from falling spheres at mesospheric altitudes. Comparisons are shown for several campaigns of radiosonde and falling sphere observations. The radar wind directions agree well to the radiosonde and falling sphere observations and are highly correlated. The winds estimated from radar measurements are less than the radiosonde data by about 15% for spaced antenna observations and by about 10% for the Doppler beam swinging experiment. At mesospheric altitudes the spaced antenna winds obtained from the wide-beam Andenes MF radar are underestimated in the order of 35% and winds from the narrow-beam Saura MF radar are underestimated by about 20% compared to falling sphere winds at altitudes between 70 and 80 km. Furthermore, the relation between wind measurements using narrow-beam and wide-beam antenna arrangements for the MF radars is discussed and VHF radar observations are compared to the wide-beam MF radar. (orig.)

  7. Calculating the azimuth of mountain waves, using the effect of tilted fine-scale stable layers on VHF radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    1999-02-01

    Full Text Available A simple method is described, based on standard VHF wind-profiler data, where imbalances of echo power between four off-vertical radar beams, caused by mountain waves, can be used to calculate the orientation of the wave pattern. It is shown that the mountain wave azimuth (direction of the horizontal component of the wavevector, is given by the vector [ W (PE - P W ,W (PN - P S ]; PN, PS, PE, PW are radar echo powers, measured in dB, in beams pointed away from vertical by the same angle towards north, south, east and west respectively, and W is the vertical wind velocity. The method is applied to Aberystwyth MST radar data, and the calculated wave vector usually, but not always, points into the low-level wind direction. The mean vertical wind at Aberystwyth, which may also be affected by tilted aspect-sensitive layers, is investigated briefly using the entire radar output 1990-1997. The mean vertical-wind profile is inconsistent with existing theories, but a new mountain-wave interpretation is proposed.Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; waves and tides; instruments and techniques.

  8. Effect of power on growth of nanocrystalline silicon films deposited by VHF PECVD technique for solar cell applications

    Science.gov (United States)

    Juneja, Sucheta; Verma, Payal; Savelyev, Dmitry A.; Khonina, Svetlana N.; Sudhakar, S.; Kumar, Sushil

    2016-04-01

    An investigation of the effect of power on the deposition of nanocrystalline silicon thin films were carried out using a gaseous mixture of silane and hydrogen in the 60MHz assisted VHF plasma enhanced chemical vapor deposition (PECVD) technique. The power was varied from 10 to 50 watt maintaining all other parameters constant. Corresponding layer properties w.r.t. material microstructure, optical, hydrogen content and electrical transport are studied in detail. The structural properties have been studied by Raman spectroscopy and x-ray diffraction (XRD). The presence of nano-sized crystals and their morphology have been investigated using atomic force microscopy (AFM). The role of bonded hydrogen content in the films have been studied from the results of Fourier transform infrared spectroscopy. It was observed from the results that with increase in power, crystalline volume fraction increases and crystallite size changes from 4 to 9 nm. The optical band gap varies from 1.7 to 2.1eV due to quantum confinement effect and which further can be explained with reduced hydrogen content. These striking features of nc-Si films can be used to fabricate stable thin film solar cells.

  9. Case study of stratospheric gravity waves of convective origin over Arctic Scandinavia. VHF radar observations and numerical modelling

    Energy Technology Data Exchange (ETDEWEB)

    Rechou, A. [La Reunion Univ., St. Denis Messag, Ile de La Reunion (France). Lab. de l' Atmosphere et des Cyclones; Arnault, J.; Dalin, P.; Kirkwood, S. [Swedish Institute of Space Physics, Kiruna (Sweden)

    2013-03-01

    Orography is a well-known source of gravity and inertia-gravity waves in the atmosphere. Other sources, such as convection, are also known to be potentially important but the large amplitude of orographic waves over Scandinavia has generally precluded the possibility to study such other sources experimentally in this region. In order to better understand the origin of stratospheric gravity waves observed by the VHF radar ESRAD (Esrange MST radar) over Kiruna, in Arctic Sweden (67.88 N, 21.10 E), observations have been compared to simulations made using the Weather Research and Forecasting model (WRF) with and without the effects of orography and clouds. This case study concerns gravity waves observed from 00:00 UTC on 18 February to 12:00 UTC on 20 February 2007. We focus on the wave signatures in the static stability field and vertical wind deduced from the simulations and from the observations as these are the parameters which are provided by the observations with the best height coverage. As is common at this site, orographic gravity waves were produced over the Scandinavian mountains and observed by the radar. However, at the same time, southward propagation of fronts in the Barents Sea created short-period waves which propagated into the stratosphere and were transported, embedded in the cyclonic winds, over the radar site. (orig.)

  10. Development of a Coherent Bistatic Vegetation Model for Signal of Opportunity Applications at VHF UHF-Bands

    Science.gov (United States)

    Kurum, Mehmet; Deshpande, Manohar; Joseph, Alicia T.; O'Neill, Peggy E.; Lang, Roger H.; Eroglu, Orhan

    2017-01-01

    A coherent bistatic vegetation scattering model, based on a Monte Carlo simulation, is being developed to simulate polarimetric bi-static reflectometry at VHF/UHF-bands (240-270 MHz). The model is aimed to assess the value of geostationary satellite signals of opportunity to enable estimation of the Earth's biomass and root-zone soil moisture. An expression for bistatic scattering from a vegetation canopy is derived for the practical case of a ground-based/low altitude platforms with passive receivers overlooking vegetation. Using analytical wave theory in conjunction with distorted Born approximation (DBA), the transmit and receive antennas effects (i.e., polarization, orientation, height, etc.) are explicitly accounted for. Both the coherency nature of the model (joint phase and amplitude information) and the explicit account of system parameters (antenna, altitude, polarization, etc) enable one to perform various beamforming techniques to evaluate realistic deployment configurations. In this paper, several test scenarios will be presented and the results will be evaluated for feasibility for future biomass and root-zone soil moisture application using geostationary communication satellite signals of opportunity at low frequencies.

  11. Characterisation of the rare cadmium chromate pigment in a 19th century tube colour by Raman, FTIR, X-ray and EPR

    DEFF Research Database (Denmark)

    Christiansen, Marie Bitsch; Sørensen, Mikkel Agerbæk; Sanyova, Jana

    2017-01-01

    In an investigation of the artists' materials used by P. S. Krøyer the contents of the tube colours found in Krøyer's painting cabinet were examined. In most cases, the results of the pigment analyses were as expected based on our knowledge of artists' colours used in the late 1800s and early 1900s....... The yellow colour of the paint sample taken from the tube had a greenish hue, which became even more prominent upon storage and drying. EPR analysis of the sample showed the presence of paramagnetic degradation products containing Cr(III) and Cr(V)....

  12. Study of Thermal Properties of Mixed (PP/EPR/ABS with Five Model Compatibilizers

    Directory of Open Access Journals (Sweden)

    Pierre Marcel Anicet Noah

    2016-01-01

    Full Text Available The influences of incorporating compatibilizers E-EA-MAH, E-MA-GMA, E-AM, SEBS KRATON G, or PP-g-MAH on the thermal properties of mixed (polypropylene/ethylene propylene rubber/acrylonitrile butadiene styrene (PP/EPR/ABS have been investigated. DSC investigations have revealed that the incorporation of 5% of ABS in the copolymer (PP/EPR does not fundamentally affect the thermal properties of the basic copolymer; additionally, the addition of 1.5% of each of the compatibilizers in the basic mixture does not significantly alter the crystallization temperature values and the melting of the -P- sequences. There is a variation of melting enthalpy values of the -P- sequences of 18.23% using SEBS KRATON G and of 10.38% using E-AM-GMA. When the rate of each of the compatibilizers increases to 5%, overall crystallization enthalpies of -P- sequences are almost kept unchanged, except for the case of using the compatibilizer E-AM-GMA with a variation of 8.42%. There is a minor variation of the melting enthalpy of -P- sequences with higher levels of compatibilizer. The incorporation of 5% ABS copolymer in the PP/EPR does not significantly alter the thermal properties of the basic structure of (PP/EPR/ABS.

  13. VO2+ ions in zinc lead borate glasses studied by EPR and optical absorption techniques.

    Science.gov (United States)

    Prakash, P Giri; Rao, J Lakshmana

    2005-09-01

    Electron paramagnetic resonance (EPR) and optical absorption spectra of vanadyl ions in zinc lead borate (ZnO-PbO-B2O3) glass system have been studied. EPR spectra of all the glass samples exhibit resonance signals characteristic of VO2+ ions. The values of spin-Hamiltonian parameters indicate that the VO2+ ions in zinc lead borate glasses were present in octahedral sites with tetragonal compression and belong to C4V symmetry. The spin-Hamiltonian parameters g and A are found to be independent of V2O5 content and temperature but changing with ZnO content. The decrease in Deltag( parallel)/Deltag( perpendicular) value with increase in ZnO content indicates that the symmetry around VO2+ ions is more octahedral. The decrease in intensity of EPR signal above 10 mol% of V2O5 is attributed to a fall in the ratio of the number of V4+ ions (N4) to the number of V5+ ions (N5). The number of spins (N) participating in resonance was calculated as a function of temperature for VO2+ doped zinc lead borate glass sample and the activation energy was calculated. From the EPR data, the paramagnetic susceptibility was calculated at various temperatures and the Curie constant was evaluated from the 1/chi-T graph. The optical absorption spectra show single absorption band due to VO2+ ions in tetragonally distorted octahedral sites.

  14. In Vivo EPR Resolution Enhancement Using Techniques Known from Quantum Computing Spin Technology.

    Science.gov (United States)

    Rahimi, Robabeh; Halpern, Howard J; Takui, Takeji

    2017-01-01

    A crucial issue with in vivo biological/medical EPR is its low signal-to-noise ratio, giving rise to the low spectroscopic resolution. We propose quantum hyperpolarization techniques based on 'Heat Bath Algorithmic Cooling', allowing possible approaches for improving the resolution in magnetic resonance spectroscopy and imaging.

  15. High-frequency EPR and ENDOR spectroscopy on semiconductor quantum dots

    NARCIS (Netherlands)

    Baranov, P.G.; Orlinskii, S.B.; de Mello Donega, C.|info:eu-repo/dai/nl/125593899; Schmidt, J.

    2010-01-01

    It is shown that high-frequency electron paramagnetic resonance (EPR) and electron-nuclear double resonance (ENDOR) spectroscopy are excellent tools for the investigation of the electronic properties of semiconductor quantum dots (QDs). The great attractions of these techniques are that, in contrast

  16. EPR policies for electronics in developing Asia: an adapted phase-in approach.

    Science.gov (United States)

    Akenji, Lewis; Hotta, Yasuhiko; Bengtsson, Magnus; Hayashi, Shiko

    2011-09-01

    The amount of e-waste is growing rapidly in developing countries, and the health and environmental problems resulting from poor management of this waste have become a concern for policy makers. In response to these challenges, a number of Asian developing countries have been inspired by policy developments in OECD countries, and have drafted legislations based on the principle of extended producer responsibility (EPR). However, the experiences from developed countries show that a successful implementation of EPR policies requires adequate institutions and sufficient administrative capacity. Even advanced countries are thus facing difficulties. This paper concludes from existing literature and from the authors' own observations that there seems to be a mismatch between the typical policy responses to e-waste problems in developing Asia and the capacity for successful implementation of such policies. It also notes that the e-waste situation in developing Asian countries is further complicated by a number of additional factors, such as difficulties in identifying producers, import of used electronic products and e-waste (sometimes illegal), and the existence of a strong informal waste sector. Given these challenges, the authors conclude that comprehensive EPR policy schemes of the kind that have been implemented in some advanced countries are not likely to be effective. The paper therefore proposes an alternative phase-in approach whereby developing Asian countries are able to move gradually towards EPR systems. It argues that this approach would be more feasible, and discusses what could be the key building blocks of each implementation stage.

  17. EPR and photoluminescence study of irradiated anion-defective alumina single crystals

    Science.gov (United States)

    Kortov, V. S.; Ananchenko, D. V.; Konev, S. F.; Pustovarov, V. A.

    2017-09-01

    Electron paramagnetic resonance (EPR) and photoluminescence (PL) spectra of anion-defective alumina single crystals were measured. Exposure to a dose 10 Gy-1 kGy causes isotropic EPR signal of a complex form, this signal contains narrow and broad components. At the same time, in the PL spectrum alongside with a band of F+-centers (3.8 eV) an additional emission band with the maximum of 2.25 eV is registered. This band corresponds to aggregate F22+-centers which were create under irradiation. By comparing measurements in EPR and PL spectra with further stepped annealing in the temperature range of 773-1473 K of the samples exposed to the same doses, we were able to conclude that a narrow component of isotropic EPR signal is associated with the formation of paramagnetic F22+-centers under irradiation. A wide component can be caused by deep hole traps which are created by a complex defect (VAl2- - F+) with a localized hole.

  18. CO{sub 2} doped γ-irradiated hydroxyapatite for EPR dosimetry

    Energy Technology Data Exchange (ETDEWEB)

    Ziaie, Farhood [Nuclear Science and Technology Resesarch Institute, Tehran (Iran, Islamic Republic of). Radiation Application Research School

    2014-11-15

    Synthetic nano-structure hydroxyapatite samples were doped by carbon in furnace via exposing to CO{sub 2} circulating gas in different time of 30, 120, and 360 min under 100 C and 400 C of temperatures. FTIR, TEM and XRD analyses results confirmed the doping of carbonate group to the hydroxyapatite structure. The samples were irradiated in absorbed doses of 2, 5, 10, 20, 50, and 80 kGy using a {sup 60}Co γ-ray source and subjected to EPR measurement, subsequently. The EPR signal intensities were constructed as a function of radiation dose, were compared with the results of raw sample and were studied from dosimetric point of view. The obtained results show a considerable increment in EPR signal intensities of the samples which were treated at 400 C. At the doses less than 20 kGy the carbon doped samples show a better EPR respond. This is much better for doses below 5 kGy in comparison to the raw samples and the response is quite linear.

  19. Irradiated bivalve mollusks: Use of EPR spectroscopy for identification and dosimetry

    Energy Technology Data Exchange (ETDEWEB)

    Alberti, Angelo, E-mail: aalberti@isof.cnr.it [CNR-ISOF, Area della Ricerca di Bologna, Via P. Gobetti 101, Bologna I-40129 (Italy); Chiaravalle, Eugenio [Istituto Zooprofilattico Sperimentale della Puglia e Basilicata, Via Manfredonia 20, Foggia I-71100 (Italy); Fuochi, Piergiorgio; Macciantelli, Dante [CNR-ISOF, Area della Ricerca di Bologna, Via P. Gobetti 101, Bologna I-40129 (Italy); Mangiacotti, Michele, E-mail: michelemangiacotti@libero.it [Istituto Zooprofilattico Sperimentale della Puglia e Basilicata, Via Manfredonia 20, Foggia I-71100 (Italy); Marchesani, Giuliana [Istituto Zooprofilattico Sperimentale della Puglia e Basilicata, Via Manfredonia 20, Foggia I-71100 (Italy); Plescia, Elena [CNR-ISOF, Area della Ricerca di Bologna, Via P. Gobetti 101, Bologna I-40129 (Italy)

    2011-12-15

    High energy radiation treatment of foodstuff for microbial control and shelf-life extension is being used in many countries. However, for consumer protection and information, the European Union has adopted the Directives 1999/2/EC and 1999/3/EC to harmonize the rules concerning the treatment and trade of irradiated foods in EU countries. Among the validated methods to detect irradiated foods the EU directives also include Electron Paramagnetic Resonance (EPR/ESR) spectroscopy. We describe herein the use of EPR for identification of four species of bivalve mollusks, i.e. brown Venus shells (Callista chione), clams (Tapes semidecussatus), mussels (Mytilus galloprovincialis) and oysters (Ostrea edulis) irradiated with {sup 60}Co {gamma}-rays. EPR could definitely identify irradiated seashells due to the presence of long-lived free radicals, primarily CO{sub 2}{sup -}, CO{sub 3}{sup 3-}, SO{sub 2}{sup -} and SO{sub 3}{sup -} radical anions. The presence of other organic free radicals, believed to originate from conchiolin, a scleroprotein present in the shells, was also ascertained. The use of one of these radicals as a marker for irradiation of brown Venus shells and clams can be envisaged. We also propose a dosimetric protocol for the reconstruction of the administered dose in irradiated oysters. - Highlights: > EPR spectroscopy is confirmed a valuable identification tool for irradiated mollusks. > A conchiolin-derived radical can be used as irradiation marker for some mollusks. > A reliable protocol is outlined for dose reconstruction of irradiated oysters.

  20. Model compounds of humic acid and oxovanadium cations. Potentiometric titration and EPR spectroscopy studies

    Directory of Open Access Journals (Sweden)

    Mercê Ana Lucia Ramalho

    1999-01-01

    Full Text Available The stability constants and the isotropic EPR parameters Ao (hyperfine splitting constant and g o (g value were obtained by potentiometric titrations and EPR spectroscopy, respectively, of 85%v/v aqueous solutions of model compounds of humic acids - salicylic acid (SALA - and both nitrohumic acids, a laboratory artifact - nitrosalicylic acids, 3-nitrosalicylic acid (3-NSA, 5-nitrosalicylic acid (5-NSA and 3,5-dinitrosalicylic acid (3,5-DNSA and oxovanadium cations. It was possible to record EPR spectra of those model compounds and the ion VO2+ (V(IV, and the stability constants were obtained from a solution of VO3+ (V(V, the values for the logarithms of the stability constants ranging from 12.77 ± 0.04 to 7.06 ± 0.05 for the species ML, and from 9.90 ±0.04 to 4.06 ± 0.05 for the species ML2 according to the decrease in the acidity of the carboxylic and the hydroxyl groups in the aromatic ring of the model compounds studied as the -NO2 substituents were added. Species distribution diagrams were also obtained for the equilibria studied. The EPR parameters showed that as the logarithm of the overall stability constants increase, g o values also increase, while Ao values show a tendency to decrease.

  1. On the use of locally dense basis sets in the calculation of EPR hyperfine couplings

    DEFF Research Database (Denmark)

    Milhøj, Birgitte Olai; Hedegård, Erik D.; Sauer, Stephan P. A.

    2013-01-01

    The usage of locally dense basis sets in the calculation of Electron Paramagnetic Resonance (EPR) hyperne coupling constants is investigated at the level of Density Functional Theory (DFT) for two model systems of biologically important transition metal complexes: One for the active site in the c...

  2. On the use of Locally Dense Basis Sets in the Calculation of EPR Hyperfine Couplings

    DEFF Research Database (Denmark)

    Hedegård, Erik D.; Sauer, Stephan P. A.; Milhøj, Birgitte O.

    2013-01-01

    The usage of locally dense basis sets in the calculation of Electron Paramagnetic Resonance (EPR) hyperne coupling constants is investigated at the level of Density Functional Theory (DFT) for two model systems of biologically important transition metal complexes: One for the active site in the c...

  3. Measuring precarious employment in times of crisis: the revised Employment Precariousness Scale (EPRES in Spain

    Directory of Open Access Journals (Sweden)

    Alejandra Vives

    2015-09-01

    Conclusion: The revised version of the EPRES demonstrated good metric properties and improved sensitivity to worker vulnerability and employment instability among permanent workers. Furthermore, it was sensitive to increased levels of precariousness in some dimensions despite decreases in others, demonstrating responsiveness to the context of the economic crisis affecting the Spanish labour market.

  4. Single crystal EPR studies of Mn (II) doped into zinc ammonium ...

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 62; Issue 1. Single crystal EPR studies of Mn(II) doped into zinc ammonium phosphate hexahydrate (ZnNH4PO4⋅6H2O): A case of interstitial site for bio-mineral analogue. H Anandalakshmi K Velavan I Sougandi Venkatesan P Sambasiva Rao. Research Articles ...

  5. Pulsed EPR Spin-probe study of intracellular glasses in seed and pollen

    NARCIS (Netherlands)

    Buitink, J.; Dzuba, S.A.; Hoekstra, F.A.; Tsvetkov, Y.D.

    2000-01-01

    EPR spectra of 3-carboxy-proxyl (CP) in dry biological tissues exhibited a temperature-dependent change in the principal value A′zz of the hyperfine interaction tensor. The A′zz value changed sharply at a particular temperature that was dependent on water content. At elevated water contents, the

  6. Simple group password-based authenticated key agreements for the integrated EPR information system.

    Science.gov (United States)

    Lee, Tian-Fu; Chang, I-Pin; Wang, Ching-Cheng

    2013-04-01

    The security and privacy are important issues for electronic patient records (EPRs). The goal of EPRs is sharing the patients' medical histories such as the diagnosis records, reports and diagnosis image files among hospitals by the Internet. So the security issue for the integrated EPR information system is essential. That is, to ensure the information during transmission through by the Internet is secure and private. The group password-based authenticated key agreement (GPAKE) allows a group of users like doctors, nurses and patients to establish a common session key by using password authentication. Then the group of users can securely communicate by using this session key. Many approaches about GAPKE employ the public key infrastructure (PKI) in order to have higher security. However, it not only increases users' overheads and requires keeping an extra equipment for storing long-term secret keys, but also requires maintaining the public key system. This investigation presents a simple group password-based authenticated key agreement (SGPAKE) protocol for the integrated EPR information system. The proposed SGPAKE protocol does not require using the server or users' public keys. Each user only remembers his weak password shared with a trusted server, and then can obtain a common session key. Then all users can securely communicate by using this session key. The proposed SGPAKE protocol not only provides users with convince, but also has higher security.

  7. How can EPR spectroscopy help to unravel molecular mechanisms of flavin-dependent photoreceptors?

    Directory of Open Access Journals (Sweden)

    Daniel eNohr

    2015-09-01

    Full Text Available Electron paramagnetic resonance (EPR spectroscopy is a well-established spectroscopic method for the examination of paramagnetic molecules. Proteins can contain paramagnetic moieties in form of stable cofactors, transiently formed intermediates, or spin labels artificially introduced to cysteine sites. The focus of this review is to evaluate potential scopes of application of EPR to the emerging field of optogenetics. The main objective for EPR spectroscopy in this context is to unravel the complex mechanisms of light-active proteins, from their primary photoreaction to downstream signal transduction. An overview of recent results from the family of flavin-containing, blue-light dependent photoreceptors is given. In detail, mechanistic similarities and differences are condensed from the three classes of flavoproteins, the cryptochromes, LOV (Light-oxygen-voltage, and BLUF (blue-light using FAD domains. Additionally, a concept that includes spin-labeled proteins and examination using modern pulsed EPR is introduced, which allows for a precise mapping of light-induced conformational changes.

  8. single crystal EPR studies of Mn(II) doped into zinc ammonium ...

    Indian Academy of Sciences (India)

    -sulphato-aquotris(imidazole) cadmium(II), the paramagnetic ion enters substi- tutionally into the host lattice giving rise to two magnetically inequivalent sites. [9]. single crystal EPR study of Mn(II)-doped magnesium bis(hydrogen maleate) hexahydrate confirms that the impurity ion not only occupies the magnesium site.

  9. Detection and characterisation of radicals using electron paramagnetic resonance (EPR) spin trapping and related methods

    DEFF Research Database (Denmark)

    Davies, Michael Jonathan

    2016-01-01

    Electron paramagnetic resonance (EPR) spectroscopy (also known as electron spin resonance, ESR, or electron magnetic resonance, EMR, spectroscopy) is often described as the “gold standard” for the detection and characterisation of radicals in chemical, biological and medical systems. The article...

  10. The analogy in the formation of hardness salts and gallstones according to the EPR study

    Science.gov (United States)

    Pichugina, Alina; Tsyro, Larisa; Unger, Felix

    2017-11-01

    The article shows that the hardness salts contain the same crystalline phases as the bile stone pigment. The identity of EPR spectra of hardness salts and pigment of gallstones containing calcium carbonate was established. An analogy between the processes of formation of hardness salts and gallstones is played, in which particles with open spin-orbitals (fermions) play a decisive role.

  11. A 5 tesla superconducting magnet and cryostats for an EPR/FMR spectrometer

    NARCIS (Netherlands)

    Reuvekamp, E.M.C.M.; Gerritsma, G.J.; ten Kate, Herman H.J.; van de Klundert, L.J.M.

    1988-01-01

    A description is given of the cryogenic part of an electron paramagnetic resonance (EPR)/ferromagnetic resonance (FMR) spectrometer using Ka-band (26.5-40 GHz) and U-band (40-60 GHz) frequencies for resonance measurements on large magnetic thin-films. The unit has two cryostats; the first has a

  12. Single crystal EPR study of VO (II)-doped cadmium potassium ...

    Indian Academy of Sciences (India)

    Single crystal EPR studies of VO(II)-doped cadmium potassium phosphate hexahydrate (CPPH) have been carried out at room temperature. The angular variation spectra in the three orthogonal planes indicate that the paramagnetic impurity has entered the lattice only substitutionally in place of Cd(II). Spin Hamiltonian ...

  13. High-spin chloro mononuclear MnIII complexes: a multifrequency high-field EPR study.

    Science.gov (United States)

    Mantel, Claire; Chen, Hongyu; Crabtree, Robert H; Brudvig, Gary W; Pécaut, Jacques; Collomb, Marie-Noëlle; Duboc, Carole

    2005-03-01

    The isolation, structural characterization, and electronic properties of two six-coordinated chloromanganese (III) complexes, [Mn(terpy)(Cl)3] (1) and [Mn(Phterpy)(Cl)3] (2), are reported (terpy = 2,2':6'2"-terpyridine, Phterpy = 4'-phenyl-2,2':6',2"-terpyridine). These complexes complement a series of mononuclear azide and fluoride Mn(lll) complexes synthesized with neutral N-tridentate ligands, [Mn(L)(X)3] (X = F- or N3 and L = terpy or bpea [N,N-bis(2-pyridylmethyl)-ethylamine)], previously described. Similar to these previous complexes, 1 and 2 exhibit a Jahn-Teller distortion of the octahedron, characteristic of a high-spin Mn(III) complex (S = 2). The analysis of the crystallographic data shows that, in both cases, the manganese ion lies in the center of a distorted octahedron characterized by an elongation along the tetragonal axis. Their electronic properties were investigated by multifrequency EPR (190-475 GHz) performed in the solid state at different temperatures (5-15 K). This study confirms our previous results and further shows that: i) the sign of D is correlated with the nature of the tetragonal distortion; ii) the magnitude of D is not sensitive to the nature of the anions in our series of rhombic complexes, contrary to the porphyrinic systems; iii) the [E/D] values (0.124 for 1 and 0.085 for 2) are smaller compared to those found for the [Mn(L)(X)3] complexes (in the range of 0.146 to 0.234); and iv) the E term increases when the ligand-field strength of the equatorial ligands decreases.

  14. Validation of dose painting of lung tumours using alanine/EPR dosimetry.

    Science.gov (United States)

    Knudtsen, Ingerid Skjei; Svestad, Jørund Graadal; Skaug Sande, Erlend Peter; Rekstad, Bernt Louni; Rødal, Jan; van Elmpt, Wouter; Öllers, Michel; Hole, Eli Olaug; Malinen, Eirik

    2016-03-21

    Biologic image guided radiotherapy (RT) with escalated doses to tumour sub volumes challenges today's RT dose planning and delivery systems. In this phantom study, we verify the capability of a clinical dose planning and delivery system to deliver an 18F-FDG-PET based dose painted treatment plan to a lung tumour. Furthermore, we estimate the uncertainties of the dose painted treatment compared to conventional RT plans. An anthropomorphic thorax phantom of polystyrene and polyurethane was constructed based on CT images of a lung cancer patient. 101 EPR/alanine dosimeters were placed in separate cavities within the phantom. IMRT and VMAT plans were generated in Eclipse (version 10.0, Analytical Anisotropic Algorithm version 10.2.28, Varian Medical Systems, Inc.) for 6 and 15 MV photons, based on 18F-FDG-PET/CT images of the patient. A boost dose of 3.8 Gy/fraction was given to the 18F-FDG-avid region (biological planning volume; BTV), whereas 3.1 Gy/fraction was planned to the planning target volume (PTV, excluding the BTV). For the homogenous plans, 3.2 Gy/fraction was given to the PTV. Irradiation of the phantom was carried out at a Varian Trilogy linear accelerator (Varian Medical Systems, Inc.). Uncertainties involved in treatment planning and delivery were estimated from portal dosimetry gamma evaluation. Measured and calculated doses were compared by Bland-Altmann analysis. For all treatment plans, all dose-volume objectives could be achieved in the treatment planning system. The mean absolute differences between calculated and measured doses were small (planned doses was less than 3% for all plans, whereas the estimated uncertainty in the measured doses was less 2.3%. Our results show that planning and delivery of dose escalated lung cancer treatment on a clinical dose planning and delivery system has high dosimetric accuracy. The uncertainties associated with the dose escalated treatment plans are comparable to the conventional plans.

  15. Ir-192 HDR transit dose and radial dose function determination using alanine/EPR dosimetry

    Energy Technology Data Exchange (ETDEWEB)

    Calcina, Carmen S Guzman [Departamento de FIsica e Matematica, FFCLRP, Universidade de Sao Paulo, Av Bandeirantes 3900, 14040-901, Ribeirao Preto, SP (Brazil); Almeida, Adelaide de [Departamento de FIsica e Matematica, FFCLRP, Universidade de Sao Paulo, Av Bandeirantes 3900, 14040-901, Ribeirao Preto, SP (Brazil); Rocha, Jose R Oliveira [Setor de FIsica Medica-CEB-UNICAMP e Setor de Radioterapia-CAISM-UNICAMP (Brazil); Abrego, Felipe Chen [Departamento de FIsica e Matematica, FFCLRP, Universidade de Sao Paulo, Av Bandeirantes 3900, 14040-901, Ribeirao Preto, SP (Brazil); Baffa, Oswaldo [Departamento de FIsica e Matematica, FFCLRP, Universidade de Sao Paulo, Av Bandeirantes 3900, 14040-901, Ribeirao Preto, SP (Brazil)

    2005-03-21

    Source positioning close to the tumour in high dose rate (HDR) brachytherapy is not instantaneous. An increment of dose will be delivered during the movement of the source in the trajectory to its static position. This increment is the transit dose, often not taken into account in brachytherapeutic treatment planning. The transit dose depends on the prescribed dose, number of treatment fractions, velocity and activity of the source. Combining all these factors, the transit dose can be 5% higher than the prescribed absorbed dose value (Sang-Hyun and Muller-Runkel, 1994 Phys. Med. Biol. 39 1181-8, Nath et al 1995 Med. Phys. 22 209-34). However, it cannot exceed this percentage (Nath et al 1995). In this work, we use the alanine-EPR (electron paramagnetic resonance) dosimetric system using analysis of the first derivative of the signal. The transit dose was evaluated for an HDR system and is consistent with that already presented for TLD dosimeters (Bastin et al 1993 Int. J. Radiat. Oncol. Biol. Phys. 26 695-702). Also using the same dosimetric system, the radial dose function, used to evaluate the geometric dose degradation around the source, was determined and its behaviour agrees better with those obtained by Monte Carlo simulations (Nath et al 1995, Williamson and Nath 1991 Med. Phys. 18 434-48, Ballester et al 1997 Med. Phys. 24 1221-8, Ballester et al 2001 Phys. Med. Biol. 46 N79-90) than with TLD measurements (Nath et al 1990 Med. Phys. 17 1032-40)

  16. Detection of free radicals formed by in vitro metabolism of fluoride using EPR spectroscopy.

    Science.gov (United States)

    Pawłowska-Góral, Katarzyna; Pilawa, Barbara

    2011-10-01

    In many parts of the globe, where water contains large amount of fluoride, fluorosis is a serious public health problem. It is accompanied by many changes, not only in the bones, but practically in all organs of the body. Since it was discovered that oxidation stress, together with the peroxidation of lipids which accompanies it, results in many diseases, research has been carried out on this aspect of fluorosis. The findings, however, are incomplete and divergent. The aim of our study was to determine the presence of free radicals in hepatocytes exposed to fluoride in concentrations which do not lead to changes in the concentrations of calcium and magnesium ions. Free radical properties of hepatocytes incubated with fluoride were studied by an X-band electron paramagnetic resonance (EPR) spectroscopy. Hepatocytes are paramagnetic and broad unsymmetrical EPR spectra were obtained for them. Oxygen free radicals with g-factor of 2.0032 exist in hepatocytes. The effect of fluoride concentration and the time of incubation on free radicals amount in cells were examined. The amount of free radicals in hepatocytes increases with the increase of fluoride concentration for all the incubation times (10, 30, and 60 min). The amount of free radicals in hepatocytes decreases with the increase of time of incubation for all the used fluoride concentrations (0.002, 0.082, and 0.164 mmol/l). EPR spectra of the studied cells are homogeneously broadened. Continuous microwave saturation of EPR lines indicates that slow spin-lattice relaxation processes exist in the studied cells. Strong dipolar interactions responsible for the broadening (ΔB(pp): 1.45-1.87 mT) of the EPR spectra exist in the hepatocytes. Copyright © 2011 Elsevier Ltd. All rights reserved.

  17. Application of EPR spectroscopy to the examination of pro-oxidant activity of coffee.

    Science.gov (United States)

    Krakowian, Daniel; Skiba, Dominik; Kudelski, Adam; Pilawa, Barbara; Ramos, Paweł; Adamczyk, Jakub; Pawłowska-Góral, Katarzyna

    2014-05-15

    Free radicals present in coffee may be responsible for exerting toxic effects on an organism. The objectives of this work were to compare free radicals properties and concentrations in different commercially available coffees, in solid and liquid states, and to determine the effect of roasting on the formation of free radicals in coffee beans of various origins. The free radicals content of 15 commercially available coffees (solid and liquid) was compared and the impact of processing examined using electron paramagnetic resonance (EPR) spectroscopy at X-band (9.3 GHz). First derivative EPR spectra were measured at microwave power in the range of 0.7-70 mW. The following parameters were calculated for EPR spectra: amplitude (A), integral intensity (I), and line-width (ΔBpp); g-Factor was obtained from resonance condition. Our study showed that free radicals exist in green coffee beans (10(16) spin/g), roasted coffee beans (10(18) spin/g), and in commercially available coffee (10(17)-10(18) spin/g). Free radical concentrations were higher in solid ground coffee than in instant or lyophilised coffee. Continuous microwave saturation indicated homogeneous broadening of EPR lines from solid and liquid commercial coffee samples as well as green and roasted coffee beans. Slow spin-lattice relaxation processes were found to be present in all coffee samples tested, solid and liquid commercial coffees as well as green and roasted coffee beans. Higher free radicals concentrations were obtained for both the green and roasted at 240 °C coffee beans from Peru compared with those originating from Ethiopia, Brazil, India, or Colombia. Moreover, more free radicals occurred in Arabica coffee beans roasted at 240 °C than Robusta. EPR spectroscopy is a useful method of examining free radicals in different types of coffee. Copyright © 2013 Elsevier Ltd. All rights reserved.

  18. VHF radar observation of atmospheric winds, associated shears and C2n at a tropical location: interdependence and seasonal pattern

    Directory of Open Access Journals (Sweden)

    A. R. Jain

    Full Text Available The turbulence refractivity structure constant (C2n is an important parameter of the atmosphere. VHF radars have been used extensively for the measurements of C2n. Presently, most of such observations are from mid and high latitudes and only very limited observations are available for equatorial and tropical latitudes. Indian MST radar is an excellent tool for making high-resolution measurements of atmospheric winds, associated shears and turbulence refractivity structure constant (C2n. This radar is located at Gadanki (13.45° N, 79.18° E, a tropical station in India. The objective of this paper is to bring out the height structure of C2n for different seasons using the long series of data (September 1995 – August 1999 from Indian MST radar. An attempt is also made to understand such changes in the height structure of C2n in relation to background atmospheric parameters such as horizontal winds and associated shears. The height structure of C2n, during the summer monsoon and post-monsoon season, shows specific height features that are found to be related to Tropical Easterly Jet (TEJ winds. It is important to examine the nature of the radar back-scatterers and also to understand the causative mechanism of such scatterers. Aspect sensitivity of the received radar echo is examined for this purpose. It is observed that radar back-scatterers at the upper tropospheric and lower stratospheric heights are more anisotropic, with horizontal correlation length of 10–20 m, as compared to those observed at lower and middle tropospheric heights.Key words. Meteorology and atmospheric dynamics (climatology; tropical meteorology; turbulence

  19. VHF SoOp (Signal of Opportunity) Technology Demonstration for Soil Moisture Measurement Using Microwave Hydraulic Boom Truck Platform

    Science.gov (United States)

    Joseph, A. T.; Deshpande, M.; O'Neill, P. E.; Miles, L.

    2017-01-01

    A goal of this research is to test deployable VHF antennas for 6U Cubesat platforms to enable validation of root zone soil moisture (RZSM) estimation algorithms for signal of opportunity (SoOp) remote sensing over the 240-270 MHz frequency band. The proposed work provides a strong foundation for establishing a technology development path for maturing a global direct surface soil moisture (SM) and RZSM measurement system over a variety of land covers. Knowledge of RZSM up to a depth of 1 meter and surface SM up to a depth of 0.05 meter on a global scale, at a spatial resolution of 1-10 km through moderate-to-heavy vegetation, is critical to understanding global water resources and the vertical moisture gradient in the Earths surface layer which controls moisture interactions between the soil, vegetation, and atmosphere. Current observations of surface SM from space by L-band radiometers (1.4 GHz) and radars (1.26 GHz) are limited to measurements of surface SM up to a depth of 0.05 meter through moderate amounts of vegetation. This limitation is mainly due to the inability of L-band signals to penetrate through dense vegetation and deep into the soil column. Satellite observations of the surface moisture conditions are coupled to sophisticated models which extrapolate the surface SM into the root zone, thus providing an indirect estimate rather than a direct measurement of RZSM. To overcome this limitation, low-frequency airborne radars operating at 435 MHz and 118 MHz have been investigated, since these lower frequencies should penetrate denser vegetation and respond to conditions deeper in the soil.

  20. Spatial variability of the aspect sensitivity of VHF radar echoes in the troposphere and lower stratosphere during jet stream passages

    Directory of Open Access Journals (Sweden)

    J. G. Yoe

    Full Text Available The aspect sensitivity of SOUSY-VHF-radar oblique-beam echoes from the troposphere and lower stratosphere has been examined for a number of jet stream passages during the years 1990 - 1992. When the core of the jet is overhead or nearly so, vertical profiles of the aspect sensitivity display two notable features. First, the distinction between mainly isotropic and strongly aspect-sensitive echoes in the troposphere and the lower stratosphere, respectively, often reported for measurements made during calm conditions, does not necessarily prevail in the vicinity of the jet stream. Second, echoes obtained at altitudes near the height of the horizontal wind maximum are found to be more aspect sensitive for beams directed parallel to the horizontal flow or nearly so, than for other beam directions. It is demonstrated that time-averaged horizontal wind speeds estimated from the radar data, taking into account the reduced effective oblique-beam zenith angle resulting from aspect sensitivity, may exceed uncorrected wind speeds by as much as 10 m s-1 in these circumstances. Implications for wind profiling and for describing the backscattering process are discussed. Doppler spectral widths examined for one jet stream passage are found to be narrower in a beam aligned with the horizontal wind at heights near the wind speed maximum than corresponding widths measured in a beam projected at right angles to the jet. The narrowest spectra thus coincide with the most aspect-sensitive echoes, consistent with the hypothesis that such returns result from specular backscattering processes.

  1. Calculating the azimuth of mountain waves, using the effect of tilted fine-scale stable layers on VHF radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    Full Text Available A simple method is described, based on standard VHF wind-profiler data, where imbalances of echo power between four off-vertical radar beams, caused by mountain waves, can be used to calculate the orientation of the wave pattern. It is shown that the mountain wave azimuth (direction of the horizontal component of the wavevector, is given by the vector [ W (PE - P W ,W (PN - P S ]; PN, PS, PE, PW are radar echo powers, measured in dB, in beams pointed away from vertical by the same angle towards north, south, east and west respectively, and W is the vertical wind velocity. The method is applied to Aberystwyth MST radar data, and the calculated wave vector usually, but not always, points into the low-level wind direction. The mean vertical wind at Aberystwyth, which may also be affected by tilted aspect-sensitive layers, is investigated briefly using the entire radar output 1990-1997. The mean vertical-wind profile is inconsistent with existing theories, but a new mountain-wave interpretation is proposed.

    Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; waves and tides; instruments and techniques.

  2. EPR and ligand field studies of iron superoxide dismutases and iron-substituted manganese superoxide dismutases: relationships between electronic structure of the active site and activity.

    Science.gov (United States)

    Renault, J P; Verchère-Béaur, C; Morgenstern-Badarau, I; Yamakura, F; Gerloch, M

    2000-06-12

    The problem of metal selectivity of iron/manganese superoxide dismutases (SODs) is addressed through the electronic structures of active sites using electron paramagnetic resonance and ligand field calculations. Studies of wild-type iron(III) SOD (FeSOD) from Escherichia coli and from Methanobacterium thermoautotrophicum and iron-substituted manganese(III) SOD (Fe(sub)MnSOD) from E. coli and from Serratia marcescens are reported. EPR spectroscopy of wild-type enzymes shows transitions within all three Kramers doublets identified by their g values. From the temperature dependence of the observed transitions, the zero-field splitting is found to be negative, D = -2 +/- 0.2 cm-1. The electronic structure is typical of a distorted trigonal bipyramid, all the EPR features being reproduced by ligand field analysis. This unique and necessary electronic structure characterizes wild-type enzymes whatever their classification from the amino acid sequence into iron or manganese types, as E. coli FeSOD or M. thermoautotrophicum FeSOD. In iron-substituted manganese SODs, reduced catalytic activity is found. We describe how inhomogeneity of all reported substituted MnSODs might explain the activity decrease. EPR spectra of substituted enzymes show several overlapping components. From simulation of these spectra, one component is identified which shares the same electronic structure of the wild-type FeSODs, with the proportion depending on pH. Ligand field calculations were performed to investigate distortions of the active site geometry which induce variation of the excitation energy of the lowest quartet state. The corresponding coupling between the ground state and the excited state is found to be maximum in the geometry of the native SODs. We conjecture that such coupling should be considered in the electron-transfer process and in the contribution of the typical electronic structure of FeSOD to the activity.

  3. A comparative study of the effect of cholesterol on bicelle model membranes using X-band and Q-band EPR spectroscopy.

    Science.gov (United States)

    Ghimire, Harishchandra; Inbaraj, Johnson J; Lorigan, Gary A

    2009-08-01

    X-band and Q-band electron paramagnetic resonance (EPR) spectroscopic techniques were used to investigate the structure and dynamics of cholesterol containing phospholipid bicelles based upon molecular order parameters (S(mol)), orientational dependent hyperfine splittings and line shape analysis of the corresponding EPR spectra. The nitroxide spin-label 3-beta-doxyl-5-alpha-cholestane (cholestane) was incorporated into DMPC/DHPC bicelles to report the alignment of bicelles in the static magnetic field. The influence of cholesterol on aligned phospholipid bicelles in terms of ordering, the ease of alignment, phase transition temperature have been studied comparatively at X-band and Q-band. At a magnetic field of 1.25 T (Q-band), bicelles with 20 mol% cholesterol aligned at a much lower temperature (313 K), when compared to 318 K at a 0.35 T field strength for X-band, showed better hyperfine splitting values (18.29 G at X-band vs. 18.55 G at Q-band for perpendicular alignment and 8.25 G at X-band vs. 7.83 G at Q-band for the parallel alignment at 318 K) and have greater molecular order parameters (0.76 at X-band vs. 0.86 at Q-band at 318 K). Increasing cholesterol content increased the bicelle ordering, the bicelle-alignment temperature and the gel to liquid crystalline phase transition temperature. We observed that Q-band is more effective than X-band for studying aligned bicelles, because it yielded a higher ordered bicelle system for EPR spectroscopic studies.

  4. Saturation transfer EPR (ST-EPR) for dating biocarbonates containing large amount of Mn{sup 2+}: separation of SO{sub 3}{sup -} and CO{sub 2}{sup -} lines and geochronology of Brazilian fish fossil

    Energy Technology Data Exchange (ETDEWEB)

    Sastry, M.D.; Andrade, M.B.; Watanabe, Shigueo E-mail: watanabe@if.usp.br

    2003-04-01

    A method using saturation transfer EPR (ST-EPR) is shown to be feasible for detecting EPR signal of radiation-induced defects in biocarbonates containing large amount of Mn{sup 2+}. The ST-EPR measurements conducted at room temperature on fish fossil of Brazilian origin, enabled the identification of CO{sub 2}{sup -} and SO{sub 3}{sup -} radical ions, by partially suppressing the intense signal from Mn{sup 2+} when the signal are detected 90 deg. out of phase with magnetic field modulating signal and at high microwave power (50 mW). Using these signals the age of fish fossil is estimated to be (36{+-}5) Ma.

  5. Retrospective individual dosimetry using luminescence and EPR after radiation accidents; Retroperspektive individuelle Dosimetrie mit Lumineszenz - und EPR-Messungen fuer den Notfallschutz

    Energy Technology Data Exchange (ETDEWEB)

    Goeksu, H.Y.; Wieser, A.; Ulanovsky, A. [GSF - Forschungszentrum fuer Umwelt und Gesundheit GmbH, Neuherberg (Germany)

    2007-07-01

    doses requires further investigation. Applicability of suggested procedure need to be tested under factory conditions using the latest material and card technology. Feasibility of production of such cards on an industrial scale is discussed. Alternatively individual dose after emergency situations can be reconstructed by assessment of absorbed dose in human tooth enamel by electron paramagnetic resonance (EPR) measurements. From absorbed dose in tooth enamel the effective dose and dose in organs can be reconstructed in consideration of photon energy response characteristic of teeth, and photon energy spectrum and geometry of the exposure field. In this project the applicability of EPR measurements with teeth was extended by reducing the detection threshold and computation of the photon energy response characteristic of deciduous teeth. It is shown that current limitation of EPR measurement with teeth at low absorbed dose is caused by incomplete consideration of the EPR spectrum of nonradiation induced (initial) radicals. By adding further components for simulation of the initial EPR spectrum in the dose evaluation procedure, the critical value for detection of absorbed dose in tooth enamel could be decreased to 19 mGy. Dose conversion coefficients for deciduous teeth in dependence of photon energy and exposure geometry were computed by Monte Carlo simulation using a mathematical child phantom. For use with luminescence measurements with chip cards and EPR measurements with teeth a software was established that allows conversion of the measured dose to integral free-in-air kerma, tissue dose or dose water in dependence on exposure scenario. (orig.)

  6. Enactment of a decree for a EPR unit on the Flamanville site; Publication du decret sur l'EPR a Flamanville

    Energy Technology Data Exchange (ETDEWEB)

    Anon

    2007-03-15

    The decree allowing the construction of a EPR (European Pressurized Reactor) on the Flamanville site has been enacted through publishing in the official gazette on the 11. April 2007. This decree sets the technical specifications concerning: nuclear safety, radiation protection and environment protection that will have to be followed during the operating life of the reactor. This decree is the last step before construction works begin, this 1650 MWe reactor is expected to enter into service by 2012. The regional administrative jurisdiction has rejected 3 requests in annulment claimed by associations, upon the grounds that the 1986 law on the coastline development is not relevant in this case. (A.C.)

  7. Projects of Iberdrola Engineering and Construction on the Flamanville 3 EPR; Proyectos de Iberdrola Ingenieria y construccion en el EPR de Flamanville 3

    Energy Technology Data Exchange (ETDEWEB)

    Zornoza, J.; Dumas, H.; Sesma, J. L.; Cubian, B.; Diaz, J. I.

    2013-06-01

    Iberdrola Engineering and Construction is participating during the last 5 years in 5 projects on the Flamanville 3 EPR, both in the nuclear island and conventional island and the pump house. These projects represent a challenge from the technical point of view due to the high requirements applicable to the project because of the experience feedback of the operator EDF and of compliance with new regulations that have emerged since the completion of the last nuclear power station in France. This paper presents the description of these projects, as well as its current status. (Author)

  8. Synthesis and characterization of mono- and dinuclear phenanthroline-extended tetramesitylporphyrin complexes as well as UV-Vis and EPR studies on their one-electron reduced species.

    Science.gov (United States)

    Matlachowski, Corinna; Schwalbe, Matthias

    2013-03-14

    The syntheses of mononuclear compounds based on the fused porphyrin phenanthroline ligand (H(2)-1) and their corresponding dinuclear porphyrin bis-bipyridine ruthenium complexes are reported. The extended π-system of the ligand is able to store electron equivalents as could be proven by the single electron reduction with KC(8) (and/or Na(Hg)) followed by subsequent UV-Vis and EPR analysis. Electron reduction could also be achieved under light illumination in a dichloromethane-triethylamine mixture. The two coordination spheres of the ligand are different so that mononuclear or (hetero)dinuclear complexes can be isolated depending on the reaction conditions. We could successfully introduce Zn, Cu and Pd into the porphyrinic unit leading to a series of mononuclear (M-1) compounds. Further, we could attach the bis-(4,4'-di-tert-butyl-2,2'-bipyridine) ruthenium fragment (Ru(tbbpy)(2)(2+)) to obtain dinuclear (M-1-Ru) metal complexes. In the case of Zn-1 an X-ray crystal structure could be obtained confirming the selective metallation in the porphyrinic unit. All metal complexes were isolated and characterized with standard analytical tools (elemental analysis, mass spectrometry and NMR (or EPR) spectroscopy).

  9. High-field (high-frequency) EPR spectroscopy and structural characterization of a novel manganese(III) corrole

    OpenAIRE

    Bendix, Jesper; Gray, Harry B.; Golubkov, Galina; Gross, Zeev

    2000-01-01

    The X-ray structure, magnetic susceptibility, and high-field (high-frequency) EPR spectrum of manganese 5,10,15-tris(pentafluorophenyl) corrole unambiguously establish that the complex contains an isolated, slightly rhombic, manganese(III) center.

  10. An EPR study of the intramolecular dynamics in o-semiquinonic nickel complexes with a diphosphorous pincer ligand.

    Science.gov (United States)

    Kozhanov, Konstantin A; Bubnov, Michael P; Cherkasov, Vladimir K; Fukin, Georgy K; Abakumov, Gleb A

    2003-10-21

    Square pyramidal o-semiquinonic nickel complexes with 2,6-bis(diphenylphosphinomethyl)phenyl have a flexible coordination sphere and exist in solution as the mixture of tautomers rapidly, according to EPR time scale, interconverting at room temperature.

  11. RosettaTMH: a method for membrane protein structure elucidation combining EPR distance restraints with assembly of transmembrane helices

    Directory of Open Access Journals (Sweden)

    Andrew Leaver-Fay

    2015-12-01

    Full Text Available Membrane proteins make up approximately one third of all proteins, and they play key roles in a plethora of physiological processes. However, membrane proteins make up less than 2% of experimentally determined structures, despite significant advances in structure determination methods, such as X-ray crystallography, nuclear magnetic resonance spectroscopy, and cryo-electron microscopy. One potential alternative means of structure elucidation is to combine computational methods with experimental EPR data. In 2011, Hirst and others introduced RosettaEPR and demonstrated that this approach could be successfully applied to fold soluble proteins. Furthermore, few computational methods for de novo folding of integral membrane proteins have been presented. In this work, we present RosettaTMH, a novel algorithm for structure prediction of helical membrane proteins. A benchmark set of 34 proteins, in which the proteins ranged in size from 91 to 565 residues, was used to compare RosettaTMH to Rosetta’s two existing membrane protein folding protocols: the published RosettaMembrane folding protocol (“MembraneAbinitio” and folding from an extended chain (“ExtendedChain”. When EPR distance restraints are used, RosettaTMH+EPR outperforms ExtendedChain+EPR for 11 proteins, including the largest six proteins tested. RosettaTMH+EPR is capable of achieving native-like folds for 30 of 34 proteins tested, including receptors and transporters. For example, the average RMSD100SSE relative to the crystal structure for rhodopsin was 6.1 ± 0.4 Å and 6.5 ± 0.6 Å for the 449-residue nitric oxide reductase subunit B, where the standard deviation reflects variance in RMSD100SSE values across ten different EPR distance restraint sets. The addition of RosettaTMH and RosettaTMH+EPR to the Rosetta family of de novo folding methods broadens the scope of helical membrane proteins that can be accurately modeled with this software suite.

  12. EPR experiment and 2-photon interferometry: Report of a 2-photon interference experiment

    Science.gov (United States)

    Shih, Y. H.; Rubin, M. H.; Sergienko, A. V.

    1992-01-01

    After a very brief review of the historical Einstein, Podolsky, and Rosen (EPR) experiments, a new two-photon interference type EPR experiment is reported. A two-photon state was generated by optical parametric down conversion. Pairs of light quanta with degenerate frequency but divergent directions of propagation were sent to two independent Michelson interferometers. First and second order interference effectors were studied. Different than other reports, we observed that the second order interference visibility vanished when the optical path difference of the interferometers were much less than the coherence length of the pumping laser beam. However, we also observed that the second order interference behaved differently depending on whether the interferometers were set at equal or different optical path differences.

  13. The Interplay of manganese and nitrate in hydroxyapatite nanoparticles as revealed by pulsed EPR and DFT.

    Science.gov (United States)

    Gafurov, Marat; Biktagirov, Timur; Mamin, Georgy; Klimashina, Elena; Putlayev, Valery; Kuznetsova, L; Orlinskii, Sergei

    2015-08-21

    The interplay of oppositely charged substitutions in the structure of hydroxyapatite (HAp) nanopowders is investigated on the atomic level by pulsed electron paramagnetic resonance (EPR) technique and ab initio density functional theory calculations. Benefits of EPR to determine Mn(2+) ions in nano-HAp samples are demonstrated. A simple approach based on the measurements of electron spin relaxation times allowed observing the strong influence of fast-relaxing Mn(2+) ions on the relaxation characteristics of the nitrate ions (NO3(-)/NO3(2-)) incorporated in trace amounts. Based on the results of ab initio calculations, we show the propensity of Mn(2+) and NO3(-)/NO3(2-) to associate within the HAp crystal lattice. This could have a direct impact on the functional properties of the material especially to resorption and ion exchange. Furthermore, such an effect can increase a propensity of undesired impurities to incorporate into the doped nanocrystals.

  14. The design and integration of retinal CAD-SR to diabetes patient ePR system

    Science.gov (United States)

    Wu, Huiqun; Wei, Yufang; Liu, Brent J.; Shang, Yujuan; Shi, Lili; Jiang, Kui; Dong, Jiancheng

    2017-03-01

    Diabetic retinopathy (DR) is one of the serious complications of diabetes that could lead to blindness. Digital fundus camera is often used to detect retinal changes but the diagnosis relies too much on ophthalmologist's experience. Based on our previously developed algorithms for quantifying retinal vessels and lesions, we developed a computer aided detection-structured report (CAD-SR) template and implemented it into picture archiving and communication system (PACS). Furthermore, we mapped our CAD-SR into HL7 CDA to integrate CAD findings into diabetes patient electronic patient record (ePR) system. Such integration could provide more quantitative features from fundus image into ePR system, which is valuable for further data mining researches.

  15. A Novel Approach to Separating EPR Lines Arising from Species with Different Transition Moments

    Science.gov (United States)

    Hofbauer, Wulf; Bittl, Robert

    2000-12-01

    In pulsed EPR, spectral contributions from several species in one sample can be separated based on different EPR transition probabilities. This is usually done by monitoring the Rabi nutations in a 2D experiment. By using long pulses, the FID and echo shapes of species with different transition probabilities differ significantly, including temporal shifts of the observed echo signals in a two-pulse ESE experiment. These shifts can be used to disentangle spectral components in a 1D field-swept ESE experiment by choosing an appropriate detection time. This approach is demonstrated by experiments on a sample containing Mn2+ and Cr3+ centers as well as on an exchange-coupled Mn(III)/Mn(IV) system with Mn2+ contaminations.

  16. EPR, optical and superposition model study of Mn2+ doped L+ glutamic acid

    Science.gov (United States)

    Kripal, Ram; Singh, Manju

    2015-12-01

    Electron paramagnetic resonance (EPR) study of Mn2+ doped L+ glutamic acid single crystal is done at room temperature. Four interstitial sites are observed and the spin Hamiltonian parameters are calculated with the help of large number of resonant lines for various angular positions of external magnetic field. The optical absorption study is also done at room temperature. The energy values for different orbital levels are calculated, and observed bands are assigned as transitions from 6A1g(s) ground state to various excited states. With the help of these assigned bands, Racah inter-electronic repulsion parameters B = 869 cm-1, C = 2080 cm-1 and cubic crystal field splitting parameter Dq = 730 cm-1 are calculated. Zero field splitting (ZFS) parameters D and E are calculated by the perturbation formulae and crystal field parameters obtained using superposition model. The calculated values of ZFS parameters are in good agreement with the experimental values obtained by EPR.

  17. Solid-state NMR and EPR Spectroscopy of Mn2+ -Substituted ATP-Fueled Protein Engines.

    Science.gov (United States)

    Wiegand, Thomas; Lacabanne, Denis; Keller, Katharina; Cadalbert, Riccardo; Lecoq, Lauriane; Yulikov, Maxim; Terradot, Laurent; Jeschke, Gunnar; Meier, Beat H; Böckmann, Anja

    2017-03-13

    Paramagnetic metal ions deliver structural information both in EPR and solid-state NMR experiments, offering a profitable synergetic approach to study bio-macromolecules. We demonstrate the spectral consequences of Mg2+ / Mn2+ substitution and the resulting information contents for two different ATP:Mg2+ -fueled protein engines, a DnaB helicase from Helicobacter pylori active in the bacterial replisome, and the ABC transporter BmrA, a bacterial efflux pump. We show that, while EPR spectra report on metal binding and provide information on the geometry of the metal centers in the proteins, paramagnetic relaxation enhancements identified in the NMR spectra can be used to localize residues at the binding site. Protein engines are ubiquitous and the methods described herein should be applicable in a broad context. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  18. AC susceptibility and EPR investigations of superspin dynamics in magnetite nanoparticles

    Science.gov (United States)

    Price, Alex D.

    In this investigation we use two complementary techniques to distinguish between superparamagnetic blocking (SPB) and superspin-glass (SSG) freezing phenomena in magnetite nanoparticles. While these manifestations of the superspin dynamics are fundamentally different, they have similar "signatures", especially in dc-magnetization experiments. Even if ac-susceptibility measurements are employed, careful use of mathematical models to analyze the data are needed to uncover which type of phenomena (SPB or SSG freezing) occurs within the material. Yet, by utilizing electron paramagnetic resonance (EPR) on a 10 nm Fe3O4 nano-powder as well as on a ferrofluid (based on the same nanoparticle ensemble) we found a very distinct difference in the absorption spectra between the two samples, which indicates markedly different EPR signatures from SPB and SSG freezing behaviors.

  19. Electrochemical behaviour of gold modified with contaminated TMP amine adlayers studied by STM, CV, EPR

    Energy Technology Data Exchange (ETDEWEB)

    Krukowski, P. [Division of Physics and Technology of Nanometric Structures, Solid State Physics Department, University of Lodz, Pomorska 149/153, 90-236 Lodz (Poland)], E-mail: pkrukowski@std2.phys.uni.lodz.pl; Kowalczyk, P.J. [Division of Physics and Technology of Nanometric Structures, Solid State Physics Department, University of Lodz, Pomorska 149/153, 90-236 Lodz (Poland); Krzyczmonik, P. [Department of General and Inorganic Chemistry, University of Lodz, Narutowicza 68, 90-136 Lodz (Poland); Olejniczak, W.; Klusek, Z.; Puchalski, M. [Division of Physics and Technology of Nanometric Structures, Solid State Physics Department, University of Lodz, Pomorska 149/153, 90-236 Lodz (Poland); Gwozdzinski, K. [Department of Molecular Biophysics, University of Lodz, Banacha 12/16, 90-237 Lodz (Poland)

    2009-01-15

    Scanning tunnelling microscopy (STM), cyclic voltammetry (CV) and electron paramagnetic resonance spectroscopy (EPR) were used to investigate the influence of the TMP amine derivative on Au (1 1 1). The STM results show that the gold surface covered by the adlayer of the TMP derivative is easily modified (holes formation) after increasing the bias voltage to 0.5 V. The CV and EPR results show the electrochemical origin of observed STM topography changes. It is suggested that TMP could be oxidized to the nitroxyl TEMPO radical which adsorbs on Au in the form of an oxoammonium cation. Such an oxoammonium cation at the potential of 0.5 V forms a permanent complex of gold and the nitroxyl radical which could be easily desorbed during STM imaging.

  20. In vivo preclinical cancer and tissue engineering applications of absolute oxygen imaging using pulse EPR

    Science.gov (United States)

    Epel, Boris; Kotecha, Mrignayani; Halpern, Howard J.

    2017-07-01

    The value of any measurement and a fortiori any measurement technology is defined by the reproducibility and the accuracy of the measurements. This implies a relative freedom of the measurement from factors confounding its accuracy. In the past, one of the reasons for the loss of focus on the importance of imaging oxygen in vivo was the difficulty in obtaining reproducible oxygen or pO2 images free from confounding variation. This review will briefly consider principles of electron paramagnetic oxygen imaging and describe how it achieves absolute oxygen measurements. We will provide a summary review of the progress in biomedical EPR imaging, predominantly in cancer biology research, discuss EPR oxygen imaging for cancer treatment and tissue graft assessment for regenerative medicine applications.

  1. Parametrization of spectra of plasma bubble induced VHF satellite scintillations and its geophysical significance

    Directory of Open Access Journals (Sweden)

    P. N. Vijayakumar

    Full Text Available An important component of ionospheric plasma irregularity studies in the Indian low latitudes involves the study of the plasma bubbles which produce intense scintillations of the transionospheric satellite signals. Many such plasma bubble induced (PBI scintillation events were identified while recording 244 MHz signal from the geostationary satellite Fleetsat (73°E at Delhi (28.6°N, 77.2°E during March-April 1991. This type of scintillations represents changes in plasma processes. These scintillations are spectrally analyzed using an autoregressive (AR scheme, which is equivalent to maximum entropy method of spectrum analysis, amenable to extracting optimum spectral content from short data lengths (20 – 40 s. Each spectrum is assigned a level of detectability using the final prediction error (FPE derived from the optimum filter order required to resolve the spectrum. Lower detectability together with a higher order filter indicate a higher level of coherence for the plasma irregularities (discrete structures. Consistent patterns for these scintillations emerge from the present analysis as follows: (1 the initial and final phases of a scintillation patch display quasiperiodic oscillations. Their corresponding spectra show dominant (Gaussian shaped spectral features with detectability levels of –6 dB to –12 dB and requiring a higher order (>6 AR filter for their spectral resolution. These are most likely associated with discrete "filament-like" or "sheet-like" plasma structures that exist near the bubble walls. (2 Two main features of the scintillation spectra could be positively associated with the well-developed plasma bubble stage: (a spectra displaying a power-law process with a single component spectral slope between 1.6 to 3.0. Generally such spectra are resolved with a 2nd order filter and have a 1 dB to 6 dB of detectability. (b Spectra displaying a double slope, indicating an inner and an outer scale regime for the power

  2. Parametrization of spectra of plasma bubble induced VHF satellite scintillations and its geophysical significance

    Directory of Open Access Journals (Sweden)

    P. N. Vijayakumar

    1997-03-01

    Full Text Available An important component of ionospheric plasma irregularity studies in the Indian low latitudes involves the study of the plasma bubbles which produce intense scintillations of the transionospheric satellite signals. Many such plasma bubble induced (PBI scintillation events were identified while recording 244 MHz signal from the geostationary satellite Fleetsat (73°E at Delhi (28.6°N, 77.2°E during March-April 1991. This type of scintillations represents changes in plasma processes. These scintillations are spectrally analyzed using an autoregressive (AR scheme, which is equivalent to maximum entropy method of spectrum analysis, amenable to extracting optimum spectral content from short data lengths (20 – 40 s. Each spectrum is assigned a level of detectability using the final prediction error (FPE derived from the optimum filter order required to resolve the spectrum. Lower detectability together with a higher order filter indicate a higher level of coherence for the plasma irregularities (discrete structures. Consistent patterns for these scintillations emerge from the present analysis as follows: (1 the initial and final phases of a scintillation patch display quasiperiodic oscillations. Their corresponding spectra show dominant (Gaussian shaped spectral features with detectability levels of –6 dB to –12 dB and requiring a higher order (>6 AR filter for their spectral resolution. These are most likely associated with discrete "filament-like" or "sheet-like" plasma structures that exist near the bubble walls. (2 Two main features of the scintillation spectra could be positively associated with the well-developed plasma bubble stage: (a spectra displaying a power-law process with a single component spectral slope between 1.6 to 3.0. Generally such spectra are resolved with a 2nd order filter and have a 1 dB to 6 dB of detectability. (b Spectra displaying a double slope, indicating an inner and an outer scale regime for the power

  3. Antennas for VHF/UHF personal radio: A theoretical and experimental study of characteristics and performance

    DEFF Research Database (Denmark)

    Andersen, Jørgen Bach; Hansen, Flemming

    1977-01-01

    A theoretical analysis of the characteristics of small personal radio antennas for the 68- to 470-MHz frequency range is given. Representing the human body by a simplified lossy dielectric structure, the influence of the body on the performance of the antenna is investigated in detail...... to efficiency and radiation patterns at 80, 160, and 450 MHz, and it is demonstrated how the physical length of the antenna affects the antenna performance. The design of a very short and compact personal radio antenna is described....

  4. Nighttime enhancements in total electron content near Arecibo and their association with VHF scintillations

    Energy Technology Data Exchange (ETDEWEB)

    Kersley, L.; Aarons, J.; Klobuchar, J.A.

    1980-08-01

    From the analysis of 16 months of transionospheric propagation data taken near Arecibo it has been found that there are associations between nighttime enhancements and quasi-periodic fluctuations in total electron content and the occurrence of amplitude scintillations. A postmidnight peak is found in the occurrence of electron content increases, maximum wave activity, and largest scintillation index, with some evidence to suggest a second premidnight peak in winter and reduced probability of the features being found at equinox. An analysis of the large-scale variations of the total content data for three stations has shown that the postsunset minimum in electron content propagates at high speed toward the northeast, while the premidnight minimum advances toward the south with the main postmidnight maximum having northward component of motion. The results are discussed in terms of the known dynamical features of the ionosphere at Arecibo and in particular the effects of the neutral wind on the bottpmside ionosphere. It appears that conditions conducive to the production of nighttime enhancements in total electron content may also allow the penetration of medium scale gravity waves through the lower thermosphere with an unstable breakdown process giving rise to the development of scintillation-producing irregularities.

  5. Bismuth germanate as a perspective material for dielectric resonators in EPR spectroscopy

    Science.gov (United States)

    Ivanov, Mikhail Y.; Nadolinny, Vladimir A.; Bagryanskaya, Elena G.; Grishin, Yuriy A.; Fedin, Matvey V.; Veber, Sergey L.

    2016-10-01

    High purity bismuth germanate (Bi4(GeO4)3, BGO) is proposed and implemented as an alternative material for dielectric EPR resonators. A significant improvement of the absolute sensitivity can be readily achieved by substituting the alumina insert (ring) by BGO-made one in commercially available X-band EPR probeheads. Four BGO dielectric inserts of 2, 3, 4 and 5 mm inner diameter (ID) were made for comparison with standard 5 mm inner diameter alumina insert. All inserts were introduced into commercial Bruker EPR resonator ER 4118X-MD-5W1, and their performance was investigated. The Q-values of empty resonators, B1 saturation curves and continuous wave EPR spectra of DPPH (2,2-diphenyl-1-picrylhydrazyl) were measured and analyzed in a temperature range 6-300 K. BGO-made resonators were found superior in several important aspects. The background signals arising from BGO are much weaker compared to those of alumina at B = 0-0.6 T and T = 6-300 K; this is especially useful for measuring weak signals in the half-field region, as well as those near the central field. Moreover, mechanical properties of BGO allow easy fabrication of dielectric bodies having various shapes and sizes; in particular, small BGO resonators (e.g. ID = 2 or 3 mm) strongly enhance sensitivity for small samples due to increase of the filling factor. All these advantages have been also inspected in the pulse mode, proving that higher B1 fields and better filling factors can be achieved, contributing to the overall enhancement of the performance.

  6. Quantum Chemical Investigations of Structure, Bonding and EPR Parameters of Manganese Complexes relevant to Photosystem II

    OpenAIRE

    Schinzel, Sandra

    2009-01-01

    Im Wasser-oxidierenden Cluster („oxygen-evolving complex“, OEC) des Photosystem II findet sich die primäre Quelle der Sauerstoffproduktion der Erde. Der OEC katalysiert in grünen Pflanzen unter Absorption von Sonnenlicht die Vierelektronen-Oxidation von Wasser zu Sauerstoff in einer zyklischen Sequenz von Oxidationszuständen (Kok-Zyklus). In dieser Arbeit wurden Strukturen, Spindichteverteilungen sowie EPR-Parameter ein-, zwei- und vierkerniger Mangankomplexe, die in Bezug auf den OEC modelli...

  7. Multifrequency EPR Studies of Manganese Catalases Provide a Complete Description of Proteinaceous Nitrogen Coordination

    OpenAIRE

    Stich, Troy A.; Whittaker, James W.; Britt, R. David

    2010-01-01

    Pulse electron paramagnetic resonance (EPR) spectroscopy is employed at two very different excitation frequencies, 9.77 and 30.67 GHz, in the study of the nitrogen coordination environment of the Mn(III)Mn(IV) state of the dimanganese-containing catalases from Lactobacillus plantarum and Thermus thermophilus. Consistent with previous studies, the lower-frequency results reveal one unique histidine nitrogen-Mn cluster interaction. For the first time, a second, more strongly hyperfine-coupled 1...

  8. Very-Low-Frequency Electron Paramagnetic Resonance (EPR) Imaging of Nitroxide-Loaded Cells

    OpenAIRE

    Kao, Joseph P. Y.; Barth, Eugene D.; Burks, Scott R.; Smithback, Philip; Mailer, Colin; Ahn, Kang-Hyun; Halpern, Howard J.; Rosen, Gerald M

    2007-01-01

    Recent advances in electron paramagnetic resonance (EPR) imaging have made it possible to image, in real time in vivo, cells that have been labeled with nitroxide spin probes. We previously reported that cells can be loaded to high (millimolar) intracellular concentrations with (2,2,5,5-tetramethylpyrrolidin-1-oxyl-3-ylmethyl)amine-N,N-diacetic acid by incubation with the corresponding acetoxymethyl (AM) ester. Furthermore, the intracellular lifetime (t1/e) of this nitroxide is 114 min—suffic...

  9. Emergency Preservation and Resuscitation for Cardiac Arrest from Trauma (EPR-CAT)

    Science.gov (United States)

    2015-10-01

    Award Number: W81XWH-07-1-0682 TITLE: Emergency Preservation and Resuscitation for Cardiac Arrest from Trauma (EPR-CAT) PRINCIPAL INVESTIGATOR...COVERED (From - To) 26 SEP 2014 – 25 SEP 2015 4. TITLE AND SUBTITLE Emergency Preservation and Resuscitation for Cardiac Arrest 5a. CONTRACT NUMBER From...study. It was felt that patients who arrive at the hospital with a pulse, but then develop cardiac arrest in the operating room, rather than in the

  10. CONFORMATIONAL EQUILIBRIA OF BULGED SITES IN DUPLEX DNA STUDIED BY EPR SPECTROSCOPY

    OpenAIRE

    Smith, Alyssa L.; Cekan, Pavol; Brewood, Greg P.; Okonogi, Tamara M.; Alemayehu, Saba; Hustedt, Eric J.; Benight, Albert S.; Sigurdsson, Snorri Th.; Robinson, Bruce H.

    2009-01-01

    Conformational flexibility in nucleic acids provides a basis for complex structures, binding, and signaling. One-base bulges directly neighboring single-base mismatches in nucleic acids can be present in a minimum of two distinct conformations, complicating the examination of the thermodynamics by calorimetry or UV-monitored melting techniques. To provide additional information about such structures, we demonstrate how electron paramagnetic resonance (EPR) active spin-labeled base analogues, ...

  11. EPR support for the ketyl radical-anion "triggered" [3,3]-sigmatropic rearrangement.

    Science.gov (United States)

    Enholm, Eric J; Battiste, Merle A; Gallagher, Maria; Moran, Kelley M; Alberti, Angelo; Guerra, Maurizio; Macciantelli, Dante

    2002-09-06

    New physical evidence to support a ketyl radical-anion mechanism for the [3,3]-sigmatropic rearrangement is presented. With use of EPR spectroscopy, spectra are observed that can be attributed to 8, an acyl radical-anion species resulting from a [3,3]-rearrangement; this also functions as a key intermediate in the process. The spectrum of an additional paramagnetic species resulting from further addition of tin-centered radicals to the reaction product was also observed.

  12. Assessing dimerisation degree and cooperativity in a biomimetic small-molecule model by pulsed EPR

    OpenAIRE

    Ackermann, Katrin; Giannoulis, Angeliki; Cordes, David Bradford; Slawin, Alexandra Martha Zoya; Bode, Bela Ernest

    2015-01-01

    AG acknowledges a postgraduate fellowship by the EPSRC funded doctoral training centre ‘integrated magnetic resonance’. BEB is grateful for an EaStCHEM Hirst Academic Fellowship by the School of Chemistry, St Andrews, and funding from the People Programme (Marie Curie Actions) of the European Union’s Seventh Framework Programme (REA 334496). Pulsed electron paramagnetic resonance (EPR) spectroscopy is gaining increasing importance as a complementary biophysical technique in structural biol...

  13. Free Radical Scavenging Activity of Drops and Spray Containing Propolis—An EPR Examination

    OpenAIRE

    Pawel Olczyk; Katarzyna Komosinska-Vassev; Pawel Ramos; Lukasz Mencner; Krystyna Olczyk; Barbara Pilawa

    2017-01-01

    The influence of heating at a temperature of 50 °C and UV-irradiation of propolis drops and spray on their free radical scavenging activity was determined. The kinetics of interactions of the propolis samples with DPPH free radicals was analyzed. Interactions of propolis drops and propolis spray with free radicals were examined by electron paramagnetic resonance spectroscopy. A spectrometer generating microwaves of 9.3 GHz frequency was used. The EPR spectra of the model DPPH free radicals we...

  14. EPR Oximetry Sensor-Developing a TAM Derivative for In Vivo Studies.

    Science.gov (United States)

    Boś-Liedke, Agnieszka; Walawender, Magdalena; Woźniak, Anna; Flak, Dorota; Gapiński, Jacek; Jurga, Stefan; Kucińska, Małgorzata; Plewiński, Adam; Murias, Marek; Elewa, Marwa; Lampp, Lisa; Imming, Peter; Tadyszak, Krzysztof

    2017-09-04

    Oxygenation is one of the most important physiological parameters of biological systems. Low oxygen concentration (hypoxia) is associated with various pathophysiological processes in different organs. Hypoxia is of special importance in tumor therapy, causing poor response to treatment. Triaryl methyl (TAM) derivative radicals are commonly used in electron paramagnetic resonance (EPR) as sensors for quantitative spatial tissue oxygen mapping. They are also known as magnetic resonance imaging (MRI) contrast agents and fluorescence imaging compounds. We report the properties of the TAM radical tris(2,3,5,6-tetrachloro-4-carboxy-phenyl)methyl, (PTMTC), a potential multimodal (EPR/fluorescence) marker. PTMTC was spectrally analyzed using EPR and characterized by estimation of its sensitivity to the oxygen in liquid environment suitable for intravenous injection (1 mM PBS, pH = 7.4). Further, fluorescent emission of the radical was measured using the same solvent and its quantum yield was estimated. An in vitro cytotoxicity examination was conducted in two cancer cell lines, HT-29 (colorectal adenocarcinoma) and FaDu (squamous cell carcinoma) and followed by uptake studies. The stability of the radical in different solutions (PBS pH = 7.4, cell media used for HT-29 and FaDu cells culturing and cytotoxicity procedure, full rat blood and blood plasma) was determined. Finally, a primary toxicity test of PTMTC was carried out in mice. Results of spectral studies confirmed the multimodal properties of PTMTC. PTMTC was demonstrated to be not absorbed by cancer cells and did not interfere with luciferin-luciferase based assays. Also in vitro and in vivo tests showed that it was non-toxic and can be freely administrated till doses of 250 mg/kg BW via both i.v. and i.p. injections. This work illustrated that PTMTC is a perfect candidate for multimodal (EPR/fluorescence) contrast agent in preclinical studies.

  15. Synthesis and EPR studies of the first water-soluble N@C60 derivative.

    Science.gov (United States)

    Cornes, Stuart P; Zhou, Shen; Porfyrakis, Kyriakos

    2017-11-28

    The first water-soluble derivative of the paramagnetic endohedral fullerene N@C60 has been prepared through the covalent attachment of a single addend containing two permethylated β-cyclodextrin units to the surface of the carbon cage. The line width of the derivative's EPR signal is highly sensitive to both the nature of the solvent and the presence of Cu(ii) ions in solution.

  16. Observations of mesosphere summer echoes with calibrated VHF radars at latitudes between 54°N and 69°N in summer 2004

    Science.gov (United States)

    Latteck, R.; Singer, W.; Kirkwood, S.; Jönsson, L. O.; Eriksson, Håkan

    2005-08-01

    Mesosphere Summer Echoes (MSE) have been observed with 50-MHz VHF radars at middle (MSE) and polar latitudes (PMSE) for more than 20 years. The occurrence and seasonal variation of these radar echoes as well as their dependence on solar and geomagnetic activity are mostly studied basing on relative signal strength measurements (signal-to-noise ratios). The latitudinal dependence of the appearance and intensity of mesospheric summer echoes is still an open question as the widely used relative signal strength observations are determined by the atmospheric properties as well as by the individual radar characteristics. The use of absolutely calibrated echo powers allows a system in-depended comparison of mesospheric summer echoes observed at different sites by different systems. We present two different radar calibration methods. One applies a noise source to calibrate the receive path of the radar only, a second uses the radar signal itself to calibrate the complete transmitting and receiving path of the radar system. Both techniques and the same calibration hardware have been applied to the ALWIN VHF radar at Andenes/Norway (69°N), the ESRAD radar at Kiruna/Sweden (68deg;N) and OSWIN radar at Kühlungsborn/Germany (54°N). The sensitivity of the different radar systems and the seasonal and diurnal variation of the occurrence of mesospheric summer echoes at different locations are discussed on the basis of radar backscatter cross-sections.

  17. SISTEMA WEB DE GEOLOCALIZACIÓN Y MONITOREO DE LA TORTUGA PODOCNEMIS LEWYANA EN EL RÍO SINÚ, MEDIANTE EL USO DE ANTENAS VHF Y DISPOSITIVOS GPS

    Directory of Open Access Journals (Sweden)

    Mario Macea Anaya

    2016-03-01

    Full Text Available Este trabajo tiene como finalidad el diseño e implementación de una aplicación para el monitoreo de las Tortugas de Río Podocnemis Lewyana, utilizando las tecnologías GPS (Global Positioning System y VHF (Very High Frequency. La aplicación permite apoyar los procesos de conservación y recuperación de la especie en el Departamento de Córdoba, en las poblaciones de Caño Viejo y Cotocá Arriba del municipio Santa Cruz de Lorica, Colombia. El uso de esa herramienta está dirigido a biólogos y personas de las comunidades rurales dedicadas a conservar dicha especie. En el desarrollo del proyecto se utilizaron 18 Tortugas de Río para su monitoreo. El resultado del trabajo es la aplicación Web Podocnemis-Soft. Su funcionamiento se basa en un dispositivo GPS y VHF, ubicado en una o varias de las tortugas Podocnemis Lewyana; los dispositivos envían los datos de la ubicación de la tortuga hasta un servidor para su procesamiento y posterior visualización de la información.

  18. Relationship between propagation direction of gravity waves in OH and OI airglow images and VHF radar echo occurrence during the SEEK-2 campaign

    Directory of Open Access Journals (Sweden)

    F. Onoma

    2005-10-01

    Full Text Available We report simultaneous observations of atmospheric gravity waves (AGW in OI (557.7nm and OH airglow images and VHF radar backscatter from field-aligned irregularities (FAI in the E-region during the SEEK-2 (Sporadic-E Experiment over Kyushu 2 campaign period from 29 July to 9 August 2002. An all-sky imager was operated at Nishino-Omote (30.5 N, 130.1 E, Japan. On 14 nights, 17 AGW events were detected in OI and OH airglow images. AGW propagated mostly toward the northeast or southeast. From comparison with the E-region FAI occurrence, which is detected by a nearby VHF radar (31.57MHz, we found that AGW tended to propagate southeastward during FAI events. This result suggests that the interaction between AGW and E-region plasma plays an important role in generating FAI. Furthermore, polarization electric fields generated directly by AGW may contribute to the FAI generation.

    Keywords. Atmospheric composition and structure (Airglow and aurora, Ionosphere (Ionospheric irregularities, Mid-latitude ionosphere

  19. On the angular dependence and scattering model of polar mesospheric summer echoes at VHF

    Science.gov (United States)

    Sommer, Svenja; Stober, Gunter; Chau, Jorge L.

    2016-01-01

    We present measurements of the angular dependence of polar mesospheric summer echoes (PMSE) with the Middle Atmosphere Alomar Radar System in Northern Norway (69.30° N, 16.04° E). Our results are based on multireceiver and multibeam observations using beam pointing directions with off-zenith angles up to 25° as well as on spatial correlation analysis (SCA) from vertical beam observations. We consider a beam filling effect at the upper and lower boundaries of PMSE in tilted beams, which determines the effective mean angle of arrival. Comparing the average power of the vertical beam to the oblique beams suggests that PMSE are mainly not as aspect sensitive as in contrast to previous studies. However, from SCA, times of enhanced correlation are found, indicating aspect sensitivity or a localized scattering mechanism. Our results suggest that PMSE consist of nonhomogeneous isotropic scattering and previously reported aspect sensitivity values might have been influenced by the inhomogeneous nature of PMSE.

  20. Multifrequency EPR studies of manganese catalases provide a complete description of proteinaceous nitrogen coordination.

    Science.gov (United States)

    Stich, Troy A; Whittaker, James W; Britt, R David

    2010-11-18

    Pulse electron paramagnetic resonance (EPR) spectroscopy is employed at two very different excitation frequencies, 9.77 and 30.67 GHz, in the study of the nitrogen coordination environment of the Mn(III)Mn(IV) state of the dimanganese-containing catalases from Lactobacillus plantarum and Thermus thermophilus. Consistent with previous studies, the lower-frequency results reveal one unique histidine nitrogen-Mn cluster interaction. For the first time, a second, more strongly hyperfine-coupled (14)N atom is unambiguously observed through the use of higher frequency/higher field EPR spectroscopy. The low excitation frequency spectral features are rationalized as arising from the interaction of a histidine nitrogen that is bound to the Mn(IV) ion, and the higher excitation frequency features are attributed to the histidine nitrogen bound to the Mn(III) ion. These results allow for the computation of intrinsic hyperfine coupling constants, which range from 2.2 to 2.9 MHz, for sp(2)-hybridized nitrogens coordinating equatorially to high-valence Mn ions. The relevance of these findings is discussed in the context of recent results from analogous higher frequency EPR studies of the Mn cluster in photosystem II and other exchange-coupled, transition metal-containing systems.

  1. Photochemistry of naphthalene diimides: EPR study of free radical formation via photoredox process.

    Science.gov (United States)

    Reszka, Krzysztof J; Takayama, Masami; Sik, Robert H; Chignell, Colin F; Saito, Isao

    2005-01-01

    Earlier studies have shown that on exposure to UVA, hydroperoxynaphthalene diimide (IA) generates hydroxyl radicals, induces DNA strand scission, and kills cells. Here we employed electron paramagnetic resonance (EPR) and spin trapping to investigate the free radical photochemistry of IA and that of related naphthalene diimides, which are devoid of the hydroperoxyl moiety (N,N'-bis[2-methyl]-1,4,5,8-naphthaldiimide [IB], N,N'-bis[2-thiomethyl-2-methoxyethyl]-1,4,5,8-naphthaldiimide [IC]) and therefore are unable to generate hydroxyl radicals. It is shown that on UV irradiation (>300 nm) in air-free methanol or ethanol solutions all these naphthalene diimides undergo one-electron reduction to corresponding anion radicals, positively identified by EPR. With EPR and a spin trap 5,5-dimethyl-1-pyrroline N-oxide (DMPO), we found that the photogeneration of the naphthalene diimide radicals is concomitant with the formation of radicals from the solvents, presumably through electron/hydrogen atom abstraction by photoactivated diimides. Irradiation of IA, IB or IC in the presence of oxygen generates superoxide, which was detected as a DMPO adduct. The high photoreactivity of IB and IC supports the notion that hydroperoxide IA can induce oxidative damage via photoprocesses that are independent of *OH generation. These observations could be pertinent to the application of naphthalene diimides as selective photonucleases, PDT anticancer agents or both.

  2. Entanglement conservation, ER=EPR, and a new classical area theorem for wormholes

    Energy Technology Data Exchange (ETDEWEB)

    Remmen, Grant N. [Walter Burke Institute for Theoretical PhysicsCalifornia Institute of Technology, Pasadena, CA 91125 (United States); Bao, Ning [Walter Burke Institute for Theoretical PhysicsCalifornia Institute of Technology, Pasadena, CA 91125 (United States); Institute for Quantum Information and Matter,California Institute of Technology, Pasadena, CA 91125 (United States); Pollack, Jason [Walter Burke Institute for Theoretical PhysicsCalifornia Institute of Technology, Pasadena, CA 91125 (United States)

    2016-07-11

    We consider the question of entanglement conservation in the context of the ER=EPR correspondence equating quantum entanglement with wormholes. In quantum mechanics, the entanglement between a system and its complement is conserved under unitary operations that act independently on each; ER=EPR suggests that an analogous statement should hold for wormholes. We accordingly prove a new area theorem in general relativity: for a collection of dynamical wormholes and black holes in a spacetime satisfying the null curvature condition, the maximin area for a subset of the horizons (giving the largest area attained by the minimal cross section of the multi-wormhole throat separating the subset from its complement) is invariant under classical time evolution along the outermost apparent horizons. The evolution can be completely general, including horizon mergers and the addition of classical matter satisfying the null energy condition. This theorem is the gravitational dual of entanglement conservation and thus constitutes an explicit characterization of the ER=EPR duality in the classical limit.

  3. Simultaneous EPR and optical spectroscopy of pure and Rh-doped barium calcium titanate crystals

    Science.gov (United States)

    Grachev, Valentin; Malovichko, Galina; Schirmer, Ortwin

    2003-03-01

    The large electro-optic coefficients and high holographic sensitivity of barium calcium titanate (Ba0.77Ca0.23TiO3, BCT) make it promising candidate for various applications, since it has no drawback related to the phase transition at 280 K like barium titanate. The nominally pure and Rh doped BCT crystals were investigated with the help of optical absorption spectroscopy, light induced absorption change measurements and electron paramagnetic resonance (EPR) in the temperature range between 4.2 and 300 K. Analyzing angular dependencies of the EPR lines we succeed to identify low-symmetry and nearly cubic centers of iron trace impurity. Four other paramagnetic defects were found after illumination: Ti3+, Rh2+, O- and Pt3+. All these defects are participants of charge transfer processes. At the light energy E about 1.3 eV the holes abandon Ti4+ creating the paramagnetic electronic Ti3+. At E > 2.3 eV O2- ions capture the holes and create hole O- centers and simultaneously Ti3+ concentration increases. Nearly located non-controlled or intentionally introduced impurities (Sr, K, Na, Ca...) may serve as pins for the fixation of the electrons and holes. Additional correlated changes were found at E > 3.2 eV (band-band transition), when EPR lines of Rh2+, Pt3+ appear and intensities of Ti3+, O- and Fe3+ essentially increase. Models of defects involved in these light induced processes are proposed.

  4. Bacterial recovery and recycling of tellurium from tellurium-containing compounds by Pseudoalteromonas sp. EPR3.

    Science.gov (United States)

    Bonificio, W D; Clarke, D R

    2014-11-01

    Tellurium-based devices, such as photovoltaic (PV) modules and thermoelectric generators, are expected to play an increasing role in renewable energy technologies. Tellurium, however, is one of the scarcest elements in the earth's crust, and current production and recycling methods are inefficient and use toxic chemicals. This study demonstrates an alternative, bacterially mediated tellurium recovery process. We show that the hydrothermal vent microbe Pseudoalteromonas sp. strain EPR3 can convert tellurium from a wide variety of compounds, industrial sources and devices into metallic tellurium and a gaseous tellurium species. These compounds include metallic tellurium (Te(0)), tellurite (TeO3(2-)), copper autoclave slime, tellurium dioxide (TeO2), tellurium-based PV material (cadmium telluride, CdTe) and tellurium-based thermoelectric material (bismuth telluride, Bi2Te3). Experimentally, this was achieved by incubating these tellurium sources with the EPR3 in both solid and liquid media. Despite the fact that many of these tellurium compounds are considered insoluble in aqueous solution, they can nonetheless be transformed by EPR3, suggesting the existence of a steady state soluble tellurium concentration during tellurium transformation. These experiments provide insights into the processes of tellurium precipitation and volatilization by bacteria, and their implications on tellurium production and recycling. © 2014 The Society for Applied Microbiology.

  5. Applications of pulsed EPR spectroscopy to structural studies of sulfite oxidizing enzymes

    Energy Technology Data Exchange (ETDEWEB)

    Klein, Eric L.; Astashkin, Andrei V.; Raitsimring, Arnold M.; Enemark, John H.

    2013-01-01

    Sulfite oxidizing enzymes (SOEs), including sulfite oxidase (SO) and bacterial sulfite dehydrogenase (SDH), catalyze the oxidation of sulfite (SO32-) to sulfate (SO42-). The active sites of SO and SDH are nearly identical, each having a 5-coordinate, pseudo-square-pyramidal Mo with an axial oxo ligand and three equatorial sulfur donor atoms. One sulfur is from a conserved Cys residue and two are from a pyranopterindithiolene (molybdopterin, MPT) cofactor. The identity of the remaining equatorial ligand, which is solvent-exposed, varies during the catalytic cycle. Numerous in vitro studies, particularly those involving electron paramagnetic resonance (EPR) spectroscopy of the Mo(V) states of SOEs, have shown that the identity and orientation of this exchangeable equatorial ligand depends on the buffer pH, the presence and concentration of certain anions in the buffer, as well as specific point mutations in the protein. Until very recently, however, EPR has not been a practical technique for directly probing specific structures in which the solvent-exposed, exchangeable ligand is an O, OH-, H2O, SO32-, or SO42- group, because the primary O and S isotopes (16O and 32S) are magnetically silent (I = 0). This review focuses on the recent advances in the use of isotopic labeling, variable-frequency high resolution pulsed EPR spectroscopy, synthetic model compounds, and DFT calculations to elucidate the roles of various anions, point mutations, and steric factors in the formation, stabilization, and transformation of SOE active site structures.

  6. X-ray absorption spectroscopy and EPR studies of oriented spinach thylakoid preparations

    Energy Technology Data Exchange (ETDEWEB)

    Andrews, J.C. [Univ. of California, Berkeley, CA (United States). Dept. of Chemistry]|[Lawrence Berkeley Lab., CA (United States). Structural Biology Div.

    1995-08-01

    In this study, oriented Photosystem II (PS II) particles from spinach chloroplasts are studied with electron paramagnetic resonance (EPR) and x-ray absorption spectroscopy (XAS) to determine more details of the structure of the oxygen evolving complex (OEC). The nature of halide binding to Mn is also studied with Cl K-edge and Mn EXAFS (extended x-ray absorption fine structure) of Mn-Cl model compounds, and with Mn EXAFS of oriented PS II in which Br has replaced Cl. Attention is focused on the following: photosynthesis and the oxygen evolving complex; determination of mosaic spread in oriented photosystem II particles from signal II EPR measurement; oriented EXAFS--studies of PS II in the S{sub 2} state; structural changes in PS II as a result of treatment with ammonia: EPR and XAS studies; studies of halide binding to Mn: Cl K-edge and Mn EXAFS of Mn-Cl model compounds and Mn EXAFS of oriented Br-treated photosystem II.

  7. Development of next-generation macromolecular drugs based on the EPR effect: challenges and pitfalls.

    Science.gov (United States)

    Nakamura, Hideaki; Fang, Jun; Jun, Fang; Maeda, Hiroshi

    2015-01-01

    A major problem with conventional antitumor therapeutics is nonselective delivery of cytotoxic drugs to normal vital organs and tissues but little delivery to tumor tissues. Here, the authors describe the tumor selective delivery of antitumor drugs by taking advantage of nano-sized drugs and the means to augment it further. Based on the enhanced permeability and retention (EPR) effect, the mechanism for more efficient universal tumor delivery using macromolecular drugs to cover wider tumor types than single molecular target is discussed. Unique properties of solid tumor vasculature in the tumor tissue are discussed, especially leakiness of the blood vessels and factors involved and impaired clearance of macromolecular drugs from the tumor interstitium via the lymphatic system. The criteria for such macromolecular drugs or nanomedicines for effective accumulation at tumor sites is commented on as well as the importance of long plasma retention time of such drugs and a need to release active principles from nanoparticles at target sites. Methods to augment the EPR effect and tumor delivery (2 - 3 times) and its application to photodynamic therapy are also discussed. Tumor selective delivery of antitumor drugs based on the EPR effect can be accomplished and augmented by modulating the tumor environment. This methodology is favorable not only for tumor therapy but also for tumor imaging.

  8. Non-invasive determination of the irradiation dose in fingers using low-frequency EPR

    Energy Technology Data Exchange (ETDEWEB)

    Zdravkova, M [Laboratory of Biomedical Magnetic Resonance, Universite catholique de Louvain, UCL, Avenue Hippocrate, 10, B-1200 Brussels (Belgium); Crokart, N [Laboratory of Biomedical Magnetic Resonance, Universite catholique de Louvain, UCL, Avenue Hippocrate, 10, B-1200 Brussels (Belgium); Trompier, F [Service de Dosimetrie Externe, Departement de Radioprotection et de Protection de l' Homme, Institut de Radioprotection et de Surete Nucleaire, IRSN, BP no 17, F-92262 Fontenay-aux-Roses Cedex (France); Beghein, N [Laboratory of Biomedical Magnetic Resonance, Universite catholique de Louvain, UCL, Avenue Hippocrate, 10, B-1200 Brussels (Belgium); Gallez, B [Laboratory of Biomedical Magnetic Resonance, Universite catholique de Louvain, UCL, Avenue Hippocrate, 10, B-1200 Brussels (Belgium); Debuyst, R [Laboratory of Biomedical Magnetic Resonance, Universite catholique de Louvain, UCL, Avenue Hippocrate, 10, B-1200 Brussels (Belgium)

    2004-07-07

    Several reports in the literature have described the effects of radiation in workers who exposed their fingers to intense radioactive sources. The radiation injuries occurring after local exposure to a high dose (20 to 100 Gy) could lead to the need for amputation. Follow-up of victims needs to be more rational with a precise knowledge of the irradiated area that risks tissue degradation and necrosis. It has been described previously that X-band electron paramagnetic resonance (EPR) spectroscopy could be used to assess the dose in irradiated amputated fingers. Here, we propose the use of low-frequency EPR spectroscopy to evaluate non-invasively the absorbed dose. Low-frequency microwaves are indeed less absorbed by water and penetrate more deeply into living material ({approx}10 mm in tissues using 1 GHz spectrometers). This work presents preliminary results obtained with baboon and human fingers compared with human dry phalanxes placed inside a surface-coil resonator. The EPR signal increased linearly with the dose. The ratio of the slopes of the dry bone to whole finger linear regression lines was around 5. The detection limit achievable with the present spectrometer and resonator is around 60 Gy, which is well within the range of accidentally exposed fingers. It is likely that the detection limit could be improved in the future, thanks to further technical spectrometer and resonator developments as well as to appropriate spectrum deconvolution into native and dosimetric signals.

  9. Camel molar tooth enamel response to gamma rays using EPR spectroscopy.

    Science.gov (United States)

    El-Faramawy, N A; El-Somany, I; Mansour, A; Maghraby, A M; Eissa, H; Wieser, A

    2017-10-12

    Tooth enamel samples from molar teeth of camel were prepared using a combined procedure of mechanical and chemical tooth treatment. Based on electron paramagnetic resonance (EPR) spectroscopy, the dose response of tooth enamel samples was examined and compared to that of human enamel. The EPR dose response of the tooth enamel samples was obtained through irradiation to gamma doses from 1 Gy up to 100 kGy. It was found that the radiation-induced EPR signal increased linearly with gamma dose for all studied tooth enamel samples, up to about 15 kGy. At higher doses, the dose response curve leveled off. The results revealed that the location of the native signal of camel tooth enamel was similar to that of enamel from human molars at 2.00644, but different from that of enamel from cows and goats. In addition, the peak-to-peak width (ΔH pp) for human and camel molar teeth was similar. It was also found that the response of camel enamel to gamma radiation was 36% lower than that of human enamel. In conclusion, the results indicate the suitability of camel teeth for retrospective gamma dosimetry.

  10. EPR study of the formation of radicals in PP with antioxidants irradiated with gamma rays

    Energy Technology Data Exchange (ETDEWEB)

    Silva, P. [Instituto Venezolano de Investigaciones Cientificas, Centro de Fisica, Carretera Panamericana Km. 11, Caracas 1020-A (Venezuela)], E-mail: silva@ivic.ve; Albano, C. [Instituto Venezolano de Investigaciones Cientificas, Centro de Quimica, Universidad Central de Venezuela, Facultad de Ingenieria (Venezuela); Perera, R. [Departamento de Mecanica, Universidad Simon Bolivar (Venezuela)

    2007-12-15

    The behavior of different compounds of polypropylene (PP) with stabilizers such as buthyl-hydroxy-toluene (BHT), Chimassorb 944 (Hals) (CHIM), and a copolymer of styrene-butadiene-styrene (SBS) was studied using electron paramagnetic resonance (EPR). A characteristic spectra for pure PP irradiated in air was obtained for all the samples just after being irradiated [M. Dole, The Radiation Chemistry of Macromolecules, Vol. 2, Academic Press, 1973]. A change in the lineshape of the spectra from a pure PP's EPR signal to that of nitroxyl radical as a function of time was observed. The total free radical concentration (TFRC) decayed until approximately 800 h in the PP-HALS and until around 2000 h in all other cases, when the TFRC began to increase in all the cases, except in that of PP-BHT. In this last case, the EPR signal was not detectable after 4000 h. The BHT and the SBS diluted the free radical concentrations, being them smaller when they are present. The behavior observed in all the samples is consistent with the formation of nitroxyl radicals by gamma rays.

  11. Mapping ischemic risk region and necrosis in the isolated heart using EPR imaging.

    Science.gov (United States)

    Velayutham, Murugesan; Li, Haiquan; Kuppusamy, Periannan; Zweier, Jay L

    2003-06-01

    Reperfusion of ischemic tissue is a common event in the treatment of heart attack and stroke. To study disease pathogenesis, methods are required to measure tissue perfusion and area at risk, as well as localized regions of injury. While histology can provide this information, its destructive nature precludes assessment of time course. Thus, there is a critical need for a noninvasive technique to obtain this information. To map myocardial redox state as a possible index of cellular ischemia and viability, electron paramagnetic resonance (EPR) imaging experiments were performed on isolated rat hearts before and after the onset of regional ischemia using nitroxide spin labels. With coronary artery occlusion, the EPR images clearly showed the risk region as a void of lower intensity that reversed upon reperfusion. The extent of risk region in the heart was similar in EPR imaging and histological measurements. The unique information obtained regarding the time course of changes in redox metabolism of the risk region and normal myocardium can provide important insights regarding the mechanisms of myocardial injury during and following ischemia. Copyright 2003 Wiley-Liss, Inc.

  12. 240 GHz EPR Studies of Intrinsic Defects in 4H SiC

    Science.gov (United States)

    Konovalov, V. V.; Zvanut, M. E.; van Tol, J.; Brunel, L.-C.

    2002-03-01

    Intrinsic defects may strongly influence the conductivity and optical behavior of SiC. Several groups have reported 9.5 GHz EPR studies of a carbon vacancy in electron irradiated p-type and as-grown nominally semi-insulating SiC. Recently, Son et al. interpreted two lines in a 95 GHz EPR spectrum as a carbon vacancy and silicon antisite. We report 240 GHz EPR studies of intrinsic defects in as-grown 4H SiC provided by Cree Inc. The ID-1 line we observed earlier at 9.5 GHz and assigned to a carbon vacancy was resolved at 240 GHz into two lines, ID-1a and ID-1b. As the temperature decreased from 80 to 4 K, with H//c-axis the g-value of ID-1a remained constant at 2.00307, but the g-value of ID-1b decreased from 2.00272 to 2.00235. Concomitantly, the intensity of ID-1a decreased while that of ID-1b increased. Although our data are close to Son’s 95 GHz spectrum, preliminary interpretation of the highly resolved lines obtained at 240 GHz does not suggest a silicon antisite. Illumination with IR light quenches both ID-1a and ID-1b simultaneously, indicating close defect levels. The work is supported by the ONR.

  13. Stable radicals and biochemical compounds in embryos and endosperm of wheat grains differentiating sensitive and tolerant genotypes--EPR and Raman studies.

    Science.gov (United States)

    Kurdziel, Magdalena; Dłubacz, Aleksandra; Wesełucha-Birczyńska, Aleksandra; Filek, Maria; Łabanowska, Maria

    2015-07-01

    The aim of this study was to uncover the specific species in grains that might differentiate the wheat genotypes according to their tolerance to oxidative stress. Measurements by EPR and Raman spectroscopy techniques were used to examine whole grains and their parts (embryo, endosperm, seed coat) originating from four wheat genotypes with differing tolerance to drought stress. Raman spectra showed that, in spite of the similar amounts of proteins in whole grains from tolerant and sensitive genotypes, in tolerant ones they were accumulated mainly in embryos. Moreover, in embryos from these grains, a higher content of unsaturated fatty acids was observed. Endosperm of grains from the tolerant genotype, richer with starch than that of sensitive one, exhibited higher content of amylopectin. Detailed analysis of EPR signals and simulation procedures of the spectra allowed the estimation of the nature of interactions of Fe(III) and Mn(II) with organic and inorganic structures of grains and the character of organic stable radicals. Three types of these radicals: carbohydrate, semiquinone and phenoxyl, were identified. The amounts of these radicals were higher in grains of sensitive genotypes, mostly because of differences in carbohydrate radical content in endosperm. Taking into account the level of radical concentration and greater capacity for radical formation in grains from plants of lower tolerance to stress, the content of radicals, especially of a carbohydrate nature, was considered as a marker of the plant resistance to stress conditions. Copyright © 2015 Elsevier GmbH. All rights reserved.

  14. Mn7 species with an S = 29/2 ground state: high-frequency EPR studies of a species at the classical/quantum spin interface.

    Science.gov (United States)

    Wang, Zhenxing; van Tol, Johan; Taguchi, Taketo; Daniels, Matthew R; Christou, George; Dalal, Naresh S

    2011-11-09

    A high spin (S) compound has been synthesized whose properties straddle the interface between the classical and quantum mechanical spin descriptions. The cluster [Mn(7)O(4)(pdpm)(6)(N(3))(4)](ClO(4))(2) (Mn(7)) has an unprecedented core structure comprising an octahedral [Mn(III)(6)(μ(4)-O)(μ(3)-O)(3)(μ(3)-N(3))(4)](6+) unit with one of its faces capped by a Mn(II) ion. Magnetization and susceptibility studies indicate an S = (29/2) ground state, the maximum possible. Variable-temperature, high-frequency electron paramagnetic resonance (HF-EPR) spectra on powder and single-crystal samples of Mn(7) exhibit sharp spectral features characteristic of a quantum spin that are well resolved in a certain temperature range but which transform to a continuum of peaks characteristic of a classical spin in another; these features have been well reproduced by computer simulations. A fast Fourier transform analysis of the sharp spectral features and the low temperature EPR spectra suggests that more than one spin state are involved.

  15. Free radical formation in chloramphenicol heated at different temperatures and the best thermal sterilization conditions - application of EPR spectroscopy and UV spectrophotometry.

    Science.gov (United States)

    Ramos, Paweł; Pilawa, Barbara

    2016-12-12

    Free radicals in thermally treated chloramphenicol were examined by electron paramagnetic resonance (EPR) spectroscopy. The parameters and shape of EPR spectra were analysed and free radical concentrations were obtained in the tested drug samples. Chloramphenicol was thermally sterilized at pharmacopeia conditions: 100 °C (120 min). Sterilization was also carried out at different conditions, 110 °C (60 min) and 120 °C (30 min), for comparison with pharmacopeia settings. Microbiological analysis was performed on the samples to confirm sterility. The aim of this work was to determine the concentration of free radicals in chloramphenicol following thermal sterilization at pharmacopeia conditions and compare this with other sets of conditions [110 °C (60 min) and 120 °C (30 min)]. The best conditions of thermal sterilization are determined as those that kill microorganisms and produce the lowest amounts of free radicals in this drug. It was concluded that the optimal temperatures and times for the thermal sterilization of chloramphenicol are 100 °C and 120 min and 110 °C and 60 min. A temperature of 120 °C coupled with a heating time of 30 min was rejected for thermal sterilization because of the high amount of free radicals produced by the drug samples.

  16. Interactions of short-acting, intermediate-acting and pre-mixed human insulins with free radicals--Comparative EPR examination.

    Science.gov (United States)

    Olczyk, Paweł; Komosinska-Vassev, Katarzyna; Ramos, Paweł; Mencner, Łukasz; Olczyk, Krystyna; Pilawa, Barbara

    2015-07-25

    Electron paramagnetic resonance (EPR) spectroscopy was used to examine insulins interactions with free radicals. Human recombinant DNA insulins of three groups were studied: short-acting insulin (Insuman Rapid); intermediate-acting insulins (Humulin N, Insuman Basal), and pre-mixed insulins (Humulin M3, Gensulin M50, Gensulin M40, Gensulin M30). The aim of an X-band (9.3GHz) study was comparative analysis of antioxidative properties of the three groups of human insulins. DPPH was used as a stable free radical model. Amplitudes of EPR lines of DPPH as the paramagnetic free radical reference, and DPPH interacting with the individual tested insulins were compared. For all the examined insulins kinetics of their interactions with free radicals up to 60 min were obtained. The strongest interactions with free radicals were observed for the short-acting insulin - Insuman Rapid. The lowest interactions with free radicals were characteristic for intermediate-acting insulin - Insuman Basal. The pre-mixed insulins i.e. Humulin M3 and Gensulin M50 revealed the fastest interactions with free radicals. The short acting, intermediate acting and premixed insulins have been found to be effective agents in reducing free radical formation in vitro and should be further considered as potential useful tools in attenuation of oxidative stress in diabetic patients. Copyright © 2015 Elsevier B.V. All rights reserved.

  17. The structure, magnetism and EPR spectra of a (μ-thiophenolato)(μ-pyrazolato-N,N') double bridged dicopper(II) complex.

    Science.gov (United States)

    Khadir, Narjes; Boghaei, Davar M; Assoud, Abdeljalil; Nascimento, Otaciro R; Nicotina, Amanda; Ghivelder, Luis; Calvo, Rafael

    2015-02-07

    A new binuclear copper(ii) complex, namely [Cu2L(pz)(DMSO)], where L = 2,6-bis[(2-phenoxy)iminomethyl]-4-methylthiophenolate(3-) and pz = pyrazolate ligand, has been synthesized by a one-pot synthesis involving copper(ii) acetate monohydrate, the S-protected ligand precursor 2-(N,N-dimethylthiocarbamato)-5-methylisophthalaldehyde di-2'-hydroxy anil, (), and pyrazole, in which a metal-promoted S-deprotection reaction occurs during the formation of the complex. This was characterized by routine physicochemical studies, single crystal X-ray diffraction and electron paramagnetic resonance (EPR) techniques. The structure analysis reveals that there are copper centres in two different environments, a slightly distorted square planar and a distorted square-pyramidal, arranged in binuclear units. The EPR study of these binuclear units performed at 9.4 GHz in the temperature range between 4 and 293 K shows an antiferromagnetic interaction between Cu(II) ions, and allows evaluating g factors gx = 2.068(1), gy = 2.091(1) and gz = 2.165(1), with = 2.108(1), an exchange coupling parameter J0 = -26(1) cm(-1) (defined as ), and a zero field splitting of the ground triplet state described by D = 86(2) × 10(-4) cm(-1) and E = -48(3) × 10(-4) cm(-1). These results are discussed and compared with the existing literature.

  18. Characterization of complexes metal-polymer by electron paramagnetic resonance (EPR); Caracterizacao de complexos polimero-metal por ressonancia paramagnetica eletronica (RPE)

    Energy Technology Data Exchange (ETDEWEB)

    Santos, Venina dos; Crespo, Janaina S.; Zeni, Mara [Universidade de Caxias do Sul, RS (Brazil). Centro de Ciencias Exatas e Tecnologia. Dept. de Fisica e Quimica]. E-mail: vsantos2@ucs.br; Mangrich, Antonio S. [Parana Univ., Curitiba, PR (Brazil). Dept. de Quimica

    2003-07-01

    In this work polymeric films of the polyvinyl alcohol (Pva) containing manganese ions (II) were investigated and analysed with enzymes were immobilized from photochemical process. The coordination and structural analysis of the compounds (Pva, Pva-Mn{sup 2+} and Pva-Mn{sup 2+}-enzyme) were all characterized by Electron Paramagnetic Resonance (EPR) and Infrared Spectroscopy (IR). The results EPR shows that the Pva is diamagnetic, films Pva-Mn{sup 2+} present specters complex of external sphere (g=2; A=96G). The commercial enzyme (DeniLite{sup TM} II S) presents a state triplet where two Cu{sup 2+} interact ferromagnetically. The enzyme when immobilized in the Pva-Mn{sup 2+} it causes to only one small widening of the line due the presence of the Cu{sup 2+}. The Pva-Mn{sup 2+} films present in the IR spectra an absorption at 715 cm{sup -1} attributed at the deformation in the PVA-Mn{sup 2+} complex in plane and out of plane. (author)

  19. Radical model of arsenic(III) toxicity: theoretical and EPR spin trapping studies.

    Science.gov (United States)

    Zamora, Pedro L; Rockenbauer, Antal; Villamena, Frederick A

    2014-05-19

    Arsenic is one of the most environmentally significant pollutants and a great global health concern. Although a growing body of evidence suggests that reactive oxygen species (ROS) mediate the mechanism of arsenic toxicity, the exact mechanism remains elusive. In this study, we examine the capacity of trivalent arsenic species arsenous acid (iAs(III)), monomethylarsonous acid (MMA(III)), and dimethylarsinous acid (DMA(III)) to generate ROS through a theoretical analysis of their structures, redox properties, and their reactivities to various ROS using a density functional theory (DFT) approach at the B3LYP/6-31+G**//B3LYP/6-31G* level of theory and by employing electron paramagnetic resonance (EPR) spin trapping studies using 5,5-dimethyl-1-pyrroline-N-oxide (DMPO) as a spin trap. Results show that the oxidized forms (As(IV)) are structurally more stable compared to the reduced forms (As(II)) that impart elongated As-O bonds leading to the formation of As(III) and hydroxide anion. Enthalpies of one-electron reduction and oxidation indicate that increasing the degree of methylation makes it harder for As(III) to be reduced but easier to be oxidized. The order of increasing favorability for arsenical activation by ROS is O2 redox pathways with concomitant generation of radicals. This is followed by MMA(III) and by iAs(III) being the least favorable. Spin trapping studies showed a higher propensity for methylated arsenicals to generate radicals than iAs(III) upon treatment with H2O2. However, in the presence of Fe(II,III), all showed radical generation where MMA(III) gave predominantly C-centered adducts, while acidified iAs (III) and DMA(III) gave primarily HO-adducts, and their formation was affected in the presence of SOD suggesting a As(III)-OO/OOH radical intermediate. Therefore, our results suggest a basis for the increased redox activity of methylated arsenicals that can be applied to the observed trends in arsenic methylation and toxicity in biological systems.

  20. Single Crystal X- and Q-Band EPR Spectroscopy of a Binuclear Mn2(III,IV) Complex Relevant to the Oxygen-Evolving Complex of Photosystem II

    OpenAIRE

    Yano, Junko; Sauer, Kenneth; Girerd, Jean-Jacques; Yachandra, Vittal K.

    2004-01-01

    The anisotropic g and hyperfine tensors of the Mn di-μ-oxo complex, [Mn2(III,IV)O2(phen)4](PF6)3·CH3CN, were derived by single-crystal EPR measurements at X- and Q-band frequencies. This is the first simulation of EPR parameters from single-crystal EPR spectra for multinuclear Mn complexes, which are of importance in several metalloenzymes; one of them is the oxygen-evolving complex in photosystem II (PS II). Single-crystal [Mn2(III,IV)O2(phen)4](PF6)3·CH3CN EPR spectra showed distinct resolv...