WorldWideScience

Sample records for vhf coherent scatter

  1. Phase and coherence analysis of VHF scintillation over Christmas Island

    Directory of Open Access Journals (Sweden)

    E. B. Shume

    2014-03-01

    Full Text Available This short paper presents phase and coherence data from the cross-wavelet transform applied on longitudinally separated very high frequency (VHF equatorial ionospheric scintillation observations over Christmas Island. The phase and coherence analyses were employed on a pair of scintillation observations, namely, the east-looking and west-looking VHF scintillation monitors at Christmas Island. Our analysis includes 3 years of peak season scintillation data from 2008, 2009 (low solar activity, and 2011 (moderate solar activity. In statistically significant and high spectral coherence regions of the cross-wavelet transform, scintillation observations from the east-looking monitor lead those from the west-looking monitor by about 20 to 60 (40 ± 20 min (most frequent lead times. Using several years (seasons and solar cycle of lead (or lag and coherence information of the cross-wavelet transform, we envisage construction of a probability model for forecasting scintillation in the nighttime equatorial ionosphere.

  2. Measurements and simulation of ionospheric scattering on VHF and UHF radar signals: Channel scattering function

    Science.gov (United States)

    Rogers, Neil C.; Cannon, Paul S.; Groves, Keith M.

    2009-02-01

    The design and operation of transionospheric VHF and UHF radars requires knowledge of amplitude and phase scintillation due to ionospheric scattering. Phase coherence is of particular importance where long coherent integration periods and large bandwidths are required. A thin phase screen, parabolic equation based, Trans-Ionospheric Radio Propagation Simulator (TIRPS) is described. Modeled channel scattering functions (CSFs) are compared to experimental VHF and UHF data derived from the Advanced Research Projects Agency Long-range Tracking and Instrumentation Radar on Kwajalein Island (9.4°N, 166.8°E). TIRPS quantitatively reproduces the experimental results, including the quasi-parabolic profile observed in the measured CSFs under strong turbulence conditions. Variations in the simulated CSF with ionospheric phase screen parameters are also presented. Under conditions of high integrated strength of turbulence (CkL), a low phase spectral index (p = 1), indicating relatively dense small-scale irregularities, produces pronounced range spreading. Conversely, when the spectral index is high (p = 4), indicative of strong focusing/defocusing by large-scale irregularities, there is increased Doppler spreading and, when the outer scale of irregularities is large, a greater likelihood of asymmetry of the CSF about the zero Doppler axis.

  3. An analysis on the mid-latitude scintillation and coherence frequency bandwidth using transionospheric VHF signals

    Energy Technology Data Exchange (ETDEWEB)

    Juang, Zhen [Los Alamos National Laboratory; Roussel-dupre, Robert [Los Alamos National Laboratory

    2008-01-01

    An analysis was perfonned on the mid-latitude scintillation and coherence frequency bandwidth (Fcoh) using transionospheric VHF signal data. The data include 1062 events spanning from November 1997 to June 2002. Each event records FORTE satellite received VHF signals from LAPP located at Los Alamos, New Mexico. Fcohs were derived to study scintillation characteristics on diurnal and seasonal variations, as well as changes due to solar and geomagnetic activities. Comparisons to the VHFIUHF coherence frequency bandwidth studies previously reported at equatorial and mid-latitude regions are made using a 4th power frequency dependence relationship. Furthennore, a wideband ionospheric scintillation model, WBMOD, was used to estimate Fcohs and compared with our VHF Fcoh values. Our analysis indicates mid-latitude scintillation characteristics that are not previously revealed. At the VHF bottom frequency range (3035 MHz), distinguished smaller Fcohs are found in time period from sunset to midnight, in wann season from May to August, and in low solar activity years. The effects of geomagnetic storm activity on Fcoh are characterized by a sudden transition at a Kp index of 50-60. Comparisons with median Fcohs estimated from other studies validated our VHF Fcohs for daytime while an order of magnitude larger Fcohs are found for nighttime, implying a time-dependent issue in applying the 4th order power relationship. Furthermore, comparisons with WBMOD-estimated Fcohs indicated generally matched median scintillation level estimates while differences do exist for those events undergoing high geomagnetic stonn activity which may imply underestimates of scintillation level by the WBMOD in the mid-latitude regions.

  4. Development of a Coherent Bistatic Vegetation Model for Signal of Opportunity Applications at VHF UHF-Bands

    Science.gov (United States)

    Kurum, Mehmet; Deshpande, Manohar; Joseph, Alicia T.; O'Neill, Peggy E.; Lang, Roger H.; Eroglu, Orhan

    2017-01-01

    A coherent bistatic vegetation scattering model, based on a Monte Carlo simulation, is being developed to simulate polarimetric bi-static reflectometry at VHF/UHF-bands (240-270 MHz). The model is aimed to assess the value of geostationary satellite signals of opportunity to enable estimation of the Earth's biomass and root-zone soil moisture. An expression for bistatic scattering from a vegetation canopy is derived for the practical case of a ground-based/low altitude platforms with passive receivers overlooking vegetation. Using analytical wave theory in conjunction with distorted Born approximation (DBA), the transmit and receive antennas effects (i.e., polarization, orientation, height, etc.) are explicitly accounted for. Both the coherency nature of the model (joint phase and amplitude information) and the explicit account of system parameters (antenna, altitude, polarization, etc) enable one to perform various beamforming techniques to evaluate realistic deployment configurations. In this paper, several test scenarios will be presented and the results will be evaluated for feasibility for future biomass and root-zone soil moisture application using geostationary communication satellite signals of opportunity at low frequencies.

  5. Simultaneous observation of sporadic E with a rapid-run ionosonde and VHF coherent backscatter radar

    Directory of Open Access Journals (Sweden)

    T. Maruyama

    2006-03-01

    Full Text Available During the SEEK 2 rocket campaign, ionograms were recorded every minute at the Yamagawa Radio Observatory at about 90km west of the region monitored by a VHF (very high frequency coherent backscatter radar. Sporadic E-layer parameters, which include the critical (foEs and blanketing (fbEs frequencies, the layer height (h'Es, and the width of the range spread of sporadic E-traces, were compared with RTI (range-time-intensity plots of VHF quasi-periodic (QP and continuous coherent backscatter echoes. A close relationship was found between the appearance of QP echoes in the RTI plots and the level of spatial inhomogeneity in sporadic E plasma, signified here by the difference between foEs and fbEs. During QP echo events, foEs increased while fbEs decreased, so that the difference foEs-fbEs was enhanced, indicating the development of strong spatial structuring in electron density within a sporadic E-layer. On the other hand, increases in sporadic E range spreading also correlated with the occurrence of QP echoes but the degree of correlation varied from event to event. Continuous radar echoes were observed in association with low altitude sporadic E-layers, located well below 100 km and at times as low as 90 km. During the continuous echo events, both foEs and fbEs were less variable, and the difference foEs-fbEs was small and not as dynamic as in the QP echoes. On the other hand, the Es-layer spread intensified during continuous echoes, which means that some patchiness or corrugation in those low altitude layers is also necessary for the continuous backscatter echoes to take place.

  6. Simultaneous observation of sporadic E with a rapid-run ionosonde and VHF coherent backscatter radar

    Directory of Open Access Journals (Sweden)

    T. Maruyama

    2006-03-01

    Full Text Available During the SEEK 2 rocket campaign, ionograms were recorded every minute at the Yamagawa Radio Observatory at about 90km west of the region monitored by a VHF (very high frequency coherent backscatter radar. Sporadic E-layer parameters, which include the critical (foEs and blanketing (fbEs frequencies, the layer height (h'Es, and the width of the range spread of sporadic E-traces, were compared with RTI (range-time-intensity plots of VHF quasi-periodic (QP and continuous coherent backscatter echoes. A close relationship was found between the appearance of QP echoes in the RTI plots and the level of spatial inhomogeneity in sporadic E plasma, signified here by the difference between foEs and fbEs. During QP echo events, foEs increased while fbEs decreased, so that the difference foEs-fbEs was enhanced, indicating the development of strong spatial structuring in electron density within a sporadic E-layer. On the other hand, increases in sporadic E range spreading also correlated with the occurrence of QP echoes but the degree of correlation varied from event to event. Continuous radar echoes were observed in association with low altitude sporadic E-layers, located well below 100 km and at times as low as 90 km. During the continuous echo events, both foEs and fbEs were less variable, and the difference foEs-fbEs was small and not as dynamic as in the QP echoes. On the other hand, the Es-layer spread intensified during continuous echoes, which means that some patchiness or corrugation in those low altitude layers is also necessary for the continuous backscatter echoes to take place.

  7. Contrast in coherent raman scattering microscopy

    NARCIS (Netherlands)

    Garbacik, E.T.

    2014-01-01

    Coherent anti-Stokes Raman scattering (CARS) microscopy is becoming a widely used technique for sub-micron, chemically-selective imaging at high rates of speed In this thesis I discuss three methods for increasing the specificity and selectivity of coherent Raman experiments. The first method is the

  8. Multiphoton Scattering Tomography with Coherent States.

    Science.gov (United States)

    Ramos, Tomás; García-Ripoll, Juan José

    2017-10-13

    In this work we develop an experimental procedure to interrogate the single- and multiphoton scattering matrices of an unknown quantum system interacting with propagating photons. Our proposal requires coherent state laser or microwave inputs and homodyne detection at the scatterer's output, and provides simultaneous information about multiple-elastic and inelastic-segments of the scattering matrix. The method is resilient to detector noise and its errors can be made arbitrarily small by combining experiments at various laser powers. Finally, we show that the tomography of scattering has to be performed using pulsed lasers to efficiently gather information about the nonlinear processes in the scatterer.

  9. Multiple and dependent scattering effects in Doppler optical coherence tomography

    NARCIS (Netherlands)

    Kalkman, J.; Bykov, A.V.; Faber, D.J.; van Leeuwen, Ton

    2010-01-01

    Doppler optical coherence tomography (OCT) is a technique to image tissue morphology and to measure flow in turbid media. In its most basic form, it is based on single (Mie) scattering. However, for highly scattering and dense media multiple and concentration dependent scattering can occur. For

  10. Heterodyne x-ray diffuse scattering from coherent phonons.

    Science.gov (United States)

    Kozina, M; Trigo, M; Chollet, M; Clark, J N; Glownia, J M; Gossard, A C; Henighan, T; Jiang, M P; Lu, H; Majumdar, A; Zhu, D; Reis, D A

    2017-09-01

    Here, we report Fourier-transform inelastic x-ray scattering measurements of photoexcited GaAs with embedded ErAs nanoparticles. We observe temporal oscillations in the x-ray scattering intensity, which we attribute to inelastic scattering from coherent acoustic phonons. Unlike in thermal equilibrium, where inelastic x-ray scattering is proportional to the phonon occupation, we show that the scattering is proportional to the phonon amplitude for coherent states. The wavevectors of the observed phonons extend beyond the excitation wavevector. The nanoparticles break the discrete translational symmetry of the lattice, enabling the generation of large wavevector coherent phonons. Elastic scattering of x-ray photons from the nanoparticles provides a reference for heterodyne mixing, yielding signals proportional to the phonon amplitude.

  11. Effects of finite laser coherence in quasielastic multiple scattering

    Science.gov (United States)

    Bellini, T.; Glaser, M. A.; Clark, N. A.; Degiorgio, V.

    1991-10-01

    We have studied the amplitude and temporal correlations of intensity fluctuations of multiply scattered light transmitted through a colloidal suspension. When the coherence length lc of the incident light becomes comparable to the width of the probability distribution of photon-path lengths, both the amplitude and dynamics of intensity fluctuations become functions of lc. In this article we present a simple theory that relates these coherence effects to the photon path-length distribution P(L). We have tested this theory using P(L) calculated from computer simulations and from the diffusion approximation, and find that our theory qualitatively accounts for the observed dependences on coherence length. Our results indicate when the effects of finite laser coherence must be taken into account in quasielastic multiple scattering. In the few-scattering regime of quasielastic multiple scattering, we find that the intensity autocorrelation function generally has a stretched-exponential form, and we discuss the origin of this behavior.

  12. Non-coherent continuum scattering as a line polarization mechanism

    Energy Technology Data Exchange (ETDEWEB)

    Del Pino Alemán, T.; Manso Sainz, R.; Trujillo Bueno, J., E-mail: tanausu@iac.es, E-mail: rsainz@iac.es, E-mail: jtb@iac.es [Instituto de Astrofísica de Canarias, E-38205 La Laguna, Tenerife (Spain)

    2014-03-20

    Line scattering polarization can be strongly affected by Rayleigh scattering at neutral hydrogen and Thomson scattering at free electrons. Often a depolarization of the continuum results, but the Doppler redistribution produced by the continuum scatterers, which are light (hence, fast), induces more complex interactions between the polarization in spectral lines and in the continuum. Here we formulate and solve the radiative transfer problem of scattering line polarization with non-coherent continuum scattering consistently. The problem is formulated within the spherical tensor representation of atomic and light polarization. The numerical method of solution is a generalization of the Accelerated Lambda Iteration that is applied to both the atomic system and the radiation field. We show that the redistribution of the spectral line radiation due to the non-coherence of the continuum scattering may modify the shape of the emergent fractional linear polarization patterns significantly, even yielding polarization signals above the continuum level in intrinsically unpolarizable lines.

  13. International workshop on phase retrieval and coherent scattering. Coherence 2005

    Energy Technology Data Exchange (ETDEWEB)

    Nugent, K.A.; Fienup, J.R.; Van Dyck, D.; Van Aert, S.; Weitkamp, T.; Diaz, A.; Pfeiffer, F.; Cloetens, P.; Stampanoni, M.; Bunk, O.; David, C.; Bronnikov, A.V.; Shen, Q.; Xiao, X.; Gureyev, T.E.; Nesterets, Ya.I.; Paganin, D.M.; Wilkins, S.W.; Mokso, R.; Cloetens, P.; Ludwig, W.; Hignette, O.; Maire, E.; Faulkner, H.M.L.; Rodenburg, J.M.; Wu, X.; Liu, H.; Grubel, G.; Ludwig, K.F.; Livet, F.; Bley, F.; Simon, J.P.; Caudron, R.; Le Bolloc' h, D.; Moussaid, A.; Gutt, C.; Sprung, M.; Madsen, A.; Tolan, M.; Sinha, S.K.; Scheffold, F.; Schurtenberger, P.; Robert, A.; Madsen, A.; Falus, P.; Borthwick, M.A.; Mochrie, S.G.J.; Livet, F.; Sutton, M.D.; Ehrburger-Dolle, F.; Bley, F.; Geissler, E.; Sikharulidze, I.; Jeu, W.H. de; Lurio, L.B.; Hu, X.; Jiao, X.; Jiang, Z.; Lurio, L.B.; Hu, X.; Jiao, X.; Jiang, Z.; Naryanan, S.; Sinha, S.K.; Lal, J.; Naryanan, S.; Sinha, S.K.; Lal, J.; Robinson, I.K.; Chapman, H.N.; Barty, A.; Beetz, T.; Cui, C.; Hajdu, J.; Hau-Riege, S.P.; He, H.; Stadler, L.M.; Sepiol, B.; Harder, R.; Robinson, I.K.; Zontone, F.; Vogl, G.; Howells, M.; London, R.; Marchesini, S.; Shapiro, D.; Spence, J.C.H.; Weierstall, U.; Eisebitt, S.; Shapiro, D.; Lima, E.; Elser, V.; Howells, M.R.; Huang, X.; Jacobsen, C.; Kirz, J.; Miao, H.; Neiman, A.; Sayre, D.; Thibault, P.; Vartanyants, I.A.; Robinson, I.K.; Onken, J.D.; Pfeifer, M.A.; Williams, G.J.; Pfeiffer, F.; Metzger, H.; Zhong, Z.; Bauer, G.; Nishino, Y.; Miao, J.; Kohmura, Y.; Yamamoto, M.; Takahashi, Y.; Koike, K.; Ebisuzaki, T.; Ishikawa, T.; Spence, J.C.H.; Doak, B

    2005-07-01

    The contributions of the participants have been organized into 3 topics: 1) phase retrieval methods, 2) X-ray photon correlation spectroscopy, and 3) coherent diffraction imaging. This document gathers the abstracts of the presentations and of the posters.

  14. On the angular dependence and scattering model of polar mesospheric summer echoes at VHF

    Science.gov (United States)

    Sommer, Svenja; Stober, Gunter; Chau, Jorge L.

    2016-01-01

    We present measurements of the angular dependence of polar mesospheric summer echoes (PMSE) with the Middle Atmosphere Alomar Radar System in Northern Norway (69.30° N, 16.04° E). Our results are based on multireceiver and multibeam observations using beam pointing directions with off-zenith angles up to 25° as well as on spatial correlation analysis (SCA) from vertical beam observations. We consider a beam filling effect at the upper and lower boundaries of PMSE in tilted beams, which determines the effective mean angle of arrival. Comparing the average power of the vertical beam to the oblique beams suggests that PMSE are mainly not as aspect sensitive as in contrast to previous studies. However, from SCA, times of enhanced correlation are found, indicating aspect sensitivity or a localized scattering mechanism. Our results suggest that PMSE consist of nonhomogeneous isotropic scattering and previously reported aspect sensitivity values might have been influenced by the inhomogeneous nature of PMSE.

  15. Optical Coherence Tomography and Biomolecular Imaging with Coherent Raman Scattering Microscopy

    DEFF Research Database (Denmark)

    Andersson-Engels, Stefan; Andersen, Peter E.

    2014-01-01

    The Special Section on Selected Topics in Biophotonics: Optical Coherence Tomography and Biomolecular Imaging with Coherent Raman Scattering Microscopy comprises two invited review papers and several contributed papers from the summer school Biophotonics ’13, as well as contributed papers within...

  16. Coherent multiple light scattering in Faraday active materials

    Science.gov (United States)

    Schertel, L.; Aubry, G. J.; Aegerter, C. M.; Maret, G.

    2017-05-01

    Wave propagation in multiple scattering media shows various kinds of coherent phenomena such as coherent backscattering [1, 2] or Anderson localization [3], both of which are intimately connected to the concept of reciprocity. Manipulating reciprocity in such media is a powerful tool to study these phenomena in experiments [4]. Here we discuss the manipulation of reciprocity in reflection and transmission geometry for the case of light propagation in magneto-optical media. We show new experiments on coherent backscattering and speckle correlations in strongly scattering samples containing Faraday active materials (CeF3) with transport mean free path in the μm range, at low temperatures (T < 10 K) and high fields (B = 18 T). Under such conditions we observe the effect of a Faraday rotation saturation in multiple scattering measurements.

  17. Coherent methods in X-ray scattering

    Energy Technology Data Exchange (ETDEWEB)

    Gorobtsov, Oleg

    2017-05-15

    X-ray radiation has been used to study structural properties of materials for more than a hundred years. Construction of extremely coherent and bright X-ray radiation sources such as free electron lasers (FELs) and latest generationstorage rings led to rapid development of experimental methods relying on high radiation coherence. These methods allow to perform revolutionary studies in a wide range of fields from solid state physics to biology. In this thesis I focus on several important problems connected with the coherent methods. The first part considers applications of dynamical diffraction theory on crystals to studies with coherent X-ray radiation. It presents the design of a high-resolution spectrometer for free electron lasers that should allow to resolve spectral structure of individual FEL pulses. The spectrometer is based on the principle of dynamical diffraction focusing. The knowledge of individual FEL pulse spectra is necessary for understanding FEL longitudinal coherence. In the same part I present quasi-kinematical approximation to dynamical theory which allows to treat analytically phase effects observed in X-ray coherent imaging on nanocrystals. These effects may play a big role when methods such as ptychography are used to study crystalline samples. The second part deals with measurements of FEL coherence properties using intensity - intensity interferometry. Results of several experiments performed at FELs FLASH and LCLS are revealed in this section. I have developed models and theories to explain the behavior observed in experiments on FLASH. These models allowed to extract information about external positional jitter of FEL pulses and secondary beams present in FEL radiation. In the LCLS experiment the Hanbury Brown and Twiss type interferometry was performed on Bragg peaks from colloidal crystal. This did not require additional measurements without the sample and information was extracted directly from diffraction patterns. Therefore intensity

  18. On the coherent scattering length of natural gadolinium

    CERN Document Server

    Frank, A I; Kulin, G V; Kulina, O V

    2002-01-01

    Using the reflection of thermal neutrons from the surface of plane sample the coherent scattering length of natural gadolinium was measured. Due to the closeness of resonances in radiation capture cross section the imaginary part of coherent scattering length strongly depends on neutron wavelength. Its real part can be expressed as a sum of Re(b)=b sub 0 + b(lambda). For the constant component of the real part we experimentally obtained the value b sub 0 =(11.5+-0.7)Fm. This result should be considered as a preliminary.

  19. Determination of optical scattering properties of highly-scattering media in optical coherence tomography images

    DEFF Research Database (Denmark)

    Levitz, D.; Thrane, L.; Frosz, Michael Henoch

    2004-01-01

    We developed a new algorithm that fits optical coherence tomography (OCT) signals as a function of depth to a general theoretical OCT model which takes into account multiple scattering effects. With use of this algorithm, it was possible to extract both the scattering coefficient and anisotropy...

  20. On measuring the neutron coherent scattering length with ultrahigh ...

    Indian Academy of Sciences (India)

    We propose an order of magnitude improvement in the present five parts in 105 precision of a nondispersive interferometric measurement of the neutron coherent scattering length c. For this purpose we make a judicious selection of the Bragg angle for the interferometer and the sample thickness. The precision is further ...

  1. Collective Excitations in Liquid Hydrogen Observed by Coherent Neutron Scattering

    DEFF Research Database (Denmark)

    da Costa Carneiro, Kim; Nielsen, M.; McTague, J. P.

    1973-01-01

    Coherent scattering of neutrons by liquid parahydrogen shows the existence of well-defined collective excitations in this liquid. Qualitative similarity with the scattering from liquid helium is found. Furthermore, in the range of observed wave vectors, 0.7 Å-1 ≤κ≤3.1 Å-1, extending from the firs...... through the third Brillouin zones in the solid, S(κ,ω) is remarkably similar to the scattering law expected from a polycrystal. For κ≤2.3 Å-1 the observed spectra satisfy the one-phonon sum rule with mean square displacement 〈u2〉=1.0 Å2....

  2. VHF volume-imaging radar observation of aspect-sensitive scatterers tilted in mountain waves above a convective boundary layer

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    2005-06-01

    Full Text Available Thin stable atmospheric layers cause VHF radars to receive increased echo power from near zenith. Layers can be tilted from horizontal, for instance by gravity waves, and the direction of VHF "glinting" is measurable by spatial domain interferometry or many-beam Doppler beam swinging (DBS. This paper uses the Middle and Upper atmosphere (MU radar, Shigaraki, Japan as a volume-imaging radar with 64-beam DBS, to show tilting of layers and air flow in mountain waves. Tilt of aspect-sensitive echo power from horizontal is nearly parallel to air flow, as assumed in earlier measurements of mountain-wave alignment. Vertical-wind measurements are self-consistent from different beam zenith angles, despite the combined effects of aspect sensitivity and horizontal-wind gradients.

  3. Multiple Scattering Model for Optical Coherence Tomography with Rytov Approximation

    KAUST Repository

    Li, Muxingzi

    2017-04-24

    Optical Coherence Tomography (OCT) is a coherence-gated, micrometer-resolution imaging technique that focuses a broadband near-infrared laser beam to penetrate into optical scattering media, e.g. biological tissues. The OCT resolution is split into two parts, with the axial resolution defined by half the coherence length, and the depth-dependent lateral resolution determined by the beam geometry, which is well described by a Gaussian beam model. The depth dependence of lateral resolution directly results in the defocusing effect outside the confocal region and restricts current OCT probes to small numerical aperture (NA) at the expense of lateral resolution near the focus. Another limitation on OCT development is the presence of a mixture of speckles due to multiple scatterers within the coherence length, and other random noise. Motivated by the above two challenges, a multiple scattering model based on Rytov approximation and Gaussian beam optics is proposed for the OCT setup. Some previous papers have adopted the first Born approximation with the assumption of small perturbation of the incident field in inhomogeneous media. The Rytov method of the same order with smooth phase perturbation assumption benefits from a wider spatial range of validity. A deconvolution method for solving the inverse problem associated with the first Rytov approximation is developed, significantly reducing the defocusing effect through depth and therefore extending the feasible range of NA.

  4. Effect of scattering on coherent anti-Stokes Raman scattering (CARS) signals.

    Science.gov (United States)

    Ranasinghesagara, Janaka C; De Vito, Giuseppe; Piazza, Vincenzo; Potma, Eric O; Venugopalan, Vasan

    2017-04-17

    We develop a computational framework to examine the factors responsible for scattering-induced distortions of coherent anti-Stokes Raman scattering (CARS) signals in turbid samples. We apply the Huygens-Fresnel wave-based electric field superposition (HF-WEFS) method combined with the radiating dipole approximation to compute the effects of scattering-induced distortions of focal excitation fields on the far-field CARS signal. We analyze the effect of spherical scatterers, placed in the vicinity of the focal volume, on the CARS signal emitted by different objects (2μm diameter solid sphere, 2μm diameter myelin cylinder and 2μm diameter myelin tube). We find that distortions in the CARS signals arise not only from attenuation of the focal field but also from scattering-induced changes in the spatial phase that modifies the angular distribution of the CARS emission. Our simulations further show that CARS signal attenuation can be minimized by using a high numerical aperture condenser. Moreover, unlike the CARS intensity image, CARS images formed by taking the ratio of CARS signals obtained using x- and y-polarized input fields is relatively insensitive to the effects of spherical scatterers. Our computational framework provide a mechanistic approach to characterizing scattering-induced distortions in coherent imaging of turbid media and may inspire bottom-up approaches for adaptive optical methods for image correction.

  5. Coherent Anti-Stokes and Coherent Stokes in Raman Scattering by Superconducting Nanowire Single-Photon Detector for Temperature Measurement

    Directory of Open Access Journals (Sweden)

    Annepu Venkata Naga Vamsi

    2016-01-01

    Full Text Available We have reported the measurement of temperature by using coherent anti-Stroke and coherent Stroke Raman scattering using superconducting nano wire single-photon detector. The measured temperatures by both methods (Coherent Anti-Raman scattering & Coherent Stroke Raman scattering and TC 340 are in good accuracy of ± 5 K temperature range. The length of the pipe line under test can be increased by increasing the power of the pump laser. This methodology can be widely used to measure temperatures at instantaneous positions in test pipe line or the entire temperature of the pipe line under test.

  6. Simulating Microwave Scattering for Wetland Vegetation in Poyang Lake, Southeast China, Using a Coherent Scattering Model

    Directory of Open Access Journals (Sweden)

    Jingjuan Liao

    2015-07-01

    Full Text Available We developed a polarimetric coherent electromagnetic scattering model for Poyang Lake wetland vegetation. Realistic canopy structures including curved leaves and the lodging situation of the vegetation were taken into account, and the situation at the ground surface was established using an Advanced Integral Equation Model combined with Oh’s 2002 model. This new model can reasonably describe the coherence effect caused by the phase differences of the electromagnetic fields scattered from different particles by different scattering mechanisms. We obtained good agreement between the modeling results and C-band data from the Radarsat-2 satellite. A simulation of scattering from the vegetation in Poyang Lake showed that direct vegetation scattering and the single-ground-bounce mechanism are the dominant scattering mechanisms in the C-band and L-band, while the effects of the double-ground-bounce mechanism are very small. We note that the curvature of the leaves and the lodging characteristics of the vegetation cannot be ignored in the modeling process. Monitoring soil moisture in the Poyang Lake wetland with the C-band data was not feasible because of the density and depth of Poyang Lake vegetation. When the density of Poyang Lake Carex increases, the backscattering coefficient either decreases or remains stable.

  7. Coherent and Incoherent Neutral Current Scattering for Supernova Detection

    Directory of Open Access Journals (Sweden)

    P. C. Divari

    2012-01-01

    Full Text Available The total cross sections as well as the neutrino event rates are calculated in the neutral current neutrino scattering off 40Ar and 132Xe isotopes at neutrino energies (Ev<100 MeV. The individual contribution coming from coherent and incoherent channels is taking into account. An enhancement of the neutral current component is achieved via the coherent (0gs+→0gs+ channel which is dominant with respect to incoherent (0gs+→Jf one. The response of the above isotopes as a supernova neutrino detection has been considered, assuming a two parameter Fermi-Dirac distribution for the supernova neutrino energy spectra. The calculated total cross sections are tested on a gaseous spherical TPC detector dedicated for supernova neutrino detection.

  8. Background studies for the MINER Coherent Neutrino Scattering reactor experiment

    Energy Technology Data Exchange (ETDEWEB)

    Agnolet, G.; Baker, W. [Department of Physics and Astronomy, and the Mitchell Institute for Fundamental Physics and Astronomy, Texas A& M University, College Station, TX 77843 (United States); Barker, D. [School of Physics & Astronomy, University of Minnesota, Minneapolis, MN 55455 (United States); Beck, R. [Department of Physics and Astronomy, and the Mitchell Institute for Fundamental Physics and Astronomy, Texas A& M University, College Station, TX 77843 (United States); Carroll, T.J.; Cesar, J. [Department of Physics, University of Texas at Austin, Austin, TX 78712 (United States); Cushman, P. [School of Physics & Astronomy, University of Minnesota, Minneapolis, MN 55455 (United States); Dent, J.B. [Department of Physics, University of Louisiana at Lafayette, Lafayette, LA 70504 (United States); De Rijck, S. [Department of Physics, University of Texas at Austin, Austin, TX 78712 (United States); Dutta, B. [Department of Physics and Astronomy, and the Mitchell Institute for Fundamental Physics and Astronomy, Texas A& M University, College Station, TX 77843 (United States); Flanagan, W. [Department of Physics, University of Texas at Austin, Austin, TX 78712 (United States); Fritts, M. [School of Physics & Astronomy, University of Minnesota, Minneapolis, MN 55455 (United States); Gao, Y. [Department of Physics and Astronomy, and the Mitchell Institute for Fundamental Physics and Astronomy, Texas A& M University, College Station, TX 77843 (United States); Department of Physics & Astronomy, Wayne State University, Detroit 48201 (United States); Harris, H.R.; Hays, C.C. [Department of Physics and Astronomy, and the Mitchell Institute for Fundamental Physics and Astronomy, Texas A& M University, College Station, TX 77843 (United States); Iyer, V. [School of Physical Sciences, National Institute of Science Education and Research, Jatni - 752050 (India); and others

    2017-05-01

    The proposed Mitchell Institute Neutrino Experiment at Reactor (MINER) experiment at the Nuclear Science Center at Texas A&M University will search for coherent elastic neutrino-nucleus scattering within close proximity (about 2 m) of a 1 MW TRIGA nuclear reactor core using low threshold, cryogenic germanium and silicon detectors. Given the Standard Model cross section of the scattering process and the proposed experimental proximity to the reactor, as many as 5–20 events/kg/day are expected. We discuss the status of preliminary measurements to characterize the main backgrounds for the proposed experiment. Both in situ measurements at the experimental site and simulations using the MCNP and GEANT4 codes are described. A strategy for monitoring backgrounds during data taking is briefly discussed.

  9. Tomographic imaging of bone composition using coherently scattered x rays

    Science.gov (United States)

    Batchelar, Deidre L.; Dabrowski, W.; Cunningham, Ian A.

    2000-04-01

    Bone tissue consists primarily of calcium hydroxyapatite crystals (bone mineral) and collagen fibrils. Bone mineral density (BMD) is commonly used as an indicator of bone health. Techniques available at present for assessing bone health provide a measure of BMD, but do not provide information about the degree of mineralization of the bone tissue. This may be adequate for assessing diseases in which the collagen-mineral ratio remains constant, as assumed in osteoporosis, but is insufficient when the mineralization state is known to change, as in osteomalacia. No tool exists for the in situ examination of collagen and hydroxyapatite density distributions independently. Coherent-scatter computed tomography (CSCT) is a technique we are developing that produces images of the low- angle scatter properties of tissue. These depend on the molecular structure of the scatterer making it possible to produce material-specific maps of each component in a conglomerate. After corrections to compensate for exposure fluctuations, self-attenuation of scatter and the temporal response of the image intensifier, material-specific images of mineral, collagen, fat and water distributions are obtained. The gray-level in these images provides the volumetric density of each component independently.

  10. Theory of Spatial Coherence in Near-Field Raman Scattering

    Directory of Open Access Journals (Sweden)

    Luiz Gustavo Cançado

    2014-09-01

    Full Text Available A theoretical study describing the coherence properties of near-field Raman scattering in two- and one-dimensional systems is presented. The model is applied to the Raman modes of pristine graphene and graphene edges. Our analysis is based on the tip-enhanced Raman scheme, in which a sharp metal tip located near the sample surface acts as a broadband optical antenna that transfers the information contained in the spatially correlated (but nonpropagating near field to the far field. The dependence of the scattered signal on the tip-sample separation is explored, and the theory predicts that the signal enhancement depends on the particular symmetry of a vibrational mode. The model can be applied to extract the correlation length L_{c} of optical phonons from experimentally recorded near-field Raman measurements. The coherence properties of optical phonons have been broadly explored in the time and frequency domains, and the spatially resolved approach presented here provides a complementary methodology for the study of local material properties at the nanoscale.

  11. Coherent backscattering and forward-scattering peaks in the quantum kicked rotor

    Science.gov (United States)

    Lemarié, G.; Müller, Cord A.; Guéry-Odelin, D.; Miniatura, C.

    2017-04-01

    We propose and analyze an experimental scheme using the quantum kicked rotor to observe the newly predicted coherent forward-scattering peak together with its long-known twin brother, the coherent backscattering peak. Contrary to coherent backscattering, which arises already under weak-localization conditions, coherent forward scattering is only triggered by Anderson or strong localization. So far, coherent forward scattering has not been observed in conservative systems with elastic scattering by spatial disorder. We propose to turn to the quantum kicked rotor, which has a long and successful history as an accurate experimental platform to observe dynamical localization, i.e., Anderson localization in momentum space. We analyze the coherent forward-scattering effect for the quantum kicked rotor by extensive numerical simulations, both in the orthogonal and unitary class of disordered quantum systems, and show that an experimental realization involving phase-space rotation techniques is within reach of state-of-the-art cold-atom experiments.

  12. Coherent anti-Stokes Raman scattering microscopy of single nanodiamonds

    Science.gov (United States)

    Pope, Iestyn; Payne, Lukas; Zoriniants, George; Thomas, Evan; Williams, Oliver; Watson, Peter; Langbein, Wolfgang; Borri, Paola

    2016-01-01

    Nanoparticles have attracted enormous attention for biomedical applications as optical labels, drug delivery vehicles, and contrast agents in vivo. In the quest for superior photostability and bio-compatibility, nanodiamonds (NDs) are considered one of the best choices due to their unique structural, chemical, mechanical, and optical properties. So far, mainly fluorescent NDs have been utilized for cell imaging. However, their use is limited by the efficiency and costs in reliably producing fluorescent defect centers with stable optical properties. Here, we show that single non-fluorescing NDs exhibit strong coherent anti-Stokes Raman scattering (CARS) at the sp3 vibrational resonance of diamond. Using correlative light and electron microscopy, the relationship between CARS signal strength and ND size is quantified. The calibrated CARS signal in turn enables the analysis of the number and size of NDs internalized in living cells in situ, which opens the exciting prospect of following complex cellular trafficking pathways quantitatively. PMID:25305746

  13. Coherent-form energy conservation relation for the elastic scattering of a guided mode in a symmetric scattering system.

    Science.gov (United States)

    Liu, Haitao

    2013-10-07

    We propose a coherent-form energy conservation relation (ECR) that is generally valid for the elastic transmission and reflection of a guided mode in a symmetric scattering system. In contrast with the classical incoherent-form ECR, |τ|2 + |ρ|2≤1 with τ and ρ denoting the elastic transmission and reflection coefficients of a guided mode, the coherent-form ECR is expressed as |τ + ρ|≤1, which imposes a constraint on a coherent superposition of the transmitted and reflected modes. The coherent-form ECR is rigorously demonstrated and is numerically tested by considering different types of modes in various scattering systems. Further discussions with the scattering matrix formalism indicate that two coherent-form ECRs, |τ + ρ|≤1 and |τ-ρ|≤1, along with the classical ECR |τ|2 + |ρ|2≤1 constitute a complete description of the energy conservation for the elastic scattering of a guided mode in a symmetric scattering system. The coherent-form ECR provides a common tool in terms of energy transfer for understanding and analyzing the scattering dynamics in currently interested scattering systems.

  14. Prospects for measuring coherent neutrino-nucleus elastic scattering at a stopped-pion neutrino source

    OpenAIRE

    Scholberg, Kate

    2005-01-01

    Rates of coherent neutrino-nucleus elastic scattering at a high-intensity stopped-pion neutrino source in various detector materials (relevant for novel low-threshold detectors) are calculated. Sensitivity of a coherent neutrino-nucleus elastic scattering experiment to new physics is also explored.

  15. Effect of Scatterering on Coherent Anti-Stokes Raman Scattering (CARS) signals

    CERN Document Server

    Ranasinghesagara, Janaka C; Piazza, Vincenzo; Potma, Eric O; Venugopalan, Vasan

    2016-01-01

    We develop a computational framework to examine the factors responsible for scattering-induced distortions of coherent anti-Stokes Raman scattering (CARS) signals in turbid samples. We use the Huygens-Fresnel Wave-based Electric Field Superposition (HF-WEFS) method combined with the radiating dipole approximation to compute the effects of scattering-induced distortions of focal excitation fields on the far-field CARS signal. We analyze the effect of spherical scatterers, placed in the vicinity of the focal volume, on the CARS signal emitted by different objects (2{\\mu}m diameter solid sphere, 2{\\mu}m diameter myelin cylinder and 2{\\mu}m diameter myelin tube). We find that distortions in the CARS signals arise not only from attenuation of the focal field but also from scattering-induced changes in the spatial phase that modifies the angular distribution of the CARS emission. Our simulations further show that CARS signal attenuation can be minimized by using a high numerical aperture condenser. Moreover, unlike...

  16. Interior tomographic imaging for x-ray coherent scattering (Conference Presentation)

    Science.gov (United States)

    Pang, Sean; Zhu, Zheyuan

    2017-05-01

    Conventional computed tomography reconstructs the attenuation only high-dimensional images. Coherent scatter computed tomography, which reconstructs the angular dependent scattering profiles of 3D objects, can provide molecular signatures that improves the accuracy of material identification and classification. Coherent scatter tomography are traditionally acquired by setups similar to x-ray powder diffraction machine; a collimated source in combination with 2D or 1D detector collimation in order to localize the scattering point. In addition, the coherent scatter cross-section is often 3 orders of magnitude lower than that of the absorption cross-section for the same material. Coded aperture and structured illumination approaches has been shown to greatly improve the collection efficiency. In many applications, especially in security imaging and medical diagnosis, fast and accurate identification of the material composition of a small volume within the whole object would lead to an accelerated imaging procedure and reduced radiation dose. Here, we report an imaging method to reconstruct the material coherent scatter profile within a small volume. The reconstruction along one radial direction can reconstruct a scalar coherent scattering tomographic image. Our methods takes advantage of the finite support of the scattering profile in small angle regime. Our system uses a pencil beam setup without using any detector side collimation. Coherent scatter profile of a 10 mm scattering sample embedded in a 30 mm diameter phantom was reconstructed. The setup has small form factor and is suitable for various portable non-destructive detection applications.

  17. Far-zone coherence changes of electromagnetic scattered field generated by an anisotropic particulate medium.

    Science.gov (United States)

    Peng, Xinyu; Ye, Dong; Zhou, Munchun; Xin, Yu; Song, Minmin

    2017-08-01

    The far-zone scattered field generated by an anisotropic particulate medium with electromagnetic plane incident waves is discussed. The analytical expressions of the spectral density and spectral degree of coherence of the scattered field are derived, which show that the coherence properties of the scattered field depend on the characteristics of each particle and the distribution of particles. By simulations of two special cases, i.e., anisotropic random particles with isotropic determinate distribution and isotropic determinate particles with anisotropic random distribution, the properties of the medium and the polarization states of the incident wave play roles in the distribution of the spectral degree of coherence of the scattered field. Moreover, the general condition, anisotropic particles with anisotropic distribution, is briefly discussed. By comparing the results generated by different parameters, the coherence changes of scattered field are found in the scattered field.

  18. SU-E-I-64: X-Ray Coherent Scatter Mammography Simulation

    Energy Technology Data Exchange (ETDEWEB)

    Hassan, L R; MacDonald, C A [University at Albany, SUNY, Albany, NY (United States)

    2014-06-01

    Purpose: Conventional mammography has poor contrast between healthy and cancerous tissues due to the small difference in attenuation properties. Coherent scatter potentially provides more information because interference of coherently scattered radiation depends on the average intermolecular spacing, and can be used to characterize tissue types. However, typical coherent scatter analysis techniques are not compatible with rapid low dose screening modalities. Coherent scatter slot scan imaging is a novel imaging technique which provides new information with higher contrast. In this work a simulation was performed of coherent scatter slot scan imaging to assess its performance and provide system optimization. Methods: In coherent scatter imaging, the coherent scatter is exploited using a conventional slot scan mammography system with anti-scatter grids tilted at the characteristic angle of cancerous tissues. A Monte Carlo simulation was used to simulate the coherent scatter imaging. System optimization was performed across several parameters, including source voltage and filtration, tilt angle, source and grid distances, grid ratio, and shielding geometry. Results: The contrast was high and increased as the grid tilt angle was increased beyond the characteristic angle for the modeled carcinoma, and as the source voltage increased. Source filtration did not have a significant effect on contrast. Increasing grid ratio improved contrast at the expense of decreasing the signal to noise ratio (SNR). As the tumor size is decreased, additional shields to block the fat signal are necessary in order to detect the cancer signal. Conclusion: Coherent scatter analysis using a wide slot setup is promising as an enhancement for screening mammography. This work was supported by National Institutes of Health, # 7 R01EB009715.

  19. Epi-detection of vibrational phase contrast coherent anti-Stokes Raman scattering

    NARCIS (Netherlands)

    Garbacik, E.T.; Korterik, Jeroen P.; Otto, Cornelis; Herek, Jennifer Lynn; Offerhaus, Herman L.

    2014-01-01

    We demonstrate a system for the phase-resolved epi-detection of coherent anti-Stokes Raman scattering (CARS) signals in highly scattering and/or thick samples. With this setup, we measure the complex vibrational responses of multiple components in a thick, highly-scattering pharmaceutical tablet in

  20. Coherent anti-Stokes Raman scattering under electric field stimulation

    Science.gov (United States)

    Capitaine, Erwan; Ould Moussa, Nawel; Louot, Christophe; Lefort, Claire; Pagnoux, Dominique; Duclère, Jean-René; Kaneyasu, Junya F.; Kano, Hideaki; Duponchel, Ludovic; Couderc, Vincent; Leproux, Philippe

    2016-12-01

    We introduce an experiment using electro-CARS, an electro-optical method based on the combination of ultrabroadband multiplex coherent anti-Stokes Raman scattering (M-CARS) spectroscopy and electric field stimulation. We demonstrate that this method can effectively discriminate the resonant CARS signal from the nonresonant background owing to a phenomenon of molecular orientation in the sample medium. Such molecular orientation is intrinsically related to the induction of an electric dipole moment by the applied static electric field. Evidence of the electro-CARS effect is obtained with a solution of n -alkanes (CnH2 n +2 , 15 ≤n ≤40 ), for which an enhancement of the CARS signal-to-noise ratio is achieved in the case of CH2 and CH3 symmetric/asymmetric stretching vibrations. Additionally, an electric-field-induced second-harmonic generation experiment is performed in order to corroborate the orientational organization of molecules due to the electric field excitation. Finally, we use a simple mathematical approach to compare the vibrational information extracted from electro-CARS measurements with spontaneous Raman data and to highlight the impact of electric stimulation on the vibrational signal.

  1. Degree of coherence in curvilinear coordinates and its application to scattering.

    Science.gov (United States)

    Tong, Zhisong

    2012-07-01

    In the traditional treatment of the spectral degree of coherence, the Cartesian coordinate system is deployed to describe the electromagnetic field. In the description of the far field scattered from random media, however, the spherical polar coordinates system is more suitably used due to the field's outgoing spherical form. We hence derive the expression for the spectral degree of coherence in the spherical polar coordinates system. An example of one polychromatic plane wave scattered by a collection of identical particles is given.

  2. Coherent Scattering Investigations at the Spallation Neutron Source: a Snowmass White Paper

    CERN Document Server

    Akimov, D; Barbeau, P; Barton, P; Bolozdynya, A; Cabrera-Palmer, B; Cavanna, F; Cianciolo, V; Collar, J; Cooper, R J; Dean, D; Efremenko, Y; Etenko, A; Fields, N; Foxe, M; Figueroa-Feliciano, E; Fomin, N; Gallmeier, F; Garishvili, I; Gerling, M; Green, M; Greene, G; Hatzikoutelis, A; Henning, R; Hix, R; Hogan, D; Hornback, D; Jovanovic, I; Hossbach, T; Iverson, E; Klein, S R; Khromov, A; Link, J; Louis, W; Lu, W; Mauger, C; Marleau, P; Markoff, D; Martin, R D; Mueller, P; Newby, J; Orrell, J; O'Shaughnessy, C; Pentilla, S; Patton, K; Poon, A W; Radford, D; Reyna, D; Ray, H; Scholberg, K; Sosnovtsev, V; Tayloe, R; Vetter, K; Virtue, C; Wilkerson, J; Yoo, J; Yu, C H

    2013-01-01

    The Spallation Neutron Source (SNS) at Oak Ridge National Laboratory, Tennessee, provides an intense flux of neutrinos in the few tens-of-MeV range, with a sharply-pulsed timing structure that is beneficial for background rejection. In this white paper, we describe how the SNS source can be used for a measurement of coherent elastic neutrino-nucleus scattering (CENNS), and the physics reach of different phases of such an experimental program (CSI: Coherent Scattering Investigations at the SNS).

  3. Monte Carlo simulations of a novel coherent scatter materials discrimination system

    Science.gov (United States)

    Hassan, Laila; Starr-Baier, Sean; MacDonald, C. A.; Petruccelli, Jonathan C.

    2017-05-01

    X-ray coherent scatter imaging has the potential to improve the detection of liquid and powder materials of concern in security screening. While x-ray attenuation is dependent on atomic number, coherent scatter is highly dependent on the characteristic angle for the target material, and thus offers an additional discrimination. Conventional coherent scatter analysis requires pixel-by-pixel scanning, and so could be prohibitively slow for security applications. A novel slot scan system has been developed to provide rapid imaging of the coherent scatter at selected angles of interest, simultaneously with the conventional absorption images. Prior experimental results showed promising capability. In this work, Monte Carlo simulations were performed to assess discrimination capability and provide system optimization. Simulation analysis performed using the measured ring profiles for an array of powders and liquids, including water, ethanol and peroxide. For example, simulations yielded a signal-to-background ratio of 1.63+/-0.08 for a sample consisting of two 10 mm diameter vials, one containing ethanol (signal) and one water (background). This high SBR value is due to the high angular separation of the coherent scatter between the two liquids. The results indicate that the addition of coherent scatter information to single or dual energy attenuation images improves the discrimination of materials of interest.

  4. Scattering of coherent sound waves by atmospheric turbulence

    Science.gov (United States)

    Chow, P. L.; Liu, C. H.; Maestrello, L.

    1975-01-01

    An analytical study of the propagation of coherent sound waves through an atmosphere containing both mean and fluctuating flow variables is presented. The general flow problem is formulated as a time-dependent wave propagation in a half-space containing the turbulent medium. The coherent acoustic waves are analyzed by a smoothing technique, assuming that mean flow variables vary with the height only. The general equations for the coherent waves are derived, and then applied to two special cases, corresponding to uniform and shear mean flow, respectively. The results show that mean shear and turbulence introduce pronounced effects on the propagation of coherent acoustic disturbances.

  5. Coherent anti-Stokes Raman scattering microscopy for pharmaceutics: a shift in the right direction

    NARCIS (Netherlands)

    Fussell, A.L.

    2014-01-01

    This dissertation demonstrates coherent anti-Stokes Raman scattering (CARS) microscopy as a tool in pharmaceutical solid state development. CARS microscopy is a nonlinear optical imaging technique that uses inelastic scattering of light to provide chemically specific imaging. CARS microscopy is

  6. Coherent Resonant Soft X-ray Scattering Study of Magnetic Textures in FeGe

    Directory of Open Access Journals (Sweden)

    Victor Ukleev

    2018-01-01

    Full Text Available Coherent resonant soft X-ray scattering was utilized to examine the magnetic textures in a thin plate of the cubic B20 compound FeGe. Small-angle scattering patterns were measured with controlled temperatures and magnetic fields exhibiting magnetic scattering from a helical texture and skyrmion lattice. By measuring the scattering pattern in a saturation magnetic field, magnetic and charge scattering were distinguished and an iterative phase retrieval algorithm was applied to reconstruct the magnetic texture in the real-space. Results of the real-space reconstruction of magnetic texture from two independently measured datasets were used to compare the reliability of the retrieval.

  7. Vertical spatial coherence model for a transient signal forward-scattered from the sea surface

    Science.gov (United States)

    Yoerger, E.J.; McDaniel, S.T.

    1996-01-01

    The treatment of acoustic energy forward scattered from the sea surface, which is modeled as a random communications scatter channel, is the basis for developing an expression for the time-dependent coherence function across a vertical receiving array. The derivation of this model uses linear filter theory applied to the Fresnel-corrected Kirchhoff approximation in obtaining an equation for the covariance function for the forward-scattered problem. The resulting formulation is used to study the dependence of the covariance on experimental and environmental factors. The modeled coherence functions are then formed for various geometrical and environmental parameters and compared to experimental data.

  8. Delayed coherent quantum feedback from a scattering theory and a matrix product state perspective

    Science.gov (United States)

    Guimond, P.-O.; Pletyukhov, M.; Pichler, H.; Zoller, P.

    2017-12-01

    We study the scattering of photons propagating in a semi-infinite waveguide terminated by a mirror and interacting with a quantum emitter. This paradigm constitutes an example of coherent quantum feedback, where light emitted towards the mirror gets redirected back to the emitter. We derive an analytical solution for the scattering of two-photon states, which is based on an exact resummation of the perturbative expansion of the scattering matrix, in a regime where the time delay of the coherent feedback is comparable to the timescale of the quantum emitter’s dynamics. We compare the results with numerical simulations based on matrix product state techniques simulating the full dynamics of the system, and extend the study to the scattering of coherent states beyond the low-power limit.

  9. Coherent light scattering of heterogeneous randomly rough films and effective medium in the theory of electromagnetic wave multiple scattering

    Energy Technology Data Exchange (ETDEWEB)

    Berginc, G [THALES, 2 avenue Gay-Lussac 78995 ELANCOURT (France)

    2013-11-30

    We have developed a general formalism based on Green's functions to calculate the coherent electromagnetic field scattered by a random medium with rough boundaries. The approximate expression derived makes it possible to determine the effective permittivity, which is generalised for a layer of an inhomogeneous random medium with different types of particles and bounded with randomly rough interfaces. This effective permittivity describes the coherent propagation of an electromagnetic wave in a random medium with randomly rough boundaries. We have obtained an expression, which contains the Maxwell – Garnett formula at the low-frequency limit, and the Keller formula; the latter has been proved to be in good agreement with experiments for particles whose dimensions are larger than a wavelength. (coherent light scattering)

  10. X-ray coherent scattering tomography of textured material (Conference Presentation)

    Science.gov (United States)

    Zhu, Zheyuan; Pang, Shuo

    2017-05-01

    Small-angle X-ray scattering (SAXS) measures the signature of angular-dependent coherently scattered X-rays, which contains richer information in material composition and structure compared to conventional absorption-based computed tomography. SAXS image reconstruction method of a 2 or 3 dimensional object based on computed tomography, termed as coherent scattering computed tomography (CSCT), enables the detection of spatially-resolved, material-specific isotropic scattering signature inside an extended object, and provides improved contrast for medical diagnosis, security screening, and material characterization applications. However, traditional CSCT methods assumes materials are fine powders or amorphous, and possess isotropic scattering profiles, which is not generally true for all materials. Anisotropic scatters cannot be captured using conventional CSCT method and result in reconstruction errors. To obtain correct information from the sample, we designed new imaging strategy which incorporates extra degree of detector motion into X-ray scattering tomography for the detection of anisotropic scattered photons from a series of two-dimensional intensity measurements. Using a table-top, narrow-band X-ray source and a panel detector, we demonstrate the anisotropic scattering profile captured from an extended object and the reconstruction of a three-dimensional object. For materials possessing a well-organized crystalline structure with certain symmetry, the scatter texture is more predictable. We will also discuss the compressive schemes and implementation of data acquisition to improve the collection efficiency and accelerate the imaging process.

  11. Modeling and Measurement of Spatial Coherence for Normal Incidence Seafloor Scattering

    Science.gov (United States)

    Brown, Daniel C.

    A small body of literature exists regarding the spatial coherence of the incoherent (or non-specular) component of the field scattered from the sea floor. Within this literature, the seafloor is described using simple models that consider only one or two properties that determine the spatial coherence. Additionally, the literature has focused on describing the average spatial coherence over an ensemble of seafloor realizations. The variability of the coherence that is observed for individual pings has been described neither theoretically nor through experimental observation. This research has extended the existing models for the mean spatial coherence to include a broader range of physical processes that determine the coherence of the field scattered from the seafloor near normal incidence. In particular, the effects of sensor directivity, seafloor slope, sediment scattering strength, interface transmission coefficient, sediment attenuation coefficient, sediment layer thickness, and temporal windowing have been explored. This is accomplished through the development of a model for the spatial coherence that is based upon the van Cittert-Zernike theorem. The results of this modeling show that in many realistic scenarios it is a combination of multiple parameters that determine the observed spatial coherence. This represents a significant extension in understanding that reaches beyond those processes that have been described previously. In particular, the application of a temporal window was found to have a significant impact on the spatial coherence in many scenarios. This research provides the first documentation of this effect. In addition to the modeling effort, an experiment was conducted where the spatial coherence is measured for scattering from the lake bed at Seneca Lake, New York. In this experiment, the spatial coherence of the scattered field was measured over a number of pings. This data set was used to form an ensemble that compares favorably to

  12. Scattering of a partially-coherent wave from a material circular cylinder.

    Science.gov (United States)

    Hyde, Milo W; Bogle, Andrew E; Havrilla, Michael J

    2013-12-30

    The case of a partially-coherent wave scattered from a material circular cylinder is investigated. Expressions for the TMz and TEz scattered-field cross-spectral density functions are derived by utilizing the plane-wave spectrum representation of electromagnetic fields and cylindrical wave transformations. From the analytical scattered-field cross-spectral density functions, the mean scattering widths are derived and subsequently validated via comparison with those computed from Method of Moments Monte Carlo simulations. The analytical relations as well as the simulation results are discussed and physically interpreted. Key insights are noted and subsequently analyzed.

  13. Path-length-multiplexed scattering-angle-diverse optical coherence tomography for retinal imaging.

    Science.gov (United States)

    Wang, Bingqing; Yin, Biwei; Dwelle, Jordan; Rylander, H Grady; Markey, Mia K; Milner, Thomas E

    2013-11-01

    A low-resolution path-length-multiplexed scattering angle diverse optical coherence tomography (PM-SAD-OCT) is constructed to investigate the scattering properties of the retinal nerve fiber layer (RNFL). Low-resolution PM-SAD-OCT retinal images acquired from a healthy human subject show the variation of RNFL scattering properties at retinal locations around the optic nerve head. The results are consistent with known retinal ganglion cell neural anatomy and principles of light scattering. Application of PM-SAD-OCT may provide potentially valuable diagnostic information for clinical retinal imaging.

  14. Coherent and spontaneous Rayleigh-Brillouin scattering in atomic and molecular gases and gas mixtures

    OpenAIRE

    Vieitez, MO; van Duijn; Ubachs, W.; Witschas, B.; Meijer, A.; Wijn, De, JR; Dam, NJ Nico; Water, van de, W Willem

    2010-01-01

    We study Rayleigh-Brillouin scattering in gases of N2, O2, and SF6 molecules, Kr atoms, and He-Xe and He-CO2 mixtures at pressures ranging from 1 to 3 bar and using two different experimental setups. In one setup, we measure spectra of light scattered by thermal density fluctuations (spontaneous Rayleigh-Brillouin scattering); in the second setup density waves are induced in the overlap region of two counterpropagating laser beams (coherent Rayleigh-Brillouin scattering).We compare measured s...

  15. A coupled bispectral, temporal and spatial coherence function of the pressure field, scattered from a moving sea surface (A)

    DEFF Research Database (Denmark)

    Bjerrum-Niese, Christian; Jensen, Leif Bjørnø

    1995-01-01

    Fluctuations in the scattering of high-frequency sound from the moving sea surface is of significance, particularly in underwater acoustic communication systems using adaptive methods. Surface scattering may statistically be described using coherence functions, especially for higher frequencies...

  16. Coherent anti-Stokes Raman scattering microscopy with a photonic crystal fiber based light source

    DEFF Research Database (Denmark)

    Paulsen, H.N.; Hilligsøe, Karen Marie; Thøgersen, J.

    2003-01-01

    A coherent anti-Stokes Raman scattering microscope based on a Ti:sapphire femtosecond oscillator and a photonic crystal fiber is demonstrated. The nonlinear response of the fiber is used to generate the additional wavelength needed in the Raman process. The applicability of the setup is demonstra......A coherent anti-Stokes Raman scattering microscope based on a Ti:sapphire femtosecond oscillator and a photonic crystal fiber is demonstrated. The nonlinear response of the fiber is used to generate the additional wavelength needed in the Raman process. The applicability of the setup...

  17. Coherent electromagnetic waves in the presence of a half space of randomly distributed scatterers

    Science.gov (United States)

    Karam, M. A.; Fung, A. K.

    1988-01-01

    The present investigation of coherent field propagation notes, upon solving the Foldy-Twersky integral equation for a half-space of small spherical scatterers illuminated by a plane wave at oblique incidence, that the coherent field for a horizontally-polarized incident wave exhibits reflectivity and transmissivity consistent with the Fresnel formula for an equivalent continuous effective medium. In the case of a vertically polarized incident wave, both the vertical and longitudinal waves obtained for the coherent field have reflectivities and transmissivities that do not agree with the Fresnel formula.

  18. Anatomically diverse butterfly scales all produce structural colours by coherent scattering.

    Science.gov (United States)

    Prum, Richard O; Quinn, Tim; Torres, Rodolfo H

    2006-02-01

    The structural colours of butterflies and moths (Lepidoptera) have been attributed to a diversity of physical mechanisms, including multilayer interference, diffraction, Bragg scattering, Tyndall scattering and Rayleigh scattering. We used fibre optic spectrophotometry, transmission electron microscopy (TEM) and 2D Fourier analysis to investigate the physical mechanisms of structural colour production in twelve lepidopteran species from four families, representing all of the previously proposed anatomical and optical classes of butterfly nanostructure. The 2D Fourier analyses of TEMs of colour producing butterfly scales document that all species are appropriately nanostructured to produce visible colours by coherent scattering, i.e. differential interference and reinforcement of scattered, visible wavelengths. Previously hypothesized to produce a blue colour by incoherent, Tyndall scattering, the scales of Papilio zalmoxis are not appropriately nanostructured for incoherent scattering. Rather, available data indicate that the blue of P. zalmoxis is a fluorescent pigmentary colour. Despite their nanoscale anatomical diversity, all structurally coloured butterfly scales share a single fundamental physical color production mechanism - coherent scattering. Recognition of this commonality provides a new perspective on how the nanostructure and optical properties of structurally coloured butterfly scales evolved and diversified among and within lepidopteran clades.

  19. Path length distribution of multiple-scattered photons by low coherence Doppler interferometry

    NARCIS (Netherlands)

    Petoukhova, Anna; Steenbergen, Wiendelt; de Mul, F.F.M.; Tuchin, V.V.; Izatt, J.A.; Fujimoto, J.G.

    2002-01-01

    We report results of measurements by low coherence Doppler interferometry of the path length distribution of photons undergoing multiple scattering in a highly turbid medium. We use a Mach-Zehnder interferometer with multimode graded index fibers and a superluminescent diode as light source. The

  20. Vibrational Phase Contrast Microscopy by Use of Coherent Anti-Stokes Raman Scattering

    NARCIS (Netherlands)

    Jurna, M.; Korterik, Jeroen P.; Otto, Cornelis; Herek, Jennifer Lynn; Offerhaus, Herman L.

    2009-01-01

    In biological samples the resonant coherent anti-Stokes Raman scattering signal of less abundant constituents can be overwhelmed by the nonresonant background, preventing detection of those molecules. We demonstrate a method to obtain the phase of the oscillators in the focal volume that allows

  1. Rapid identification of heterogeneous mixture components with hyperspectral coherent anti-Stokes Raman scattering imaging

    NARCIS (Netherlands)

    Garbacik, E.T.; Herek, Jennifer Lynn; Otto, Cornelis; Offerhaus, Herman L.

    2012-01-01

    For the rapid analysis of complicated heterogeneous mixtures, we have developed a method to acquire and intuitively display hyperspectral coherent anti-Stokes Raman scattering (CARS) images. The imaging is performed with a conventional optical setup based around an optical parametric oscillator.

  2. Effects of absorption on coherence domain path length resolved dynamic light scattering in the diffuse regime

    NARCIS (Netherlands)

    Petoukhova, Anna; Steenbergen, Wiendelt; van Leeuwen, Ton; de Mul, F.F.M.

    2002-01-01

    A low coherence Mach–Zehnder interferometer is developed for path length resolved dynamic light scattering in highly turbid media. The path length distribution of multiply scatteredphotons in Intralipid is changed by the addition of absorbing dyes. Path length distributions obtained for various

  3. Coherent anti-Stokes Raman scattering microscopy for quantitative characterization of mixing and flow in microfluidics

    NARCIS (Netherlands)

    Schafer, D.; Müller, M.; Bonn, M.; Marr, D.W.M.; van Maarseveen, J.; Squier, J.

    2009-01-01

    We present an optical, noninvasive and label-free approach to characterize flow profiles in microfluidic devices. Coherent anti-Stokes Raman scattering signals were used to map the mass transport in a microfluidic device that was then related back to the local flow rate of dilute solutes having

  4. Coherent anti-Stokes Raman scattering (CARS) microscopy driving the future of loaded mesoporous silica imaging

    NARCIS (Netherlands)

    Fussell, A.L.; Mah, Pei Ting; Offerhaus, Herman L.; Niemi, Sanna-Mari; Salonen, Jarno; Santos, Helder A.; Strachan, Clare

    2014-01-01

    This study reports the use of variants of coherent anti-Stokes Raman scattering (CARS) microscopy as a novel method for improved physicochemical characterization of drug-loaded silica particles. Ordered mesoporous silica is a biomaterial that can be loaded to carry a number of biochemicals,

  5. Completely background free broadband coherent anti-Stokes Raman scattering spectroscopy

    DEFF Research Database (Denmark)

    Liu, Xing; Niu, Hanben; Liu, Wei

    2013-01-01

    For the first time it was proposed a numerical approach to obtain non-NRB time-frequency coherent anti-Stokes Raman scattering (CARS) spectrograms. In order to evaluate the validity of the CARS spectrogram for background free broadband CARS spectroscopy, the authors numerically constructed a CARS...

  6. Acoustic Coherent Backscatter Enhancement from Aggregations of Point Scatterers

    Science.gov (United States)

    2014-09-30

    one computational element assigned to each scatterer. The computational burden of this approach is set by the inversion of the fully-populated N-by-N...B(φ) is the beamformed output of the receiving array, and [B]excluding peak is the array’s average beamformed output in directions near backscatter...but excluding the ACBE peak. The independent parameters of these investigations are A, k0, σs, s, R, L, φ or ϕ, X, Y, and Z, but the current problem

  7. On the relationship between aspect sensitivity, wave activity, andmultiple scattering centers of mesosphere summer echoes: a case study using coherent radar imaging

    Directory of Open Access Journals (Sweden)

    J.-S. Chen

    2004-03-01

    Full Text Available A mesosphere-summer-echo layer, observed by the OSWIN VHF radar (54.1°N, 11.8°E with vertical and 7° oblique radar beams, was examined using the method of coherent radar imaging (CRI. We disclosed the echo events having multiple scattering centers (MSC in the radar volume by means of the high angular resolution of the CRI technique and found that the MSC events occurred more frequently in the upper portion of the echo layer. More examinations showed that the characteristics were different between the upper and lower portions of the layer. For example, the differences in echo power between vertical and oblique beams changed mostly from positive to negative along the increase of altitude, and strong turbulent echoes were seen in the upper portion of the layer. These observations indicate that the aspect sensitivity of the echoes became less and less with the increase of altitude. Moreover, the scattering centers of the echoes were close to zenith for the lower portion of the layer but were usually several degrees from the zenith for the upper portion of the layer. Observable wave-like variation in the scattering center was also seen in the upper part of the layer. Based on these features, we drew some conclusions for this case study: (a the MSC events might result from the slanted layer/anisotropic structure tilted by short-wave activities, (b the tilt angle of the layer structure could be 6°–10°, causing the echo power received by the 7° oblique beam was larger than or comparable to that received by the vertical beam, and (c short-wave activities not only tilted the layer structure, but also induced isotropic irregularities.

    Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics. Radio science (interferometry; instruments and techniques

  8. Tissue Equivalent Phantom Design for Characterization of a Coherent Scatter X-ray Imaging System

    Science.gov (United States)

    Albanese, Kathryn Elizabeth

    Scatter in medical imaging is typically cast off as image-related noise that detracts from meaningful diagnosis. It is therefore typically rejected or removed from medical images. However, it has been found that every material, including cancerous tissue, has a unique X-ray coherent scatter signature that can be used to identify the material or tissue. Such scatter-based tissue-identification provides the advantage of locating and identifying particular materials over conventional anatomical imaging through X-ray radiography. A coded aperture X-ray coherent scatter spectral imaging system has been developed in our group to classify different tissue types based on their unique scatter signatures. Previous experiments using our prototype have demonstrated that the depth-resolved coherent scatter spectral imaging system (CACSSI) can discriminate healthy and cancerous tissue present in the path of a non-destructive x-ray beam. A key to the successful optimization of CACSSI as a clinical imaging method is to obtain anatomically accurate phantoms of the human body. This thesis describes the development and fabrication of 3D printed anatomical scatter phantoms of the breast and lung. The purpose of this work is to accurately model different breast geometries using a tissue equivalent phantom, and to classify these tissues in a coherent x-ray scatter imaging system. Tissue-equivalent anatomical phantoms were designed to assess the capability of the CACSSI system to classify different types of breast tissue (adipose, fibroglandular, malignant). These phantoms were 3D printed based on DICOM data obtained from CT scans of prone breasts. The phantoms were tested through comparison of measured scatter signatures with those of adipose and fibroglandular tissue from literature. Tumors in the phantom were modeled using a variety of biological tissue including actual surgically excised benign and malignant tissue specimens. Lung based phantoms have also been printed for future

  9. Coherent and spontaneous Rayleigh-Brillouin scattering in atomic and molecular gases and gas mixtures

    Science.gov (United States)

    Vieitez, M. O.; van Duijn, E. J.; Ubachs, W.; Witschas, B.; Meijer, A.; de Wijn, A. S.; Dam, N. J.; van de Water, W.

    2010-10-01

    We study Rayleigh-Brillouin scattering in gases of N2, O2, and SF6 molecules, Kr atoms, and He-Xe and He-CO2 mixtures at pressures ranging from 1 to 3 bar and using two different experimental setups. In one setup, we measure spectra of light scattered by thermal density fluctuations (spontaneous Rayleigh-Brillouin scattering); in the second setup density waves are induced in the overlap region of two counterpropagating laser beams (coherent Rayleigh-Brillouin scattering). We compare measured spectra to the Tenti models and to a recent model for mixtures. We find new values of the bulk viscosity, which is a parameter in line-shape models that allows for internal degrees of freedom. Both experiments agree on the value of the bulk viscosity. Our results indicate a need for new line-shape models for mixtures of molecules with internal degrees of freedom.

  10. T-matrix based inverse light scattering analysis using angle resolved low coherence interferometry

    Science.gov (United States)

    Giacomelli, Michael; Chalut, Kevin; Ostrander, Julie; Wax, Adam

    2009-02-01

    Inverse light scattering methods have been applied by several groups as a means to probe cellular structure in both clinical and scientific applications with sub-wavelength accuracy. These methods determine the geometric properties of tissue scatterers based on far field scattering patterns. Generally, structure is determined by measuring scattering over some range of angles, wavelengths, or polarizations and then fitting the observed data to a database of simulated scattering selected from a range of probable geometries. We have developed new light scattering software based on the T-matrix method that creates databases of scattering from spheroidal objects, representing a substantial improvement over Mie theory, a method limited to simulating scattering from spheres. The computational cost of the T-matrix method is addressed through a simple but massively parallel program that concurrently simulates scattering across hundreds of PCs. We are exploring the use of these T-matrix databases in inverting interferometric measurements of angle-resolved scattering from spheroidal cell nuclei using a technique called angle-resolved low coherence interferometry (a/LCI). With a/LCI, we have previously distinguished between healthy and dysplastic tissue in both cell cultures and in ex vivo rat and hamster tissue using Mie theory to measure nuclear diameter. We now present nuclear volume and spheroidal aspect ratio measurements of unstained, living MCF7 cells using the improved T-matrix database to analyze a/LCI data. We achieve measurement accuracy equivalent to conventional image analysis of stained samples. We will further validate the approach by comparing experimental measurements of scattering from polystyrene microspheroids, and show that the T-matrix is a suitable replacement for Mie theory in ex vivo tissue samples.

  11. Distributed fiber temperature and strain sensor using coherent radio-frequency detection of spontaneous Brillouin scattering

    Science.gov (United States)

    Geng, Jihong; Staines, Sean; Blake, Mike; Jiang, Shibin

    2007-08-01

    A novel technique that enables coherent detection of spontaneous Brillouin scattering in the radio-frequency (<500 MHz) region with excellent long-term stability has been demonstrated for distributed measurements of temperature and strain in long fiber. An actively stabilized single-frequency Brillouin fiber laser with extremely low phase noise and intensity noise is used as a well-defined, frequency-shifted local oscillator for the heterodyne detection, yielding measurements of spontaneous Brillouin scattering with high frequency stability. Based on this approach, a highly stable real-time fiber sensor for distributed measurements of both temperature and strain over long fiber has been developed utilizing advanced digital signal processing techniques.

  12. A versatile setup using femtosecond adaptive spectroscopic techniques for coherent anti-Stokes Raman scattering

    Energy Technology Data Exchange (ETDEWEB)

    Shen, Yujie, E-mail: styojm@physics.tamu.edu [Texas A& M University, College Station, Texas 77843 (United States); Voronine, Dmitri V.; Sokolov, Alexei V. [Texas A& M University, College Station, Texas 77843 (United States); Baylor University, Waco, Texas 76798 (United States); Scully, Marlan O. [Texas A& M University, College Station, Texas 77843 (United States); Baylor University, Waco, Texas 76798 (United States); Princeton University, Princeton, New Jersey 08544 (United States)

    2015-08-15

    We report a versatile setup based on the femtosecond adaptive spectroscopic techniques for coherent anti-Stokes Raman scattering. The setup uses a femtosecond Ti:Sapphire oscillator source and a folded 4f pulse shaper, in which the pulse shaping is carried out through conventional optical elements and does not require a spatial light modulator. Our setup is simple in alignment, and can be easily switched between the collinear single-beam and the noncollinear two-beam configurations. We demonstrate the capability for investigating both transparent and highly scattering samples by detecting transmitted and reflected signals, respectively.

  13. Limits to coherent scattering and photon coalescence from solid-state quantum emitters

    Science.gov (United States)

    Iles-Smith, Jake; McCutcheon, Dara P. S.; Mørk, Jesper; Nazir, Ahsan

    2017-05-01

    The desire to produce high-quality single photons for applications in quantum information science has lead to renewed interest in exploring solid-state emitters in the weak excitation regime. Under these conditions it is expected that photons are coherently scattered, and so benefit from a substantial suppression of detrimental interactions between the source and its surrounding environment. Nevertheless, we demonstrate here that this reasoning is incomplete, as phonon interactions continue to play a crucial role in determining solid-state emission characteristics even for very weak excitation. We find that the sideband resulting from non-Markovian relaxation of the phonon environment is excitation strength independent. It thus leads to an intrinsic limit to the fraction of coherently scattered light and to the visibility of two-photon coalescence at weak driving, both of which are absent for atomic systems or within simpler Markovian treatments.

  14. Extinction of light and coherent scattering by a single nitrogen-vacancy center in diamond

    Science.gov (United States)

    Tran, Thai Hien; Siyushev, Petr; Wrachtrup, Jörg; Gerhardt, Ilja

    2017-05-01

    The efficient interaction of light and a single quantum system is required to implement a photon to spin interface. It is important to determine the amount of coherent and incoherent photons in such a scheme, since it is based on coherent scattering. In this paper an external laser field is efficiently coupled to a single nitrogen vacancy center in diamond. We detect the direct extinction signal and estimate the nitrogen vacancy's extinction cross section. The exact amount of coherent and incoherent photons is determined against the saturation parameter. This reveals the optimal point of interaction for further experiments. A theoretical model allows us to explain the deviation to an atom in free space. The introduced experimental techniques are used to determine the properties of the tight focusing in an interference experiment and allow for a direct determination of the Gouy phase in a strongly focused beam.

  15. Charge coupled devices for detection of coherent neutrino-nucleus scattering

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez Moroni, Guillermo; Estrada, Juan; Paolini, Eduardo E.; Cancelo, Gustavo; Tiffenberg, Javier; Molina, Jorge

    2015-04-01

    In this article the feasibility of using charge coupled devices (CCD) to detect low-energy neutrinos through their coherent scattering with nuclei is analyzed. The detection of neutrinos through this standard model process has been elusive because of the small energy deposited in such interaction. Typical particle detectors have thresholds of a few keV, and most of the energy deposition expected from coherent scattering is well below this level. The CCD detectors discussed in this paper can operate at a threshold of approximately 30 eV, making them ideal for observing this signal. On a CCD array of 500 g located next to a power nuclear reactor the number of coherent scattering events expected is about 3000 events/year. Our results shows that a detection with a confidence level of 99% can be reached within 16 days of continuous operation; with the current 52 g detector prototype this time lapse extends to five months.

  16. Optical coherence tomography of scattering media using frequency-modulated continuous-wave techniques with tunable near-infrared laser

    Science.gov (United States)

    Haberland, Udo; Jansen, Peter; Blazek, Vladimir; Schmitt, Hans J.

    1997-05-01

    A new near-infrared coherent imaging technique that can reveal scattering bodies embedded in highly scattering media is presented. Its underlying principle is extended from frequency modulated continuous wave radar systems. This technique has advantages over low coherence tomography as it does not require the reference mirror to be scanned. The tunable laser is characterized and the system's performance is demonstrated on images recorded from solid scattering phantoms. Furthermore a combination of our chirp-tomography (C-OCT) and laser Doppler perfusion imaging (LDPI) is demonstrated. The influence of moving scatterers on the tomographic images are discussed.

  17. Ultrafast spectral interferometry of resonant secondary emission from quantum wells: From Rayleigh scattering to coherent emission from biexcitons

    DEFF Research Database (Denmark)

    Birkedal, Dan; Shah, Jagdeep; Pfeiffer, L. N.

    1999-01-01

    Recent investigations of secondary emission from quantum well excitons following ultrafast resonant excitation have demonstrated an intricate interplay of coherent Rayleigh scattering and incoherent luminescence. We have very recently demonstrated that it is possible to isolate and time resolve t...

  18. Dicty_cDB: VHF264 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF264 (Link to dictyBase) - - - Contig-U16260-1 VHF264P (Link to Original site) VHF...264F 606 VHF264Z 693 VHF264P 1279 - - Show VHF264 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-C/VHF264Q.Seq.d/ Representative seq. ID VHF...264P (Link to Original site) Representative DNA sequence >VHF264 (VHF264Q) /CSM/VH/VHF2-C/VHF...DRRKNIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHFEMPKEDKLPAGCTS

  19. Dicty_cDB: VHF181 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF181 (Link to dictyBase) - - - Contig-U16260-1 VHF181P (Link to Original site) VHF...181F 610 VHF181Z 416 VHF181P 1006 - - Show VHF181 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-D/VHF181Q.Seq.d/ Representative seq. ID VHF...181P (Link to Original site) Representative DNA sequence >VHF181 (VHF181Q) /CSM/VH/VHF1-D/VHF...VKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKVSG DMRYMSCRADEQERGITIKSSSVSLHF

  20. Dicty_cDB: VHF777 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF777 (Link to dictyBase) - - - Contig-U16283-1 VHF777P (Link to Original site) VHF...777F 474 VHF777Z 669 VHF777P 1123 - - Show VHF777 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-D/VHF777Q.Seq.d/ Representative seq. ID VHF...777P (Link to Original site) Representative DNA sequence >VHF777 (VHF777Q) /CSM/VH/VHF7-D/VHF...PNIIGVEHYKVATDVQKILXRI*itsryychfryg*fi *rpksncipcs*dstflittirscprxhqygr*ir*tlrlyq

  1. Dicty_cDB: VHF354 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF354 (Link to dictyBase) - - - Contig-U16260-1 VHF354P (Link to Original site) VHF...354F 617 VHF354Z 721 VHF354P 1318 - - Show VHF354 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-C/VHF354Q.Seq.d/ Representative seq. ID VHF...354P (Link to Original site) Representative DNA sequence >VHF354 (VHF354Q) /CSM/VH/VHF3-C/VHF...no Acid sequence LSSAKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGD

  2. Dicty_cDB: VHF590 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF590 (Link to dictyBase) - - - Contig-U16306-1 VHF590P (Link to Original site) VHF...590F 115 VHF590Z 603 VHF590P 698 - - Show VHF590 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-D/VHF590Q.Seq.d/ Representative seq. ID VHF...590P (Link to Original site) Representative DNA sequence >VHF590 (VHF590Q) /CSM/VH/VHF5-D/VHF5...qlphvlrqlk*sqnfhkkylkkvqeqqq--- ---rwifhrwccfqsthdamyflyqxfgslsw*snlxrpkist*xfyhifghfw*rls*l ss*ipi*lqkwysyv

  3. Dicty_cDB: VHF536 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF536 (Link to dictyBase) - - - Contig-U16531-1 VHF536P (Link to Original site) VHF...536F 255 VHF536Z 685 VHF536P 920 - - Show VHF536 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-B/VHF536Q.Seq.d/ Representative seq. ID VHF...536P (Link to Original site) Representative DNA sequence >VHF536 (VHF536Q) /CSM/VH/VHF5-B/VHF5...ti*mlhliskvmtvh*mslslfyggyfl*lsi*llwnysig qvvvcliksikxerllkstmt--- ---*erlcl*ilxlvsichf

  4. Dicty_cDB: VHF730 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF730 (Link to dictyBase) - - - Contig-U15767-1 VHF730P (Link to Original site) VHF...730F 569 VHF730Z 718 VHF730P 1267 - - Show VHF730 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-B/VHF730Q.Seq.d/ Representative seq. ID VHF...730P (Link to Original site) Representative DNA sequence >VHF730 (VHF730Q) /CSM/VH/VHF7-B/VHF...QEKRIPVLNSMDANDSINKKA RISWPDGFKYFFVDNQAGDSESAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQXFN DVSYPV--- ---lhvvvvkxvhtlpvnvnqivhf

  5. Dicty_cDB: VHF649 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF649 (Link to dictyBase) - - - Contig-U11031-1 VHF649P (Link to Original site) VHF...649F 562 VHF649Z 671 VHF649P 1213 - - Show VHF649 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF6-C/VHF649Q.Seq.d/ Representative seq. ID VHF...649P (Link to Original site) Representative DNA sequence >VHF649 (VHF649Q) /CSM/VH/VHF6-C/VHF...PNTPPTIKIELPSQSILKPSGQLKK*x* Translated Amino Acid sequence (All Frames) Frame A: i*qlvchlsivlfhhqviyphvlklekhf

  6. Dicty_cDB: VHF527 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF527 (Link to dictyBase) - - - Contig-U16260-1 VHF527P (Link to Original site) VHF...527F 571 VHF527Z 456 VHF527P 1007 - - Show VHF527 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-B/VHF527Q.Seq.d/ Representative seq. ID VHF...527P (Link to Original site) Representative DNA sequence >VHF527 (VHF527Q) /CSM/VH/VHF5-B/VHF...AKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQXRGITIKSSSVSLHF

  7. Dicty_cDB: VHF294 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF294 (Link to dictyBase) - - - Contig-U16441-1 VHF294P (Link to Original site) VHF...294F 573 VHF294Z 215 VHF294P 768 - - Show VHF294 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-D/VHF294Q.Seq.d/ Representative seq. ID VHF...294P (Link to Original site) Representative DNA sequence >VHF294 (VHF294Q) /CSM/VH/VHF2-D/VHF2...ssfst*scisfttfry*gfsdctfr*fhfn**RFWFNMEQCII QWVMFYS--- ---DCHVSIKKFFKWWQRLDRWCCXXXSCXXXSWWFWFPTFLRIQISNXXY*k

  8. Dicty_cDB: VHF690 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF690 (Link to dictyBase) - - - Contig-U11064-1 VHF690P (Link to Original site) VHF...690F 199 VHF690Z 419 VHF690P 598 - - Show VHF690 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF6-D/VHF690Q.Seq.d/ Representative seq. ID VHF...690P (Link to Original site) Representative DNA sequence >VHF690 (VHF690Q) /CSM/VH/VHF6-D/VHF6...vllksqsknqyl*hlikslidfinif*hgmhqiyhqrkkn*nq *k--- ---rrwfpr*rernhhfqlc*sts*rgcryw

  9. Dicty_cDB: VHF273 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF273 (Link to dictyBase) - - - Contig-U11514-1 VHF273P (Link to Original site) VHF...273F 644 VHF273Z 678 VHF273P 1302 - - Show VHF273 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-D/VHF273Q.Seq.d/ Representative seq. ID VHF...273P (Link to Original site) Representative DNA sequence >VHF273 (VHF273Q) /CSM/VH/VHF2-D/VHF...ctr*ccnvkdwchyssrl*syrs*ts*nrsifidr*iftsh*kdw**s llwfsnetr*skmcchcnwckhflwscckfstrnrrtwssssys*kywslly*fhrhlg

  10. Dicty_cDB: VHF243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF243 (Link to dictyBase) - - - Contig-U16423-1 VHF243P (Link to Original site) VHF...243F 580 VHF243Z 334 VHF243P 894 - - Show VHF243 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-B/VHF243Q.Seq.d/ Representative seq. ID VHF...243P (Link to Original site) Representative DNA sequence >VHF243 (VHF243Q) /CSM/VH/VHF2-B/VHF2...AATCNAGATATTCCAGATTGGTTTGAAAAGATGG TACA sequence update 2002.10.25 Translated Amino Acid sequence ifihadkff*RISHF

  11. Dicty_cDB: VHF134 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF134 (Link to dictyBase) - - - Contig-U16260-1 VHF134P (Link to Original site) VHF...134F 533 VHF134Z 404 VHF134P 917 - - Show VHF134 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-B/VHF134Q.Seq.d/ Representative seq. ID VHF...134P (Link to Original site) Representative DNA sequence >VHF134 (VHF134Q) /CSM/VH/VHF1-B/VHF1...cid sequence LSSAKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHFEMPKE

  12. Dicty_cDB: VHF892 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF892 (Link to dictyBase) - - - Contig-U16260-1 VHF892P (Link to Original site) VHF...892F 140 VHF892Z 417 VHF892P 537 - - Show VHF892 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF8-D/VHF892Q.Seq.d/ Representative seq. ID VHF...892P (Link to Original site) Representative DNA sequence >VHF892 (VHF892Q) /CSM/VH/VHF8-D/VHF8... Translated Amino Acid sequence TIKSSSVSLHFEMPXEDKLPAGCTSHEFLINLIDSPSHVDFS--- ---ELTASPNILEPIYLVEITAPENAIGGI

  13. Dicty_cDB: VHF479 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF479 (Link to dictyBase) - - - Contig-U11426-1 VHF479P (Link to Original site) VHF...479F 629 VHF479Z 691 VHF479P 1300 - - Show VHF479 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF4-D/VHF479Q.Seq.d/ Representative seq. ID VHF...479P (Link to Original site) Representative DNA sequence >VHF479 (VHF479Q) /CSM/VH/VHF4-D/VHF...EKNPQEWRWSGGFFVDSISDYVVKSRNTERPDHDSLLF HVNIKEKQGTHFIRIPLSSKESPPYIIQNDTQFKISFFQRDSPENIDYIEPKEKLCYGWD EPSAEYVL

  14. Dicty_cDB: VHF754 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF754 (Link to dictyBase) - - - Contig-U16531-1 VHF754P (Link to Original site) VHF...754F 526 VHF754Z 624 VHF754P 1130 - - Show VHF754 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-C/VHF754Q.Seq.d/ Representative seq. ID VHF...754P (Link to Original site) Representative DNA sequence >VHF754 (VHF754Q) /CSM/VH/VHF7-C/VHF...ixnkmqwlkmlqvk*killk*ekvvslgiiftipf--- ---flvsichfnchc*itfccsrwnnlxllxfldsryllqw*

  15. Dicty_cDB: VHF461 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF461 (Link to dictyBase) - - - Contig-U11551-1 VHF461P (Link to Original site) VHF...461F 646 VHF461Z 261 VHF461P 887 - - Show VHF461 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF4-C/VHF461Q.Seq.d/ Representative seq. ID VHF...461P (Link to Original site) Representative DNA sequence >VHF461 (VHF461Q) /CSM/VH/VHF4-C/VHF4...TTAAATTATTAAAAATAGTAAATAAAAAAAA sequence update 2002.10.25 Translated Amino Acid sequence fyfifenfkthfhiiffl

  16. Dicty_cDB: VHF781 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF781 (Link to dictyBase) - - - Contig-U16440-1 VHF781P (Link to Original site) VHF...781F 452 VHF781Z 680 VHF781P 1112 - - Show VHF781 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF7-D/VHF781Q.Seq.d/ Representative seq. ID VHF...781P (Link to Original site) Representative DNA sequence >VHF781 (VHF781Q) /CSM/VH/VHF7-D/VHF...vlkmmmlkf*xixftr*r Frame C: glldinkleeiik*rfhlfylfl*rlllayhfhkilfqlisktaligsnfnhyiqikmim y*l*iqdqrmf*kdqqmvv

  17. Dicty_cDB: VHF435 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF435 (Link to dictyBase) - - - Contig-U16260-1 VHF435P (Link to Original site) VHF...435F 616 VHF435Z 703 VHF435P 1299 - - Show VHF435 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF4-B/VHF435Q.Seq.d/ Representative seq. ID VHF...435P (Link to Original site) Representative DNA sequence >VHF435 (VHF435Q) /CSM/VH/VHF4-B/VHF...AKKVKYKMVNFTIDQIRAIMDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHF

  18. Dicty_cDB: VHF553 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF553 (Link to dictyBase) - - - Contig-U16433-1 VHF553P (Link to Original site) VHF...553F 122 VHF553Z 533 VHF553P 635 - - Show VHF553 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-C/VHF553Q.Seq.d/ Representative seq. ID VHF...553P (Link to Original site) Representative DNA sequence >VHF553 (VHF553Q) /CSM/VH/VHF5-C/VHF5...ed Amino Acid sequence syhfylfiy*IIIYLLNYYLLSCVNYLPINFNILYIY--- ---YVINLTLDGDNVNGFPKTVTVKPAPSXEQXYAEGEGLVKVF

  19. A method to improve the measurement stability of scattering coefficients in lip with optical coherence tomography

    Science.gov (United States)

    Zhang, Xiyang; Zhang, Ying; Li, Zhifang; Li, Hui

    2016-10-01

    Optical coherence tomography (OCT) is a non-invasive imaging technique that provides real-time two- and three-dimensional images of scattering tissues with micrometer resolution. Scattering coefficient is estimated based on the slope of OCT dependent of depth. However, stability of the OCT signal slope is dependent on tissue heterogeneity. Our work is to provide a method of combining post-processing Fourier filtration with automatic identification of fitting range to reduce the effect of tissue heterogeneity on scattering coefficient, and used for noninvasive monitoring of glucose concentration in lip. Axial and lateral resolutions of OCT are 20 μm and 15 μm respectively. OCT images were obtained from lip before breakfast and after breakfast respectively. Results demonstrate that the method improve the stability and the precision of measurement of scattering coefficient of lip. There are obviously different in scattering coefficient of tissue between preprandial glucose and 2-hours postprandial glucose. These pilot studies show that OCT scattering coefficient extraction of lip may be considered as a significant diagnostic marker. OCT has potential to monitor glucose-induced changes in lip in vivo.

  20. Frequency domain interferometry mode observations of PMSE using the EISCAT VHF radar

    Directory of Open Access Journals (Sweden)

    P. B. Chilson

    2000-12-01

    Full Text Available During the summer of 1997 investigations into the nature of polar mesosphere summer echoes (PMSE were conducted using the European incoherent scatter (EISCAT VHF radar in Norway. The radar was operated in a frequency domain interferometry (FDI mode over a period of two weeks to study the frequency coherence of the returned radar signals. The operating frequencies of the radar were 224.0 and 224.6 MHz. We present the first results from the experiment by discussing two 4-h intervals of data collected over two consecutive nights. During the first of the two days an enhancement of the FDI coherence, which indicates the presence of distinct scattering layers, was found to follow the lower boundary of the PMSE. Indeed, it is not unusual to observe that the coherence values are peaked around the heights corresponding to both the lower- and upper-most boundaries of the PMSE layer and sublayers. A Kelvin-Helmholtz mechanism is offered as one possible explanation for the layering structure. Additionally, our analysis using range-time-pseudocolor plots of signal-to-noise ratios, spectrograms of Doppler velocity, and estimates of the positions of individual scattering layers is shown to be consistent with the proposition that upwardly propagating gravity waves can become steepened near the mesopause.Key words: Ionosphere (polar ionosphere · Meteorology and Atmospheric Dynamics (middle atmosphere dynamics · Radio Science (Interferometry

  1. Frequency domain interferometry mode observations of PMSE using the EISCAT VHF radar

    Directory of Open Access Journals (Sweden)

    P. B. Chilson

    Full Text Available During the summer of 1997 investigations into the nature of polar mesosphere summer echoes (PMSE were conducted using the European incoherent scatter (EISCAT VHF radar in Norway. The radar was operated in a frequency domain interferometry (FDI mode over a period of two weeks to study the frequency coherence of the returned radar signals. The operating frequencies of the radar were 224.0 and 224.6 MHz. We present the first results from the experiment by discussing two 4-h intervals of data collected over two consecutive nights. During the first of the two days an enhancement of the FDI coherence, which indicates the presence of distinct scattering layers, was found to follow the lower boundary of the PMSE. Indeed, it is not unusual to observe that the coherence values are peaked around the heights corresponding to both the lower- and upper-most boundaries of the PMSE layer and sublayers. A Kelvin-Helmholtz mechanism is offered as one possible explanation for the layering structure. Additionally, our analysis using range-time-pseudocolor plots of signal-to-noise ratios, spectrograms of Doppler velocity, and estimates of the positions of individual scattering layers is shown to be consistent with the proposition that upwardly propagating gravity waves can become steepened near the mesopause.

    Key words: Ionosphere (polar ionosphere · Meteorology and Atmospheric Dynamics (middle atmosphere dynamics · Radio Science (Interferometry

  2. High angle phase modulated low coherence interferometry for path length resolved Doppler measurements of multiply scattered light

    NARCIS (Netherlands)

    Varghese, Babu; Rajan, Vinayakrishnan; van Leeuwen, Ton; Steenbergen, Wiendelt

    2008-01-01

    We describe an improved method for coherence domain path length resolved measurements of multiply scattered photons in turbid media. An electro-optic phase modulator sinusoidally modulates the phase in the reference arm of a low coherence fiber optic Mach–Zehnder interferometer, at a high phase

  3. Coherent X-ray scattering beamline at port 9C of Pohang Light Source II.

    Science.gov (United States)

    Yu, Chung-Jong; Lee, Hae Cheol; Kim, Chan; Cha, Wonsuk; Carnis, Jerome; Kim, Yoonhee; Noh, Do Young; Kim, Hyunjung

    2014-01-01

    The coherent X-ray scattering beamline at the 9C port of the upgraded Pohang Light Source (PLS-II) at Pohang Accelerator Laboratory in Korea is introduced. This beamline provides X-rays of 5-20 keV, and targets coherent X-ray experiments such as coherent diffraction imaging and X-ray photon correlation spectroscopy. The main parameters of the beamline are summarized, and some preliminary experimental results are described.

  4. Characterization of photodamage in coherent anti-Stokes Raman scattering microscopy

    Science.gov (United States)

    Fu, Yan; Wang, Haifeng; Shi, Riyi; Cheng, Ji-Xin

    2006-05-01

    We report a mechanistic analysis of photodamage in coherent anti-Stokes Raman scattering (CARS) microscopy. Photodamage to the myelin sheath in spinal tissues is induced by using the point scan mode and is featured by myelin splitting and shockwaves with broadband emission. Our measurement of photodamage rate versus the excitation power reveals that both linear and nonlinear mechanisms are involved. Moreover, we show that vibrational absorption induced by coherent Raman processes significantly contributes to the nonlinear damage at high peak powers. For CARS imaging of cultured cells, the photodamage is characterized by plasma membrane blebbing and is dominated by a second order mechanism. Our study suggests that for dense samples such as the myelin sheath, CARS imaging induced photodamage can be minimized by using laser beams with relatively long near IR wavelengths and a repetition rate of a few MHz. For less dense samples such as cultured cells, laser pulses of higher repetition rates are preferred.

  5. Phase-shift effect of amplitude spread function on spectrum and image formation in coherent Raman scattering microspectroscopy.

    Science.gov (United States)

    Fukutake, Naoki

    2016-03-01

    Coherent Raman scattering microspectroscopy, which includes coherent anti-Stokes Raman scattering (CARS) and stimulated Raman scattering (SRS) microspectroscopy, permits label-free hyperspectral imaging. We report the theoretical study of the phase-shift effect of the impulse response function on the spectral and image-forming properties of coherent Raman scattering microspectroscopy. We show that the spectrum and image are influenced by not only the NA of objective for excitation (NA(ex)) but also that for signal collection (NA(col)), in association with the phase-shift effect. We discuss that, under the condition NA(ex)≠NA(col), both the spectrum and the image become deformed by the phase-shift effect, which can be applied to the direct measurement of the imaginary part of the nonlinear susceptibility in CARS spectroscopy. We point out that, even in SRS microscopy, the nonresonant background can contribute to the image formation and cause the artifact in the image.

  6. Impulsive Light Scattering by Coherent Phonons in LaAlO3: Disorder and Boundary Effects

    Science.gov (United States)

    Liu, Y.; Frenkel, A.; Garrett, G. A.; Whitaker, J. F.; Fahy, S.; Uher, C.; Merlin, R.

    1995-07-01

    Pump-probe measurements of coherent-phonon-induced changes of refractive index in LaAlO3 are dominated by normally weak boundary effects. Atomic displacements in the range 50-500 μÅ were generated and probed by femtosecond laser pulses through impulsive Raman scattering. The absence of a bulk contribution is ascribed to phase mismatch due to domain disorder. Selection rules are consistent with a Raman model considering reflection and transmission at interfaces. Intensities and phonon parameters as a function of temperature agree well with incoherent Raman data.

  7. Rapid spectro-polarimetry to probe molecular symmetry in multiplex coherent anti-Stokes Raman scattering.

    Science.gov (United States)

    Würthwein, Thomas; Brinkmann, Maximilian; Hellwig, Tim; Fallnich, Carsten

    2017-11-21

    We present the simultaneous detection of the spectrum and the complete polarization state of a multiplex coherent anti-Stokes Raman scattering signal with a fast division-of-amplitude spectro-polarimeter. The spectro-polarimeter is based on a commercial imaging spectrograph, a birefringent wedge prism, and a segmented polarizer. Compared to the standard rotating-retarder fixed-analyzer spectro-polarimeter, only a single measurement is required and an up to 21-fold reduced acquisition time is shown. The measured Stokes parameters allow us to differentiate between vibrational symmetries and to determine the depolarization ratio ρ by data post-processing.

  8. Coherent neutrino scattering with low temperature bolometers at Chooz reactor complex

    Science.gov (United States)

    Billard, J.; Carr, R.; Dawson, J.; Figueroa-Feliciano, E.; Formaggio, J. A.; Gascon, J.; Heine, S. T.; De Jesus, M.; Johnston, J.; Lasserre, T.; Leder, A.; Palladino, K. J.; Sibille, V.; Vivier, M.; Winslow, L.

    2017-10-01

    We present the potential sensitivity of a future recoil detector for a first detection of the process of coherent elastic neutrino nucleus scattering (CEνNS). We use the Chooz reactor complex in France as our luminous source of reactor neutrinos. Leveraging the ability to cleanly separate the rate correlated with the reactor thermal power against (uncorrelated) backgrounds, we show that a 10 kg cryogenic bolometric array with 100 eV threshold should be able to extract a CEνNS signal within one year of running.

  9. Phonons in Solid Hydrogen and Deuterium Studied by Inelastic Coherent Neutron Scattering

    DEFF Research Database (Denmark)

    Nielsen, Mourits

    1973-01-01

    Phonon dispersion relations have been measured by coherent neutron scattering in solid para-hydrogen and ortho-deuterium. The phonon energies are found to be nearly equal in the two solids, the highest energy in each case lying close to 10 meV. The pressure and temperature dependence of the phonon...... energies have been measured in ortho-deuterium and the lattice change determined by neutron diffraction. When a pressure of 275 bar is applied, the phonon energies are increased by about 10%, and heating the crystal to near the melting point decreases them by about 7%. The densities of states, the specific...

  10. Spatial observations by the CUTLASS coherent scatter radar of ionospheric modification by high power radio waves

    Directory of Open Access Journals (Sweden)

    G. E. Bond

    1997-11-01

    Full Text Available Results are presented from an experimental campaign in April 1996, in which the new CUTLASS (Co-operative UK twin-located Auroral Sounding System coherent scatter radar was employed to observe artificial field aligned irregularities (FAI generated by the EISCAT (European Incoherent SCATter heating facility at Tromsø, Norway. The distribution of backscatter intensity from within the heated region has been investigated both in azimuth and range with the Finland component of CUTLASS, and the first observations of artificial irregularities by the Iceland radar are also presented. The heated region has been measured to extend over a horizontal distance of 170±50km, which by comparison with a model of the heater beam pattern corresponds to a threshold electric field for FAI of between 0.1 and 0.01V/m. Differences between field-aligned and vertical propagation heating are also presented.

  11. Spatial observations by the CUTLASS coherent scatter radar of ionospheric modification by high power radio waves

    Directory of Open Access Journals (Sweden)

    G. E. Bond

    Full Text Available Results are presented from an experimental campaign in April 1996, in which the new CUTLASS (Co-operative UK twin-located Auroral Sounding System coherent scatter radar was employed to observe artificial field aligned irregularities (FAI generated by the EISCAT (European Incoherent SCATter heating facility at Tromsø, Norway. The distribution of backscatter intensity from within the heated region has been investigated both in azimuth and range with the Finland component of CUTLASS, and the first observations of artificial irregularities by the Iceland radar are also presented. The heated region has been measured to extend over a horizontal distance of 170±50km, which by comparison with a model of the heater beam pattern corresponds to a threshold electric field for FAI of between 0.1 and 0.01V/m. Differences between field-aligned and vertical propagation heating are also presented.

  12. Simultaneous strain and coherent imaging using coupled photorefractive holography and shearography through scattering media.

    Science.gov (United States)

    Rosso, Vanessa; Béland, Rémy; Lecler, Sylvain; Renotte, Yvon; Habraken, Serge; Lion, Yves; Charette, Paul

    2008-01-01

    The direct simultaneous acquisition of coherent imaging and strain information is of particular importance in the biomechanical characterization of biological tissue. This type of simultaneous information acquisition can be accomplished using a coupled photorefractive holography and shearography system for imaging and strain measurements, respectively. Optical scattering in a conventional speckle shearing interferometer rapidly reduces the contrast of the shearing fringes, thereby limiting the use of such interferometers with opaque surfaces. By coupling photorefractive holography with speckle shearing interferometry, properties of the photorefractive effect (spatial high-pass filtering and temporal low-pass filtering) combine to restore the shearing fringe contrast and enable strain imaging in diffusing media. This effect is demonstrated using synthetic scattering phantoms built from suspensions of silica spheres in water.

  13. Dicty_cDB: VHF163 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF163 (Link to dictyBase) - - - Contig-U11129-1 VHF163P (Link to Original site) VHF1...63F 611 VHF163Z 654 VHF163P 1245 - - Show VHF163 Library VH (Link to library) Clone ID VHF1...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-C/VHF163Q.Seq.d/ Representative seq. ID VHF1...63P (Link to Original site) Representative DNA sequence >VHF163 (VHF163Q) /CSM/VH/VHF1-C/VHF1...nt alignments: (bits) Value VHF163 (VHF163Q) /CSM/VH/VHF1-C/VHF163Q.Seq.d/ 2357 0.0 VHM584 (VHM584Q) /CSM/VH

  14. Dicty_cDB: VHF444 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (Link to library) VHF444 (Link to dictyBase) - G20601 DDB0204337 Contig-U12392-1 VHF444P (Link to Original...site) VHF444F 579 VHF444Z 213 VHF444P 772 - - Show VHF444 Library VH (Link to library) Clone ID VHF444 (Link...tsukuba.ac.jp/CSM/VH/VHF4-B/VHF444Q.Seq.d/ Representative seq. ID VHF444P (Link to Original site) Representative...Representative DNA sequence >VHF444 (VHF444Q) /CSM/VH/VHF4-B/VHF444Q.Seq.d/ CAAAAGAAATAAATAATTATGCCATCA...significant alignments: (bits) Value VHF444 (VHF444Q) /CSM/VH/VHF4-B/VHF444Q.Seq.d/ 1479 0.0 VHA836 (VHA836Q)

  15. Dicty_cDB: VHF338 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF338 (Link to dictyBase) - - - Contig-U14303-1 VHF338P (Link to Original site) VHF3...38F 208 VHF338Z 685 VHF338P 873 - - Show VHF338 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF338Q.Seq.d/ Representative seq. ID VHF3...38P (Link to Original site) Representative DNA sequence >VHF338 (VHF338Q) /CSM/VH/VHF3-B/VHF3...significant alignments: (bits) Value VHF338 (VHF338Q) /CSM/VH/VHF3-B/VHF338Q.Seq.d/ 1296 0.0 VHK267 (VHK267Q

  16. Dicty_cDB: VHF394 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF394 (Link to dictyBase) - - - Contig-U16260-1 VHF394P (Link to Original site) VHF3...94F 563 VHF394Z 417 VHF394P 960 - - Show VHF394 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-D/VHF394Q.Seq.d/ Representative seq. ID VHF3...94P (Link to Original site) Representative DNA sequence >VHF394 (VHF394Q) /CSM/VH/VHF3-D/VHF3...nt alignments: (bits) Value VHF394 (VHF394Q) /CSM/VH/VHF3-D/VHF394Q.Seq.d/ 1776 0

  17. Dicty_cDB: VHF340 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF340 (Link to dictyBase) - - - Contig-U11939-1 VHF340P (Link to Original site) VHF3...40F 113 VHF340Z 506 VHF340P 599 - - Show VHF340 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF340Q.Seq.d/ Representative seq. ID VHF3...40P (Link to Original site) Representative DNA sequence >VHF340 (VHF340Q) /CSM/VH/VHF3-B/VHF3...Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF340 (VHF340Q) /CSM/VH/VHF3-B/VHF3

  18. COHERENCE PROPERTIES OF ELECTROMAGNETIC RADIATION,

    Science.gov (United States)

    ELECTROMAGNETIC RADIATION , COHERENT SCATTERING), (*COHERENT SCATTERING, ELECTROMAGNETIC RADIATION ), LIGHT, INTERFERENCE, INTENSITY, STATISTICAL FUNCTIONS, QUANTUM THEORY, BOSONS, INTERFEROMETERS, CHINA

  19. Coherent scattering function in the reptation model: analysis beyond asymptotic limits.

    Science.gov (United States)

    Schäfer, Lothar; Ebert, Ute; Baumgärtner, Artur

    2002-06-01

    We calculate the coherent dynamical scattering function S(c)(q,t;N) of a flexible chain of length N, diffusing through an ordered background of topological obstacles. As an instructive generalization, we also calculate the scattering function S(c)(q,t;M,N) for the central piece of length Mreptation model, we treat global creep, tube length fluctuations, and internal relaxation within a consistent and unified approach. Our theory concentrates on the universal aspects of reptational motion, and our results in all details show excellent agreement with our simulations of the Evans-Edwards model, provided we allow for a phenomenological prefactor which accounts for nonuniversal effects of the microstructure of the Monte Carlo chain, present for short times. Previous approaches to the coherent structure function can be analyzed as special limits of our theory. First, the effects of internal relaxation can be isolated by studying the limit N--> infinity, M fixed. The results do not support the model of a "Rouse chain in a tube." We trace this back to the nonequilibrium initial conditions of the latter model. Second, in the limit of long chains (M=N--> infinity ) and times large compared to the internal relaxation time (t/N(2)--> infinity ), our theory reproduces the results of the primitive chain model. This limiting form applies only to extremely long chains, and for chain lengths accessible in practice, effects of, e.g., tube length fluctuations are not negligible.

  20. Three-dimensional coherent X-ray surface scattering imaging near total external reflection

    Science.gov (United States)

    Sun, Tao; Jiang, Zhang; Strzalka, Joseph; Ocola, Leonidas; Wang, Jin

    2012-09-01

    Lensless X-ray coherent diffraction imaging (CDI) has emerged as a thriving field promising applications in materials and biological sciences with a theoretical imaging resolution only limited by the X-ray wavelength. Most CDI methods use transmission geometry, which is not suitable for nanostructures grown on opaque substrates or for objects of interest comprising only surfaces or interfaces. Attempts have been made to perform CDI experiments in reflection geometry, both optically and with X-rays, but the reconstruction resulted in mostly planar images, with less success in the third dimension. Here, we discuss the development of coherent surface scattering imaging in grazing-incidence geometry that takes advantage of enhanced X-ray surface scattering and interference near total external reflection. We demonstrate the successful reconstruction of substrate-supported non-periodic surface patterns in three dimensions with nanometre resolution in the direction normal to the substrate, promising wide applications in elucidating structures in substrate-supported and buried nanoelectronics and photonics.

  1. Dicty_cDB: VHF329 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF329 (Link to dictyBase) - - - Contig-U16260-1 VHF329P (Link to Original site) VHF3...29F 618 VHF329Z 633 VHF329P 1231 - - Show VHF329 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF329Q.Seq.d/ Representative seq. ID VHF3...29P (Link to Original site) Representative DNA sequence >VHF329 (VHF329Q) /CSM/VH/VHF3-B/VHF3...s CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF329 (VHF329Q) /CSM/VH/VHF3

  2. Non-invasive classification of breast microcalcifications using x-ray coherent scatter computed tomography

    Science.gov (United States)

    Ghammraoui, Bahaa; Popescu, Lucretiu M.

    2017-02-01

    We investigate the use of energy dispersive x-ray coherent scatter computed tomography (ED-CSCT) as a non-invasive diagnostic method to differentiate between type I and type II breast calcifications. This approach is sensitive to the differences of composition and internal crystal structure of different types of microcalcifications. The study is carried out by simulating a CSCT system with a scanning pencil beam, considering a polychromatic x-ray source and an energy-resolving photon counting detector. In a first step, the multidimensional angle and energy distributed CSCT data is reduced to the projection-space distributions of only a few components, corresponding to the expected target composition: adipose, glandular tissue, weddellite (calcium oxalate) for type I calcifications, and hydroxyapatite for type II calcifications. The maximum-likelihood estimation of scatter components algorithm used, operating in the projection space, takes into account the polychromatic source, the detector response function and the energy dependent attenuation. In the second step, component images are reconstructed from the corresponding estimated component projections using filtered backprojection. In a preliminary step the coherent scatter differential cross sections for hydroxyapatite and weddellite minerals were determined experimentally. The classification of type I or II calcifications is done using the relative contrasts of their components as the criterion. Simulation tests were carried out for different doses and energy resolutions for multiple realizations. The results were analyzed using relative/receiver operating characteristic methodology and show good discrimination ability at medium and higher doses. The noninvasive CSCT technique shows potential to further improve the breast diagnostic accuracy and reduce the number of breast biopsies.

  3. Polarization-Dependent Interference of Coherent Scattering from Orthogonal Dipole Moments of a Resonantly Excited Quantum Dot.

    Science.gov (United States)

    Chen, Disheng; Lander, Gary R; Solomon, Glenn S; Flagg, Edward B

    2017-01-20

    Resonant photoluminescence excitation (RPLE) spectra of a neutral InGaAs quantum dot show unconventional line shapes that depend on the detection polarization. We characterize this phenomenon by performing polarization-dependent RPLE measurements and simulating the measured spectra with a three-level quantum model. The spectra are explained by interference between fields coherently scattered from the two fine structure split exciton states, and the measurements enable extraction of the steady-state coherence between the two exciton states.

  4. Fundamental Limits to Coherent Scattering and Photon Coalescence from Solid-State Quantum Emitters [arXiv

    DEFF Research Database (Denmark)

    Iles-Smith, Jake; McCutcheon, Dara; Mørk, Jesper

    2016-01-01

    find that the sideband resulting from non-Markovian relaxation of the phonon environment leads to a fundamental limit to the fraction of coherently scattered light and to the visibility of two-photon coalescence at weak driving, both of which are absent for atomic systems or within simpler Markovian......The desire to produce high-quality single photons for applications in quantum information science has lead to renewed interest in exploring solid-state emitters in the weak excitation regime. Under these conditions it is expected that photons are coherently scattered, and so benefit from...

  5. In situ coherent x-ray scattering and STM studies of hexagonally reconstructed Au(001) in Electrolytes

    Science.gov (United States)

    Pierce, Michael S.; Komanicky, Vladimir; Barbour, Andi; Hennessy, Daniel; Su, Jun-Dar; Sandy, Alec; You, Hoydoo

    2011-03-01

    We have studied the dynamics of Au(001) and Au(111) surfaces in situ in 0.1 M HClO4 electrolyte solution using coherent x-ray scattering experiments and STM microscopy. Our coherent x-ray scattering experiments measure a correlation time for the surface as a function of applied potentials. Coherent x-ray scattering differs from the ordinary x-ray diffraction in sensitivity to the structural and temporal details. The correlation times were obtained from measurements conducted while the surface is in equilibrium and the ordinary surface scattering intensity is constant. The correlation time changes from high 103 seconds to low 102 seconds. The correlation times of reconstructed surfaces at low potential are at least an order of magnitude smaller than those measured at the reconstructed surfaces in vacuum. The correlation times also change dramatically in response to the applied potential. These experiments also represent the first successful application of coherent x-ray scattering to the study of electrochemical interfaces in situ. Work at ANL is supported by DOE-BES and work at SU by VEGA.

  6. Coherent self-heterodyne detection of spontaneously Brillouin-scattered light waves in a single-mode fiber

    Science.gov (United States)

    Shimizu, Kaoru; Horiguchi, Tsuneo; Koyamada, Yahei; Kurashima, Toshio

    1993-02-01

    Time-domain reflectometry of spontaneous Brillouin scattering in a single-mode optical fiber is performed with a coherent self-heterodyne detection system containing a recently proposed external frequency translator and a single light-wave source. The light wave is divided into probe and reference light waves. The frequency of the probe light wave is upconverted by the translator by an amount approximately equal to the Brillouin frequency shift. The frequency-converted probe is launched into the fiber and spontaneously Brillouin scattered. As the frequency of the scattered probe is downconverted to near that of the reference light wave, coherent self-heterodyne detection of spontaneous Brillouin scattering becomes possible without having to use a fast-speed detector.

  7. Dicty_cDB: VHF187 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF187 (Link to dictyBase) - - - Contig-U16363-1 VHF187P (Link to Original site) VHF1...87F 549 VHF187Z 707 VHF187P 1236 - - Show VHF187 Library VH (Link to library) Clone ID VHF1...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1-D/VHF187Q.Seq.d/ Representative seq. ID VHF1...87P (Link to Original site) Representative DNA sequence >VHF187 (VHF187Q) /CSM/VH/VHF1-D/VHF1...* Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF187 (VHF1

  8. Dicty_cDB: VHF368 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF368 (Link to dictyBase) - - - Contig-U12673-1 VHF368P (Link to Original site) VHF3...68F 597 VHF368Z 746 VHF368P 1323 - - Show VHF368 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-C/VHF368Q.Seq.d/ Representative seq. ID VHF3...68P (Link to Original site) Representative DNA sequence >VHF368 (VHF368Q) /CSM/VH/VHF3-C/VHF3...ikfpknkii*nki k*nkiky Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF368 (VHF3

  9. Single-pulse coherent anti-Stokes Raman scattering microscopy employing an octave spanning pulse.

    Science.gov (United States)

    Isobe, Keisuke; Suda, Akira; Tanaka, Masahiro; Hashimoto, Hiroshi; Kannari, Fumihiko; Kawano, Hiroyuki; Mizuno, Hideaki; Miyawaki, Atsushi; Midorikawa, Katsumi

    2009-07-06

    We demonstrate two complementary types of microscopy using an identical setup for single-pulse coherent anti-Stokes Raman scattering (CARS) imaging, which employs an ultrabroadband laser pulse with a spectral bandwidth of 4800 cm(-1) and enables the suppression of nonresonant CARS signals. One is a novel type of microscopy that uses spectral phase modulation for the selective excitation of a single Raman mode. The selective excitation is achieved by the modulated pulse focusing its difference-frequency spectrum into a narrow spectral region. Another type is Fourier-transform CARS (FT-CARS) microspectroscopy based on the measurement of the CARS spectrum obtained from the Fourier-transform of the interferometric autocorrelation (IAC) signal. Vibrational spectral imaging of chemical and biological samples is demonstrated using the two types of microscopy.

  10. Quantitative assessment of spinal cord injury using circularly polarized coherent anti-Stokes Raman scattering microscopy

    Science.gov (United States)

    Bae, Kideog; Zheng, Wei; Huang, Zhiwei

    2017-08-01

    We report the quantitative assessment of spinal cord injury using the circularly polarized coherent anti-Stokes Raman scattering (CP-CARS) technique together with Stokes parameters in the Poincaré sphere. The pump and Stokes excitation beams are circularly polarized to suppress both the linear polarization-dependent artifacts and the nonresonant background of tissue CARS imaging, enabling quantitative CP-CARS image analysis. This study shows that CP-CARS imaging uncovers significantly increased phase retardance of injured spinal cord tissue as compared to normal tissue, suggesting that CP-CARS is an appealing label-free imaging tool for determining the degree of tissue phase retardance, which could serve as a unique diagnostic parameter associated with nervous tissue injury.

  11. Effects of tissue fixation on coherent anti-Stokes Raman scattering images of brain

    Science.gov (United States)

    Galli, Roberta; Uckermann, Ortrud; Koch, Edmund; Schackert, Gabriele; Kirsch, Matthias; Steiner, Gerald

    2014-07-01

    Coherent anti-Stokes Raman scattering (CARS) microscopy is an emerging multiphoton technique for the label-free histopathology of the central nervous system, by imaging the lipid content within the tissue. In order to apply the technique on standard histology sections, it is important to know the effects of tissue fixation on the CARS image. Here, we report the effects of two common fixation methods, namely with formalin and methanol-acetone, on mouse brain and human glioblastoma tissue. The variations induced by fixation on the CARS contrast and intensity were compared and interpreted using Raman microspectroscopy. The results show that, whenever unfixed cryosections cannot be used, fixation with formalin constitutes an alternative which does not deteriorate substantially the contrast generated by the different brain structures in the CARS image. Fixation with methanol-acetone strongly modifies the tissue lipid content and is therefore incompatible with the CARS imaging.

  12. Chemical imaging and microspectroscopy with spectral focusing coherent anti-Stokes Raman scattering

    Science.gov (United States)

    Chen, Bi-Chang; Sung, Jiha; Wu, Xiaoxi; Lim, Sang-Hyun

    2011-02-01

    We demonstrate two different coherent anti-Stokes Raman scattering (CARS) microscopy and microspectroscopy methods based on the spectral focusing mechanism. The first method uses strongly chirped broadband pulses from a single Ti:sapphire laser and generates CARS signals at the fingerprint region. Fast modulation of the time delay between the pump and Stokes laser pulses coupled with lock-in signal detection significantly reduces the nonresonant background and produces Raman-like CARS signals with a spectral resolution of 20 cm-1. The second method generates CARS signals in the CH (carbon-hydrogen) stretching region with IR supercontinuum pulses from a photonic crystal fiber. The spectral resolution of 30 cm-1 is achieved. Maximum entropy method is used to retrieve a Raman-equivalent CARS spectrum from lipid membranes. Chemical imaging and microspectroscopy are demonstrated with various samples.

  13. Coherent deeply virtual Compton scattering off 3He and neutron generalized parton distributions

    Directory of Open Access Journals (Sweden)

    Rinaldi Matteo

    2014-06-01

    Full Text Available It has been recently proposed to study coherent deeply virtual Compton scattering (DVCS off 3He nuclei to access neutron generalized parton distributions (GPDs. In particular, it has been shown that, in Impulse Approximation (IA and at low momentum transfer, the sum of the quark helicity conserving GPDs of 3He, H and E, is dominated by the neutron contribution. This peculiar result makes the 3He target very promising to access the neutron information. We present here the IA calculation of the spin dependent GPD H See Formula in PDF of 3He. Also for this quantity the neutron contribution is found to be the dominant one, at low momentum transfer. The known forward limit of the IA calculation of H See Formula in PDF , yielding the polarized parton distributions of 3He, is correctly recovered. The extraction of the neutron information could be anyway non trivial, so that a procedure, able to take into account the nuclear effects encoded in the IA analysis, is proposed. These calculations, essential for the evaluation of the coherent DVCS cross section asymmetries, which depend on the GPDs H,E and H See Formula in PDF , represent a crucial step for planning possible experiments at Jefferson Lab.

  14. Coherent anti-Stokes Raman scattering microscopy: overcoming technical barriers for clinical translation.

    Science.gov (United States)

    Tu, Haohua; Boppart, Stephen A

    2014-01-01

    Clinical translation of coherent anti-Stokes Raman scattering microscopy is of great interest because of the advantages of noninvasive label-free imaging, high sensitivity, and chemical specificity. For this to happen, we have identified and review the technical barriers that must be overcome. Prior investigations have developed advanced techniques (features), each of which can be used to effectively overcome one particular technical barrier. However, the implementation of one or a small number of these advanced features in previous attempts for clinical translation has often introduced more tradeoffs than benefits. In this review, we outline a strategy that would integrate multiple advanced features to overcome all the technical barriers simultaneously, effectively reduce tradeoffs, and synergistically optimize CARS microscopy for clinical translation. The operation of the envisioned system incorporates coherent Raman micro-spectroscopy for identifying vibrational biomolecular markers of disease and single-frequency (or hyperspectral) Raman imaging of these specific biomarkers for real-time in vivo diagnostics and monitoring. Copyright © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  15. Quantification of Optical Doppler broadening and optical path lengths of multiply scattered light with phase modulated low coherence interferometry

    NARCIS (Netherlands)

    Varghese, Babu; Rajan, Vinayakrishnan; van Leeuwen, Ton; Steenbergen, Wiendelt

    2007-01-01

    We show experimental validation of a novel technique to measure optical path length distributions and path length resolved Doppler broadening in turbid media for different reduced scattering coefficients and anisotropies. The technique involves a phase modulated low coherence Mach-Zehnder

  16. Spatially dependent Rabi oscillations: An approach to sub-diffraction-limited coherent anti-Stokes Raman-scattering microscopy

    NARCIS (Netherlands)

    Beeker, Willem; Beeker, W.P.; Lee, Christopher James; Boller, Klaus J.; Gross, P.; Cleff, Carsten; Fallnich, Carsten; Offerhaus, Herman L.; Herek, Jennifer Lynn

    2010-01-01

    We present a theoretical investigation of coherent anti-Stokes Raman scattering (CARS) that is modulated by periodically depleting the ground-state population through Rabi oscillations driven by an additional control laser. We find that such a process generates optical sidebands in the CARS spectrum

  17. Visualizing Resonances in the Complex Plane with Vibrational Phase Contrast Coherent Anti-Stokes Raman Scattering (CARS)

    NARCIS (Netherlands)

    Jurna, M.; Garbacik, E.T.; Korterik, Jeroen P.; Herek, Jennifer Lynn; Otto, Cornelis; Offerhaus, Herman L.

    2010-01-01

    In coherent anti-Stokes Raman scattering (CARS), the emitted signal carries both amplitude and phase information of the molecules in the focal volume. Most CARS experiments ignore the phase component, but its detection allows for two advantages over intensity-only CARS. First, the pure resonant

  18. Dicty_cDB: VHF348 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF348 (Link to dictyBase) - - - Contig-U13926-1 VHF348P (Link to Original site) VHF3...48F 539 VHF348Z 473 VHF348P 992 - - Show VHF348 Library VH (Link to library) Clone ID VHF3... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF348Q.Seq.d/ Representative seq. ID VHF3...48P (Link to Original site) Representative DNA sequence >VHF348 (VHF348Q) /CSM/VH/VHF3-B/VHF3...ksxvlmliltck Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF3

  19. Dicty_cDB: VHF312 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF312 (Link to dictyBase) - - - Contig-U15897-1 VHF312P (Link to Original site) VHF3...12F 543 VHF312Z 483 VHF312P 1006 - - Show VHF312 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF312Q.Seq.d/ Representative seq. ID VHF3...12P (Link to Original site) Representative DNA sequence >VHF312 (VHF312Q) /CSM/VH/VHF3-A/VHF3... 4.0 %: extracellular, including cell wall 4.0 %: plasma membrane 4.0 %: peroxisomal >> prediction for VHF31

  20. Dicty_cDB: VHF375 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF375 (Link to dictyBase) - - - Contig-U16260-1 VHF375P (Link to Original site) VHF3...75F 432 VHF375Z 670 VHF375P 1082 - - Show VHF375 Library VH (Link to library) Clone ID VHF3...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-D/VHF375Q.Seq.d/ Representative seq. ID VHF3...75P (Link to Original site) Representative DNA sequence >VHF375 (VHF375Q) /CSM/VH/VHF3-D/VHF3...pperekv*pqksqiltnstknskqfkshxsfqr*xsnlkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF3

  1. Quantification of Doppler broadening in path length resolved diffusive light scattering using phase modulated low-coherence interferometry

    Science.gov (United States)

    Varghese, Babu; Rajan, Vinayakrishnan; van Leeuwen, Ton G.; Steenbergen, Wiendelt

    2007-02-01

    We describe path length resolved Doppler measurements of the multiply scattered light in turbid media using phase modulated low coherence Mach-Zehnder interferometer, with separate fibers for illumination and detection. A Doppler broadened phase modulation interference peak observed at the modulation frequency shows an increase in the average Doppler shift with optical path length. The path length dependent Doppler broadening of scattered light due to the detection of multiple scattered light is measured from the Lorentzian linewidth and the results are compared with the predictions of Diffusive Wave Spectroscopy. For particles with small scattering anisotropy, the diffusion approximation shows good agreement with our experimental results. For anisotropic scatterers, the experimental results show deviations from the Diffusion theory. The optical path lengths are determined experimentally from the Zero order moment of the phase modulation peak around the modulation frequency and the results are validated with the Monte Carlo technique.

  2. Dicty_cDB: VHF190 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available F0-ATPase putative regulatory protein IF1 (if1) mRNA, complete cds; nuclear gene for mitochondrial produc...VH (Link to library) VHF190 (Link to dictyBase) - - - Contig-U12594-1 - (Link to Original site) VHF1...90F 581 - - - - - - Show VHF190 Library VH (Link to library) Clone ID VHF190 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF1-D/VHF190Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF190 (VHF190Q) /CSM/VH/VHF1-D/VHF190Q.Seq.d/ ATTTTTCATTTTAAAAA

  3. Dicty_cDB: VHF331 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF331 (Link to dictyBase) - - - - - (Link to Original site) VHF3...31F 609 - - - - - - Show VHF331 Library VH (Link to library) Clone ID VHF331 (Link to dictyBase) Atlas ID... - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-B/VHF3...31Q.Seq.d/ Representative seq. ID - (Link to Original site) Representative DNA sequence >VHF3...31 (VHF331Q) /CSM/VH/VHF3-B/VHF331Q.Seq.d/ AACTCTCGAGTGCAAAAAAAGTAAAGTACAAAATGGTTAATTTCA

  4. Dicty_cDB: VHF709 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF709 (Link to dictyBase) - - - Contig-U15897-1 - (Link to Original site) - - VHF...709Z 602 - - - - Show VHF709 Library VH (Link to library) Clone ID VHF709 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF7-A/VHF709Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF709 (VHF709Q) /CSM/VH/VHF7-A/VHF709Q.Seq.d/ XXXXXXXXXXCGTCCAA...vestir Frame B: ---sknfttrsrlqlccsfnglxpr**rw*tnrqhyhg*cksiwsssfnlsryyw*yrcs ilpqiq*kwchhsnlpiw*wsflyhf

  5. Dicty_cDB: VHF236 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF236 (Link to dictyBase) - - - Contig-U14303-1 - (Link to Original site) - - VHF...236Z 611 - - - - Show VHF236 Library VH (Link to library) Clone ID VHF236 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF2-B/VHF236Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF236 (VHF236Q) /CSM/VH/VHF2-B/VHF236Q.Seq.d/ XXXXXXXXXXTGCCATT...VQKISQELKHLT*tfvsylvlk Frame B: ---plvicc*ninvlhfveilsxhglay*xhcfplvlv*fqilsrmiqs

  6. Dicty_cDB: VHF140 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF140 (Link to dictyBase) - - - Contig-U15309-1 - (Link to Original site) - - VHF...140Z 518 - - - - Show VHF140 Library VH (Link to library) Clone ID VHF140 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF1-B/VHF140Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF140 (VHF140Q) /CSM/VH/VHF1-B/VHF140Q.Seq.d/ XXXXXXXXXXCCGATAA...EDYINMQIKQLENSENSQELIQKLNEHLSEYKASVEEIKHNVQNN Frame C: ---iixvtlmlflqngilhfigviil

  7. Dicty_cDB: VHF507 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF507 (Link to dictyBase) - - - Contig-U11594-1 - (Link to Original site) - - VHF...507Z 541 - - - - Show VHF507 Library VH (Link to library) Clone ID VHF507 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF5-A/VHF507Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF507 (VHF507Q) /CSM/VH/VHF5-A/VHF507Q.Seq.d/ XXXXXXXXXXTACCAAT...nvhsmiwihvglxlvigx*sncfvttsfikst mmvllcstftmllkpsixwivvsmkkyf*clemnxhfw*sviki*knv

  8. Dicty_cDB: VHF321 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF321 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) VHF...321F 617 - - - - - - Show VHF321 Library VH (Link to library) Clone ID VHF321 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF321Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF321 (VHF321Q) /CSM/VH/VHF3-A/VHF321Q.Seq.d/ AACTCTCGAGTGCAAAA...VIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSCRADEQERGITIKSSSVSLHFEMPKEDKLPAGCTSHEFLINLIDSPGHVDFS SEVTAALRVTDGALVVIDC

  9. Dicty_cDB: VHF866 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF866 (Link to dictyBase) - - - Contig-U16600-1 - (Link to Original site) - - VHF...866Z 388 - - - - Show VHF866 Library VH (Link to library) Clone ID VHF866 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF8-C/VHF866Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF866 (VHF866Q) /CSM/VH/VHF8-C/VHF866Q.Seq.d/ XXXXXXXXXXAAGCAGC...Frame C: ---qhnnifklafptiknftgvpmxfvmtnegdnlgnftvkthfakffstyyscgeaghh yfdsccn*y*qkqgckfhs*h*xkssrr*lcfxqnwfi

  10. The coherent scattering function of the reptation model: simulations compared to theory.

    Science.gov (United States)

    Baumgärtner, A; Ebert, U; Schäfer, L

    2003-10-01

    We present results of Monte Carlo simulations measuring the coherent structure function of a chain moving through an ordered lattice of fixed topological obstacles. Our computer experiments use chains up to 320 beads and cover a large range of wave vectors and a time range exceeding the reptation time. For additional information we also measured the coherent structure function of internal pieces of the chain. We compare our results i) to the predictions of the primitive chain model, ii) to an approximate form resulting from Rouse motion in a coiled tube, and iii) to our recent evaluation of the full reptation model. i) The primitive chain model can fit the data for times t reptation time T(3) as a second fit parameter. For the chain lengths measured, the asymptotic behavior T3 approximately equal to N3 is not attained. ii) The model of Rouse motion in a tube, which we have criticized before on theoretical grounds, is shown to fail also on the purely phenomenological level. iii) Our evaluation of the full reptation model yields an excellent fit to the data for both total chains and internal pieces and for all wave vectors and all times, provided specific micro-structure effects of the MC dynamics are negligible. Such micro-structure effects show up for wave vectors of the order of the inverse segment size and enforce the introduction of some phenomenological, wave-vector-dependent prefactor. For the dynamics of the total chain our data analysis based on the full reptation model shows the importance of tube length fluctuations. Universal (Rouse-type) internal relaxation, however, is unimportant. It can be observed only in the form of the diffusive motion of a short central subchain in the tube. Finally, we present a fit formula which in a large range of wave vectors and chain lengths reproduces the numerical results of our theory for the scattering from the total chain.

  11. Dicty_cDB: VHF155 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF155 (Link to dictyBase) - - - - VHF155P (Link to Original site) VHF155F 587 VHF1...55Z 643 VHF155P 1210 - - Show VHF155 Library VH (Link to library) Clone ID VHF155 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF1...-C/VHF155Q.Seq.d/ Representative seq. ID VHF155P (Link to... Original site) Representative DNA sequence >VHF155 (VHF155Q) /CSM/VH/VHF1-C/VHF155Q.Seq.d/ ATTCTCGATACTGGAA

  12. Dicty_cDB: VHF392 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF392 (Link to dictyBase) - - - - VHF392P (Link to Original site) VHF392F 568 VHF3...92Z 375 VHF392P 923 - - Show VHF392 Library VH (Link to library) Clone ID VHF392 (Link ...to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3...-D/VHF392Q.Seq.d/ Representative seq. ID VHF392P (Link to ...Original site) Representative DNA sequence >VHF392 (VHF392Q) /CSM/VH/VHF3-D/VHF392Q.Seq.d/ AACTCTCGAGTGCAAAA

  13. Dicty_cDB: VHF366 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF366 (Link to dictyBase) - - - Contig-U12131-1 | Contig-U13633-1 VHF3...66P (Link to Original site) VHF366F 590 VHF366Z 544 VHF366P 1114 - - Show VHF366 Library VH (Link to library) Clone ID VHF3...131-1 | Contig-U13633-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-C/VHF3...66Q.Seq.d/ Representative seq. ID VHF366P (Link to Original site) Representative DNA sequence >VHF366 (VHF3...66Q) /CSM/VH/VHF3-C/VHF366Q.Seq.d/ AATAATTTATTATTATTATTAATAAGTAATAGAAATAAAAGATGGAACCAATTCCAGATA

  14. Dicty_cDB: VHF310 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF310 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) - - VHF3...10Z 625 - - - - Show VHF310 Library VH (Link to library) Clone ID VHF310 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF310Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF310 (VHF310Q) /CSM/VH/VHF3-A/VHF310Q.Seq.d/ XXXXXXXXXXTCGTCAA...omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHF310 (VHF310Q) /CSM/VH/VHF3-A/VHF3

  15. Dicty_cDB: VHF315 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF315 (Link to dictyBase) - G20600 DDB0169270 Contig-U12450-1 VHF3...15P (Link to Original site) VHF315F 216 VHF315Z 353 VHF315P 549 - - Show VHF315 Library VH (Link to library) Clone ID VHF3...ontig-U12450-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF3-A/VHF3...15Q.Seq.d/ Representative seq. ID VHF315P (Link to Original site) Representative DNA sequence >VHF315 (VHF315Q) /CSM/VH/VHF3...-A/VHF315Q.Seq.d/ ATTAAAAAACTTCTTACTTGGACACCCCTTTTATATATATAAATAAAAACTTCTAAATAT AAATCCCA

  16. Dicty_cDB: VHF381 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF381 (Link to dictyBase) - - - Contig-U16508-1 - (Link to Original site) - - VHF3...81Z 645 - - - - Show VHF381 Library VH (Link to library) Clone ID VHF381 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHF3-D/VHF381Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHF381 (VHF381Q) /CSM/VH/VHF3-D/VHF381Q.Seq.d/ XXXXXXXXXXCAACCAA...ignments: (bits) Value VHF381 (VHF381Q) /CSM/VH/VHF3-D/VHF381Q.Seq.d/ 1223 0.0 VHP767 (VHP767Q) /CSM/VH/VHP7

  17. Dicty_cDB: VHF210 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF210 (Link to dictyBase) - - - Contig-U12400-1 | Contig-U16431-1 VHF...210P (Link to Original site) VHF210F 613 VHF210Z 636 VHF210P 1229 - - Show VHF210 Library VH (Link to library) Clone ID VHF...400-1 | Contig-U16431-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-A/VHF...210Q.Seq.d/ Representative seq. ID VHF210P (Link to Original site) Representative DNA sequence >VHF210 (VHF...210Q) /CSM/VH/VHF2-A/VHF210Q.Seq.d/ AATAAAATGATAAGATCATCAATAAAAAATAAAATAACAACAACAAAAAGTTTATCATGT

  18. Dicty_cDB: VHF575 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF575 (Link to dictyBase) - - - Contig-U15481-1 | Contig-U15981-1 VHF...575P (Link to Original site) VHF575F 586 VHF575Z 397 VHF575P 963 - - Show VHF575 Library VH (Link to library) Clone ID VHF...81-1 | Contig-U15981-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF5-D/VHF...575Q.Seq.d/ Representative seq. ID VHF575P (Link to Original site) Representative DNA sequence >VHF575 (VHF...575Q) /CSM/VH/VHF5-D/VHF575Q.Seq.d/ ATAATAATACAAAGAAGAAATGAAAAATATAAATAATAAAATTTTAAAGATTTTTATTCT

  19. Dicty_cDB: VHF296 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF296 (Link to dictyBase) - G23392 DDB0187414 Contig-U12449-1 VHF...296P (Link to Original site) VHF296F 241 VHF296Z 482 VHF296P 703 - - Show VHF296 Library VH (Link to library) Clone ID VHF...ontig-U12449-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-D/VHF...296Q.Seq.d/ Representative seq. ID VHF296P (Link to Original site) Representative DNA sequence >VHF296 (VHF296Q) /CSM/VH/VHF...2-D/VHF296Q.Seq.d/ GATTATCAGAAAGATTACATTATGAAATTATACCAGATTGTATTAAAATTATTGAAAGCT CAAAACAA

  20. Dicty_cDB: VHF436 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF436 (Link to dictyBase) - - - - VHF436P (Link to Original site) VHF436F 618 VHF...436Z 699 VHF436P 1297 - - Show VHF436 Library VH (Link to library) Clone ID VHF436 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF...4-B/VHF436Q.Seq.d/ Representative seq. ID VHF436P (Link to... Original site) Representative DNA sequence >VHF436 (VHF436Q) /CSM/VH/VHF4-B/VHF436Q.Seq.d/ AACTCTCGAGTGCAAA

  1. Dicty_cDB: VHF158 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF158 (Link to dictyBase) - - - - VHF158P (Link to Original site) VHF158F 608 VHF...158Z 693 VHF158P 1281 - - Show VHF158 Library VH (Link to library) Clone ID VHF158 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF...1-C/VHF158Q.Seq.d/ Representative seq. ID VHF158P (Link to... Original site) Representative DNA sequence >VHF158 (VHF158Q) /CSM/VH/VHF1-C/VHF158Q.Seq.d/ AACTCTCGAGTGCAAA

  2. Dicty_cDB: VHF847 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF847 (Link to dictyBase) - - - Contig-U15351-1 | Contig-U16514-1 VHF...847P (Link to Original site) VHF847F 478 VHF847Z 709 VHF847P 1167 - - Show VHF847 Library VH (Link to library) Clone ID VHF...351-1 | Contig-U16514-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF8-B/VHF...847Q.Seq.d/ Representative seq. ID VHF847P (Link to Original site) Representative DNA sequence >VHF847 (VHF...847Q) /CSM/VH/VHF8-B/VHF847Q.Seq.d/ TATGATGTTCCACTTATAATTCAAACGGTTGCCAATAATAAATCAACAAAACTCANTCTT

  3. Dicty_cDB: VHF272 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF272 (Link to dictyBase) - - - Contig-U15754-1 VHF272P (Link to Original site) VHF...272F 515 VHF272Z 603 VHF272P 1098 - - Show VHF272 Library VH (Link to library) Clone ID VHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-C/VHF272Q.Seq.d/ Representative seq. ID VHF...272P (Link to Original site) Representative DNA sequence >VHF272 (VHF272Q) /CSM/VH/VHF2-C/VHF...id sequence (All Frames) Frame A: ixfssq**wnkkd*mihy*eiligrigvpm*vidngqlfvkimvvnhgptfhtimldhvh idgqrivlvdfvidfkifv*v*hf

  4. Quantification of optical Doppler broadening and optical path lengths of multiply scattered light by phase modulated low coherence interferometry.

    Science.gov (United States)

    Varghese, B; Rajan, V; van Leeuwen, T G; Steenbergen, W

    2007-07-23

    We show experimental validation of a novel technique to measure optical path length distributions and path length resolved Doppler broadening in turbid media for different reduced scattering coefficients and anisotropies. The technique involves a phase modulated low coherence Mach-Zehnder interferometer, with separate fibers for illumination and detection. Water suspensions of Polystyrene microspheres with high scattering and low absorption levels are used as calibrated scattering phantoms. The path length dependent diffusion broadening or Doppler broadening of scattered light is shown to agree with Diffusive Wave Spectroscopy within 5%. The optical path lengths are determined experimentally from the zero order moment of the phase modulation peak around the modulation frequency in the power spectrum and the results are validated with Monte Carlo simulations.

  5. Quantification of optical Doppler broadening and optical path lengths of multiply scattered light by phase modulated low coherence interferometry

    Science.gov (United States)

    Varghese, B.; Rajan, V.; van Leeuwen, T. G.; Steenbergen, W.

    2007-07-01

    We show experimental validation of a novel technique to measure optical path length distributions and path length resolved Doppler broadening in turbid media for different reduced scattering coefficients and anisotropies. The technique involves a phase modulated low coherence Mach-Zehnder interferometer, with separate fibers for illumination and detection. Water suspensions of Polystyrene microspheres with high scattering and low absorption levels are used as calibrated scattering phantoms. The path length dependent diffusion broadening or Doppler broadening of scattered light is shown to agree with Diffusive Wave Spectroscopy within 5%. The optical path lengths are determined experimentally from the zero order moment of the phase modulation peak around the modulation frequency in the power spectrum and the results are validated with Monte Carlo simulations.

  6. Intracellular imaging of docosanol in living cells by coherent anti-Stokes Raman scattering microscopy

    Science.gov (United States)

    You, Sixian; Liu, Yuan; Arp, Zane; Zhao, Youbo; Chaney, Eric J.; Marjanovic, Marina; Boppart, Stephen A.

    2017-07-01

    Docosanol is an over-the-counter topical agent that has proved to be one of the most effective therapies for treating herpes simplex labialis. However, the mechanism by which docosanol suppresses lesion formation remains poorly understood. To elucidate its mechanism of action, we investigated the uptake of docosanol in living cells using coherent anti-Stokes Raman scattering microscopy. Based on direct visualization of the deuterated docosanol, we observed highly concentrated docosanol inside living cells 24 h after drug treatment. In addition, different spatial patterns of drug accumulation were observed in different cell lines. In keratinocytes, which are the targeted cells of docosanol, the drug molecules appeared to be docking at the periphery of the cell membrane. In contrast, the drug molecules in fibroblasts appeared to accumulate in densely packed punctate regions throughout the cytoplasm. These results suggest that this molecular imaging approach is suitable for the longitudinal tracking of drug molecules in living cells to identify cell-specific trafficking and may also have implications for elucidating the mechanism by which docosanol suppresses lesion formation.

  7. Insights into Caco-2 cell culture structure using coherent anti-Stokes Raman scattering (CARS) microscopy.

    Science.gov (United States)

    Saarinen, Jukka; Sözeri, Erkan; Fraser-Miller, Sara J; Peltonen, Leena; Santos, Hélder A; Isomäki, Antti; Strachan, Clare J

    2017-05-15

    We have used coherent anti-Stokes Raman scattering (CARS) microscopy as a novel and rapid, label-free and non-destructive imaging method to gain structural insights into live intestinal epithelial cell cultures used for drug permeability testing. Specifically we have imaged live Caco-2 cells in (bio)pharmaceutically relevant conditions grown on membrane inserts. Imaging conditions were optimized, including evaluation of suitable membrane materials and media solutions, as well as tolerable laser powers for non-destructive imaging of the live cells. Lipid structures, in particular lipid droplets, were imaged within the cells on the insert membranes. The size of the individual lipid droplets increased substantially over the 21-day culturing period up to approximately 10% of the volume of the cross section of individual cells. Variation in lipid content has important implications for intestinal drug permeation testing during drug development but has received limited attention to date due to a lack of suitable analytical techniques. CARS microscopy was shown to be well suited for such analysis with the potential for in situ imaging of the same individual cell-cultures that are used for permeation studies. Overall, the method may be used to provide important information about cell monolayer structure to better understand drug permeation results. Copyright © 2017 Elsevier B.V. All rights reserved.

  8. Label-free imaging of human breast tissues using coherent anti-Stokes Raman scattering microscopy

    Science.gov (United States)

    Yang, Yaliang; Gao, Liang; Wang, Zhiyong; Thrall, Michael J.; Luo, Pengfei; Wong, Kelvin K.; Wong, Stephen T.

    2011-03-01

    Breast cancer is a common disease in women. Current imaging and diagnostic methods for breast cancer confront several limitations, like time-consuming, invasive and with a high cost. Alternative strategies are in high demand to alleviate patients' trauma and lower medical expenses. Coherent anti-Stokes Raman scattering (CARS) imaging technique offers many advantages, including label-free, sub-wavelength spatial resolution and video-rate imaging speed. Therefore, it has been demonstrated as a powerful tool for various biomedical applications. In this study, we present a label-free fast imaging method to identify breast cancer and its subtypes using CARS microscopy. Human breast tissues, including normal, benign and invasive carcinomas, were imaged ex vivo using a custom-built CARS microscope. Compared with results from corresponding hematoxylin and eosin (H&E) stains, the CARS technique has demonstrated its capability in identifying morphological features in a similar way as in H&E stain. These features can be used to distinguish breast cancer from normal and benign tissues, and further separate cancer subtypes from each other. Our pilot study suggests that CARS microscopy could be used as a routine examination tool to characterize breast cancer ex vivo. Moreover, its label-free and fast imaging properties render this technique as a promising approach for in vivo and real-time imaging and diagnosis of breast cancer.

  9. Optical transistor action by nonlinear coupling of stimulated emission and coherent scattering

    Science.gov (United States)

    Andrews, David L.; Bradshaw, David S.

    2010-08-01

    In the pursuit of improved platforms for computing, communications and internet connectivity, all-optical systems offer excellent prospects for a speed and fidelity of data transmission that will greatly surpass conventional electronics, alongside the anticipated benefits of reduced energy loss. With a diverse range of sources and fiber optical connections already in production, much current effort is being devoted towards forging optical components for signal switching, such as an all-optical transistor. Achievement of the desired characteristics for any practicable device can be expected to depend crucially on the engagement of a strongly nonlinear optical response. The innovative scheme proposed in the present work is based upon a third-order nonlinearity - its effect enhanced by stimulated emission - operating within a system designed to exploit the highly nonlinear response observed at the threshold for laser emission. Here, stimulated emission is strongly driven by coupling to the coherent scattering of a signal input beam whose optical frequency is purposely off-set from resonance. An electrodynamical analysis of the all-optical coupling process shows that the signal beam can significantly modify the kinetics of emission, and so lead to a dramatically enhanced output of resonant radiation. The underlying nonlinear optical mechanism is analyzed, model calculations are performed for realizable three-level laser systems, and the results exhibited graphically. The advantages of implementing this all-optical transistor scheme, compared to several previously envisaged proposals, are then outlined.

  10. Explicit Form of the Radiative and Collisional Branching Ratios in Polarized Radiation Transport with Coherent Scattering

    Science.gov (United States)

    Casini, R.; del Pino Alemán, T.; Manso Sainz, R.

    2017-10-01

    We consider the vector emissivity of the polarized radiation transfer in a Λ-type atomic transition, which we recently proposed to account for both complete frequency redistribution (CRD) and partial redistribution (PRD) contributions to the scattered radiation. This expression can concisely be written as ɛ = ( ɛ ( 1 ) - ɛ f . s . ( 2 ) ) + ɛ ( 2 ) , where {{\\boldsymbol{\\varepsilon }}}(1) and {{\\boldsymbol{\\varepsilon }}}(2) are the emissivity terms describing, respectively, one-photon and two-photon processes in a Λ-type atom, and where “f.s.” means that the corresponding term must be evaluated assuming an appropriate “flat spectrum” average of the incident radiation across the spectral line. In this follow-up study, we explicitly consider the expressions of these various terms for the case of a polarized multi-term atom to derive the algebraic forms of the branching ratios between the CRD and PRD contributions to the emissivity. In the limit of a two-term atom with non-coherent lower term, our results are shown to be in full agreement with those recently derived by Bommier.

  11. Coherent Raman Scattering Microscopy for Evaluation of Head and Neck Carcinoma.

    Science.gov (United States)

    Hoesli, Rebecca C; Orringer, Daniel A; McHugh, Jonathan B; Spector, Matthew E

    2017-09-01

    Objective We aim to describe a novel, label-free, real-time imaging technique, coherent Raman scattering (CRS) microscopy, for histopathological evaluation of head and neck cancer. We evaluated the ability of CRS microscopy to delineate between tumor and nonneoplastic tissue in tissue samples from patients with head and neck cancer. Study Design Prospective case series. Setting Tertiary care medical center. Subjects and Methods Patients eligible were surgical candidates with biopsy-proven, previously untreated head and neck carcinoma and were consented preoperatively for participation in this study. Tissue was collected from 50 patients, and after confirmation of tumor and normal specimens by hematoxylin and eosin (H&E), there were 42 tumor samples and 42 normal adjacent controls. Results There were 42 confirmed carcinoma specimens on H&E, and CRS microscopy identified 37 as carcinoma. Of the 42 normal specimens, CRS microscopy identified 40 as normal. This resulted in a sensitivity of 88.1% and specificity of 95.2% in distinguishing between neoplastic and nonneoplastic images. Conclusion CRS microscopy is a unique label-free imaging technique that can provide rapid, high-resolution images and can accurately determine the presence of head and neck carcinoma. This holds potential for implementation into standard practice, allowing frozen margin evaluation even at institutions without a histopathology laboratory.

  12. Scattering angle resolved optical coherence tomography for in vivo murine retinal imaging

    Science.gov (United States)

    Gardner, Michael R.; Katta, Nitesh; McElroy, Austin; Baruah, Vikram; Rylander, H. G.; Milner, Thomas E.

    2017-02-01

    Optical coherence tomography (OCT) retinal imaging contributes to understanding central nervous system (CNS) diseases because the eye is an anatomical "window to the brain" with direct optical access to nonmylenated retinal ganglion cells. However, many CNS diseases are associated with neuronal changes beyond the resolution of standard OCT retinal imaging systems. Though studies have shown the utility of scattering angle resolved (SAR) OCT for particle sizing and detecting disease states ex vivo, a compact SAR-OCT system for in vivo rodent retinal imaging has not previously been reported. We report a fiber-based SAR-OCT system (swept source at 1310 nm +/- 65 nm, 100 kHz scan rate) for mouse retinal imaging with a partial glass window (center aperture) for angular discrimination of backscattered light. This design incorporates a dual-axis MEMS mirror conjugate to the ocular pupil plane and a high collection efficiency objective. A muring retina is imaged during euthanasia, and the proposed SAR-index is examined versus time. Results show a positive correlation between the SAR-index and the sub-cellular hypoxic response of neurons to isoflurane overdose during euthanasia. The proposed SAR-OCT design and image process technique offer a contrast mechanism able to detect sub-resolution neuronal changes for murine retinal imaging.

  13. Femtosecond Coherent Anti-Stokes Raman Scattering Gas Phase Thermometry at 5 kHz

    Science.gov (United States)

    Fineman, Claresta; Lucht, Robert

    2014-05-01

    Understanding the thermal instabilities occurring in turbulent combustion, such as in modern gas turbine combustors, is critical for more reliable and fuel-efficient operation. Non-intrusive laser based spectroscopy methods have been documented as the techniques of choice for turbulent combustion diagnostics. Specifically, femtosecond coherent anti-Stokes Raman scattering (fs-CARS) thermometry has been established for temporal resolution of turbulent fluctuations in flame structure and provides accurate measurements across a wide range of temperatures. Experiments performed to date include 5 kHz pure vibrational N2 chirped probe-pulse fs-CARS thermometry on non-premixed hydrogen jet diffusion flames, methane jet diffusion flames, and the DLR gas turbine model combustor (GTMC). The fs-CARS signal generation process requires precise spatial and temporal overlap of tightly focused pulsed laser beams of less than 100 fs pulse duration. Here, signal loss due to beam steering, pressure fluctuations, or shear layer density gradients can become a problem. The effect of such interferences has been investigated using high velocity flow of compressed nitrogen gas from a converging-diverging nozzle. Resulting changes in fs-CARS spectra have been studied. Funding for this work was provided by the U.S. Department of Energy, Division of Chemical Sciences, Geosciences and Biosciences.

  14. Impact of input field characteristics on vibrational femtosecond coherent anti-Stokes Raman scattering thermometry.

    Science.gov (United States)

    Yang, Chao-Bo; He, Ping; Escofet-Martin, David; Peng, Jiang-Bo; Fan, Rong-Wei; Yu, Xin; Dunn-Rankin, Derek

    2018-01-10

    In this paper, three ultrashort-pulse coherent anti-Stokes Raman scattering (CARS) thermometry approaches are summarized with a theoretical time-domain model. The difference between the approaches can be attributed to variations in the input field characteristics of the time-domain model. That is, all three approaches of ultrashort-pulse (CARS) thermometry can be simulated with the unified model by only changing the input fields features. As a specific example, the hybrid femtosecond/picosecond CARS is assessed for its use in combustion flow diagnostics; thus, the examination of the input field has an impact on thermometry focuses on vibrational hybrid femtosecond/picosecond CARS. Beginning with the general model of ultrashort-pulse CARS, the spectra with different input field parameters are simulated. To analyze the temperature measurement error brought by the input field impacts, the spectra are fitted and compared to fits, with the model neglecting the influence introduced by the input fields. The results demonstrate that, however the input pulses are depicted, temperature errors still would be introduced during an experiment. With proper field characterization, however, the significance of the error can be reduced.

  15. Surfactant uptake dynamics in mammalian cells elucidated with quantitative coherent anti-stokes Raman scattering microspectroscopy.

    Directory of Open Access Journals (Sweden)

    Masanari Okuno

    Full Text Available The mechanism of surfactant-induced cell lysis has been studied with quantitative coherent anti-Stokes Raman scattering (CARS microspectroscopy. The dynamics of surfactant molecules as well as intracellular biomolecules in living Chinese Hamster Lung (CHL cells has been examined for a low surfactant concentration (0.01 w%. By using an isotope labeled surfactant having CD bonds, surfactant uptake dynamics in living cells has been traced in detail. The simultaneous CARS imaging of the cell itself and the internalized surfactant has shown that the surfactant molecules is first accumulated inside a CHL cell followed by a sudden leak of cytosolic components such as proteins to the outside of the cell. This finding indicates that surfactant uptake occurs prior to the cell lysis, contrary to what has been believed: surface adsorption of surfactant molecules has been thought to occur first with subsequent disruption of cell membranes. Quantitative CARS microspectroscopy enables us to determine the molecular concentration of the surfactant molecules accumulated in a cell. We have also investigated the effect of a drug, nocodazole, on the surfactant uptake dynamics. As a result of the inhibition of tubulin polymerization by nocodazole, the surfactant uptake rate is significantly lowered. This fact suggests that intracellular membrane trafficking contributes to the surfactant uptake mechanism.

  16. Quantitative chemical imaging and unsupervised analysis using hyperspectral coherent anti-Stokes Raman scattering microscopy.

    Science.gov (United States)

    Masia, Francesco; Glen, Adam; Stephens, Phil; Borri, Paola; Langbein, Wolfgang

    2013-11-19

    In this work, we report a method to acquire and analyze hyperspectral coherent anti-Stokes Raman scattering (CARS) microscopy images of organic materials and biological samples resulting in an unbiased quantitative chemical analysis. The method employs singular value decomposition on the square root of the CARS intensity, providing an automatic determination of the components above noise, which are retained. Complex CARS susceptibility spectra, which are linear in the chemical composition, are retrieved from the CARS intensity spectra using the causality of the susceptibility by two methods, and their performance is evaluated by comparison with Raman spectra. We use non-negative matrix factorization applied to the imaginary part and the nonresonant real part of the susceptibility with an additional concentration constraint to obtain absolute susceptibility spectra of independently varying chemical components and their absolute concentration. We demonstrate the ability of the method to provide quantitative chemical analysis on known lipid mixtures. We then show the relevance of the method by imaging lipid-rich stem-cell-derived mouse adipocytes as well as differentiated embryonic stem cells with a low density of lipids. We retrieve and visualize the most significant chemical components with spectra given by water, lipid, and proteins segmenting the image into the cell surrounding, lipid droplets, cytosol, and the nucleus, and we reveal the chemical structure of the cells, with details visualized by the projection of the chemical contrast into a few relevant channels.

  17. Imaging the intact mouse cornea using coherent anti-stokes Raman scattering (CARS).

    Science.gov (United States)

    Ammar, David A; Lei, Tim C; Kahook, Malik Y; Masihzadeh, Omid

    2013-08-05

    The aim of this study was to image the cellular and noncellular structures of the cornea and limbus in an intact mouse eye using the vibrational oscillation of the carbon-hydrogen bond in lipid membranes and autofluorescence as label-free contrast agents. Freshly enucleated mouse eyes were imaged using two nonlinear optical techniques: coherent anti-Stokes Raman scattering (CARS) and two-photon autofluorescence (TPAF). Sequential images were collected through the full thickness of the cornea and limbal regions. Line scans along the transverse/sagittal axes were also performed. Analysis of multiple CARS/TPAF images revealed that corneal epithelial and endothelial cells could be identified by the lipid-rich plasma membrane CARS signal. The fluorescent signal from the collagen fibers of the corneal stroma was evident in the TPAF channel. The transition from the cornea to sclera at the limbus was marked by a change in collagen pattern (TPAF channel) and thickness of surface cells (CARS channel). Regions within the corneal stroma that lack collagen autofluorescence coincided with CARS signal, indicating the presence of stromal fibroblasts or nerve fibers. The CARS technique was successful in imaging cells in the intact mouse eye, both at the surface and within corneal tissue. Multiphoton images were comparable to histologic sections. The methods described here represent a new avenue for molecular specific imaging of the mouse eye. The lack of need for tissue fixation is unique compared with traditional histology imaging techniques.

  18. Rapid-scan Fourier-transform coherent anti-Stokes Raman scattering spectroscopy with heterodyne detection.

    Science.gov (United States)

    Hiramatsu, Kotaro; Luo, Yizhi; Ideguchi, Takuro; Goda, Keisuke

    2017-11-01

    High-speed Raman spectroscopy has become increasingly important for analyzing chemical dynamics in real time. To address the need, rapid-scan Fourier-transform coherent anti-Stokes Raman scattering (FT-CARS) spectroscopy has been developed to realize broadband CARS measurements at a scan rate of more than 20,000 scans/s. However, the detection sensitivity of FT-CARS spectroscopy is inherently low due to the limited number of photons detected during each scan. In this Letter, we show our experimental demonstration of enhanced sensitivity in rapid-scan FT-CARS spectroscopy by heterodyne detection. Specifically, we implemented heterodyne detection by superposing the CARS electric field with an external local oscillator (LO) for their interference. The CARS signal was amplified by simply increasing the power of the LO without the need for increasing the incident power onto the sample. Consequently, we achieved enhancement in signal intensity and the signal-to-noise ratio by factors of 39 and 5, respectively, compared to FT-CARS spectroscopy with homodyne detection. The sensitivity-improved rapid-scan FT-CARS spectroscopy is expected to enable the sensitive real-time observation of chemical dynamics in a broad range of settings, such as combustion engines and live biological cells.

  19. Coherent anti-Stokes Raman scattering and two photon excited fluorescence for neurosurgery.

    Science.gov (United States)

    Romeike, Bernd F M; Meyer, Tobias; Reichart, Rupert; Kalff, Rolf; Petersen, Iver; Dietzek, Benjamin; Popp, Jürgen

    2015-04-01

    There is no established method for in vivo imaging during biopsy and surgery of the brain, which is capable to generate competitive images in terms of resolution and contrast comparable with histopathological staining. Coherent anti-Stokes Raman scattering (CARS) and two photon excited fluorescence (TPEF) microscopy are non-invasive all optical imaging techniques that are capable of high resolution, label-free, real-time, nondestructive examination of living cells and tissues. They provide image contrast based on the molecular composition of the specimen which allows the study of large tissue areas of frozen tissue sections ex vivo. Here, preliminary data on 55 lesions of the central nervous system are presented. The generated images very nicely demonstrate cytological and architectural features required for pathological tumor typing and grading. Furthermore, information on the molecular content of a probe is provided. The tool will be implemented into a biopsy needle or endoscope in the near future for in vivo studies. With this promising multimodal imaging approach the neurosurgeon might directly see blood vessels to minimize the risk for biopsy associated hemorrhages. The attending neuropathologist might directly identify the tumor and guide the selection of representative specimens for further studies. Thus, collection of non-representative material could be avoided and the risk to injure eloquent brain tissue minimized. Copyright © 2015 Elsevier B.V. All rights reserved.

  20. Dual-Pump Coherent Anti-Stokes Raman Scattering Temperature and CO2 Concentration Measurements

    Science.gov (United States)

    Lucht, Robert P.; Velur-Natarajan, Viswanathan; Carter, Campbell D.; Grinstead, Keith D., Jr.; Gord, James R.; Danehy, Paul M.; Fiechtner, G. J.; Farrow, Roger L.

    2003-01-01

    Measurements of temperature and CO2 concentration using dual-pump coherent anti-Stokes Raman scattering, (CARS) are described. The measurements were performed in laboratory flames,in a room-temperature gas cell, and on an engine test stand at the U.S. Air Force Research Laboratory, Wright-Patterson Air Force Base. A modeless dye laser, a single-mode Nd:YAG laser, and an unintensified back-illuminated charge-coupled device digital camera were used for these measurements. The CARS measurements were performed on a single-laser-shot basis. The standard deviations of the temperatures and CO2 mole fractions determined from single-shot dual-pump CARS spectra in steady laminar propane/air flames were approximately 2 and 10% of the mean values of approximately 2000 K and 0.10, respectively. The precision and accuracy of single-shot temperature measurements obtained from the nitrogen part of the dual-pump CARS system were investigated in detail in near-adiabatic hydrogen/air/CO2 flames. The precision of the CARS temperature measurements was found to be comparable to the best results reported in the literature for conventional two-laser, single-pump CARS. The application of dual-pump CARS for single-shot measurements in a swirl-stabilized combustor fueled with JP-8 was also demonstrated.

  1. Investigation of lipid homeostasis in living Drosophila by coherent anti-Stokes Raman scattering microscopy

    Science.gov (United States)

    Chien, Cheng-Hao; Chen, Wei-Wen; Wu, June-Tai; Chang, Ta-Chau

    2012-12-01

    To improve our understanding of lipid metabolism, Drosophila is used as a model animal, and its lipid homeostasis is monitored by coherent anti-Stokes Raman scattering microscopy. We are able to achieve in vivo imaging of larval fat body (analogous to adipose tissue in mammals) and oenocytes (analogous to hepatocytes) in Drosophila larvae at subcellular level without any labeling. By overexpressing two lipid regulatory proteins-Brummer lipase (Bmm) and lipid storage droplet-2 (Lsd-2)-we found different phenotypes and responses under fed and starved conditions. Comparing with the control larva, we observed more lipid droplet accumulation by ˜twofold in oenocytes of fat-body-Bmm-overexpressing (FB-Bmm-overexpressing) mutant under fed condition, and less lipid by ˜fourfold in oenocytes of fat-body-Lsd-2-overexpressing (FB-Lsd-2-overexpressing) mutant under starved condition. Moreover, together with reduced size of lipid droplets, the lipid content in the fat body of FB-Bmm-overexpressing mutant decreases much faster than that of the control and FB-Lsd-2-overexpressing mutant during starvation. From long-term starvation assay, we found FB-Bmm-overexpressing mutant has a shorter lifespan, which can be attributed to faster consumption of lipid in its fat body. Our results demonstrate in vivo observations of direct influences of Bmm and Lsd-2 on lipid homeostasis in Drosophila larvae.

  2. Brownian and advective dynamics in microflow studied by coherent X-ray scattering experiments.

    Science.gov (United States)

    Urbani, Raphael; Westermeier, Fabian; Banusch, Benjamin; Sprung, Michael; Pfohl, Thomas

    2016-11-01

    Combining microfluidics with coherent X-ray illumination offers the possibility to not only measure the structure but also the dynamics of flowing samples in a single-scattering experiment. Here, the power of this combination is demonstrated by studying the advective and Brownian dynamics of colloidal suspensions in microflow of different geometries. Using an experimental setup with a fast two-dimensional detector and performing X-ray correlation spectroscopy by calculating two-dimensional maps of the intensity auto-correlation functions, it was possible to evaluate the sample structure and furthermore to characterize the detailed flow behavior, including flow geometry, main flow directions, advective flow velocities and diffusive dynamics. By scanning a microfocused X-ray beam over a microfluidic device, the anisotropic auto-correlation functions of driven colloidal suspensions in straight, curved and constricted microchannels were mapped with the spatial resolution of the X-ray beam. This method has not only a huge potential for studying flow patterns in complex fluids but also to generally characterize anisotropic dynamics in materials.

  3. Observation of Laser Induced Magnetization Dynamics in Co/Pd Multilayers with Coherent X-ray Scattering

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Benny

    2012-04-05

    We report on time-resolved coherent x-ray scattering experiments of laser induced magnetization dynamics in Co/Pd multilayers with a high repetition rate optical pump x-ray probe setup. Starting from a multi-domain ground state, the magnetization is uniformly reduced after excitation by an intense 50 fs laser pulse. Using the normalized time correlation, we study the magnetization recovery on a picosecond timescale. The dynamic scattering intensity is separated into an elastic portion at length scales above 65 nm which retains memory of the initial domain magnetization, and a fluctuating portion at smaller length scales corresponding to domain boundary motion during recovery.

  4. High angle phase modulated low coherence interferometry for path length resolved Doppler measurements of multiply scattered light

    Science.gov (United States)

    Varghese, Babu; Rajan, Vinayakrishnan; Van Leeuwen, Ton G.; Steenbergen, Wiendelt

    2008-02-01

    We describe an improved method for coherence domain path length resolved measurements of multiply scattered photons in turbid media. An electro-optic phase modulator sinusoidally modulates the phase in the reference arm of a low coherence fiber optic Mach-Zehnder interferometer, at a high phase modulation angle. For dynamic turbid media this results in Doppler broadened phase modulation interference peaks at the modulation frequency and its multiples. The signal to noise ratio is increased by almost one order or magnitude for large modulation angles and the shape of the spectral peaks resulting from the interference of Doppler shifted sample waves and reference light is not changed. The path length dependent Doppler broadening is compared with the theoretical predictions in the single scattered and diffusive regimes. The experimentally measured optical path lengths are validated with the Monte Carlo technique.

  5. Detection of chemical interfaces in coherent anti-Stokes Raman scattering microscopy: Dk-CARS. I. Axial interfaces.

    Science.gov (United States)

    Gachet, David; Rigneault, Hervé

    2011-12-01

    We develop a full vectorial theoretical investigation of the chemical interface detection in conventional coherent anti-Stokes Raman scattering (CARS) microscopy. In Part I, we focus on the detection of axial interfaces (i.e., parallel to the optical axis) following a recent experimental demonstration of the concept [Phys. Rev. Lett. 104, 213905 (2010)]. By revisiting the Young's double slit experiment, we show that background-free microscopy and spectroscopy is achievable through the angular analysis of the CARS far-field radiation pattern. This differential CARS in k space (Dk-CARS) technique is interesting for fast detection of interfaces between molecularly different media. It may be adapted to other coherent and resonant scattering processes.

  6. Discrimination of chemical warfare simulants via multiplex coherent anti-Stokes Raman scattering and multivariate statistical analysis

    Science.gov (United States)

    Brady, John J.; Farrell, Mikella E.; Pellegrino, Paul M.

    2014-02-01

    Multiplex coherent anti-Stokes Raman scattering (MCARS) is used to detect several chemical warfare simulants, such as dimethyl methylphosphonate and 2-chloroethyl ethyl sulfide, with high specificity. The spectral bandwidth of the femtosecond laser pulse used in these studies is sufficient to coherently and simultaneously drive all the vibrational modes in the molecule of interest. Evidence shows that MCARS is capable of overcoming common sensitivity limitations of spontaneous Raman scattering, thus allowing for the detection of the target material in milliseconds with standard, uncooled universal serial bus spectrometers as opposed to seconds with cooled, intensified CCD-based spectrometers. In addition, the obtained MCARS spectrum of the investigated sample provides multiple unique signatures. These signatures are used in an off-line multivariate statistical analysis allowing for the material's discrimination with high fidelity.

  7. Non-Gaussian statistics of extreme events in stimulated Raman scattering: The role of coherent memory and source noise

    Science.gov (United States)

    Monfared, Yashar E.; Ponomarenko, Sergey A.

    2017-10-01

    We explore theoretically and numerically extreme event excitation in stimulated Raman scattering in gases. We consider gas-filled hollow-core photonic crystal fibers as a particular system realization. We show that moderate amplitude pump fluctuations obeying Gaussian statistics lead to the emergence of heavy-tailed non-Gaussian statistics as coherent seed Stokes pulses are amplified on propagation along the fiber. We reveal the crucial role that coherent memory effects play in causing non-Gaussian statistics of the system. We discover that extreme events can occur even at the initial stage of stimulated Raman scattering when one can neglect energy depletion of an intense, strongly fluctuating Gaussian pump source. Our analytical results in the undepleted pump approximation explicitly illustrate power-law probability density generation as the input pump noise is transferred to the output Stokes pulses.

  8. Coherent band excitations in CePd 3 : A comparison of neutron scattering and ab initio theory

    Energy Technology Data Exchange (ETDEWEB)

    Goremychkin, Eugene A.; Park, Hyowon; Osborn, Raymond; Rosenkranz, Stephan; Castellan, John-Paul; Fanelli, Victor R.; Christianson, Andrew D.; Stone, Matthew B.; Bauer, Eric D.; McClellan, Kenneth J.; Byler, Darrin D.; Lawrence, Jon M.

    2018-01-11

    In common with many strongly correlated electron systems, intermediate valence compounds are believed to display a crossover from a high-temperature regime of incoherently fluctuating local moments to a low-temperature regime of coherent hybridized bands. We show that inelastic neutron scattering measurements of the dynamic magnetic susceptibility of CePd3 provides a benchmark for ab initio calculations based on dynamical mean field theory. The magnetic response is strongly momentum dependent thanks to the formation of coherent f-electron bands at low temperature, with an amplitude that is strongly enhanced by local particle-hole interactions. The agreement between experiment and theory shows that we have a robust first-principles understanding of the temperature dependence of f-electron coherence.

  9. Lipid-cell interactions in human monocytes investigated by doubly-resonant coherent anti-Stokes Raman scattering microscopy

    OpenAIRE

    Weeks, Tyler; Schie, Iwan; den Hartigh, Laura J.; Rutledge, John C.; Huser, Thomas

    2011-01-01

    We demonstrate that doubly-resonant coherent anti-Stokes Raman scattering can provide enhanced and highly specific contrast for molecules containing unique Raman-active small molecular groups. This combination provides contrast for molecules that can otherwise be difficult to discriminate by Raman spectroscopy. Here, human monocytes were incubated with either deuterated oleic acid or 17-octadecynoic acid (a fatty acid with an end terminal acetylene group). The carbon-deuterium stretching vibr...

  10. Asymptotic Modeling of Coherent Scattering from Random Rough Layers: Application to Road Survey by GPR at Nadir

    Directory of Open Access Journals (Sweden)

    Nicolas Pinel

    2012-01-01

    Full Text Available This paper studies the coherent scattering from random rough layers made up of two uncorrelated random rough surfaces, by considering 2D problems. The results from a rigorous electromagnetic method called PILE (propagation-inside-layer expansion are used as a reference. Also, two asymptotic analytical approaches are presented and compared to the numerical model for comparison. The cases of surfaces with both Gaussian and exponential correlations are studied. This approach is applied to road survey by GPR at nadir.

  11. Temperature Measurements in Reacting Flows Using Time-Resolved Femtosecond Coherent Anti-Stokes Raman Scattering (fs-CARS) Spectroscopy (Postprint)

    National Research Council Canada - National Science Library

    Roy, Sukesh; Kinnius, Paul J; Lucht, Robert P; Gord, James R

    2007-01-01

    Time-resolved femtosecond coherent anti-Stokes Raman scattering (fs-CARS) spectroscopy of the nitrogen molecule is used for the measurement of temperature in atmospheric-pressure, near-adiabatic, hydrogen-air diffusion flames...

  12. Coherent Anti-Stokes Raman Scattering Spectroscopy of Single Molecules in Solution

    Energy Technology Data Exchange (ETDEWEB)

    Sunney Xie, Wei Min, Chris Freudiger, Sijia Lu

    2012-01-18

    During this funding period, we have developed two breakthrough techniques. The first is stimulated Raman scattering microscopy, providing label-free chemical contrast for chemical and biomedical imaging based on vibrational spectroscopy. Spontaneous Raman microscopy provides specific vibrational signatures of chemical bonds, but is often hindered by low sensitivity. We developed a three-dimensional multiphoton vibrational imaging technique based on stimulated Raman scattering (SRS). The sensitivity of SRS imaging is significantly greater than that of spontaneous Raman microscopy, which is achieved by implementing high-frequency (megahertz) phase-sensitive detection. SRS microscopy has a major advantage over previous coherent Raman techniques in that it offers background-free and readily interpretable chemical contrast. We demonstrated a variety of biomedical applications, such as differentiating distributions of omega-3 fatty acids and saturated lipids in living cells, imaging of brain and skin tissues based on intrinsic lipid contrast, and monitoring drug delivery through the epidermis. This technology offers exciting prospect for medical imaging. The second technology we developed is stimulated emission microscopy. Many chromophores, such as haemoglobin and cytochromes, absorb but have undetectable fluorescence because the spontaneous emission is dominated by their fast non-radiative decay. Yet the detection of their absorption is difficult under a microscope. We use stimulated emission, which competes effectively with the nonradiative decay, to make the chromophores detectable, as a new contrast mechanism for optical microscopy. We demonstrate a variety of applications of stimulated emission microscopy, such as visualizing chromoproteins, non-fluorescent variants of the green fluorescent protein, monitoring lacZ gene expression with a chromogenic reporter, mapping transdermal drug distribu- tions without histological sectioning, and label-free microvascular

  13. Feasibility study for a first observation of coherent neutrino nucleus scattering using low-temperature detectors

    Energy Technology Data Exchange (ETDEWEB)

    Guetlein, Achim

    2013-04-17

    Coherent Neutrino Nucleus Scattering (CNNS) is a neutral current process of the weak interaction. For low transferred momenta the neutrino scatters coherently off all nucleons leading to an enhanced cross section. However, because of the small resulting recoil energies (O(keV)) CNNS has not been observed experimentally so far. For the first observation of CNNS a strong neutrino source is needed. Thus, the expected count rates for solar neutrinos, supernova neutrinos, neutrinos generated by the decay of stopped π{sup +} particles at accelerators, and reactor neutrinos were calculated. Although an observation of CNNS could also be possible with other sources, the most promising neutrino sources are nuclear reactors with thermal powers between 2 and 4 GW. For an assumed energy threshold of 0.5 keV the target material with the largest count rate (∝10 kg{sup -1}day{sup -1}) is sapphire. Thus, a low-temperature detector based on a 32 g sapphire crystal was designed and built to measure the background spectrum for energies below ∝10 keV. Although the energy threshold (∝1 keV) of this detector is too large for an observation of CNNS, the measured background spectrum can still be used for an investigation of the main background sources and the suppression of their events. For this investigation the simulated spectra of cosmic muons, ambient neutrons, and external gamma-rays are compared to the measured background spectrum. As a result, cosmic muons are the main contribution to the measured background spectrum. For a future experiment aiming at the observation of CNNS an array of 125 low-temperature detectors based on 32 g sapphire crystals is assumed. Background simulations of cosmic muons, ambient neutrons, and intrinsic radioactivity show that especially an efficient muon-veto system is crucial for a sufficient background suppression. To study the observation potential of this future experiment a distance of ∝ 40 m to a reactor core with a thermal power of ∝4

  14. New imaging-based biomarkers for melanoma diagnosis using coherent Raman Scattering microscopy (Conference Presentation)

    Science.gov (United States)

    Wang, Hequn; Osseiran, Sam; Roider, Elisabeth; Fisher, David E.; Evans, Conor L.

    2016-02-01

    Recently, pheomelanin has been found to play a critical role in melanoma progression given its pro-oxidant chemical properties as well as its marked presence in pre-cancerous and malignant melanoma lesions, even in the absence of ultraviolet radiation. In addition, epidemiological evidence indicates a strong correlation between melanoma incidence and skin type, with the highest incidence occurring in individuals of the red-haired/fair-skinned phenotype. Interestingly, nevus count correlates well with melanoma incidence and skin type, except in the population most prone to developing melanoma, where nevus count strikingly drops. As such, a current hypothesis proposes that fair-skinned red-haired individuals, who are unable to stimulate production of eumelanin due to a mutation in MC1R in melanocytes, may actually harbor numerous "invisible", pheomelanin-rich nevi that evade clinical detection, supporting the high incidence of melanoma in that population. Here, we show for the very first time that melanocytes extracted from genetically modified MC1R-mutant, red-haired mice displayed bright perinuclear distributions of signal within the cells under coherent anti-Stokes Raman scattering (CARS) microscopy. Changes in pheomelanin production in siRNA knockdowns of cultured human melanoma cells were also sensed. We then successfully imaged pheomelanin distributions in both ex vivo and in vivo mouse ear skin. Finally, melanosomes within amelanotic melanoma patient tissue sections were found to show bright pheomelanin signals. This is the first time, to our knowledge, that pheomelanin has been found spatially localized in a human amelanotic melanoma sample. These pheomelanotic CARS features may be used as potential biomarkers for melanoma detection, especially for amelanotic melanomas.

  15. Evans blue dye-enhanced imaging of the brain microvessels using spectral focusing coherent anti-Stokes Raman scattering microscopy.

    Directory of Open Access Journals (Sweden)

    Bo-Ram Lee

    Full Text Available We performed dye-enhanced imaging of mouse brain microvessels using spectral focusing coherent anti-Stokes Raman scattering (SF-CARS microscopy. The resonant signals from C-H stretching in forward CARS usually show high background intensity in tissues, which makes CARS imaging of microvessels difficult. In this study, epi-detection of back-scattered SF-CARS signals showed a negligible background, but the overall intensity of resonant CARS signals was too low to observe the network of brain microvessels. Therefore, Evans blue (EB dye was used as contrasting agent to enhance the back-scattered SF-CARS signals. Breakdown of brain microvessels by inducing hemorrhage in a mouse was clearly visualized using backward SF-CARS signals, following intravenous injection of EB. The improved visualization of brain microvessels with EB enhanced the sensitivity of SF-CARS, detecting not only the blood vessels themselves but their integrity as well in the brain vasculature.

  16. Extraction of optical scattering parameters and attenuation compensation in optical coherence tomography images of multi-layered tissue structures

    DEFF Research Database (Denmark)

    Thrane, Lars; Frosz, Michael Henoch; Tycho, Andreas

    2004-01-01

    A recently developed analytical optical coherence tomography (OCT) model [Thrane et al., J. Opt. Soc. Am. A 17, 484 (2000)] allows the extraction of optical scattering parameters from OCT images, thereby permitting attenuation compensation in those images. By expanding this theoretical model, we...... have developed a new method for extracting optical scattering parameters from multilayered tissue structures in vivo. To verify this, we used a Monte Carlo (MC) OCT model as a numerical phantom to simulate the OCT signal for het-erogeneous multilayered tissue. Excellent agreement between the extracted...... values of the optical scattering properties of the different layers and the corresponding input reference values of the MC simulation was obtained, which demonstrates the feasibility of the method for in vivo applications. This is to our knowledge the first time such verification has been obtained...

  17. Supersonic exciton gratings: coherent inter-polariton scattering in semiconductor microcavities

    DEFF Research Database (Denmark)

    Birkedal, Dan; Vadim, Lyssenko; Hvam, Jørn Märcher

    2002-01-01

    We report on a coherent nonlinear phenomenon in a semiconductor microcavity (SMC), which has no parallel for QW excitons. When two different polariton modes of the SMC are impulsively excited they undergo normal mode oscillations (NMOs) with coherent energy exchange between the exciton and the ca...

  18. Coherent scattering of an atom in the field of a standing wave under conditions of initial quantum correlation of subsystems

    Energy Technology Data Exchange (ETDEWEB)

    Trubilko, A. I., E-mail: trubilko.andrey@gmail.com [St. Petersburg University of State Fire Service of the Russian Ministry of Emergency Situations (Russian Federation)

    2016-10-15

    Coherent scattering of a two-level atom in the field of a quantized standing wave of a micromaser is considered under conditions of initial quantum correlation between the atom and the field. Such a correlation can be produced by a broadband parametric source. The interaction leading to scattering of the atom from the nonuniform field occurs in the dispersion limit or in the wing of the absorption line of the atom. Apart from the quantized field, the atom simultaneously interacts with two classical counterpropagating waves with different frequencies, which are acting in the plane perpendicular to the atom’s propagation velocity and to the wavevector of the standing wave. Joint action of the quantized field and two classical waves induces effective two-photon and Raman resonance interaction on the working transition. The effective Hamiltonian of the interaction is derived using the unitary transformation method developed for a moving atom. A strong effect is detected, which makes it possible to distinguish the correlated initial state of the atom and the field in the scattering of atom from the state of independent systems. For all three waves, scattering is not observed when systems with quantum correlation are prepared using a high-intensity parametric source. Conversely, when the atom interacts only with the nonuniform field of the standing wave, scattering is not observed in the case of the initial factorized state.

  19. Velocity gradients in spatially resolved laser Doppler flowmetry and dynamic light scattering with confocal and coherence gating

    Science.gov (United States)

    Uribe-Patarroyo, Néstor; Bouma, Brett E.

    2016-08-01

    Dynamic light scattering (DLS) is widely used to characterize diffusive motion to obtain precise information on colloidal suspensions by calculating the autocorrelation function of the signal from a heterodyne optical system. DLS can also be used to determine the flow velocity field in systems that exhibit mass transport by incorporating the effects of the deterministic motion of scatterers on the autocorrelation function, a technique commonly known as laser Doppler flowmetry. DLS measurements can be localized with confocal and coherence gating techniques such as confocal microscopy and optical coherence tomography, thereby enabling the determination of the spatially resolved velocity field in three dimensions. It has been thought that spatially resolved DLS can determine the axial velocity as well as the lateral speed in a single measurement. We demonstrate, however, that gradients in the axial velocity of scatterers exert a fundamental influence on the autocorrelation function even in well-behaved, nonturbulent flow. By obtaining the explicit functional relation between axial-velocity gradients and the autocorrelation function, we show that the velocity field and its derivatives are intimately related and their contributions cannot be separated. Therefore, a single DLS measurement cannot univocally determine the velocity field. Our extended theoretical model was found to be in good agreement with experimental measurements.

  20. PMSE Observations With the Tri-Static EISCAT VHF Radars

    Science.gov (United States)

    Mann, I.; Tjulin, A.; Häggström, I.

    2013-12-01

    The polar mesospheric summer echoes (PMSE) are generated in the ionosphere at roughly 80 to 90 altitude by electron irregularities in the presence of charged solid particles and PMSE are most likely observed when ice particles form onto nanodust. PMSE formation is an important part in understanding mesospheric processes, but is also an interesting example for dusty plasma phenomena occurring in space. To investigate the phenomena that lead to formation of PMSE it is helpful to study the radar reflectivity of the mesosphere at different angles. PMSE were previously studied at different aspect angles in order to better understand the scattering process. Another way is observing PMSE from multiple sites simultaneously. During this summer the EISCAT radars that are located in Northern Scandinavia could for the first time be used for tri-static observations in the VHF band and we carried out observations during three subsequent days in June 2013. The radar signal was transmitted in zenith direction with the EISCAT VHF antenna near Tromsø (69.59 deg N, 19.23 deg E) and the scattered signal was measured from Tromsø, Kiruna (67.86 deg N, 20.44 deg E) and Sodankylä (67.36 deg N, 26.63 deg E). Zenith observations were simultaneously carried out with the Tromsø UHF radar (933 MHz). Other groups have previously reported the observations of PMSE simultaneously with the EISCAT VHF and UHF radars, but with a much lower occurrence rate for the UHF. UHF observations made during this campaign are dominated by incoherent scatter. The VHF system in Tromsø detected PMSE for a large fraction of the observation time. The VHF receivers in Kiruna and Sodankylä were pointed at typical PMSE heights above the Tromsø transmitter and detected radar reflections at the same time and altitude as the Tromsø radar. These observations are among the first tri-static observations of PMSE. Preliminary results from the campaign will be presented and discussed.

  1. A unified view of coherent and incoherent dihydrogen exchange in transition metal hydrides by nuclear resonance and inelastic neutron scattering

    Energy Technology Data Exchange (ETDEWEB)

    Limbach, H.H.; Ulrich, S.; Buntkowsky, G. [Freie Univ. Berlin (Germany). Inst. fuer Organische Chemie; Sabo-Etienne, S.; Chaudret, B. [Toulouse-3 Univ., 31 (France). Lab. de Chimie de Coordination du C.N.R.S.; Kubas, G.J.; Eckert, J. [Los Alamos National Lab., NM (United States)

    1995-08-12

    In this paper a unified view of coherent and incoherent dihydrogen exchange in transition metal hydrides by nuclear magnetic resonance (NMR) and inelastic neutron scattering (INS) is presented. It is shown that both exchange processes coexist i.e. do not transform into each other although they may dominate the spectra in different temperature ranges. This superposition is the consequence of the incorporation of the tunnel frequency J of the coherent process into the nuclear two-spin hamiltonian of hydrogen pairs which allows to treat the problem using the well known density matrix theory of NMR line-shapes developed by Alexander and Binsch. It is shown that this theory can also be used to predict the line-shapes of the rotational tunneling transitions observed in the INS spectra of transition metal dihydrogen complexes and that both NMR and INS spectra depend on similar parameters.

  2. Measurement of coherent elastic and inelastic deuteron-proton scattering at s = 2800 GeV$^{2}$

    CERN Document Server

    Armitage, J C; Bobbink, Gerjan J; Erné, F C; Kooijman, P M; Loebinger, F K; MacBeth, A A; Montgomery, H E; Murphy, P G; Poorthuis, J J M; Rudge, A; Sens, Johannes C; Stork, D H; Timmer, J

    1978-01-01

    Data on coherent elastic and inelastic deuteron-proton scattering are presented. The measurements were made at the CERN ISR with a single arm spectrometer, at s=2800 GeV/sup 2/ and momentum transfer squared (-t) in the range 0.15 to 0.42 GeV/sup 2/. The data are compared with elastic and inelastic proton-proton scattering data taken with the same apparatus at the same s and t values. The t dependence of the elastic dp to dp differential cross section is compared with simple predictions based on Glauber theory. The differential cross sections for pp to pX and dp to dX are also compared for M/sub X//sup 2/ to 280 GeV/sup 2/, where M/sub X/ denotes the mass of system X recoiling against the measured proton and deuteron. (25 refs).

  3. Coherent detection of spontaneous Brillouin scattering for distributed temperature sensing using a Brillouin laser

    Science.gov (United States)

    Lecoeuche, V.; Webb, David J.; Pannell, Christopher N.; Jackson, David A.

    1998-08-01

    Distributed temperature sensors based on Brillouin scattering are attractive because they offer very large sensing length. The intensity of spontaneous Brillouin scattering is directly proportional to the temperature of the fiber, and permits a measurement independent of the strain applied to it. We report on a novel system to detect this signal, incorporating a mode-locked Brillouin fiber ring laser.

  4. Measurement of coherent $\\pi^{+}$ production in low energy neutrino-Carbon scattering

    CERN Document Server

    Abe, K.

    2016-11-04

    We report the first measurement of the flux-averaged cross section for charged current coherent $\\pi^{+}$ production on carbon for neutrino energies less than 1.5 GeV to a restricted final state phase space region in the T2K near detector, ND280. Comparisons are made with predictions from the Rein-Sehgal coherent production model and the model by Alvarez-Ruso {\\it et al.}, the latter representing the first implementation of an instance of the new class of microscopic coherent models in a neutrino interaction Monte Carlo event generator. This results contradicts the null results reported by K2K and SciBooNE in a similar neutrino energy region.

  5. Measurement of Coherent π^{+} Production in Low Energy Neutrino-Carbon Scattering.

    Science.gov (United States)

    Abe, K; Andreopoulos, C; Antonova, M; Aoki, S; Ariga, A; Assylbekov, S; Autiero, D; Ban, S; Barbi, M; Barker, G J; Barr, G; Bartet-Friburg, P; Batkiewicz, M; Bay, F; Berardi, V; Berkman, S; Bhadra, S; Blondel, A; Bolognesi, S; Bordoni, S; Boyd, S B; Brailsford, D; Bravar, A; Bronner, C; Buizza Avanzini, M; Calland, R G; Campbell, T; Cao, S; Caravaca Rodríguez, J; Cartwright, S L; Castillo, R; Catanesi, M G; Cervera, A; Cherdack, D; Chikuma, N; Christodoulou, G; Clifton, A; Coleman, J; Collazuol, G; Coplowe, D; Cremonesi, L; Dabrowska, A; De Rosa, G; Dealtry, T; Denner, P F; Dennis, S R; Densham, C; Dewhurst, D; Di Lodovico, F; Di Luise, S; Dolan, S; Drapier, O; Duffy, K E; Dumarchez, J; Dytman, S; Dziewiecki, M; Emery-Schrenk, S; Ereditato, A; Feusels, T; Finch, A J; Fiorentini, G A; Friend, M; Fujii, Y; Fukuda, D; Fukuda, Y; Furmanski, A P; Galymov, V; Garcia, A; Giffin, S G; Giganti, C; Gizzarelli, F; Gonin, M; Grant, N; Hadley, D R; Haegel, L; Haigh, M D; Hamilton, P; Hansen, D; Harada, J; Hara, T; Hartz, M; Hasegawa, T; Hastings, N C; Hayashino, T; Hayato, Y; Helmer, R L; Hierholzer, M; Hillairet, A; Himmel, A; Hiraki, T; Hirota, S; Hogan, M; Holeczek, J; Horikawa, S; Hosomi, F; Huang, K; Ichikawa, A K; Ieki, K; Ikeda, M; Imber, J; Insler, J; Intonti, R A; Irvine, T J; Ishida, T; Ishii, T; Iwai, E; Iwamoto, K; Izmaylov, A; Jacob, A; Jamieson, B; Jiang, M; Johnson, S; Jo, J H; Jonsson, P; Jung, C K; Kabirnezhad, M; Kaboth, A C; Kajita, T; Kakuno, H; Kameda, J; Karlen, D; Karpikov, I; Katori, T; Kearns, E; Khabibullin, M; Khotjantsev, A; Kielczewska, D; Kikawa, T; Kim, H; Kim, J; King, S; Kisiel, J; Knight, A; Knox, A; Kobayashi, T; Koch, L; Koga, T; Konaka, A; Kondo, K; Kopylov, A; Kormos, L L; Korzenev, A; Koshio, Y; Kropp, W; Kudenko, Y; Kurjata, R; Kutter, T; Lagoda, J; Lamont, I; Larkin, E; Lasorak, P; Laveder, M; Lawe, M; Lazos, M; Lindner, T; Liptak, Z J; Litchfield, R P; Li, X; Longhin, A; Lopez, J P; Ludovici, L; Lu, X; Magaletti, L; Mahn, K; Malek, M; Manly, S; Marino, A D; Marteau, J; Martin, J F; Martins, P; Martynenko, S; Maruyama, T; Matveev, V; Mavrokoridis, K; Ma, W Y; Mazzucato, E; McCarthy, M; McCauley, N; McFarland, K S; McGrew, C; Mefodiev, A; Metelko, C; Mezzetto, M; Mijakowski, P; Minamino, A; Mineev, O; Mine, S; Missert, A; Miura, M; Moriyama, S; Mueller, Th A; Murphy, S; Myslik, J; Nakadaira, T; Nakahata, M; Nakamura, K G; Nakamura, K; Nakamura, K D; Nakayama, S; Nakaya, T; Nakayoshi, K; Nantais, C; Nielsen, C; Nirkko, M; Nishikawa, K; Nishimura, Y; Novella, P; Nowak, J; O'Keeffe, H M; Ohta, R; Okumura, K; Okusawa, T; Oryszczak, W; Oser, S M; Ovsyannikova, T; Owen, R A; Oyama, Y; Palladino, V; Palomino, J L; Paolone, V; Patel, N D; Pavin, M; Payne, D; Perkin, J D; Petrov, Y; Pickard, L; Pickering, L; Pinzon Guerra, E S; Pistillo, C; Popov, B; Posiadala-Zezula, M; Poutissou, J-M; Poutissou, R; Przewlocki, P; Quilain, B; Radermacher, T; Radicioni, E; Ratoff, P N; Ravonel, M; Rayner, M A M; Redij, A; Reinherz-Aronis, E; Riccio, C; Rojas, P; Rondio, E; Roth, S; Rubbia, A; Rychter, A; Sacco, R; Sakashita, K; Sánchez, F; Sato, F; Scantamburlo, E; Scholberg, K; Schoppmann, S; Schwehr, J; Scott, M; Seiya, Y; Sekiguchi, T; Sekiya, H; Sgalaberna, D; Shah, R; Shaikhiev, A; Shaker, F; Shaw, D; Shiozawa, M; Shirahige, T; Short, S; Smy, M; Sobczyk, J T; Sobel, H; Sorel, M; Southwell, L; Stamoulis, P; Steinmann, J; Stewart, T; Stowell, P; Suda, Y; Suvorov, S; Suzuki, A; Suzuki, K; Suzuki, S Y; Suzuki, Y; Tacik, R; Tada, M; Takahashi, S; Takeda, A; Takeuchi, Y; Tanaka, H K; Tanaka, H A; Terhorst, D; Terri, R; Thakore, T; Thompson, L F; Tobayama, S; Toki, W; Tomura, T; Touramanis, C; Tsukamoto, T; Tzanov, M; Uchida, Y; Vacheret, A; Vagins, M; Vallari, Z; Vasseur, G; Wachala, T; Wakamatsu, K; Walter, C W; Wark, D; Warzycha, W; Wascko, M O; Weber, A; Wendell, R; Wilkes, R J; Wilking, M J; Wilkinson, C; Wilson, J R; Wilson, R J; Yamada, Y; Yamamoto, K; Yamamoto, M; Yanagisawa, C; Yano, T; Yen, S; Yershov, N; Yokoyama, M; Yoo, J; Yoshida, K; Yuan, T; Yu, M; Zalewska, A; Zalipska, J; Zambelli, L; Zaremba, K; Ziembicki, M; Zimmerman, E D; Zito, M; Żmuda, J

    2016-11-04

    We report the first measurement of the flux-averaged cross section for charged current coherent π^{+} production on carbon for neutrino energies less than 1.5 GeV, and with a restriction on the final state phase space volume in the T2K near detector, ND280. Comparisons are made with predictions from the Rein-Sehgal coherent production model and the model by Alvarez-Ruso et al., the latter representing the first implementation of an instance of the new class of microscopic coherent models in a neutrino interaction Monte Carlo event generator. We observe a clear event excess above background, disagreeing with the null results reported by K2K and SciBooNE in a similar neutrino energy region. The measured flux-averaged cross sections are below those predicted by both the Rein-Sehgal and Alvarez-Ruso et al.

  6. Measurement of Coherent π+ Production in Low Energy Neutrino-Carbon Scattering

    Science.gov (United States)

    Abe, K.; Andreopoulos, C.; Antonova, M.; Aoki, S.; Ariga, A.; Assylbekov, S.; Autiero, D.; Ban, S.; Barbi, M.; Barker, G. J.; Barr, G.; Bartet-Friburg, P.; Batkiewicz, M.; Bay, F.; Berardi, V.; Berkman, S.; Bhadra, S.; Blondel, A.; Bolognesi, S.; Bordoni, S.; Boyd, S. B.; Brailsford, D.; Bravar, A.; Bronner, C.; Buizza Avanzini, M.; Calland, R. G.; Campbell, T.; Cao, S.; Caravaca Rodríguez, J.; Cartwright, S. L.; Castillo, R.; Catanesi, M. G.; Cervera, A.; Cherdack, D.; Chikuma, N.; Christodoulou, G.; Clifton, A.; Coleman, J.; Collazuol, G.; Coplowe, D.; Cremonesi, L.; Dabrowska, A.; De Rosa, G.; Dealtry, T.; Denner, P. F.; Dennis, S. R.; Densham, C.; Dewhurst, D.; Di Lodovico, F.; Di Luise, S.; Dolan, S.; Drapier, O.; Duffy, K. E.; Dumarchez, J.; Dytman, S.; Dziewiecki, M.; Emery-Schrenk, S.; Ereditato, A.; Feusels, T.; Finch, A. J.; Fiorentini, G. A.; Friend, M.; Fujii, Y.; Fukuda, D.; Fukuda, Y.; Furmanski, A. P.; Galymov, V.; Garcia, A.; Giffin, S. G.; Giganti, C.; Gizzarelli, F.; Gonin, M.; Grant, N.; Hadley, D. R.; Haegel, L.; Haigh, M. D.; Hamilton, P.; Hansen, D.; Harada, J.; Hara, T.; Hartz, M.; Hasegawa, T.; Hastings, N. C.; Hayashino, T.; Hayato, Y.; Helmer, R. L.; Hierholzer, M.; Hillairet, A.; Himmel, A.; Hiraki, T.; Hirota, S.; Hogan, M.; Holeczek, J.; Horikawa, S.; Hosomi, F.; Huang, K.; Ichikawa, A. K.; Ieki, K.; Ikeda, M.; Imber, J.; Insler, J.; Intonti, R. A.; Irvine, T. J.; Ishida, T.; Ishii, T.; Iwai, E.; Iwamoto, K.; Izmaylov, A.; Jacob, A.; Jamieson, B.; Jiang, M.; Johnson, S.; Jo, J. H.; Jonsson, P.; Jung, C. K.; Kabirnezhad, M.; Kaboth, A. C.; Kajita, T.; Kakuno, H.; Kameda, J.; Karlen, D.; Karpikov, I.; Katori, T.; Kearns, E.; Khabibullin, M.; Khotjantsev, A.; Kielczewska, D.; Kikawa, T.; Kim, H.; Kim, J.; King, S.; Kisiel, J.; Knight, A.; Knox, A.; Kobayashi, T.; Koch, L.; Koga, T.; Konaka, A.; Kondo, K.; Kopylov, A.; Kormos, L. L.; Korzenev, A.; Koshio, Y.; Kropp, W.; Kudenko, Y.; Kurjata, R.; Kutter, T.; Lagoda, J.; Lamont, I.; Larkin, E.; Lasorak, P.; Laveder, M.; Lawe, M.; Lazos, M.; Lindner, T.; Liptak, Z. J.; Litchfield, R. P.; Li, X.; Longhin, A.; Lopez, J. P.; Ludovici, L.; Lu, X.; Magaletti, L.; Mahn, K.; Malek, M.; Manly, S.; Marino, A. D.; Marteau, J.; Martin, J. F.; Martins, P.; Martynenko, S.; Maruyama, T.; Matveev, V.; Mavrokoridis, K.; Ma, W. Y.; Mazzucato, E.; McCarthy, M.; McCauley, N.; McFarland, K. S.; McGrew, C.; Mefodiev, A.; Metelko, C.; Mezzetto, M.; Mijakowski, P.; Minamino, A.; Mineev, O.; Mine, S.; Missert, A.; Miura, M.; Moriyama, S.; Mueller, Th. A.; Murphy, S.; Myslik, J.; Nakadaira, T.; Nakahata, M.; Nakamura, K. G.; Nakamura, K.; Nakamura, K. D.; Nakayama, S.; Nakaya, T.; Nakayoshi, K.; Nantais, C.; Nielsen, C.; Nirkko, M.; Nishikawa, K.; Nishimura, Y.; Novella, P.; Nowak, J.; O'Keeffe, H. M.; Ohta, R.; Okumura, K.; Okusawa, T.; Oryszczak, W.; Oser, S. M.; Ovsyannikova, T.; Owen, R. A.; Oyama, Y.; Palladino, V.; Palomino, J. L.; Paolone, V.; Patel, N. D.; Pavin, M.; Payne, D.; Perkin, J. D.; Petrov, Y.; Pickard, L.; Pickering, L.; Pinzon Guerra, E. S.; Pistillo, C.; Popov, B.; Posiadala-Zezula, M.; Poutissou, J.-M.; Poutissou, R.; Przewlocki, P.; Quilain, B.; Radermacher, T.; Radicioni, E.; Ratoff, P. N.; Ravonel, M.; Rayner, M. A. M.; Redij, A.; Reinherz-Aronis, E.; Riccio, C.; Rojas, P.; Rondio, E.; Roth, S.; Rubbia, A.; Rychter, A.; Sacco, R.; Sakashita, K.; Sánchez, F.; Sato, F.; Scantamburlo, E.; Scholberg, K.; Schoppmann, S.; Schwehr, J.; Scott, M.; Seiya, Y.; Sekiguchi, T.; Sekiya, H.; Sgalaberna, D.; Shah, R.; Shaikhiev, A.; Shaker, F.; Shaw, D.; Shiozawa, M.; Shirahige, T.; Short, S.; Smy, M.; Sobczyk, J. T.; Sobel, H.; Sorel, M.; Southwell, L.; Stamoulis, P.; Steinmann, J.; Stewart, T.; Stowell, P.; Suda, Y.; Suvorov, S.; Suzuki, A.; Suzuki, K.; Suzuki, S. Y.; Suzuki, Y.; Tacik, R.; Tada, M.; Takahashi, S.; Takeda, A.; Takeuchi, Y.; Tanaka, H. K.; Tanaka, H. A.; Terhorst, D.; Terri, R.; Thakore, T.; Thompson, L. F.; Tobayama, S.; Toki, W.; Tomura, T.; Touramanis, C.; Tsukamoto, T.; Tzanov, M.; Uchida, Y.; Vacheret, A.; Vagins, M.; Vallari, Z.; Vasseur, G.; Wachala, T.; Wakamatsu, K.; Walter, C. W.; Wark, D.; Warzycha, W.; Wascko, M. O.; Weber, A.; Wendell, R.; Wilkes, R. J.; Wilking, M. J.; Wilkinson, C.; Wilson, J. R.; Wilson, R. J.; Yamada, Y.; Yamamoto, K.; Yamamoto, M.; Yanagisawa, C.; Yano, T.; Yen, S.; Yershov, N.; Yokoyama, M.; Yoo, J.; Yoshida, K.; Yuan, T.; Yu, M.; Zalewska, A.; Zalipska, J.; Zambelli, L.; Zaremba, K.; Ziembicki, M.; Zimmerman, E. D.; Zito, M.; Żmuda, J.; T2K Collaboration

    2016-11-01

    We report the first measurement of the flux-averaged cross section for charged current coherent π+ production on carbon for neutrino energies less than 1.5 GeV, and with a restriction on the final state phase space volume in the T2K near detector, ND280. Comparisons are made with predictions from the Rein-Sehgal coherent production model and the model by Alvarez-Ruso et al., the latter representing the first implementation of an instance of the new class of microscopic coherent models in a neutrino interaction Monte Carlo event generator. We observe a clear event excess above background, disagreeing with the null results reported by K2K and SciBooNE in a similar neutrino energy region. The measured flux-averaged cross sections are below those predicted by both the Rein-Sehgal and Alvarez-Ruso et al. models.

  7. Accurate viscosity measurements of flowing aqueous glucose solutions with suspended scatterers using a dynamic light scattering approach with optical coherence tomography

    Science.gov (United States)

    Weatherbee, Andrew; Popov, Ivan; Vitkin, Alex

    2017-08-01

    The viscosity of turbid colloidal glucose solutions has been accurately determined from spectral domain optical coherence tomography (OCT) M-mode measurements and our recently developed OCT dynamic light scattering model. Results for various glucose concentrations, flow speeds, and flow angles are reported. The relative "combined standard uncertainty" uc(η) on the viscosity measurements was ±1% for the no-flow case and ±5% for the flow cases, a significant improvement in measurement robustness over previously published reports. The available literature data for the viscosity of pure water and our measurements differ by 1% (stagnant case) and 1.5% (flow cases), demonstrating good accuracy; similar agreement is seen across the measured glucose concentration range when compared to interpolated literature values. The developed technique may contribute toward eventual noninvasive glucose measurements in medicine.

  8. Separation of coherent and incoherent scattering in liquid para-H{sub 2} by polarisation analysis

    Energy Technology Data Exchange (ETDEWEB)

    Garcia-Hernandez, M.; Mompean, F.J. [Madrid Univ. (Spain); Schaerpf, O.; Andersen, K.H. [Institut Max von Laue - Paul Langevin (ILL), 38 - Grenoble (France); Fak, B. [CEA Centre d`Etudes de Grenoble, 38 (France)

    1997-04-01

    In the 1960 IAEA Symposium on Neutron Scattering, Sarma presented his theoretical study on the scattering of cold neutrons by liquid hydrogen and demonstrated how the intimate coupling between nuclear and rotational degrees of freedom finally results in the possibility of observing collective modes from this material, which to many neutron scatterers is synonymous with `incoherent`. This problem is investigated with polarised neutrons to gain access to a limited region of the (Q,E) space where the collective response from this liquid is found. (author).

  9. The coherent scattering function of the reptation model: simulations compared to theory

    NARCIS (Netherlands)

    A. Baumgärtner; U. Ebert (Ute); L. Schäfer

    2003-01-01

    textabstractWe present results of Monte Carlo simulations measuring the coherent structure function of a chain moving through an ordered lattice of fixed topological obstacles. Our computer experiments use chains up to 320 beads and cover a large range of wave vectors and a time range exceeding the

  10. In situ dissolution analysis using coherent anti-Stokes Raman scattering (CARS) and hyperspectral CARS microscopy

    NARCIS (Netherlands)

    Fussell, A.L.; Garbacik, E.T.; Offerhaus, Herman L.; Kleinebudde, Peter; Strachan, Clare

    2013-01-01

    The solid-state form of an active pharmaceutical ingredient (API) in an oral dosage form plays an important role in determining the dissolution rate of the API. As the solid-state form can change during dissolution, there is a need to monitor the oral dosage form during dissolution testing. Coherent

  11. Differentiation of oral precancerous stages with optical coherence tomography based on the evaluation of optical scattering properties of oral mucosae

    Science.gov (United States)

    Tsai, M. T.; Lee, J. D.; Lee, Y. J.; Lee, C. K.; Jin, H. L.; Chang, F. Y.; Hu, K. Y.; Wu, C. P.; Chiang, C. P.; Yang, C. C.

    2013-04-01

    Optical coherence tomography (OCT) has been demonstrated to be a powerful tool for noninvasive, real-time oral cancer diagnosis. However, in previous reports, OCT has still been found to be difficult to use in the diagnosis of oral precancerous stages, including mild dysplasia and moderate dysplasia. In clinical applications, early diagnosis and treatment of oral cancer can greatly improve the survival rate. Therefore, in this study, we propose a new approach to differentiate the oral precancerous stages based on the evaluation of the optical scattering properties of the epithelial layer, which is where the dysplastic cells start to develop in the precancerous stages. Instead of using exponential decay fitting to evaluate the scattering properties of mucosal tissues based on the Beer-Lambert law, linear fitting of the OCT depth intensity is used to evaluate the scattering properties of normal and dysplastic cells. From the statistical results of the linear fitting, the slope, a, can be an effective indicator to discriminate healthy mucosa and moderate dysplasia when an a value equal to zero is the threshold value, and the intercept, b, can be used to differentiate healthy and dysplastic mucosae, as well as mild and moderate dysplasia, when b values of 0.15 and 0.18 are used as the threshold values, respectively. Furthermore, this approach is also applied to the determination of the safe margin between normal and abnormal mucosae, making it possible to provide real-time, in vivo inspection during oral maxillofacial surgery.

  12. Lipid-cell interactions in human monocytes investigated by doubly-resonant coherent anti-Stokes Raman scattering microscopy

    Science.gov (United States)

    Weeks, Tyler; Schie, Iwan; den Hartigh, Laura J.; Rutledge, John C.; Huser, Thomas

    2011-02-01

    We demonstrate that doubly-resonant coherent anti-Stokes Raman scattering can provide enhanced and highly specific contrast for molecules containing unique Raman-active small molecular groups. This combination provides contrast for molecules that can otherwise be difficult to discriminate by Raman spectroscopy. Here, human monocytes were incubated with either deuterated oleic acid or 17-octadecynoic acid (a fatty acid with an end terminal acetylene group). The carbon-deuterium stretching vibration of the deuterated fatty acid, as well as the unique alkyne stretching vibration of the alkyne-containing fatty acid, were used to provide contrast for these exogenous free fatty acids. The combination of these unique modes with the common aliphatic carbon-hydrogen stretching vibration inherent to all fatty acid allowed for doubly-resonant detection of these unique molecules and enabled us to detect the presence of these lipids in areas within a cell where each molecular resonance by itself did not generate sufficient signal.

  13. Lipid-cell interactions in human monocytes investigated by doubly-resonant coherent anti-Stokes Raman scattering microscopy.

    Science.gov (United States)

    Weeks, Tyler; Schie, Iwan; den Hartigh, Laura J; Rutledge, John C; Huser, Thomas

    2011-02-01

    We demonstrate that doubly-resonant coherent anti-Stokes Raman scattering can provide enhanced and highly specific contrast for molecules containing unique Raman-active small molecular groups. This combination provides contrast for molecules that can otherwise be difficult to discriminate by Raman spectroscopy. Here, human monocytes were incubated with either deuterated oleic acid or 17-octadecynoic acid (a fatty acid with an end terminal acetylene group). The carbon-deuterium stretching vibration of the deuterated fatty acid, as well as the unique alkyne stretching vibration of the alkyne-containing fatty acid, were used to provide contrast for these exogenous free fatty acids. The combination of these unique modes with the common aliphatic carbon-hydrogen stretching vibration inherent to all fatty acid allowed for doubly-resonant detection of these unique molecules and enabled us to detect the presence of these lipids in areas within a cell where each molecular resonance by itself did not generate sufficient signal.

  14. Combining deep learning and coherent anti-Stokes Raman scattering imaging for automated differential diagnosis of lung cancer

    Science.gov (United States)

    Weng, Sheng; Xu, Xiaoyun; Li, Jiasong; Wong, Stephen T. C.

    2017-10-01

    Lung cancer is the most prevalent type of cancer and the leading cause of cancer-related deaths worldwide. Coherent anti-Stokes Raman scattering (CARS) is capable of providing cellular-level images and resolving pathologically related features on human lung tissues. However, conventional means of analyzing CARS images requires extensive image processing, feature engineering, and human intervention. This study demonstrates the feasibility of applying a deep learning algorithm to automatically differentiate normal and cancerous lung tissue images acquired by CARS. We leverage the features learned by pretrained deep neural networks and retrain the model using CARS images as the input. We achieve 89.2% accuracy in classifying normal, small-cell carcinoma, adenocarcinoma, and squamous cell carcinoma lung images. This computational method is a step toward on-the-spot diagnosis of lung cancer and can be further strengthened by the efforts aimed at miniaturizing the CARS technique for fiber-based microendoscopic imaging.

  15. Combining THz laser excitation with resonant soft X-ray scattering at the Linac Coherent Light Source

    Energy Technology Data Exchange (ETDEWEB)

    Turner, Joshua J., E-mail: joshuat@slac.stanford.edu; Dakovski, Georgi L.; Hoffmann, Matthias C. [Linac Coherent Light Source, SLAC National Accelerator Laboratory, 2575 Sand Hill Road, Menlo Park, CA 94025 (United States); Hwang, Harold Y. [Department of Chemistry, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Zarem, Alex; Schlotter, William F.; Moeller, Stefan; Minitti, Michael P. [Linac Coherent Light Source, SLAC National Accelerator Laboratory, 2575 Sand Hill Road, Menlo Park, CA 94025 (United States); Staub, Urs [Swiss Light Source, Paul Scherrer Institut, 5232 Villigen (Switzerland); Johnson, Steven [ETH Zurich, Institute for Quantum Electronics, Wolfgang-Pauli-Strasse 16, 8093 Zurich (Switzerland); Mitra, Ankush; Swiggers, Michele; Noonan, Peter; Curiel, G. Ivan; Holmes, Michael [Linac Coherent Light Source, SLAC National Accelerator Laboratory, 2575 Sand Hill Road, Menlo Park, CA 94025 (United States)

    2015-04-11

    This paper describes new instrumentation developments at the LCLS for materials studies using THz laser excitation and resonant soft X-ray scattering. This paper describes the development of new instrumentation at the Linac Coherent Light Source for conducting THz excitation experiments in an ultra high vacuum environment probed by soft X-ray diffraction. This consists of a cantilevered, fully motorized mirror system which can provide 600 kV cm{sup −1} electric field strengths across the sample and an X-ray detector that can span the full Ewald sphere with in-vacuum motion. The scientific applications motivated by this development, the details of the instrument, and spectra demonstrating the field strengths achieved using this newly developed system are discussed.

  16. Fiber-based optical parametric oscillator for high resolution coherent anti-Stokes Raman scattering (CARS) microscopy.

    Science.gov (United States)

    Gottschall, Thomas; Meyer, Tobias; Baumgartl, Martin; Dietzek, Benjamin; Popp, Jürgen; Limpert, Jens; Tünnermann, Andreas

    2014-09-08

    Imaging based on coherent anti-Stokes Raman scattering (CARS) relies on the interaction of high peak-power, synchronized picosecond pulses with narrow bandwidths and a well-defined frequency difference. Recently a new type of fiber-based CARS laser source based on four-wave-mixing (FWM) has been developed. In order to enhance its spectral resolution and efficiency, a FWM based fiber optical parametric oscillator (FOPO) is proposed in this work. The source delivers 180 mW with 5.6 kW peak power for the CARS pump and 130 mW with 2.9 kW peak power for the Stokes signal. CARS resonances around 2850 and 2930 cm(-1) can be resolved with a resolution of 1 cm(-1) enabling high-contrast, spectrally resolved CARS imaging of biological tissue.

  17. Multiplex coherent anti-Stokes Raman scattering microspectroscopy of brain tissue with higher ranking data classification for biomedical imaging

    Science.gov (United States)

    Pohling, Christoph; Bocklitz, Thomas; Duarte, Alex S.; Emmanuello, Cinzia; Ishikawa, Mariana S.; Dietzeck, Benjamin; Buckup, Tiago; Uckermann, Ortrud; Schackert, Gabriele; Kirsch, Matthias; Schmitt, Michael; Popp, Jürgen; Motzkus, Marcus

    2017-06-01

    Multiplex coherent anti-Stokes Raman scattering (MCARS) microscopy was carried out to map a solid tumor in mouse brain tissue. The border between normal and tumor tissue was visualized using support vector machines (SVM) as a higher ranking type of data classification. Training data were collected separately in both tissue types, and the image contrast is based on class affiliation of the single spectra. Color coding in the image generated by SVM is then related to pathological information instead of single spectral intensities or spectral differences within the data set. The results show good agreement with the H&E stained reference and spontaneous Raman microscopy, proving the validity of the MCARS approach in combination with SVM.

  18. Three-dimensional coherent diffraction imaging of Mie-scattering spheres by laser single-orientation measurement

    Science.gov (United States)

    Zhang, Jian; Fan, Jia-Dong; Zhang, Jian-Hua; Sun, Zhi-Bin; Huang, Qing-Jie; Jiang, Huai-Dong

    2015-09-01

    Three-dimensional imaging with single orientation is a potential and novel technique. We successfully demonstrate that three-dimensional (3D) structure can be determined by a single orientation diffraction measurement for a phase object of double-layer Mie-scattering silica spheres on a Si3N4 membrane. Coherent diffraction pattern at high numerical aperture was acquired with an optical laser, and the oversampled pattern was projected from a planar detector onto the Ewald sphere. The double-layered spheres are reconstructed from the spherical diffraction pattern and a 2D curvature-corrected pattern, which improve convergence speed and stability of reconstruction. Project supported by the Major State Basic Research Development Program of China (Grant No. 2014CB910401) and the National Natural Science Foundation of China (Grant Nos. 31430031, 21390414, and U1332118).

  19. Nonlinear coherent Thomson scattering from relativistic electron sheets as a means to produce isolated ultrabright attosecond x-ray pulses

    Directory of Open Access Journals (Sweden)

    H.-C. Wu (武慧春

    2011-07-01

    Full Text Available A new way to generate intense attosecond x-ray pulses is discussed. It relies on coherent Thomson scattering (CTS from relativistic electron sheets. A double layer technique is used to generate planar solid-density sheets of monochromatic high-γ electrons with zero transverse momentum such that coherently backscattered light is frequency upshifted by factors up to 4γ^{2}. Here previous work [H.-C. Wu et al., Phys. Rev. Lett. 104, 234801 (2010PRLTAO0031-900710.1103/PhysRevLett.104.234801] is extended to the regime of high-intensity probe light with normalized amplitude a_{0}>1 leading to nonlinear CTS effects such as pulse contraction and steepening. The results are derived both by particle-in-cell (PIC simulation in a boosted frame and by analytic theory. PIC simulation shows that powerful x-ray pulses (1 keV, 10   gigawatt can be generated. They call for experimental verification. Required prerequisites such as manufacture of nanometer-thick target foils is ready and ultrahigh contrast laser pulses should be within reach in the near future.

  20. Supercontinuum generation for coherent anti- Stokes Raman scattering microscopy with photonic crystal fibers

    DEFF Research Database (Denmark)

    Pedersen, Pernille Klarskov; Isomäki, Antti; Hansen, Kim P.

    2011-01-01

    with power concentrated around the relevant wavelengths for lipid imaging (648 nm and 1027 nm). This new PCF is characterized by varying the fiber length, the average power, and the pulse width of the fs pump pulses. It was found that the selected PCF design gave a significantly improved spectral...... analysis, the nonlinear effects responsible for the spectral broadening are explained to be soliton fission processes, dispersive waves, and stimulated Raman scattering....

  1. Discrimination between Doppler-shifted and non-shifted light in coherence domain path length resolved measurements of multiply scattered light

    NARCIS (Netherlands)

    Varghese, Babu; Rajan, Vinayakrishnan; van Leeuwen, Ton; Steenbergen, Wiendelt

    2007-01-01

    We show a novel technique to distinguish between Doppler shifted and unshifted light in multiple scattering experiments on mixed static and dynamic media. With a phase modulated low coherence Mach- Zehnder interferometer, optical path lengths of shifted and unshifted light and path length dependent

  2. Path-length distribution and path-length-resolved Doppler measurements of multiply scattered photons by use of low-coherence interferometry

    NARCIS (Netherlands)

    Petoukhova, Anna; Steenbergen, Wiendelt; de Mul, F.F.M.

    2001-01-01

    We report first results of measurements by low-coherence Doppler interferometry of the path-length distribution of photons undergoing multiple scattering in a highly turbid medium. We use a Mach–Zehnder interferometer with multimode graded-index fibers and a superluminescent diode as the light

  3. Noncritical phase-matched lithium triborate optical parametric oscillator for high resolution coherent anti-stokes Raman scattering spectroscopy and microscopy

    NARCIS (Netherlands)

    Jurna, M.; Korterik, Jeroen P.; Offerhaus, Herman L.; Otto, Cornelis

    2006-01-01

    An efficient, widely tunable, narrow-bandwidth, green-pumped, noncritical phase-matched lithium triborate based optical parametric oscillator (OPO) is applied to coherent anti-Stokes Raman scattering (CARS) spectroscopy and microscopy. The tunable signal beam (740–930 nm) of the OPO is combined with

  4. First wind shear observation in PMSE with the tristatic EISCAT VHF radar

    Science.gov (United States)

    Mann, I.; Häggström, I.; Tjulin, A.; Rostami, S.; Anyairo, C. C.; Dalin, P.

    2016-11-01

    The Polar Summer Mesosphere has the lowest temperatures that occur in the entire Earth system. Water ice particles below the optically observable size range participate there in the formation of strong radar echoes (Polar Mesospheric Summer Echoes, PMSE). To study PMSE we carried out observations with the European Incoherent Scatter (EISCAT) VHF and EISCAT UHF radar simultaneously from a site near Tromsø (69.58°N, 19.2272°E) and observed VHF backscattering also with the EISCAT receivers in Kiruna (67.86°N, 20.44°E) and Sodankylä (67.36°N, 26.63°E). This is one of the first tristatic measurements with EISCAT VHF, and we therefore describe the observations and geometry in detail. We present observations made on 26 June 2013 from 7:00 to 13:00 h UT where we found similar PMSE patterns with all three VHF receivers and found signs of wind shear in PMSE. The observations suggest that the PMSE contains sublayers that move in different directions horizontally, and this points to Kelvin-Helmholtz instability possibly playing a role in PMSE formation. We find no signs of PMSE in the UHF data. The electron densities that we derive from observed incoherent scatter at UHF are at PMSE altitudes close to the noise level but possibly indicate reduced electron densities directly above the PMSE.

  5. Surface defects characterization in a quantum wire by coherent phonons scattering

    Energy Technology Data Exchange (ETDEWEB)

    Rabia, M. S. [Laboratoire de Mécanique des Structures et Energétique, Faculté du Génie de la Construction, Université. Mammeri de Tizi-Ouzou, BP 17 RP Hasnaoua II, Tizi-Ouzou 15000, Algérie m2msr@yahoo.fr (Algeria)

    2015-03-30

    The influence of surface defects on the scattering properties of elastic waves in a quasi-planar crystallographic waveguide is studied in the harmonic approximation using the matching method formalism. The structural model is based on three infinite atomic chains forming a perfect lattice surmounted by an atomic surface defect. Following the Landauer approach, we solve directly the Newton dynamical equation with scattering boundary conditions and taking into account the next nearest neighbour’s interaction. A detailed study of the defect-induced fluctuations in the transmission spectra is presented for different adatom masses. As in the electronic case, the presence of localized defect-induced states leads to Fano-like resonances. In the language of mechanical vibrations, these are called continuum resonances. Numerical results reveal the intimate relation between transmission spectra and localized defect states and provide a basis for the understanding of conductance spectroscopy experiments in disordered mesoscopic systems. The results could be useful for the design of phononic devices.

  6. Detection of early carious lesions using contrast enhancement with coherent light scattering (speckle imaging)

    Science.gov (United States)

    Deana, A. M.; Jesus, S. H. C.; Koshoji, N. H.; Bussadori, S. K.; Oliveira, M. T.

    2013-07-01

    Currently, dental caries still represent one of the chronic diseases with the highest prevalence and present in most countries. The interaction between light and teeth (absorption, scattering and fluorescence) is intrinsically connected to the constitution of the dental tissue. Decay induced mineral loss introduces a shift in the optical properties of the affected tissue; therefore, study of these properties may produce novel techniques aimed at the early diagnosis of carious lesions. Based on the optical properties of the enamel, we demonstrate the application of first-order spatial statistics in laser speckle imaging, allowing the detection of carious lesions in their early stages. A highlight of this noninvasive, non-destructive, real time and cost effective approach is that it allows a dentist to detect a lesion even in the absence of biofilm or moisture.

  7. Investigation of Surface Enhanced Coherent Raman Scattering on Nano-patterned Insect Wings

    Science.gov (United States)

    Ujj, Laszlo; Lawhead, Carlos

    2015-03-01

    Many insect wings (cicadas, butterflies, mosquitos) poses nano-patterned surface structure. Characterization of surface morphology and chemical composition of insect wings is important to understand the extreme mechanical properties and the biophysical functionalities of the wings. We have measured the image of the membrane of a cicada's wing with the help of Scanning Electron Microscopy (SEM). The results confirm the existing periodic structure of the wing measured previously. In order to identify the chemical composition of the wing, we have deposited silver nanoparticles on it and applied Coherent anti-Stokes Raman Spectroscopy to measure the vibrational spectra of the molecules comprising the wing for the first time. The measured spectra are consistent with the original assumption that the wing membrane is composed of protein, wax, and chitin. The results of these studies can be used to measure other nano-patterned surfaces and to make artificial materials in the future. Authors grateful for financial support from the Department of Physics of the College of Sciences Engineering and Health of UWF and the Pall Corporation for SEM imaging.

  8. Dicty_cDB: VHF476 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uences producing significant alignments: (bits) Value VHF476 (VHF476Q) /CSM/VH/VHF4-D/VHF476Q.Seq.d/ 198 2e-...46 own update 2003.10.17 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value...e 2008.10.29 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value (Q54AX5) R

  9. Coherent scatter-controlled phase-change grating structures in silicon using femtosecond laser pulses.

    Science.gov (United States)

    Fuentes-Edfuf, Yasser; Garcia-Lechuga, Mario; Puerto, Daniel; Florian, Camilo; Garcia-Leis, Adianez; Sanchez-Cortes, Santiago; Solis, Javier; Siegel, Jan

    2017-07-04

    Periodic structures of alternating amorphous-crystalline fringes have been fabricated in silicon using repetitive femtosecond laser exposure (800 nm wavelength and 120 fs duration). The method is based on the interference of the incident laser light with far- and near-field scattered light, leading to local melting at the interference maxima, as demonstrated by femtosecond microscopy. Exploiting this strategy, lines of highly regular amorphous fringes can be written. The fringes have been characterized in detail using optical microscopy combined modelling, which enables a determination of the three-dimensional shape of individual fringes. 2D micro-Raman spectroscopy reveals that the space between amorphous fringes remains crystalline. We demonstrate that the fringe period can be tuned over a range of 410 nm - 13 µm by changing the angle of incidence and inverting the beam scan direction. Fine control over the lateral dimensions, thickness, surface depression and optical contrast of the fringes is obtained via adjustment of pulse number, fluence and spot size. Large-area, highly homogeneous gratings composed of amorphous fringes with micrometer width and millimeter length can readily be fabricated. The here presented fabrication technique is expected to have applications in the fields of optics, nanoelectronics, and mechatronics and should be applicable to other materials.

  10. An inter-hemispheric, statistical study of nightside spectral width distributions from coherent HF scatter radars

    Directory of Open Access Journals (Sweden)

    E. E. Woodfield

    2002-12-01

    Full Text Available A statistical investigation of the Doppler spectral width parameter routinely observed by HF coherent radars has been conducted between the Northern and Southern Hemispheres for the nightside ionosphere. Data from the SuperDARN radars at Thykkvibær, Iceland and Syowa East, Antarctica have been employed for this purpose. Both radars frequently observe regions of high (>200 ms-1 spectral width polewards of low (<200 ms-1 spectral width. Three years of data from both radars have been analysed both for the spectral width and line of sight velocity. The pointing direction of these two radars is such that the flow reversal boundary may be estimated from the velocity data, and therefore, we have an estimate of the open/closed field line boundary location for comparison with the high spectral widths. Five key observations regarding the behaviour of the spectral width on the nightside have been made. These are (i the two radars observe similar characteristics on a statistical basis; (ii a latitudinal dependence related to magnetic local time is found in both hemispheres; (iii a seasonal dependence of the spectral width is observed by both radars, which shows a marked absence of latitudinal dependence during the summer months; (iv in general, the Syowa East spectral width tends to be larger than that from Iceland East, and (v the highest spectral widths seem to appear on both open and closed field lines. Points (i and (ii indicate that the cause of high spectral width is magnetospheric in origin. Point (iii suggests that either the propagation of the HF radio waves to regions of high spectral width or the generating mechanism(s for high spectral width is affected by solar illumination or other seasonal effects. Point (iv suggests that the radar beams from each of the radars are subject either to different instrumental or propagation effects, or different geophysical conditions due to their locations, although we suggest that this result is more likely to

  11. Label-free evaluation of hepatic microvesicular steatosis with multimodal coherent anti-Stokes Raman scattering microscopy.

    Directory of Open Access Journals (Sweden)

    Thuc T Le

    Full Text Available Hepatic microvesicular steatosis is a hallmark of drug-induced hepatotoxicity and early-stage fatty liver disease. Current histopathology techniques are inadequate for the clinical evaluation of hepatic microvesicular steatosis. In this paper, we explore the use of multimodal coherent anti-Stokes Raman scattering (CARS microscopy for the detection and characterization of hepatic microvesicular steatosis. We show that CARS microscopy is more sensitive than Oil Red O histology for the detection of microvesicular steatosis. Computer-assisted analysis of liver lipid level based on CARS signal intensity is consistent with triglyceride measurement using a standard biochemical assay. Most importantly, in a single measurement procedure on unprocessed and unstained liver tissues, multimodal CARS imaging provides a wealth of critical information including the detection of microvesicular steatosis and quantitation of liver lipid content, number and size of lipid droplets, and lipid unsaturation and packing order of lipid droplets. Such information can only be assessed by multiple different methods on processed and stained liver tissues or tissue extracts using current standard analytical techniques. Multimodal CARS microscopy also permits label-free identification of lipid-rich non-parenchymal cells. In addition, label-free and non-perturbative CARS imaging allow rapid screening of mitochondrial toxins-induced microvesicular steatosis in primary hepatocyte cultures. With its sensitivity and versatility, multimodal CARS microscopy should be a powerful tool for the clinical evaluation of hepatic microvesicular steatosis.

  12. Photodetection-induced relative timing jitter in synchronized time-lens source for coherent Raman scattering microscopy

    Directory of Open Access Journals (Sweden)

    Jiaqi Wang

    2017-09-01

    Full Text Available Synchronized time-lens source is a novel method to generate synchronized optical pulses to mode-locked lasers, and has found widespread applications in coherent Raman scattering microscopy. Relative timing jitter between the mode-locked laser and the synchronized time-lens source is a key parameter for evaluating the synchronization performance of such synchronized laser systems. However, the origins of the relative timing jitter in such systems are not fully determined, which in turn prevents the experimental efforts to optimize the synchronization performance. Here, we demonstrate, through theoretical modeling and numerical simulation, that the photodetection could be one physical origin of the relative timing jitter. Comparison with relative timing jitter due to the intrinsic timing jitter of the mode-locked laser is also demonstrated, revealing different qualitative and quantitative behaviors. Based on the nature of this photodetection-induced timing jitter, we further propose several strategies to reduce the relative timing jitter. Our theoretical results will provide guidelines for optimizing synchronization performance in experiments.

  13. Paranodal myelin retraction in relapsing experimental autoimmune encephalomyelitis visualized by coherent anti-Stokes Raman scattering microscopy

    Science.gov (United States)

    Fu, Yan; Frederick, Terra J.; Huff, Terry B.; Goings, Gwendolyn E.; Miller, Stephen D.; Cheng, Ji-Xin

    2011-10-01

    How demyelination is initiated is a standing question for pathology of multiple sclerosis. By label-free coherent anti-Stokes Raman scattering (CARS) imaging of myelin lipids, we investigate myelin integrity in the lumbar spinal cord tissue isolated from naïve SJL mice, and from mice at the onset, peak acute, and remission stages of relapsing experimental autoimmune encephalomyelitis (EAE). Progressive demyelinating disease is initially characterized by the retraction of paranodal myelin both at the onset of disease and at the borders of acute demyelinating lesions. Myelin retraction is confirmed by elongated distribution of neurofascin proteins visualized by immunofluorescence. The disruption of paranodal myelin subsequently exposes Kv1.2 channels at the juxtaparanodes and lead to the displacement of Kv1.2 channels to the paranodal and nodal domains. Paranodal myelin is partially restored during disease remission, indicating spontaneous myelin regeneration. These findings suggest that paranodal domain injury precedes formation of internodal demyelinating lesions in relapsing EAE. Our results also demonstrate that CARS microscopy is an effective readout of myelin disease burden.

  14. Effects of moderate pump and Stokes chirp on chirped-probe pulse femtosecond coherent anti-Stokes Raman scattering thermometry

    KAUST Repository

    Gu, Mingming

    2018-01-08

    The effects of moderate levels of chirp in the pump and Stokes pulses on chirped-probe-pulse femtosecond coherent anti-Stokes Raman scattering (CPP fs CARS) were investigated. The frequency chirp in the pump and Stokes pulses was introduced by placing SF11 glass disks with thicknesses of 10 mm or 20 mm in the optical path for these beams. The magnitude of the chirp in the probe beam was much greater and was induced by placing a 30-cm rod of SF10 glass in the beam path. The temperature measurements were performed in hydrogen/air non-premixed flames stabilized on a Hencken burner at equivalence ratios of 0.3, 0.5, 0.7, and 1.0. We performed measurements with no disks in pump and Stokes beam paths, and then with disks of 10 mm and 20 mm placed in both beam paths. The spectrum of the nonresonant background four-wave mixing signal narrowed considerably with increasing pump and Stokes chirp, while the resonant CARS signal was relatively unaffected. Consequently, the interference of the nonresonant background with the resonant CARS signal in the frequency-spread dephasing region of the spectrum was minimized. The increased rate of decay of the resonant CARS signal with increasing temperature was thus readily apparent. We have started to analyze the CPP fs CARS thermometry data and initial results indicate improved accuracy and precision are obtained due to moderate chirp in the pump and Stokes laser pulses.

  15. Hyperspectral coherent anti-Stokes Raman scattering microscopy for in situ analysis of solid-state crystal polymorphs

    Science.gov (United States)

    Garbacik, E. T.; Fussell, A. L.; Güres, S.; Korterik, J. P.; Otto, C.; Herek, J. L.; Offerhaus, H. L.

    2013-02-01

    Hyperspectral coherent anti-Stokes Raman scattering (CARS) microscopy is quickly becoming a prominent imaging modality because of its many advantages over the traditional paradigm of multispectral CARS. In particular, recording a significant portion of the vibrational spectrum at each spatial pixel allows image-wide spectral analysis at much higher rates than can be achieved with spontaneous Raman. We recently developed a hyperspectral CARS method, the driving principle behind which is the fast acquisition and display of a hyperspectral datacube as a set of intuitive images wherein each material in a sample appears with a unique trio of colors. Here we use this system to image and analyze two types of polymorphic samples: the pseudopolymorphic hydration of theophylline, and the packing polymorphs of the sugar alcohol mannitol. In addition to these solid-state form modifications we have observed spectral variations of crystalline mannitol and diprophylline as functions of their orientations relative to the optical fields. We use that information to visualize the distributions of these compounds in a pharmaceutical solid oral dosage form.

  16. First wind shear observation in PMSE with the tristatic EISCAT VHF radar

    OpenAIRE

    Mann, Ingrid; Häggström, I.; Tjulin, A; Rostami, S; Anyairo, CC; Dalin, P

    2016-01-01

    (c) American Geophysical Union, reprinted with permission. Article also available at source: https://doi.org/10.1002/2016JA023080 The Polar Summer Mesosphere has the lowest temperatures that occur in the entire Earth system. Water ice particles below the optically observable size range participate there in the formation of strong radar echoes (Polar Mesospheric Summer Echoes, PMSE). To study PMSE we carried out observations with the European Incoherent Scatter (EISCAT) VHF and EIS...

  17. SU-F-I-53: Coded Aperture Coherent Scatter Spectral Imaging of the Breast: A Monte Carlo Evaluation of Absorbed Dose

    Energy Technology Data Exchange (ETDEWEB)

    Morris, R [Durham, NC (United States); Lakshmanan, M; Fong, G; Kapadia, A [Carl E Ravin Advanced Imaging Laboratories, Durham, NC (United States); Greenberg, J [Duke University, Durham, NC (United States)

    2016-06-15

    Purpose: Coherent scatter based imaging has shown improved contrast and molecular specificity over conventional digital mammography however the biological risks have not been quantified due to a lack of accurate information on absorbed dose. This study intends to characterize the dose distribution and average glandular dose from coded aperture coherent scatter spectral imaging of the breast. The dose deposited in the breast from this new diagnostic imaging modality has not yet been quantitatively evaluated. Here, various digitized anthropomorphic phantoms are tested in a Monte Carlo simulation to evaluate the absorbed dose distribution and average glandular dose using clinically feasible scan protocols. Methods: Geant4 Monte Carlo radiation transport simulation software is used to replicate the coded aperture coherent scatter spectral imaging system. Energy sensitive, photon counting detectors are used to characterize the x-ray beam spectra for various imaging protocols. This input spectra is cross-validated with the results from XSPECT, a commercially available application that yields x-ray tube specific spectra for the operating parameters employed. XSPECT is also used to determine the appropriate number of photons emitted per mAs of tube current at a given kVp tube potential. With the implementation of the XCAT digital anthropomorphic breast phantom library, a variety of breast sizes with differing anatomical structure are evaluated. Simulations were performed with and without compression of the breast for dose comparison. Results: Through the Monte Carlo evaluation of a diverse population of breast types imaged under real-world scan conditions, a clinically relevant average glandular dose for this new imaging modality is extrapolated. Conclusion: With access to the physical coherent scatter imaging system used in the simulation, the results of this Monte Carlo study may be used to directly influence the future development of the modality to keep breast dose to

  18. 47 CFR 80.911 - VHF transmitter.

    Science.gov (United States)

    2010-10-01

    ... MARITIME SERVICES Compulsory Radiotelephone Installations for Small Passenger Boats § 80.911 VHF..., measured at the power input terminals to the transmitter, and the output power of the transmitter, terminated in a matching artificial load, must be measured at the end of 10 minutes of continuous operation...

  19. Including the effect of molecular interference in the coherent x-ray scattering modeling in MC-GPU and PENELOPE for the study of novel breast imaging modalities

    Science.gov (United States)

    Ghammraoui, B.; Peng, R.; Suarez, I.; Bettolo, C.; Badal, A.

    2014-03-01

    Purpose: To present upgraded versions of MC-GPU and PenEASY Imaging, two open-source Monte Carlo codes for the simulation of radiographic projections and CT. The codes have been extended with the aim of studying breast imaging modalities that rely on the accurate modeling of coherent x-ray scatter. Methods: The simulation codes were extended to account for the effect of molecular interference in coherent scattering using experimentally measured molecular interference functions. The validity of the new model was tested experimentally using the Energy Dispersive X-Ray Diffraction (EDXRD) technique with a polychromatic x-ray source and an energy-resolved Germanium detector at a fixed scattering angle. Experiments and simulations of a full field digital mammography system with and without a 1D focused antiscatter grid were conducted for additional validation. The modified MC-GPU code was also used to examine the possibility of characterizing breast cancer within a mathematical breast phantom using the EDXRD technique. Results: The measured EDXRD spectra were correctly reproduced by the simulation with the modified code while the previous code using the Independent Atomic Approximation led to large errors in the predicted diffraction spectra. There was good agreement between the simulated and measured rejection factor for the 1D focused antiscatter grid with both models. The simulation study in a whole breast showed that the x-ray scattering profiles of adipose, fibrosis, cancer and benign tissues are differentiable. Conclusion: MC-GPU and PENELOPE were successfully extended and validated for accurate modeling of coherent x-ray scatter. The EDXRD technique with pencil-cone geometry in a whole breast was investigated by a simulation study and it was concluded that this technique has potential to characterize breast cancer lesions.

  20. First Demonstration of a Scintillating Xenon Bubble Chamber for Detecting Dark Matter and Coherent Elastic Neutrino-Nucleus Scattering.

    Science.gov (United States)

    Baxter, D; Chen, C J; Crisler, M; Cwiok, T; Dahl, C E; Grimsted, A; Gupta, J; Jin, M; Puig, R; Temples, D; Zhang, J

    2017-06-09

    A 30-g xenon bubble chamber, operated at Northwestern University in June and November 2016, has for the first time observed simultaneous bubble nucleation and scintillation by nuclear recoils in a superheated liquid. This chamber is instrumented with a CCD camera for near-IR bubble imaging, a solar-blind photomultiplier tube to detect 175-nm xenon scintillation light, and a piezoelectric acoustic transducer to detect the ultrasonic emission from a growing bubble. The time of nucleation determined from the acoustic signal is used to correlate specific scintillation pulses with bubble-nucleating events. We report on data from this chamber for thermodynamic "Seitz" thresholds from 4.2 to 15.0 keV. The observed single- and multiple-bubble rates when exposed to a ^{252}Cf neutron source indicate that, for an 8.3-keV thermodynamic threshold, the minimum nuclear recoil energy required to nucleate a bubble is 19±6  keV (1σ uncertainty). This is consistent with the observed scintillation spectrum for bubble-nucleating events. We see no evidence for bubble nucleation by gamma rays at any of the thresholds studied, setting a 90% C.L. upper limit of 6.3×10^{-7} bubbles per gamma interaction at a 4.2-keV thermodynamic threshold. This indicates stronger gamma discrimination than in CF_{3}I bubble chambers, supporting the hypothesis that scintillation production suppresses bubble nucleation by electron recoils, while nuclear recoils nucleate bubbles as usual. These measurements establish the noble-liquid bubble chamber as a promising new technology for the detection of weakly interacting massive particle dark matter and coherent elastic neutrino-nucleus scattering.

  1. Differentiation of bacterial versus viral otitis media using a combined Raman scattering spectroscopy and low coherence interferometry probe (Conference Presentation)

    Science.gov (United States)

    Zhao, Youbo; Shelton, Ryan L.; Tu, Haohua; Nolan, Ryan M.; Monroy, Guillermo L.; Chaney, Eric J.; Boppart, Stephen A.

    2016-02-01

    Otitis media (OM) is a highly prevalent disease that can be caused by either a bacterial or viral infection. Because antibiotics are only effective against bacterial infections, blind use of antibiotics without definitive knowledge of the infectious agent, though commonly practiced, can lead to the problems of potential harmful side effects, wasteful misuse of medical resources, and the development of antimicrobial resistance. In this work, we investigate the feasibility of using a combined Raman scattering spectroscopy and low coherence interferometry (LCI) device to differentiate OM infections caused by viruses and bacteria and improve our diagnostic ability of OM. Raman spectroscopy, an established tool for molecular analysis of biological tissue, has been shown capable of identifying different bacterial species, although mostly based on fixed or dried sample cultures. LCI has been demonstrated recently as a promising tool for determining tympanic membrane (TM) thickness and the presence and thickness of middle-ear biofilm located behind the TM. We have developed a fiber-based ear insert that incorporates spatially-aligned Raman and LCI probes for point-of-care diagnosis of OM. As shown in human studies, the Raman probe provides molecular signatures of bacterial- and viral-infected OM and normal middle-ear cavities, and LCI helps to identify depth-resolved structural information as well as guide and monitor positioning of the Raman spectroscopy beam for relatively longer signal acquisition time. Differentiation of OM infections is determined by correlating in vivo Raman data collected from human subjects with the Raman features of different bacterial and viral species obtained from cultured samples.

  2. First Demonstration of a Scintillating Xenon Bubble Chamber for Detecting Dark Matter and Coherent Elastic Neutrino-Nucleus Scattering

    Science.gov (United States)

    Baxter, D.; Chen, C. J.; Crisler, M.; Cwiok, T.; Dahl, C. E.; Grimsted, A.; Gupta, J.; Jin, M.; Puig, R.; Temples, D.; Zhang, J.

    2017-06-01

    A 30-g xenon bubble chamber, operated at Northwestern University in June and November 2016, has for the first time observed simultaneous bubble nucleation and scintillation by nuclear recoils in a superheated liquid. This chamber is instrumented with a CCD camera for near-IR bubble imaging, a solar-blind photomultiplier tube to detect 175-nm xenon scintillation light, and a piezoelectric acoustic transducer to detect the ultrasonic emission from a growing bubble. The time of nucleation determined from the acoustic signal is used to correlate specific scintillation pulses with bubble-nucleating events. We report on data from this chamber for thermodynamic "Seitz" thresholds from 4.2 to 15.0 keV. The observed single- and multiple-bubble rates when exposed to a Cf 252 neutron source indicate that, for an 8.3-keV thermodynamic threshold, the minimum nuclear recoil energy required to nucleate a bubble is 19 ±6 keV (1 σ uncertainty). This is consistent with the observed scintillation spectrum for bubble-nucleating events. We see no evidence for bubble nucleation by gamma rays at any of the thresholds studied, setting a 90% C.L. upper limit of 6.3 ×10-7 bubbles per gamma interaction at a 4.2-keV thermodynamic threshold. This indicates stronger gamma discrimination than in CF3 I bubble chambers, supporting the hypothesis that scintillation production suppresses bubble nucleation by electron recoils, while nuclear recoils nucleate bubbles as usual. These measurements establish the noble-liquid bubble chamber as a promising new technology for the detection of weakly interacting massive particle dark matter and coherent elastic neutrino-nucleus scattering.

  3. Exploring the interactions between peptides and lipid bilayers using coherent anti-Stokes Raman scattering and two-photon fluorescence

    Science.gov (United States)

    Mari, M.; Mouras, R.; Downes, A.; Elfick, A.

    2011-06-01

    We have used a versatile and powerful microscope[1] for multi-modal biomedical imaging on which we combine Coherent Anti-Stokes Raman Scattering (CARS) with Two Photon Excitation Fluorescence (TPEF) using a Nd: YVO4 pump laser. We acquired 2PEF, CARS, and phase contrast images of Multilamellar Vesicles (MLVs) and Giant Unilamellar Vesicles (GUVs), as well as Raman spectra of the constituent lipids. A wide range of peptides are harmful to cells by altering the structure of the biological membranes. This effect depends on the composition of the membrane and the chemical structure of the peptide. The peptide we studied is the beta amyloid Aβ which is a major component of the amyloid plaques deposited on neuronal membranes of Alzheimer's disease (AD) patients. AD is neurodegenerative disorder in which the hallmark symptoms include cognitive decline and dementia[2] and is characterized by the formation of extracellular amyloid fibrils on the neuronal membranes of the brain. Many questions still remain unanswered concerning the destabilization of cellular ionic homeostasis due to pores formed during the interactions of lipid membranes with peptides. In this project, biomimics of cell membranes are used. The structures that best mimic the plasma membranes are MLVs or GUVs. These vesicles are formed using the gentle hydration technique[3] or the electroformation technique[4] respectively and are composed of phospholipids such as DOPC, DPPC, D62PPC and their binary mixtures. The MLVs and GUVs imaging by CARS and TPEF microscopy not only permits the direct imaging of the leakage phenomenon caused by the toxic peptide (Aβ) on the lipid bilayer, but also records simultaneously the lateral structure of the bilayer and peptide distribution in the plane across the membrane.

  4. Dicty_cDB: VHF729 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ences producing significant alignments: (bits) Value VHF729 (VHF729Q) /CSM/VH/VHF...4-A/CHC421Q.Seq.d/ 139 9e-33 own update 2002.12.27 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value... 139 2e-29 1 dna update 2008.10.31 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value

  5. From ultrafast spectroscopy to bidirectional molecular switches: DHA/VHF

    Science.gov (United States)

    Schmidhammer, U.; De Waele, V.; Buntinx, G.; Riedle, E.

    The photoconversion from dihydroazulene (DHA) to vinylheptafulvene (VHF) is governed by two mechanisms: The ring opening proceeds on the excited energy surface on the picosecond time scale. It is followed by an intemal conversion to the VHF ground state that is accelerated by the presence of a conical intersection in the case of cyclopenta-DHA. This conical intersection hinders the photoinduced back reaction from the final VHF products. However, we successfully photoconverted the cyanophenyl-VHF-cis back to the DHA with a second delayed pulse. This opens the route to the development of bistable DHAs.

  6. Path length resolved Doppler measurements of multiple scattered photons in turbid media for various absorptions using phase modulated low-coherence interferometry

    Science.gov (United States)

    Varghese, Babu; Rajan, Vinayakrishnan; Van Leeuwen, Ton G.; Steenbergen, Wiendelt

    2006-04-01

    We report the development of non-invasive, path length resolved Doppler measurements of the multiply scattered light in turbid media, for different absorptions using phase modulated Mach-Zehnder low coherence interferometer, with separate fibers for illumination and detection. A Doppler broadened phase modulation interference peak is observed that shows an increase in the average Doppler shift with optical path length, independent of absorption. The estimated path length distributions indicate suppression and narrowing for increasing absorption and can be related by Lambert-Beer's law.

  7. A method for measuring coherent elastic neutrino-nucleus scattering at a far off-axis high-energy neutrino beam target

    Energy Technology Data Exchange (ETDEWEB)

    Brice, S. J. [Fermilab; Cooper, R. L. [Indiana U.; DeJongh, F. [Fermilab; Empl, A. [Houston U.; Garrison, L. M. [Indiana U.; Hime, A. [Los Alamos; Hungerford, E. [Houston U.; Kobilarcik, T. [Fermilab; Loer, B. [Fermilab; Mariani, C. [Virginia Tech.; Mocko, M. [Los Alamos; Muhrer, G. [Los Alamos; Pattie, R. [North Carolina State U.; Pavlovic, Z. [Los Alamos; Ramberg, E. [Fermilab; Scholberg, K. [Duke U.; Tayloe, R. [Indiana U.; Thornton, R. T. [Indiana U.; Yoo, J. [Fermilab; Young, A. [North Carolina State U.

    2014-04-03

    We present an experimental method for measuring the process of coherent elastic neutrino-nucleus scattering (CENNS). This method uses a detector situated transverse to a high-energy neutrino beam production target. This detector would be sensitive to the low-energy neutrinos arising from decay-at-rest pions in the target. We discuss the physics motivation for making this measurement and outline the predicted backgrounds and sensitivities using this approach. We report a measurement of neutron backgrounds as found in an off-axis surface location of the Fermilab Booster Neutrino Beam (BNB) target. The results indicate that the Fermilab BNB target is a favorable location for a CENNS experiment.

  8. Discrimination between Doppler-shifted and non-shifted light in coherence domain path length resolved measurements of multiply scattered light.

    Science.gov (United States)

    Varghese, B; Rajan, V; van Leeuwen, T G; Steenbergen, W

    2007-10-01

    We show a novel technique to distinguish between Doppler shifted and unshifted light in multiple scattering experiments on mixed static and dynamic media. With a phase modulated low coherence Mach- Zehnder interferometer, optical path lengths of shifted and unshifted light and path length dependent Doppler broadening are measured in a two-layer tissue phantom, with a superficial static layer of different thickness covering a semi-infinite dynamic medium having identical optical properties. No Doppler broadening is observed until a certain optical path length depending on the thickness of the superficial static layer. From the minimum optical path length corresponding to the Doppler-shifted light the thickness of the static layer that overlies the dynamic layer can be estimated. Validation of the experimentally determined thickness of the static layer is done with the Doppler Monte Carlo technique. This approach has potential applications in discriminating between statically and dynamically scattered light in the perfusion signal and in determining superficial burn depths.

  9. Comparison study of Lightning VHF interferometric and LF time-of-arival maps

    Science.gov (United States)

    Kudo, A.; Stock, M.; Kawasaki, Z.; Ushio, T.

    2016-12-01

    Lightning discharges radiate broad band frequency electromagnetic waves from ULF to UHF. Using sensors which detect this radiation is an effective technique to detect lightning flashes, even if they are in a cloud. If multiple sensors are present, a lightning flash can be located using various techniques. At low frequencies, the power radiated by lightning is very high, but because the wavelengths are long, the location resolution is somewhat low. At very high frequencies, the wavelengths are much shorter allowing for much better location resolution, but the power radiation is also much lower, making it more difficult to detect. The VHF band is a good compromise between good location resolution, and good detection efficiency. One technique to locate VHF signals from lightning is interferometry. Using this technique, the signals arriving at three or more VHF broadband antennas are coherently combined to produce an image of the lightning flash. The current generation broadband lightning interferometer being developed in Japan by RAIRAN and the University of Osaka called Lightning Interferometer via VHF Emission (LIVE). Currently, LIVE is installed in Kaizuka, a city to the south of Osaka, near Osaka Bay to observe Japanese summer lightning. In the current study, we are comparing the high detail, 2-dimensional lightning maps produced by LIVE to the lower detail, 3-dimensional maps produced by a low frequency time-of-arrival system called the Broadband Observation network for Lightning and Thunderstorms (BOLT). In order to better compare the data, a new GPS timing device is being developed for LIVE to allow high absolute timing accuracy without sacrificing one of the 4 high speed digitizer channels. The objectives of the study are to better understand Japanese summer lightning, and to prepare for a future campaign as part of the GLM validation study.

  10. PMSE observations with the EISCAT VHF- and UHF-radars: Ice particles and their effect on ambient electron densities

    Science.gov (United States)

    Li, Qiang; Rapp, Markus

    2013-11-01

    It is now well understood that the occurrence of PMSE is closely connected to the presence of ice particles. These ice particles modify the ambient electron density by electron attachment which occasionally leads to large electron density depletions which have also been called ‘biteouts’. There has been some debate in the literature regarding the relative depth of such depletions which is usually expressed by the parameter Λ=|ZA|NA/ne. Here, |ZA|NA is the charge number density of ice particles and ne is the electron density. In this paper, we present, for the first time, the statistical distribution of Λ using measurements with the EISCAT VHF- and UHF-radars. Based on 25 h of simultaneous observations, we derived a total of 757 Λ values based on 15 min of data each. In each of these cases, PMSE were observed with the EISCAT VHF-radar but not with the UHF-radar and the UHF-measurement were hence used to determine the electron density profile. From these 757 cases, there are 699 cases with Λ⪡1, and only 33 cases with Λ>0.5 (21 cases with Λ>1). A correlation analysis of Λ versus PMSE volume reflectivities further reveals that there is no strong dependence between the two parameters. This is in accordance with current PMSE-theory based on turbulence in combination with a large Schmidt-number. The maxima of Λ from each profile show a negative relationship with the undisturbed electron densities deduced at the same altitudes. This reveals that the variability of Λ mainly depends on the variability of the electron densities. In addition, variations of aerosol number densities may also play a role. Although part of the observations were conducted during the HF heating experiments, the so-called overshoot effects did not significantly bias our statistical results. In order to avoid missing biteouts because of a superposition of coherent and incoherent scatter in the UHF-data, we finally calculated spectral parameters n by applying a simple fit to auto

  11. Dicty_cDB: VHF823 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uences producing significant alignments: (bits) Value VHF823 (VHF823Q) /CSM/VH/VH...186Q.Seq.d/ 86 1e-16 own update 2009. 4. 4 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value...-13 1 dna update 2008.10.31 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value

  12. The ν-cleus experiment: a gram-scale fiducial-volume cryogenic detector for the first detection of coherent neutrino-nucleus scattering

    Energy Technology Data Exchange (ETDEWEB)

    Strauss, R.; Rothe, J.; Angloher, G.; Hauff, D.; Mancuso, M.; Petricca, F.; Proebst, F.; Seidel, W.; Stodolsky, L. [Max-Planck-Institut fuer Physik, Muenchen (Germany); Bento, A. [Universidade de Coimbra, CIUC, Departamento de Fisica, Coimbra (Portugal); Guetlein, A.; Kluck, H.; Schieck, J. [Institut fuer Hochenergiephysik, Oesterreichische Akademie der Wissenschaften, Vienna (Austria); Vienna University of Technology, Atominstitut, Vienna (Austria); Oberauer, L.; Schoenert, S. [Technische Universitaet Muenchen, Physik-Department, Garching (Germany)

    2017-08-15

    We discuss a small-scale experiment, called ν-cleus, for the first detection of coherent neutrino-nucleus scattering by probing nuclear-recoil energies down to the 10 eV regime. The detector consists of low-threshold CaWO{sub 4} and Al{sub 2}O{sub 3} calorimeter arrays with a total mass of about 10 g and several cryogenic veto detectors operated at millikelvin temperatures. Realizing a fiducial volume and a multi-element target, the detector enables active discrimination of γ, neutron and surface backgrounds. A first prototype Al{sub 2}O{sub 3} device, operated above ground in a setup without shielding, has achieved an energy threshold of ∝20 eV and further improvements are in reach. A sensitivity study for the detection of coherent neutrino scattering at nuclear power plants shows a unique discovery potential (5 σ) within a measuring time of

  13. The ν -cleus experiment: a gram-scale fiducial-volume cryogenic detector for the first detection of coherent neutrino-nucleus scattering

    Science.gov (United States)

    Strauss, R.; Rothe, J.; Angloher, G.; Bento, A.; Gütlein, A.; Hauff, D.; Kluck, H.; Mancuso, M.; Oberauer, L.; Petricca, F.; Pröbst, F.; Schieck, J.; Schönert, S.; Seidel, W.; Stodolsky, L.

    2017-08-01

    We discuss a small-scale experiment, called ν -cleus, for the first detection of coherent neutrino-nucleus scattering by probing nuclear-recoil energies down to the 10 eV regime. The detector consists of low-threshold CaWO_4 and Al_2O_3 calorimeter arrays with a total mass of about 10 g and several cryogenic veto detectors operated at millikelvin temperatures. Realizing a fiducial volume and a multi-element target, the detector enables active discrimination of γ , neutron and surface backgrounds. A first prototype Al_2O_3 device, operated above ground in a setup without shielding, has achieved an energy threshold of {˜ }20 eV and further improvements are in reach. A sensitivity study for the detection of coherent neutrino scattering at nuclear power plants shows a unique discovery potential (5σ ) within a measuring time of {≲ }2 weeks. Furthermore, a site at a thermal research reactor and the use of a radioactive neutrino source are investigated. With this technology, real-time monitoring of nuclear power plants is feasible.

  14. Observations of Mesospheric Turbulence by Rocket Probe and VHF Radar, Part 2.4A

    Science.gov (United States)

    Royrvik, O.; Smith, L. G.

    1984-01-01

    Data from the Jicamarca VHF radar and from a Languir probe fine-structure on a Nike Orion rocket launched from Punto Lobos, Peru, have been compared. A single mesospheric scattering layer was observed by the radar. The Langmuir probe detected irregularities in the electron-density profile in a narrow region between 85.2 and 86.6 km. It appears from a comparison between these two data sets that turbulence in the neutral atmosphere is the mechanism generating the refractive index irregularities.

  15. Significance of coherent Rayleigh noise in fibre-optic distributed temperature sensing based on spontaneous Brillouin scattering

    Science.gov (United States)

    DeSouza, K.

    2006-05-01

    The temperature resolution of a fibre-optic distributed temperature sensor based on taking the ratio of the temperature sensitive backscattered spontaneous Brillouin signal to the corresponding Rayleigh signal depends on the optical signal-to-noise of the receiver system and the amplitude fluctuations in the Rayleigh signal. The amplitude fluctuations or coherent Rayleigh noise have been investigated experimentally as a function of detection bandwidth, source bandwidth and spatial resolution and showed good agreement with theory.

  16. Path-length distribution and path-length-resolved Doppler measurements of multiply scattered photons by use of low-coherence interferometry.

    Science.gov (United States)

    Petoukhova, A L; Steenbergen, W; de Mul, F F

    2001-10-01

    We report first results of measurements by low-coherence Doppler interferometry of the path-length distribution of photons undergoing multiple scattering in a highly turbid medium. We use a Mach-Zehnder interferometer with multimode graded-index fibers and a superluminescent diode as the light source. The path-length distribution is obtained by recording of the heterodyne fluctuations that arise from the Brownian motion of particles in an Intralipid suspension as a function of the optical path length. The experimental path-length distribution is in good agreement with predictions of Monte Carlo simulations. In the heterodyne spectrum, an increase of the mean Doppler frequency with path length is observed.

  17. In planta imaging of Δ9-tetrahydrocannabinolic acid in Cannabis sativa L. with hyperspectral coherent anti-Stokes Raman scattering microscopy

    Science.gov (United States)

    Garbacik, Erik T.; Korai, Roza P.; Frater, Eric H.; Korterik, Jeroen P.; Otto, Cees; Offerhaus, Herman L.

    2013-04-01

    Nature has developed many pathways to produce medicinal products of extraordinary potency and specificity with significantly higher efficiencies than current synthetic methods can achieve. Identification of these mechanisms and their precise locations within plants could substantially increase the yield of a number of natural pharmaceutics. We report label-free imaging of Δ9-tetrahydrocannabinolic acid (THCa) in Cannabis sativa L. using coherent anti-Stokes Raman scattering microscopy. In line with previous observations we find high concentrations of THCa in pistillate flowering bodies and relatively low amounts within flowering bracts. Surprisingly, we find differences in the local morphologies of the THCa-containing bodies: organelles within bracts are large, diffuse, and spheroidal, whereas in pistillate flowers they are generally compact, dense, and have heterogeneous structures. We have also identified two distinct vibrational signatures associated with THCa, both in pure crystalline form and within Cannabis plants; at present the exact natures of these spectra remain an open question.

  18. Hyperspectral imaging and characterization of live cells by broadband coherent anti-Stokes Raman scattering (CARS) microscopy with singular value decomposition (SVD) analysis.

    Science.gov (United States)

    Khmaladze, Alexander; Jasensky, Joshua; Price, Erika; Zhang, Chi; Boughton, Andrew; Han, Xiaofeng; Seeley, Emily; Liu, Xinran; Banaszak Holl, Mark M; Chen, Zhan

    2014-01-01

    Coherent anti-Stokes Raman scattering (CARS) microscopy can be used as a powerful imaging technique to identify chemical compositions of complex samples in biology, biophysics, medicine, and materials science. In this work we developed a CARS microscopic system capable of hyperspectral imaging. By employing an ultrafast laser source, a photonic crystal fiber, and a scanning laser microscope together with spectral detection by a highly sensitive back-illuminated cooled charge-coupled device (CCD) camera, we were able to rapidly acquire and process hyperspectral images of live cells with chemical selectivity. We discuss various aspects of hyperspectral CARS image analysis and demonstrate the use of singular value decomposition methods to characterize the cellular lipid content.

  19. Investigation of protein distribution in solid lipid particles and its impact on protein release using coherent anti-Stokes Raman scattering microscopy

    DEFF Research Database (Denmark)

    Christophersen, Philip C.; Birch, Ditlev; Saarinen, Jukka

    2015-01-01

    -destructive method for elucidating the distribution of lysozyme in SLMs. The interpretation of protein distribution and release during lipolysis enabled elucidation of protein release mechanisms. In future, CARS microscopy analysis could facilitate development of a wide range of protein-lipid matrices with tailor-made......The aim of this study was to gain new insights into protein distribution in solid lipid microparticles (SLMs) and subsequent release mechanisms using a novel label-free chemical imaging method, coherent anti-Stokes Raman scattering (CARS) microscopy. Lysozyme-loaded SLMs were prepared using...... different lipids with lysozyme incorporated either as an aqueous solution or as a solid powder. Lysozyme distribution in SLMs was investigated using CARS microscopy with supportive structural analysis using electron microscopy. The release of lysozyme from SLMs was investigated in a medium simulating...

  20. Layered Polar Mesospheric Summer Echoes Observed with the Tri-Static Eiscat VHF

    Science.gov (United States)

    Mann, I.; Anyairo, C.; Häggström, I.; Tjulin, A.

    2014-12-01

    Polar mesospheric summer echoes (PMSE) are strong radar echoes that are typically observed at 50 to 500 MHz. They are often discussed in the context of dusty plasma studies and linked to e.g. the existence of charged ice particles, neutral atmospheric turbulence and atmospheric stratification. The PMSE are observed at mesospheric temperature minimum when ice particles form, though the exact path of formation is still a topic for research. Mesospheric smoke particles that are assumed to form after or during the meteor ablation process possibly contribute to the formation of the ice particles. For understanding the formation of the radar echoes their variation with scattering angle is an important parameter. We analyze PMSE observations with the tri-static EISCAT VHF radar (224 MHz) during one day in June when PMSE were observed almost continuously from 7:00 to 13:00 UT. The radar signal was transmitted and received in zenith direction with the EISCAT VHF antenna near Tromsø. The receivers in Kiruna and Sodankylä were pointed at typical PMSE heights above the Tromsø transmitter and detected radar reflections at the same time and altitude as the Tromsø radar. The altitude of the PMSE changed with time and the extension of the echoes in altitude was smaller toward the end of the observation. These observations are among the first tri-static observations of PMSE. The observations suggest that the scattering process underlying the PMSE occurs over a broad range of scattering angles. Based on the observations we will show that the spectral width of the received echoes is most likely determined by the variations within the observed volume rather than by the scattering process. The observed frequency shifts suggest a layer structure and horizontal motions that vary with altitude. UHF (933 MHz) radar observations were carried out in parallel, they display predominantly incoherent scatter and an electron density typical for the altitude. Some other studies, have in

  1. 3D measurements in the polar mesosphere using coherent radar imaging

    Science.gov (United States)

    Zecha, M.; Sommer, S.; Rapp, M.; Stober, G.; Latteck, R.

    2012-12-01

    Radars provide the opportunity of continuous measurements in the interesting area of the polar mesosphere. Usually the spatial resolution of measurements by pulsed VHF radars is limited by the radar beam width, transmitting pulse length, and sampling time. Due to these technical restrictions the typical small-scale structures in the mesosphere often cannot be resolved. Furthermore the quality of the estimation of dynamic atmosphere parameters is reduced if the position and direction of scatter returns cannot determined exactly. Radar interferometry methods have been developed to reduce these limitations. The coherent radar imaging method gives a high resolving image of the scatter structure insight the radar beam volume. In recent years the VHF radar MAARSY was installed in Andenes/Norway (69°N). This new radar was designed to allow improved three-dimensional observations in the atmosphere. It consists of 433 Yagis and allows a minimum beam width of about 4 degree. The beam direction can be changed pulse-by-pulse freely in azimuth angle and practicable up to 40 degree in zenith angle. The pulse length can be varied from a couple of km down to 50 m. Up to 16 receiving channels of spaced antennas can be used. In this presentation we show the detection of the angles-of-arrival of radar echoes and the correction of the wind measurements. We demonstrate the improvement of measurement results by using coherent radar imaging. The differences to the results of conventional methods depend on the beam width, range resolution, antenna distances, and beam tilting. We show that the application of interferometry is necessary to improve considerably the quality of 3D-measurement results. Furthermore we demonstrate the synthesis of high resolved images to get a real 3D image of the mesosphere.

  2. Combining THz laser excitation with resonant soft X-ray scattering at the Linac Coherent Light Source.

    Science.gov (United States)

    Turner, Joshua J; Dakovski, Georgi L; Hoffmann, Matthias C; Hwang, Harold Y; Zarem, Alex; Schlotter, William F; Moeller, Stefan; Minitti, Michael P; Staub, Urs; Johnson, Steven; Mitra, Ankush; Swiggers, Michele; Noonan, Peter; Curiel, G Ivan; Holmes, Michael

    2015-05-01

    This paper describes the development of new instrumentation at the Linac Coherent Light Source for conducting THz excitation experiments in an ultra high vacuum environment probed by soft X-ray diffraction. This consists of a cantilevered, fully motorized mirror system which can provide 600 kV cm(-1) electric field strengths across the sample and an X-ray detector that can span the full Ewald sphere with in-vacuum motion. The scientific applications motivated by this development, the details of the instrument, and spectra demonstrating the field strengths achieved using this newly developed system are discussed.

  3. Magnetic and electric coherence in forward- and back-scattered electromagnetic waves by a single dielectric subwavelength sphere.

    Science.gov (United States)

    Geffrin, J M; García-Cámara, B; Gómez-Medina, R; Albella, P; Froufe-Pérez, L S; Eyraud, C; Litman, A; Vaillon, R; González, F; Nieto-Vesperinas, M; Sáenz, J J; Moreno, F

    2012-01-01

    Magnetodielectric small spheres present unusual electromagnetic scattering features, theoretically predicted a few decades ago. However, achieving such behaviour has remained elusive, due to the non-magnetic character of natural optical materials or the difficulty in obtaining low-loss highly permeable magnetic materials in the gigahertz regime. Here we present unambiguous experimental evidence that a single low-loss dielectric subwavelength sphere of moderate refractive index (n=4 like some semiconductors at near-infrared) radiates fields identical to those from equal amplitude crossed electric and magnetic dipoles, and indistinguishable from those of ideal magnetodielectric spheres. The measured scattering radiation patterns and degree of linear polarization (3-9 GHz/33-100 mm range) show that, by appropriately tuning the a/λ ratio, zero-backward ('Huygens' source) or almost zero-forward ('Huygens' reflector) radiated power can be obtained. These Kerker scattering conditions only depend on a/λ. Our results open new technological challenges from nano- and micro-photonics to science and engineering of antennas, metamaterials and electromagnetic devices.

  4. Dicty_cDB: VHF145 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF145 (Link to dictyBase) - - - Contig-U15430-1 VHF145E (Link...) Clone ID VHF145 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15430-1 Ori...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116984 |AC116984.2 Dictyos... theta DNA for complete sequence of nucleomorph chromosome 2. 48 2e-07 2 ES451909 | PREDICTED: similar to PI...al 16.0 %: nuclear 8.0 %: vacuolar 8.0 %: endoplasmic reticulum 4.0 %: cytoskeletal >> prediction for VHF145

  5. Broadband Grounded Vertical Antennas for 30-180 MHZ (VHF)

    Science.gov (United States)

    2013-10-18

    antennas are well known for their broadband gain (monocone, bicone ) but are never combined with a monopole. An eccentric combination of broadband...DATES COVERED 00-00-2014 to 00-00-2014 4. TITLE AND SUBTITLE Broadband Grounded Vertical Antennas For 30-180 MZH (VHF) 5a. CONTRACT NUMBER 5b...18 Attorney Docket No. 102536 1 of 17 BROADBAND GROUNDED VERTICAL ANTENNAS FOR 30-180 MHZ (VHF) STATEMENT OF GOVERNMENT INTEREST

  6. Influence of Electron-Acoustic-Phonon Scattering on Intensity Power Broadening in a Coherently Driven Quantum-Dot-Cavity System

    Science.gov (United States)

    Roy, C.; Hughes, S.

    2011-10-01

    We present a quantum optics formalism to study the intensity power broadening of a semiconductor quantum dot interacting with an acoustic-phonon bath and a high-Q microcavity. Power broadening is investigated using a time-convolutionless master equation in the polaron frame, which allows for a nonperturbative treatment of the interaction of the quantum dot with the phonon reservoir. We calculate the full non-Lorentzian photoluminescence (PL) line shapes and numerically extract the intensity linewidths of the quantum-dot exciton and the cavity mode as a function of the pump rate and temperature. For increasing field strengths, multiphonon and multiphoton effects are found to be important, even for phonon-bath temperatures as low as 4 K. We show that the interaction of the quantum dot with the phonon reservoir introduces pronounced features in the power-broadened PL line shape, enabling one to observe clear signatures of electron-phonon scattering. The PL line shapes from cavity pumping and exciton pumping are found to be distinctly different, primarily since the latter is excited through the exciton-phonon reservoir. To help explain the underlying physics of phonon scattering on the power-broadened line shape, an effective phonon Lindblad master equation derived from the full time-convolutionless master equation is introduced; we identify and calculate distinct Lindblad scattering contributions from electron-phonon interactions, including effects such as excitation-induced dephasing, incoherent exciton excitation, and exciton-cavity feeding. Our effective phonon master equation is shown to reproduce the full PL intensity and the phonon-coupling effects very well, suggesting that its general Lindblad form may find widespread use in semiconductor cavity-QED.

  7. Influence of Electron–Acoustic-Phonon Scattering on Intensity Power Broadening in a Coherently Driven Quantum-Dot–Cavity System

    Directory of Open Access Journals (Sweden)

    C. Roy

    2011-11-01

    Full Text Available We present a quantum optics formalism to study the intensity power broadening of a semiconductor quantum dot interacting with an acoustic-phonon bath and a high-Q microcavity. Power broadening is investigated using a time-convolutionless master equation in the polaron frame, which allows for a nonperturbative treatment of the interaction of the quantum dot with the phonon reservoir. We calculate the full non-Lorentzian photoluminescence (PL line shapes and numerically extract the intensity linewidths of the quantum-dot exciton and the cavity mode as a function of the pump rate and temperature. For increasing field strengths, multiphonon and multiphoton effects are found to be important, even for phonon-bath temperatures as low as 4 K. We show that the interaction of the quantum dot with the phonon reservoir introduces pronounced features in the power-broadened PL line shape, enabling one to observe clear signatures of electron-phonon scattering. The PL line shapes from cavity pumping and exciton pumping are found to be distinctly different, primarily since the latter is excited through the exciton-phonon reservoir. To help explain the underlying physics of phonon scattering on the power-broadened line shape, an effective phonon Lindblad master equation derived from the full time-convolutionless master equation is introduced; we identify and calculate distinct Lindblad scattering contributions from electron-phonon interactions, including effects such as excitation-induced dephasing, incoherent exciton excitation, and exciton-cavity feeding. Our effective phonon master equation is shown to reproduce the full PL intensity and the phonon-coupling effects very well, suggesting that its general Lindblad form may find widespread use in semiconductor cavity-QED.

  8. Coherent intensity fluctuation model for autocorrelation imaging spectroscopy with higher harmonic generating point scatterers-a comprehensive theoretical study.

    Science.gov (United States)

    Slenders, Eli; vandeVen, Martin; Hooyberghs, Jef; Ameloot, Marcel

    2015-07-15

    We present a general analytical model for the intensity fluctuation autocorrelation function for second and third harmonic generating point scatterers. Expressions are derived for a stationary laser beam and for scanning beam configurations for specific correlation methodologies. We discuss free translational diffusion in both three and two dimensions. At low particle concentrations, the expressions for fluorescence are retrieved, while at high particle concentrations a rescaling of the function parameters is required for a stationary illumination beam, provided that the phase shift per unit length of the beam equals zero.

  9. Performance of PolSAR backscatter and PolInSAR coherence for scattering characterization of forest vegetation using single pass X-band spaceborne synthetic aperture radar data

    Science.gov (United States)

    Joshi, Sushil Kumar; Kumar, Shashi

    2017-04-01

    Airborne synthetic aperture radar (SAR) data have been successfully used for forest height inversion; however, there is limited applicability in spaceborne scenarios due to high temporal decorrelation. This study investigates the potential of a high-resolution fully polarimetric interferometric pair of TerraSAR-X/TanDEM-X SAR data with no temporal decorrelation to analyze the backscatter and coherence response and to implement polarimetric SAR interferometry-based height inversion algorithms. The data were acquired over Barkot forest region of Uttarakhand state in India. Yamaguchi decomposition was implemented onto the dataset to express total backscatter as a sum of different scattering components from a single SAR resolution cell. Coherency matrix was used to compute complex coherence for different polarization channels. Forest areas suffered from low coherence due to volume decorrelation, whereas a dry river bed had shown high coherence. The coherence amplitude inversion approach overestimated the forest height and also resulted in false heights for this dry river bed. These limitations were overcome by implementing three-stage inversion modeling, which assumes polarization-independent volume coherence. The results were validated using ground truth data available for 49 plots, and the latter was found to be more accurate with an overall accuracy of 90.15% and root-mean-square error of 2.42 m.

  10. Coherent Anti-Stokes Raman Scattering (CARS) as a Probe for Supersonic Hydrogen-Fuel/Air Mixing

    Science.gov (United States)

    Danehy, P. M.; O'Byrne, S.; Cutler, A. D.; Rodriguez, C. G.

    2003-01-01

    The dual-pump coherent anti-Stokes Raman spectroscopy (CARS) method was used to measure temperature and the absolute mole fractions of N2, O2 and H2 in a supersonic non-reacting fuel-air mixing experiment. Experiments were conducted in NASA Langley Research Center s Direct Connect Supersonic Combustion Test Facility. Under normal operation of this facility, hydrogen and air burn to increase the enthalpy of the test gas and O2 is added to simulate air. This gas is expanded through a Mach 2 nozzle and into a combustor model where fuel is then injected, mixes and burns. In the present experiment the O2 of the test gas is replaced by N2. The lack of oxidizer inhibited combustion of the injected H2 fuel jet allowing the fuel/air mixing process to be studied. CARS measurements were performed 427 mm downstream of the nozzle exit and 260 mm downstream of the fuel injector. Maps were obtained of the mean temperature, as well as the N2, O2 and H2 mean mole fraction fields. A map of mean H2O vapor mole fraction was also inferred from these measurements. Correlations between different measured parameters and their fluctuations are presented. The CARS measurements are compared with a preliminary computational prediction of the flow.

  11. Photons and dileptons production in a quark gluon plasma: infrared structure and coherent scattering effects; Production de photons et de dileptons dans un plasma de quarks et de gluons: structure infrarouge et effets coherents

    Energy Technology Data Exchange (ETDEWEB)

    Zaraket, H

    2000-06-01

    This work is devoted to photon and dilepton production in a quark gluon plasma. The theoretical framework in which the study is carried out is Thermal Field Theory, more precisely the hard thermal loop effective theory. Several features of the observables preclude a straightforward application of the effective theory and new tools had to be developed such as the counter term method to avoid double counting. The first part of my study concerns static virtual photon production where I show that important physical contributions are missing in the effective theory at one loop level and hence a two loop calculation is indispensable. Furthermore I give an analytic leading logarithmic estimate of this two loop result showing clearly the insufficiency of the effective theory. The second part of the work focuses on real and quasi real photon production. Again, important contributions arise at two loop level due to collinear divergences. For high mass dilepton the two loop calculation is sufficient. On the other hand, near the light cone photon production rate is non perturbative. Getting closer to the light cone coherent scattering effects (Landau-Pomeranchuk-Migdal effect) arise, which imply the resummation of an infinite series of diagrams. Still nearer the light cone we found a dependence on the non perturbative magnetic mass due to infrared singularities. (author)

  12. Anechoic chamber for VHF and UHF bands

    Science.gov (United States)

    Morikawa, Takao; Sugiura, Akira; Harima, Katsushige; Masuzawa, Hiroshi

    1995-06-01

    Built in 1969, the anechoic chamber of CRL has been used to the fullest by researchers in many fields such as EMI, EMC, antenna design, standard of electric field intensity, and type approval testing. In particular, in the early days of space development in Japan, many satellite-born antennas were developed in this anechoic chamber. However, a quarter of a century has passed since its construction and deteriorated performance due to superannuation sometimes caused difficulties in experiments conducted in the chamber. In 1993, CRL constructed a Measuring Facility for Radio Research (MFRR) and the anechoic chamber for VHF-UHF bands was remodeled as one of the sub-facilities of MFRR. The remodeling work included full replacement of the electromagnetic shielding, absorbers and measurement system. Since the remodeled anechoic chamber is being used not only for EMI tests but also for other purposes, a full-anechoic chamber has been adopted. In addition the chamber has been designed for the frequency range between 30 MHz and 10 GHz. After the remodeling work, the performance of the chamber is greatly improved. The average shielding factor is better than 85 dB for all frequency ranges and the unwanted reflection characteristic is -30 dB for frequencies above 1 GHZ. This paper summarizes the remodeling work, and the specifications and performance of the remodeled anechoic chamber.

  13. Implementation of a Coherent Anti-Stokes Raman Scattering (CARS) System on a Ti:Sapphire and OPO Laser Based Standard Laser Scanning Microscope.

    Science.gov (United States)

    Mytskaniuk, Vasyl; Bardin, Fabrice; Boukhaddaoui, Hassan; Rigneault, Herve; Tricaud, Nicolas

    2016-07-17

    Laser scanning microscopes combining a femtosecond Ti:sapphire laser and an optical parametric oscillator (OPO) to duplicate the laser line have become available for biologists. These systems are primarily designed for multi-channel two-photon fluorescence microscopy. However, without any modification, complementary non-linear optical microscopy such as second-harmonic generation (SHG) or third harmonic generation (THG) can also be performed with this set-up, allowing label-free imaging of structured molecules or aqueous medium-lipid interfaces. These techniques are well suited for in-vivo observation, but are limited in chemical specificity. Chemically selective imaging can be obtained from inherent vibration signals based on Raman scattering. Confocal Raman microscopy provides 3D spatial resolution, but it requires high average power and long acquisition time. To overcome these difficulties, recent advances in laser technology have permitted the development of nonlinear optical vibrational microscopy, in particular coherent anti-Stokes Raman scattering (CARS). CARS microscopy has therefore emerged as a powerful tool for biological and live cell imaging, by chemically mapping lipids (via C-H stretch vibration), water (via O-H stretch vibrations), proteins or DNA. In this work, we describe the implementation of the CARS technique on a standard OPO-coupled multiphoton laser scanning microscope. It is based on the in-time synchronization of the two laser lines by adjusting the length of one of the laser beam path. We present a step-by-step implementation of this technique on an existing multiphoton system. A basic background in experimental optics is helpful and the presented system does not require expensive supplementary equipment. We also illustrate CARS imaging obtained on myelin sheaths of sciatic nerve of rodent, and we show that this imaging can be performed simultaneously with other nonlinear optical imaging, such as standard two-photon fluorescence technique

  14. Coherence and chaos

    Energy Technology Data Exchange (ETDEWEB)

    Sudarshan, E.C.G.

    1993-12-31

    The annihilation operator for harmonic oscillator is a weighted shift operator and can be realized on a family of over complete coherent states. Shift operators arise in dynamical maps of systems exhibiting deterministic chaos. Generalized coherent states, called harmonious states, realize these maps in a simple manner. By analytic continuation the spectral family can be altered, thus furnishing an alternative perspective on resonant scattering. Singular distributions are necessary to reproduce the rich structure of chaotic and scattering systems.

  15. Ultimate VHF Broadband Interferometer Zen KAWASAKI and Manabu AKITA

    Science.gov (United States)

    Kawasaki, Z.; Akita, M.

    2013-12-01

    Lightning Research Group of Osaka University (LRGOU) has been developing an interferometer for thunderstorm monitoring during these two decades. When LRGOU initiated this project, many related scientists claimed that LRGOU's system was a time of arrival and it must be a sophisticated TOA system. However the key technology of the system were broad band and digital data processing, and it is named the VHF broad band digital interferometer (BDITF), because the phase difference of Fourier components played the very important role. Then the BDITF finally has been realized as a quasi-real time lightning monitoring system, and LRGOU has been operating their BDITFs around Osaka area. Since the BDITF captures the VHF impulses associated with lightning discharges by amplitude triggering, it occasionally misses one of the bi-directional leader progressions because of relatively small amplitude VHF impulses mainly emitted by positive leader tips. All of high density of VHF pulses associated with recoil leaders may not be recorded. Then the ordinary BDITF is able to be accepted as the practical operational system, but from the aspect of science it has been sioriously expected to be improved its performance. To overcome the difficulty New Mexico Institute of Mining and Technology (NMIMT) and LRGOU have started the joint project, and a continuous recording system for digital signals is adopted [M. Stock et al, and M Akita et al,]. The field campaigns have been conducting in New Mexico and in Japan, and successful observations are accomplished. The algorithm to identify individual VHF pulses associated with lightning discharges from back ground noise and/or artificial noise, the dispersion of phase differences for all Fourier components is examined. In case by of small dispersion it is concluded that analyzed VHF pulse has high possibility to be emitted by lightning discharges. This interpretation means that the recorded VHF pulse shape might maintain without deformation during

  16. Raman and coherent anti-Stokes Raman scattering microscopy studies of changes in lipid content and composition in hormone-treated breast and prostate cancer cells.

    Science.gov (United States)

    Potcoava, Mariana C; Futia, Gregory L; Aughenbaugh, Jessica; Schlaepfer, Isabel R; Gibson, Emily A

    2014-01-01

    Increasing interest in the role of lipids in cancer cell proliferation and resistance to drug therapies has motivated the need to develop better tools for cellular lipid analysis. Quantification of lipids in cells is typically done by destructive chromatography protocols that do not provide spatial information on lipid distribution and prevent dynamic live cell studies. Methods that allow the analysis of lipid content in live cells are therefore of great importance. Using micro-Raman spectroscopy and coherent anti-Stokes Raman scattering (CARS) microscopy, we generated a lipid profile for breast (T47D, MDA-MB-231) and prostate (LNCaP, PC3) cancer cells upon exposure to medroxyprogesterone acetate (MPA) and synthetic androgen R1881. Combining Raman spectra with CARS imaging, we can study the process of hormone-mediated lipogenesis. Our results show that hormone-treated cancer cells T47D and LNCaP have an increased number and size of intracellular lipid droplets and higher degree of saturation than untreated cells. MDA-MB-231 and PC3 cancer cells showed no significant changes upon treatment. Principal component analysis with linear discriminant analysis of the Raman spectra was able to differentiate between cancer cells that were treated with MPA, R1881, and untreated.

  17. Long-range distributed temperature and strain optical fibre sensor based on the coherent detection of spontaneous Brillouin scattering with in-line Raman amplification

    Science.gov (United States)

    Alahbabi, Mohamed N.; Tat Cho, Yuh; Newson, Trevor P.

    2006-05-01

    We report an extended range distributed temperature and strain optical fibre sensor based on the coherent detection of spontaneous Brillouin scattering combined with Raman amplification. The Raman amplification was achieved within the sensing fibre using either co- or counter-propagating Raman pump configuration with respect to the probe pulse and experiments were conducted to investigate the optimum pump and probe power combination. Using Brillouin frequency shift measurements with co-propagating Raman pump configuration, a temperature resolution of 1.7 °C with a 20 m spatial resolution at 100 km was achieved. With the counter-propagating pump configuration, a temperature resolution of 5 °C with a 50 m spatial resolution at 150 km was achieved. Measuring both the power and frequency of the Brillouin signal, a simultaneous temperature and strain measurement was performed over 50 km using co-propagating Raman pump. Temperature and strain resolutions of 3.5 °C and 85 μɛ with 5 m spatial resolution were achieved.

  18. Label-free imaging of Drosophila in vivo by coherent anti-Stokes Raman scattering and two-photon excitation autofluorescence microscopy

    Science.gov (United States)

    Chien, Cheng-Hao; Chen, Wei-Wen; Wu, June-Tai; Chang, Ta-Chau

    2011-01-01

    Drosophila is one of the most valuable model organisms for studying genetics and developmental biology. The fat body in Drosophila, which is analogous to the liver and adipose tissue in human, stores lipids that act as an energy source during its development. At the early stages of metamorphosis, the fat body remodeling occurs involving the dissociation of the fat body into individual fat cells. Here we introduce a combination of coherent anti-Stokes Raman scattering (CARS) and two-photon excitation autofluorescence (TPE-F) microscopy to achieve label-free imaging of Drosophila in vivo at larval and pupal stages. The strong CARS signal from lipids allows direct imaging of the larval fat body and pupal fat cells. In addition, the use of TPE-F microscopy allows the observation of other internal organs in the larva and autofluorescent globules in fat cells. During the dissociation of the fat body, the findings of the degradation of lipid droplets and an increase in autofluorescent globules indicate the consumption of lipids and the recruitment of proteins in fat cells. Through in vivo imaging and direct monitoring, CARS microscopy may help elucidate how metamorphosis is regulated and study the lipid metabolism in Drosophila.

  19. Low-latitude daytime F region irregularities observed in two geomagnetically quiet days by the Hainan coherent scatter phased array radar (HCOPAR)

    Science.gov (United States)

    Chen, Gang; Jin, Han; Yan, Jingye; Zhang, Shaodong; Li, Guozhu; Yokoyama, Tatsuhiro; Yang, Guotao; Yan, Chunxiao; Wu, Chen; Wang, Jin; Zhong, Dingkun; Li, Yaxian; Wang, Zhihua

    2017-02-01

    Hainan coherent scatter phased array radar (HCOPAR) located at low latitude of China has recorded the extremely rare daytime F region irregularities at noon of 22 July 2013 and 23 May 2016. The two field-aligned irregularities (FAIs) appeared in the topside F2 layer and presented small Doppler velocities and narrow spectral widths. The fan sector maps show that the FAIs moved northward with almost no zonal speed. The irregularities emerged in the geomagnetically quiet condition and were irrelevant to the storm-induced eastward electric field as other daytime cases. More than 2 h after the emergency of the daytime irregularities over Hainan, the Shaoyang digisonde situated 870 km north to the HCOPAR recorded the spread-F in ionospheric F1 layer. According to the echo altitudes, the spread-F may connect the daytime bubbles via magnetic field line. The strong photoionization after sunrise made it difficult to generate the plasma bubbles in the sunlit ionosphere. Consequently, the two midday FAIs over Hainan may drift along the magnetic field lines from higher altitudes in the south and are most likely the remnant of previous night's bubbles.

  20. Label-free in vivo analysis of intracellular lipid droplets in the oleaginous microalga Monoraphidium neglectum by coherent Raman scattering microscopy.

    Science.gov (United States)

    Jaeger, Daniel; Pilger, Christian; Hachmeister, Henning; Oberländer, Elina; Wördenweber, Robin; Wichmann, Julian; Mussgnug, Jan H; Huser, Thomas; Kruse, Olaf

    2016-10-21

    Oleaginous photosynthetic microalgae hold great promise as non-food feedstocks for the sustainable production of bio-commodities. The algal lipid quality can be analysed by Raman micro-spectroscopy, and the lipid content can be imaged in vivo in a label-free and non-destructive manner by coherent anti-Stokes Raman scattering (CARS) microscopy. In this study, both techniques were applied to the oleaginous microalga Monoraphidium neglectum, a biotechnologically promising microalga resistant to commonly applied lipid staining techniques. The lipid-specific CARS signal was successfully separated from the interfering two-photon excited fluorescence of chlorophyll and for the first time, lipid droplet formation during nitrogen starvation could directly be analysed. We found that the neutral lipid content deduced from CARS image analysis strongly correlated with the neutral lipid content measured gravimetrically and furthermore, that the relative degree of unsaturation of fatty acids stored in lipid droplets remained similar. Interestingly, the lipid profile during cellular adaption to nitrogen starvation showed a two-phase characteristic with initially fatty acid recycling and subsequent de novo lipid synthesis. This works demonstrates the potential of quantitative CARS microscopy as a label-free lipid analysis technique for any microalgal species, which is highly relevant for future biotechnological applications and to elucidate the process of microalgal lipid accumulation.

  1. Multimodal coherent anti-Stokes Raman scattering microscopy reveals microglia-associated myelin and axonal dysfunction in multiple sclerosis-like lesions in mice

    Science.gov (United States)

    Imitola, Jaime; Côté, Daniel; Rasmussen, Stine; Xie, X. Sunney; Liu, Yingru; Chitnis, Tanuja; Sidman, Richard L.; Lin, Charles. P.; Khoury, Samia J.

    2011-02-01

    Myelin loss and axonal degeneration predominate in many neurological disorders; however, methods to visualize them simultaneously in live tissue are unavailable. We describe a new imaging strategy combining video rate reflectance and fluorescence confocal imaging with coherent anti-Stokes Raman scattering (CARS) microscopy tuned to CH2 vibration of myelin lipids, applied in live tissue of animals with chronic experimental autoimmune encephalomyelitis (EAE). Our method allows monitoring over time of demyelination and neurodegeneration in brain slices with high spatial resolution and signal-to-noise ratio. Local areas of severe loss of lipid signal indicative of demyelination and loss of the reflectance signal from axons were seen in the corpus callosum and spinal cord of EAE animals. Even in myelinated areas of EAE mice, the intensity of myelin lipid signals is significantly reduced. Using heterozygous knock-in mice in which green fluorescent protein replaces the CX3CR1 coding sequence that labels central nervous system microglia, we find areas of activated microglia colocalized with areas of altered reflectance and CARS signals reflecting axonal injury and demyelination. Our data demonstrate the use of multimodal CARS microscopy for characterization of demyelinating and neurodegenerative pathology in a mouse model of multiple sclerosis, and further confirm the critical role of microglia in chronic inflammatory neurodegeneration.

  2. Lipid droplet pattern and nondroplet-like structure in two fat mutants of Caenorhabditis elegans revealed by coherent anti-Stokes Raman scattering microscopy

    Science.gov (United States)

    Yi, Yung-Hsiang; Chien, Cheng-Hao; Chen, Wei-Wen; Ma, Tian-Hsiang; Liu, Kuan-Yu; Chang, Yu-Sun; Chang, Ta-Chau; Lo, Szecheng J.

    2014-01-01

    Lipid is an important energy source and essential component for plasma and organelle membranes in all kinds of cells. Coherent anti-Stokes Raman scattering (CARS) microscopy is a label-free and nonlinear optical technique that can be used to monitor the lipid distribution in live organisms. Here, we utilize CARS microscopy to investigate the pattern of lipid droplets in two live Caenorhabditis elegans mutants (fat-2 and fat-3). The CARS images showed a striking decrease in the size, number, and content of lipid droplets in the fat-2 mutant but a slight difference in the fat-3 mutant as compared with the wild-type worm. Moreover, a nondroplet-like structure with enhanced CARS signal was detected for the first time in the uterus of fat-2 and fat-3 mutants. In addition, transgenic fat-2 mutant expressing a GFP fusion protein of vitellogenin-2 (a yolk lipoprotein) revealed that the enhanced CARS signal colocalized with the GFP signal, which suggests that the nondroplet-like structure is primarily due to the accumulation of yolk lipoproteins. Together, this study implies that CARS microscopy is a potential tool to study the distribution of yolk lipoproteins, in addition to lipid droplets, in live animals.

  3. Reconstruction of surface morphology from coherent scattering of ''white'' synchrotron radiation in hard X-ray regime

    Energy Technology Data Exchange (ETDEWEB)

    Sant, Tushar

    2009-07-01

    Energy Dispersive Reflectometry (EDR) beamline at BESSY II provides ''white'' X-rays in the useful energy range of 5coherent reflectivity data at EDR bending magnet beamline at BESSY II from various surfaces. Technologically smooth wafers of semiconducting materials of Si and GaAs are used as ''trivial'' samples to determine the so called apparatus function. In addition I measured coherent reflectivity maps from thin film of highly scattering material of Pt with high atom number, Z=78 and patterned semiconducting surface like a GaAs surface grating which provides a certain periodicity in the measured scattering intensity. Finally I measured the surface speckles from a spatially confined Si wafer under the constraint that the size of the sample is smaller than the footprint of the incoming beam at the sample position. To reconstruct surface morphology from coherent reflectivity data is a typical inverse problem. Conventional phase retrieval algorithms like Gerchberg-Saxton (GS) algorithm, error reduction (ER) algorithm, hybrid input-output (HIO) algorithm are used in earlier work by other authors. I modified the conventional GS algorithm and ER algorithm which takes into account the additional Fresnel propagator term and also the illumination function at the sample position. I tested the modified algorithm successfully for a model surface in the form of a surface grating. I used the modified algorithm to reconstruct surface morphology from various static speckle measurements I performed at EDR beamline. The surface profiles reconstructed for different samples from the data at different energies (below the critical energy for the material at a particular incident angle) show almost the same roughness behavior for surface height with mean roughness of {proportional_to}1 nm. With the static speckle data I measured I could retrieve a one-dimensional picture of the sample surface with spatial

  4. VHF signal power suppression in stratiform and convective precipitation

    Directory of Open Access Journals (Sweden)

    A. J. McDonald

    2006-03-01

    Full Text Available Previous studies have indicated that VHF clear-air radar return strengths are reduced during periods of precipitation. This study aims to examine whether the type of precipitation, stratiform and convective precipitation types are identified, has any impact on the relationships previously observed and to examine the possible mechanisms which produce this phenomenon. This study uses a combination of UHF and VHF wind-profiler data to define periods associated with stratiform and convective precipitation. This identification is achieved using an algorithm which examines the range squared corrected signal to noise ratio of the UHF returns for a bright band signature for stratiform precipitation. Regions associated with convective rainfall have been defined by identifying regions of enhanced range corrected signal to noise ratio that do not display a bright band structure and that are relatively uniform until a region above the melting layer.

    This study uses a total of 68 days, which incorporated significant periods of surface rainfall, between 31 August 2000 and 28 February 2002 inclusive from Aberystwyth (52.4° N, 4.1° W. Examination suggests that both precipitation types produce similar magnitude reductions in VHF signal power on average. However, the frequency of occurrence of statistically significant reductions in VHF signal power are very different. In the altitude range 2-4 km stratiform precipitation is related to VHF signal suppression approximately 50% of the time while in convective precipitation suppression is observed only 27% of the time. This statistical result suggests that evaporation, which occurs more often in stratiform precipitation, is important in reducing the small-scale irregularities in humidity and thereby the radio refractive index. A detailed case study presented also suggests that evaporation reducing small-scale irregularities in humidity may contribute to the observed VHF signal

  5. VHF signal power suppression in stratiform and convective precipitation

    Directory of Open Access Journals (Sweden)

    A. J. McDonald

    2006-03-01

    Full Text Available Previous studies have indicated that VHF clear-air radar return strengths are reduced during periods of precipitation. This study aims to examine whether the type of precipitation, stratiform and convective precipitation types are identified, has any impact on the relationships previously observed and to examine the possible mechanisms which produce this phenomenon. This study uses a combination of UHF and VHF wind-profiler data to define periods associated with stratiform and convective precipitation. This identification is achieved using an algorithm which examines the range squared corrected signal to noise ratio of the UHF returns for a bright band signature for stratiform precipitation. Regions associated with convective rainfall have been defined by identifying regions of enhanced range corrected signal to noise ratio that do not display a bright band structure and that are relatively uniform until a region above the melting layer. This study uses a total of 68 days, which incorporated significant periods of surface rainfall, between 31 August 2000 and 28 February 2002 inclusive from Aberystwyth (52.4° N, 4.1° W. Examination suggests that both precipitation types produce similar magnitude reductions in VHF signal power on average. However, the frequency of occurrence of statistically significant reductions in VHF signal power are very different. In the altitude range 2-4 km stratiform precipitation is related to VHF signal suppression approximately 50% of the time while in convective precipitation suppression is observed only 27% of the time. This statistical result suggests that evaporation, which occurs more often in stratiform precipitation, is important in reducing the small-scale irregularities in humidity and thereby the radio refractive index. A detailed case study presented also suggests that evaporation reducing small-scale irregularities in humidity may contribute to the observed VHF signal suppression.

  6. Microscopie "CARS" (Coherent anti-Stokes Raman scattering). Génération du signal au voisinage d'interfaces et à l'intérieur d'une cavité Fabry-Perot.

    OpenAIRE

    Gachet, D

    2007-01-01

    Coherent anti-Stokes Raman scattering (``CARS'') is a spectroscopic technique that gives access to intra-molecular vibrational information. It was first proposed as a contrast mechanism in microscopy in 1982, and was implemented under a convenient colinear configuration in 1999. Since then, the signal generation in CARS microscopy has been studied in the litterature on some simple configurations. In this PhD dissertation, we extend the CARS signal generation study in isotropic media using a f...

  7. Crystal structure of monoclinic samarium and cubic europium sesquioxides and bound coherent neutron scattering lengths of the isotopes {sup 154}Sm and {sup 153}Eu

    Energy Technology Data Exchange (ETDEWEB)

    Kohlmann, Holger [Leipzig Univ. (Germany). Inst. of Inorganic Chemistry; Hein, Christina; Kautenburger, Ralf [Saarland Univ., Saarbruecken (Germany). Inorganic Solid State Chemistry; Hansen, Thomas C.; Ritter, Clemens [Institut Laue-Langevin, Grenoble (France); Doyle, Stephen [Karlsruhe Institute of Technology, Eggenstein-Leopoldshafen (Germany). Inst. for Synchrotron Radiation (ISS)

    2016-11-01

    The crystal structures of monoclinic samarium and cubic europium sesquioxide, Sm{sub 2}O{sub 3} and Eu{sub 2}O{sub 3}, were reinvestigated by powder diffraction methods (laboratory X-ray, synchrotron, neutron). Rietveld analysis yields more precise structural parameters than previously known, especially for oxygen atoms. Interatomic distances d(Sm-O) in Sm{sub 2}O{sub 3} range from 226.3(4) to 275.9(2) pm [average 241.6(3) pm] for the monoclinic B type Sm{sub 2}O{sub 3} [space group C2/m, a = 1418.04(3) pm, b = 362.660(7) pm, c = 885.48(2) pm, β = 100.028(1) ], d(Eu-O) in Eu{sub 2}O{sub 3} from 229.9(2) to 238.8(2) pm for the cubic bixbyite (C) type [space group Ia anti 3, a = 1086.87(1) pm]. Neutron diffraction at 50 K and 2 K did not show any sign for magnetic ordering in Sm{sub 2}O{sub 3}. Isotopically enriched {sup 154}Sm{sub 2}O{sub 3} and {sup 153}Eu{sub 2}O{sub 3} were used for the neutron diffraction work because of the enormous absorption cross section of the natural isotopic mixtures for thermal neutrons. The isotopic purity was determined by inductively coupled plasma - mass spectrometry to be 98.9% for {sup 154}Sm and 99.8% for {sup 153}Eu. Advanced analysis of the neutron diffraction data suggest that the bound coherent scattering lengths of {sup 154}Sm and {sup 153}Eu need to be revised. We tentatively propose b{sub c}({sup 154}Sm) = 8.97(6) fm and b{sub c}({sup 153}Eu) = 8.85(3) fm for a neutron wavelength of 186.6 pm to be better values for these isotopes, showing up to 8% deviation from accepted literature values. It is shown that inaccurate scattering lengths may result in severe problems in crystal structure refinements causing erroneous structural details such as occupation parameters, which might be critically linked to physical properties like superconductivity in multinary oxides.

  8. In vivo single human sweat gland activity monitoring using coherent anti-Stokes Raman scattering and two-photon excited autofluorescence microscopy.

    Science.gov (United States)

    Chen, X; Gasecka, P; Formanek, F; Galey, J-B; Rigneault, H

    2016-04-01

    Eccrine sweat secretion is of central importance for control of body temperature. Although the incidence of sweat gland dysfunction might appear of minor importance, it can be a real concern for people with either hypohidrosis or hyperhidrosis. However, sweat gland function remains relatively poorly explored. To investigate the function of single human sweat glands. We describe a new approach for noninvasive imaging of single sweat gland activity in human palms in vivo up to a depth of 100 μm, based on nonlinear two-photon excited autofluorescence (TPEF) and coherent anti-Stokes Raman scattering (CARS). These techniques appear to be useful compared with approaches already described for imaging single sweat gland activity, as they allow better three-dimensional spatial resolution of sweat pore inner morphology and real-time monitoring of individual sweat events. By filling the sweat pore with oil and tuning the CARS contrast at 2845 cm(-1) , we imaged the ejection of sweat droplets from a single sweat gland when oil is pushed out by sweat flow. On average, sweat events lasted for about 30 s every 3 min under the conditions studied. On the other hand, about 20% of sweat glands were found inactive. TPEF and CARS were also used to study, at the single pore level, the antiperspirant action of aluminium chlorohydrate (ACH) and to reveal, for the first time in vivo, the formation of a plug at the pore entrance, in agreement with reported ACH antiperspirant mechanisms. Although data were acquired on human palms, these techniques show great promise for a better understanding of sweat secretion physiology and should be helpful to improve the efficacy of antiperspirant formulations. © 2015 British Association of Dermatologists.

  9. Coherent anti-Stokes Raman scattering (CARS) spectroscopy in Caenorhabditis elegans and Globodera pallida: evidence for an ivermectin-activated decrease in lipid stores.

    Science.gov (United States)

    Smus, Justyna P; Ludlow, Elizabeth; Dallière, Nicolas; Luedtke, Sarah; Monfort, Tual; Lilley, Catherine; Urwin, Peter; Walker, Robert J; O'Connor, Vincent; Holden-Dye, Lindy; Mahajan, Sumeet

    2017-12-01

    Macrocyclic lactones are arguably the most successful chemical class with efficacy against parasitic nematodes. Here we investigated the effect of the macrocyclic lactone ivermectin on lipid homeostasis in the plant parasitic nematode Globodera pallida and provide new insight into its mode of action. A non-invasive, non-destructive, label-free and chemically selective technique called Coherent anti-Stokes Raman scattering (CARS) spectroscopy was used to study lipid stores in G. pallida. We optimised the protocol using the free-living nematode Caenorhabditis elegans and then used CARS to quantify lipid stores in the pre-parasitic, non-feeding J2 stage of G. pallida. This revealed a concentration of lipid stores in the posterior region of J2 s within 24 h of hatching which decreased to undetectable levels over the course of 28 days. We tested the effect of ivermectin on J2 viability and lipid stores. Within 24 h, ivermectin paralysed J2 s. Counterintuitively, over the same time-course ivermectin increased the rate of depletion of J2 lipid, suggesting that in ivermectin-treated J2 s there is a disconnection between the energy requirements for motility and metabolic rate. This decrease in lipid stores would be predicted to negatively impact on J2 infective potential. These data suggest that the benefit of macrocyclic lactones as seed treatments may be underpinned by a multilevel effect involving both neuromuscular inhibition and acceleration of lipid metabolism. © 2017 The Authors. Pest Management Science published by John Wiley & Sons Ltd on behalf of Society of Chemical Industry. © 2017 The Authors. Pest Management Science published by John Wiley & Sons Ltd on behalf of Society of Chemical Industry.

  10. From VHF to UHF CMOS-MEMS Monolithically Integrated Resonators

    DEFF Research Database (Denmark)

    Teva, Jordi; Berini, Abadal Gabriel; Uranga, A.

    2008-01-01

    This paper presents the design, fabrication and characterization of microresonators exhibiting resonance frequencies in the VHF and UHF bands, fabricated using the available layers of the standard and commercial CMOS technology, AMS-0.35mum. The resonators are released in a post-CMOS process cons...

  11. In-Situ Coherent Grazing Incidence Small Angle X-ray Scattering (Co-GISAXS) Studies of Surface Fluctuations of Sputter Deposited WSi2 using X-ray Photon Correlation Spectroscopy (XPCS)

    Science.gov (United States)

    Dahal, Som; Ulbrandt, Jeffrey; Headrick, Randall; Demasi, Alexander; Ludwig, Karl

    2014-03-01

    We performed Coherent Grazing Incidence Small Angle X-ray Scattering (Co-GISAXS) studies of surface dynamics during magnetron sputtering deposited WSi2 amorphous thin films. The local dynamics of surface fluctuations was studied by X-ray Photon Correlation Spectroscopy (XPCS) in the late time regime where the static GIXAXS stops evolving. Our studies reveal that the correlation time of the sputtered species varies as a power law with the in-plane momentum transfer. The experimentally obtained results are compared with predictions from continuum models of surface growth.

  12. Radar efficiency and the calculation of decade-long PMSE backscatter cross-section for the Resolute Bay VHF radar

    Directory of Open Access Journals (Sweden)

    N. Swarnalingam

    2009-04-01

    Full Text Available The Resolute Bay VHF radar, located in Nunavut, Canada (75.0° N, 95.0° W and operating at 51.5 MHz, has been used to investigate Polar Mesosphere Summer Echoes (PMSE since 1997. PMSE are a unique form of strong coherent radar echoes, and their understanding has been a challenge to the scientific community since their discovery more than three decades ago. While other high latitude radars have recorded strong levels of PMSE activities, the Resolute Bay radar has observed relatively lower levels of PMSE strengths. In order to derive absolute measurements of PMSE strength at this site, a technique is developed to determine the radar efficiency using cosmic (sky noise variations along with the help of a calibrated noise source. VHF radars are only rarely calibrated, but determination of efficiency is even less common. Here we emphasize the importance of efficiency for determination of cross-section measurements. The significant advantage of this method is that it can be directly applied to any MST radar system anywhere in the world as long as the sky noise variations are known. The radar efficiencies for two on-site radars at Resolute Bay are determined. PMSE backscatter cross-section is estimated, and decade-long PMSE strength variations at this location are investigated. It was noticed that the median of the backscatter cross-section distribution remains relatively unchanged, but over the years a great level of variability occurs in the high power tail of the distribution.

  13. Accessible coherence and coherence distribution

    Science.gov (United States)

    Ma, Teng; Zhao, Ming-Jing; Zhang, Hai-Jun; Fei, Shao-Ming; Long, Gui-Lu

    2017-04-01

    The definition of accessible coherence is proposed. Through local measurement on the other subsystem and one-way classical communication, a subsystem can access more coherence than the coherence of its density matrix. Based on the local accessible coherence, the part that cannot be locally accessed is also studied, which we call it remaining coherence. We study how the bipartite coherence is distributed by partition for both l1 norm coherence and relative entropy coherence, and the expressions for local accessible coherence and remaining coherence are derived. We also study some examples to illustrate the distribution.

  14. Optical Coherence and Quantum Optics

    CERN Document Server

    Mandel, Leonard

    1995-01-01

    This book presents a systematic account of optical coherence theory within the framework of classical optics, as applied to such topics as radiation from sources of different states of coherence, foundations of radiometry, effects of source coherence on the spectra of radiated fields, coherence theory of laser modes, and scattering of partially coherent light by random media. The book starts with a full mathematical introduction to the subject area and each chapter concludes with a set of exercises. The authors are renowned scientists and have made substantial contributions to many of the topi

  15. Meteoroid Fragmentation as Revealed in Head- and Trail-Echoes Observed with the Arecibo UHF and VHF Radars

    Science.gov (United States)

    Mathews, J. D.; Malhorta, A.

    2011-01-01

    We report recent 46.8/430 MHz (VHF/UHF) radar meteor observations at Arecibo Observatory (AO) that reveal many previously unreported features in the radar meteor return - including flare-trails at both UHF and VHF - that are consistent with meteoroid fragmentation. Signature features of fragmentation include strong intra-pulse and pulse-to-pulse fading as the result of interference between or among multiple meteor head-echo returns and between head-echo and impulsive flare or "point" trail-echoes. That strong interference fading occurs implies that these scatterers exhibit well defined phase centers and are thus small compared with the wavelength. These results are consistent with and offer advances beyond a long history of optical and radar meteoroid fragmentation studies. Further, at AO, fragmenting and flare events are found to be a large fraction of the total events even though these meteoroids are likely the smallest observed by the major radars. Fragmentation is found to be a major though not dominate component of the meteors observed at other HPLA radars that are sensitive to larger meteoroids.

  16. Optical Coherence Tomography

    DEFF Research Database (Denmark)

    Andersen, Peter E.

    2015-01-01

    Optical coherence tomography (OCT) is a noninvasive imaging technique that provides real-time two- and three-dimensional images of scattering samples with micrometer resolution. Mapping the local reflectivity, OCT visualizes the morphology of the sample, in real time or at video rate. In addition...

  17. The first operation and results of the Chung-Li VHF radar

    Science.gov (United States)

    Chao, J. K.; Kuo, F. S.; Chu, Y. S.; Fu, I. J.; Rottger, J.; Liu, C. H.

    1986-01-01

    The Chung-Li Very High Frequency (VHF) radar is used in the dual-mode operations, applying Doppler beam-swinging as well as the spaced-antenna-drift method. The design of the VHF radar is examined. Results of performance tests are discussed.

  18. Very Compact and Broadband Active Antenna for VHF Band Applications

    Directory of Open Access Journals (Sweden)

    Y. Taachouche

    2012-01-01

    Full Text Available An active receiving antenna with small size consisting of a monopole loaded with a transistor bipolar is presented in this paper. A transistor is used in order to miniaturize the receiving active antenna size in VHF band. The vertical size of the structure is equal to λ/175, where λ is the wavelength at the lower frequency of the bandwidth. Despite the very small size of the antenna, the frequency bandwidth is very wide and the gain is suitable for FM application with sensitive receivers.

  19. Optical Coherence Tomography

    DEFF Research Database (Denmark)

    Fercher, A.F.; Andersen, Peter E.

    2017-01-01

    Optical coherence tomography (OCT) is a technique that is used to peer inside a body noninvasively. Tissue structure defined by tissue absorption and scattering coefficients, and the speed of blood flow, are derived from the characteristics of light remitted by the body. Singly backscattered light...... detected by partial coherence interferometry (PCI) is used to synthesize the tomographic image coded in false colors. A prerequisite of this technique is a low time-coherent but high space-coherent light source, for example, a superluminescent diode or a supercontinuum source. Alternatively, the imaging...... technique can be realized by using ultrafast wavelength scanning light sources. For tissue imaging, the light source wavelengths are restricted to the red and near-infrared (NIR) region from about 600 to 1300 nm, the so-called therapeutic window, where absorption (μa ≈ 0.01 mm−1) is small enough. Transverse...

  20. Enhanced incoherent scatter plasma lines

    Directory of Open Access Journals (Sweden)

    H. Nilsson

    Full Text Available Detailed model calculations of auroral secondary and photoelectron distributions for varying conditions have been used to calculate the theoretical enhancement of incoherent scatter plasma lines. These calculations are compared with EISCAT UHF radar measurements of enhanced plasma lines from both the E and F regions, and published EISCAT VHF radar measurements. The agreement between the calculated and observed plasma line enhancements is good. The enhancement from the superthermal distribution can explain even the very strong enhancements observed in the auroral E region during aurora, as previously shown by Kirkwood et al. The model calculations are used to predict the range of conditions when enhanced plasma lines will be seen with the existing high-latitude incoherent scatter radars, including the new EISCAT Svalbard radar. It is found that the detailed structure, i.e. the gradients in the suprathermal distribution, are most important for the plasma line enhancement. The level of superthermal flux affects the enhancement only in the region of low phase energy where the number of thermal electrons is comparable to the number of suprathermal electrons and in the region of high phase energy where the suprathermal fluxes fall to such low levels that their effect becomes small compared to the collision term. To facilitate the use of the predictions for the different radars, the expected signal- to-noise ratios (SNRs for typical plasma line enhancements have been calculated. It is found that the high-frequency radars (Søndre Strømfjord, EISCAT UHF should observe the highest SNR, but only for rather high plasma frequencies. The VHF radars (EISCAT VHF and Svalbard will detect enhanced plasma lines over a wider range of frequencies, but with lower SNR.

  1. Long-period unstable gravity-waves and associated VHF radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    Full Text Available VHF atmospheric radar is used to measure the wind velocity and radar echo power related to long-period wind perturbations, including gravity waves, which are observed commonly in the lower stratosphere and tropopause region, and sometimes in the troposphere. These wind structures have been identified previously as either inertia-gravity waves, often associated with jet streams, or mountain waves. At heights of peak wind shear, imbalances are found between the echo powers of a symmetric pair of radar beams, which are expected to be equal. The largest of these power differences are found for conditions of simultaneous high wind shear and high aspect sensitivity. It is suggested that the effect might arise from tilted specular reflectors or anisotropic turbulent scatterers, a result of, for example, Kelvin-Helmholtz instabilities generated by the strong wind shears. This radar power-difference effect could offer information about the onset of saturation in long-period waves, and the formation of thin layers of turbulence.

  2. Range imaging observations of PMSE using the EISCAT VHF radar: Phase calibration and first results

    Directory of Open Access Journals (Sweden)

    J. R. Fernandez

    2005-01-01

    Full Text Available A novel phase calibration technique for use with the multiple-frequency Range IMaging (RIM technique is introduced based on genetic algorithms. The method is used on data collected with the European Incoherent SCATter (EISCAT VHF radar during a 2002 experiment with the goal of characterizing the vertical structure of Polar Mesosphere Summer Echoes (PMSE over northern Norway. For typical Doppler measurements, the initial phases of the transmitter and receiver are not required to be the same. The EISCAT receiver systems exploit this fact, allowing a multi-static configuration. However, the RIM method relies on the small phase differences between closely spaced frequencies. As a result, the high-resolution images produced by the RIM method can be significantly degraded if not properly calibrated. Using an enhanced numerical radar simulator, in which data from multiple sampling volumes are simultaneously generated, the proposed calibration method is validated. Subsequently, the method is applied to preliminary data from the EISCAT radar, providing first results of RIM images of PMSE. Data using conventional analysis techniques, and confirmed by RIM, reveal an often-observed double-layer structure with higher stability in the lower layer. Moreover, vertical velocity oscillations exhibit a clear correlation with the apparent motion of the layers shown in the echo power plots.

  3. Neutron Scattering from 36Ar and 4He Films

    DEFF Research Database (Denmark)

    Carneiro, K.

    1977-01-01

    Scale factors for neutron diffraction and neutron inelastic scattering are presented for common adsorbates, and the feasibility of experiments is discussed together with the information gained by each type of experiment. Diffraction, coherent inelastic scattering, and incoherent scattering are tr...

  4. An ambiguity-function-based method for analysis of Doppler decompressed radar signals applied to EISCAT measurements of oblique UHF-VHF meteor echoes

    Science.gov (United States)

    Wannberg, G.; Pellinen-Wannberg, A.; Westman, A.

    1996-05-01

    Binary phase modulation using Barker codes as the modulating sequences is often used as a pulse compression technique in incoherent scatter radar measurements of the ionospheric E region. Demodulation of the compressed signal is usually accomplished by matched filtering techniques. If the target has appreciable velocity, the resulting Doppler shift detunes the scattered signal relative to the filter, and the target response spreads over a large range interval. The paper describes the development of a new data analysis method, based on an ambiguity function description of radar total-power measurements, which uses the characteristic Doppler decompression signatures to identify, extract, and analyze high-velocity events from conventional Barker-coded power profile type incoherent scatter (IS) measurements. Data sets recorded with the European Incoherent Scatter UHF (931 MHz) and VHF (224 MHz) radars during the 1990-1991 Geminid and 1993 Perseid showers are shown to contain many events which are associated with individual meteors crossing the radar beams over a wide range of aspect angles, including a few near-radial cases. Line-of-sight velocities and effective cross sections are derived for some of the best dual radar events. The cross sections are very small and increase with decreasing wavelength, something not observed before. It is suggested that this is indicative of a scattering mechanism different from the one operating at near-normal incidence at VHF, and Rayleigh scatter from compact "balls" of plasma contained within the meteor coma is proposed as a possible candidate, in qualitative agreement with the observations. Finally, some signal-processing related aspects of the method are discussed. It is shown that most IS radars should be able to apply it to their existing programs with very little effort and without having to compromise the performance in normal E region applications. The method could therefore become a powerful tool for studies of meteor

  5. Path-length-resolved measurements of multiple scattered photons in static and dynamic turbid media using phase-modulated low-coherence interferometry.

    Science.gov (United States)

    Varghese, Babu; Rajan, Vinayakrishnan; Van Leeuwen, Ton G; Steenbergen, Wiendelt

    2007-01-01

    In optical Doppler measurements, the path length of the light is unknown. To facilitate quantitative measurements, we develop a phase-modulated Mach-Zehnder interferometer with separate fibers for illumination and detection. With this setup, path-length-resolved dynamic light scattering measurements of multiple scattered light in static and dynamic turbid media are performed. Optical path length distributions spanning a range from 0 to 11 mm are measured from the area under the phase modulation peak around the modulation frequency in the power spectrum. A Doppler-broadened phase modulation interference peak is observed that shows an increase in the average Doppler shift with optical path length, independent of absorption. Validation of the estimated path length distributions is done by measuring their deformation for increasing absorption and comparing these observations with predictions based on Lambert-Beer's law.

  6. Coherence optimization and its limitations for deformation monitoring in dynamic agricultural environments

    CSIR Research Space (South Africa)

    Eng, Jeanine

    2016-12-01

    Full Text Available scattering mechanism (MSM) approach. For C-band RADARSAT-2 data, coherence optimization resulted in a statistically significant increase in interferometric coherence. However, the spatial heterogeneity of the scattering process and how it changes over time...

  7. Aspect sensitivity measurements of polar mesosphere summer echoes using coherent radar imaging

    Directory of Open Access Journals (Sweden)

    P. B. Chilson

    Full Text Available The Esrange VHF radar (ESRAD, located in northern Sweden (67.88° N, 21.10° E, has been used to investigate polar mesosphere summer echoes (PMSE. During July and August of 1998, coherent radar imaging (CRI was used to study the dynamic evolution of PMSE with high temporal and spatial resolution. A CRI analysis provides an estimate of the angular brightness distribution within the radar’s probing volume. The brightness distribution is directly related to the radar reflectivity. Consequently, these data are used to investigate the aspect sensitivity of PMSE. In addition to the CRI analysis, the full correlation analysis (FCA is used to derive estimates of the prevailing three-dimensional wind associated with the observed PMSE. It is shown that regions within the PMSE with enhanced aspect sensitivity have a correspondingly high signal-to-noise ratio (SNR. Although this relationship has been investigated in the past, the present study allows for an estimation of the aspect sensitivity independent of the assumed scattering models and avoids the complications of comparing echo strengths from vertical and off-vertical beams over large horizontal separations, as in the Doppler Beam Swinging (DBS method. Regions of enhanced aspect sensitivity were additionally shown to correlate with the wave-perturbation induced downward motions of air parcels embedded in the PMSE.

    Key words. Ionosphere (polar ionosphere Meteorology and Atmospheric Dynamics (middle atmosphere dynamics Radio Science (Interferometry

  8. Aspect sensitivity measurements of polar mesosphere summer echoes using coherent radar imaging

    Directory of Open Access Journals (Sweden)

    P. B. Chilson

    2002-02-01

    Full Text Available The Esrange VHF radar (ESRAD, located in northern Sweden (67.88° N, 21.10° E, has been used to investigate polar mesosphere summer echoes (PMSE. During July and August of 1998, coherent radar imaging (CRI was used to study the dynamic evolution of PMSE with high temporal and spatial resolution. A CRI analysis provides an estimate of the angular brightness distribution within the radar’s probing volume. The brightness distribution is directly related to the radar reflectivity. Consequently, these data are used to investigate the aspect sensitivity of PMSE. In addition to the CRI analysis, the full correlation analysis (FCA is used to derive estimates of the prevailing three-dimensional wind associated with the observed PMSE. It is shown that regions within the PMSE with enhanced aspect sensitivity have a correspondingly high signal-to-noise ratio (SNR. Although this relationship has been investigated in the past, the present study allows for an estimation of the aspect sensitivity independent of the assumed scattering models and avoids the complications of comparing echo strengths from vertical and off-vertical beams over large horizontal separations, as in the Doppler Beam Swinging (DBS method. Regions of enhanced aspect sensitivity were additionally shown to correlate with the wave-perturbation induced downward motions of air parcels embedded in the PMSE.Key words. Ionosphere (polar ionosphere Meteorology and Atmospheric Dynamics (middle atmosphere dynamics Radio Science (Interferometry

  9. Miniaturization for ultrathin metamaterial perfect absorber in the VHF band

    Science.gov (United States)

    Khuyen, Bui Xuan; Tung, Bui Son; Yoo, Young Joon; Kim, Young Ju; Kim, Ki Won; Chen, Liang-Yao; Lam, Vu Dinh; Lee, Youngpak

    2017-03-01

    An efficient resolution for ultrathin metamaterial perfect absorber (MPA) is proposed and demonstrated in the VHF radio band (30-300 MHz). By adjusting the lumped capacitors and the through vertical interconnects, the absorber is miniaturized to be only λ/816 and λ/84 for its thickness and periodicity with respect to the operating wavelength (at 102 MHz), respectively. The detailed simulation and calculation show that the MPA can maintain an absorption rate over 90% in a certain range of incident angle and with a wide variation of capacitance. Additionally, we utilized the advantages of the initial single-band structure to realize a nearly perfect dual-band absorber in the same range. The results were confirmed by both simulation and experiment at oblique incidence angles up to 50°. Our work is expected to contribute to the actualization of future metamaterial-based devices working at radio frequency.

  10. Extraction of forest stand parameters from CARABAS VHF SAR images

    Energy Technology Data Exchange (ETDEWEB)

    Walter, Fredrik [Swedish Univ. of Agricultural Sciences, Uppsala (Sweden). Centre for Image Analysis

    1999-10-01

    Methods for extracting stand-wise forest parameters from CARABAS VHF SAR images have been developed and evaluated. CARABAS is a unique airborne synthetic aperture radar (SAR), developed by the Swedish Defence Research Establishment. It differs a lot from ordinary microwave radars by using wavelengths between 3.3 and 15 m, making the image intensity highly correlated to stem volume. Furthermore, by providing its own illumination source, the sensor operates independently of daylight and weather conditions. Empirical regression models have been developed for relating backscattering amplitude to stem volume, stem diameter, and tree height. To make comparison between CARABAS image data and forest parameters effective, a fully automatic geo-coding algorithm was developed. Image texture features have also been investigated. By using the variogram as a discriminating feature, CARABAS images and aerial images were segmented into homogeneous regions. Furthermore, a method for discriminating recently clear felled areas from forested areas, combining information from Almaz-1 SAR images and SPOT panchromatic data has also been developed, serving as a comparison to the main work of this thesis. For forest stands at near-horizontal ground, the results for estimating stem volume, stem diameter, and tree height from CARABAS image data are very satisfactory. The root mean square errors for the estimates are comparable to subjective ground-based inventories for dense forest stands. The methods and algorithms described in this thesis have been developed towards an operational remote sensing tool. Altogether, significant potential for mapping of forest characteristics exists using the CARABAS VHF SAR sensor 57 refs, 14 figs, 7 tabs

  11. Optical coherence refractometry.

    Science.gov (United States)

    Tomlins, Peter H; Woolliams, Peter; Hart, Christian; Beaumont, Andrew; Tedaldi, Matthew

    2008-10-01

    We introduce a novel approach to refractometry using a low coherence interferometer at multiple angles of incidence. We show that for plane parallel samples it is possible to measure their phase refractive index rather than the group index that is usually measured by interferometric methods. This is a significant development because it enables bulk refractive index measurement of scattering and soft samples, not relying on surface measurements that can be prone to error. Our technique is also noncontact and compatible with in situ refractive index measurements. Here, we demonstrate this new technique on a pure silica test piece and a highly scattering resin slab, comparing the results with standard critical angle refractometry.

  12. Rocket and radar investigation of background electrodynamics and bottom-type scattering layers at the onset of equatorial spread F

    Directory of Open Access Journals (Sweden)

    D. L. Hysell

    2006-07-01

    Full Text Available Sounding rocket experiments were conducted during the NASA EQUIS II campaign on Kwajalein Atoll designed to elucidate the electrodynamics and layer structure of the postsunset equatorial F region ionosphere prior to the onset of equatorial spread F (ESF. Experiments took place on 7 and 15 August 2004, each comprised of the launch of an instrumented and two chemical release sounding rockets. The instrumented rockets measured plasma number density, vector electric fields, and other parameters to an apogee of about 450 km. The chemical release rockets deployed trails of trimethyl aluminum (TMA which yielded wind profile measurements. The Altair radar was used to monitor coherent and incoherent scatter in UHF and VHF bands. Electron density profiles were also measured with rocket beacons and an ionosonde. Strong plasma shear flow was evident in both experiments. Bottom-type scattering layers were observed mainly in the valley region, below the shear nodes, in westward-drifting plasma strata. The layers were likely produced by wind-driven interchange instabilities as proposed by Kudeki and Bhattacharyya (1999. In both experiments, the layers were patchy and distributed periodically in space. Their horizontal structure was similar to that of the large-scale plasma depletions that formed later at higher altitude during ESF conditions. We argue that the bottom-type layers were modulated by the same large-scale waves that seeded the ESF. A scenario where the large-scale waves were themselves produced by collisional shear instabilities is described.

  13. Reflection, phase and en- face sectional imaging of scattering objects using quasi-single-shot wide-field optical coherence tomography

    Science.gov (United States)

    Anna, Tulsi; Kimura, Satoshi; Mehta, Dalip Singh; Sato, Manabu

    2015-10-01

    We report a quasi-single-shot wide-field optical coherence tomography system that enables to measure the reflection, phase and en- face OCT images from the same setup using the glass jig. The jig consisting of a wedge glass substrate and a glue dot is contacted to the tissue surfaces, and the data within glue dot is used to reduce the phase noise of the interference signal. The reconstructed image size of the object was 4.0 mm × 4.3 mm. The standard deviation (STD) of the phase variation was minimized by 54 % and obtained to be 0.027 rad for the poke tissue. The corresponding STD in optical path length change was measured to be 1.4 nm. The refractive index of the water and poke tissue at the surface is also evaluated as 1.36 and 1.39, respectively, using reflection intensity images. Further, the en- face sectional images of the tissue sample are also measured.

  14. A new SERS: scattering enhanced Raman scattering

    Science.gov (United States)

    Bixler, Joel N.; Yakovlev, Vladislav V.

    2014-03-01

    Raman spectroscopy is a powerful technique that can be used to obtain detailed chemical information about a system without the need for chemical markers. It has been widely used for a variety of applications such as cancer diagnosis and material characterization. However, Raman scattering is a highly inefficient process, where only one in 1011 scattered photons carry the needed information. Several methods have been developed to enhance this inherently weak effect, including surface enhanced Raman scattering and coherent anti-Stokes Raman scattering. These techniques suffer from drawbacks limiting their commercial use, such as the need for spatial localization of target molecules to a `hot spot', or the need for complex laser systems. Here, we present a simple instrument to enhance spontaneous Raman scattering using elastic light scattering. Elastic scattering is used to substantially increase the interaction volume. Provided that the scattering medium exhibits very low absorption in the spectral range of interest, a large enhancement factor can be attained in a simple and inexpensive setting. In our experiments, we demonstrate an enhancement of 107 in Raman signal intensity. The proposed novel device is equally applicable for analyzing solids, liquids, and gases.

  15. The relationship between VHF radar auroral backscatter amplitude and Doppler velocity: a statistical study

    Directory of Open Access Journals (Sweden)

    B. A. Shand

    1996-08-01

    Full Text Available A statistical investigation of the relationship between VHF radar auroral backscatter intensity and Doppler velocity has been undertaken with data collected from 8 years operation of the Wick site of the Sweden And Britain Radar-auroral Experiment (SABRE. The results indicate three different regimes within the statistical data set; firstly, for Doppler velocities <200 m s–1, the backscatter intensity (measured in decibels remains relatively constant. Secondly, a linear relationship is observed between the backscatter intensity (in decibels and Doppler velocity for velocities between 200 m s–1 and 700 m s–1. At velocities greater than 700 m s–1 the backscatter intensity saturates at a maximum value as the Doppler velocity increases. There are three possible geophysical mechanisms for the saturation in the backscatter intensity at high phase speeds: a saturation in the irregularity turbulence level, a maximisation of the scattering volume, and a modification of the local ambient electron density. There is also a difference in the dependence of the backscatter intensity on Doppler velocity for the flow towards and away from the radar. The results for flow towards the radar exhibit a consistent relationship between backscatter intensity and measured velocities throughout the solar cycle. For flow away from the radar, however, the relationship between backscatter intensity and Doppler velocity varies during the solar cycle. The geometry of the SABRE system ensures that flow towards the radar is predominantly associated with the eastward electrojet, and flow away is associated with the westward electrojet. The difference in the backscatter intensity variation as a function of Doppler velocity is attributed to asymmetries between the eastward and westward electrojets and the geophysical parameters controlling the backscatter amplitude.

  16. The relationship between VHF radar auroral backscatter amplitude and Doppler velocity: a statistical study

    Directory of Open Access Journals (Sweden)

    B. A. Shand

    Full Text Available A statistical investigation of the relationship between VHF radar auroral backscatter intensity and Doppler velocity has been undertaken with data collected from 8 years operation of the Wick site of the Sweden And Britain Radar-auroral Experiment (SABRE. The results indicate three different regimes within the statistical data set; firstly, for Doppler velocities <200 m s–1, the backscatter intensity (measured in decibels remains relatively constant. Secondly, a linear relationship is observed between the backscatter intensity (in decibels and Doppler velocity for velocities between 200 m s–1 and 700 m s–1. At velocities greater than 700 m s–1 the backscatter intensity saturates at a maximum value as the Doppler velocity increases. There are three possible geophysical mechanisms for the saturation in the backscatter intensity at high phase speeds: a saturation in the irregularity turbulence level, a maximisation of the scattering volume, and a modification of the local ambient electron density. There is also a difference in the dependence of the backscatter intensity on Doppler velocity for the flow towards and away from the radar. The results for flow towards the radar exhibit a consistent relationship between backscatter intensity and measured velocities throughout the solar cycle. For flow away from the radar, however, the relationship between backscatter intensity and Doppler velocity varies during the solar cycle. The geometry of the SABRE system ensures that flow towards the radar is predominantly associated with the eastward electrojet, and flow away is associated with the westward electrojet. The difference in the backscatter intensity variation as a function of Doppler velocity is attributed to asymmetries between the eastward and westward electrojets and the geophysical parameters controlling the backscatter amplitude.

  17. Characteristics of coherent forward scattering spectrometry in Faraday configuration measured with a diode laser on the 842.5 nm Ar I and 844.6 nm O I lines

    Science.gov (United States)

    Matsuta, Hideyuki

    2016-11-01

    In this study, a coherent forward scattering (CFS) spectrometer with permanent magnets in the Faraday configuration was developed. Neodymium ring magnets (Nd-Fe-B) were used to apply an external magnetic field to a radio frequency (RF) glow discharge. The effect of using a single or double magnet configuration on the transmitted CFS intensity was investigated. The resulting analytical curve of the CFS signal intensity on the Ar I 842.46 nm line rises with the 3.34 ± 0.17-th power of the argon partial pressure, which is larger than the theoretically expected quadratic slope. In addition, an 844.6 nm atomic oxygen line (33P-33S) is investigated as an example of a weak absorption transition from the short-lived lower level (lifetime = 1.74 ns). Despite the population inversion and the short-lived lower level, the absorption transition of O I 844.6 nm could be detected, and analytical curves in noble gas-O2 RF glow discharges were recorded successfully. The CFS signal intensities rose with the 1.65 ± 0.24-th power of the partial pressure of O2 in neon, with the 1.95 ± 0.05-th power in argon, and with the 2.15 ± 0.23-th power in helium. The estimated values are close to the theoretically expected quadratic dependence.

  18. Letter to the Editor: Complete maps of the aspect sensitivity of VHF atmospheric radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    1999-08-01

    Full Text Available Using the MU radar at Shigaraki, Japan (34.85°N, 136.10°E, we measure the power distribution pattern of VHF radar echoes from the mid-troposphere. The large number of radar beam-pointing directions (320 allows the mapping of echo power from 0° to 40° from zenith, and also the dependence on azimuth, which has not been achieved before at VHF wavelengths. The results show how vertical shear of the horizontal wind is associated with a definite skewing of the VHF echo power distribution, for beam angles as far as 30° or more from zenith, so that aspect sensitivity cannot be assumed negligible at any beam-pointing angle that most existing VHF radars are able to use. Consequently, the use of VHF echo power to calculate intensity of atmospheric turbulence, which assumes only isotropic backscatter at large beam zenith angles, will sometimes not be valid.Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; turbulence; instruments and techniques

  19. Design and Development of VHF Antennas for Space Borne Signal of Opportunity Receivers for Cubesat Platforms

    Science.gov (United States)

    Deshpande, Manohar; Piepmeier, Jeffrey

    2015-01-01

    Design and Development of VHF Antennas for Space Borne Signal of Opportunity Receivers for Cubesat Platforms. Space borne microwave remote sensors at VHF/UHF frequencies are important instruments to observe reflective properties of land surfaces through thick and heavy forestation on a global scale. One of the most cost effective ways of measuring land reflectivity at VHF/UHF frequencies is to use signals transmitted by existing communication satellites (operating at VHF/UHF band) as a signal of opportunity (SoOp) signal and passive receivers integrated with airborne/space borne platforms operating in the Low Earth Orbit (LEO). One of the critical components of the passive receiver is two antennas (one to receive only direct signal and other to receive only reflected signal) which need to have ideally high (>30dB) isolation. However, because of small size of host platforms and broad beam width of dipole antennas, achieving adequate isolation between two channels is a challenging problem and need to be solved for successful implementation of space borne SoOp technology for remote sensing. In this presentation a novel enabling VHF antenna technology for Cubesat platforms is presented to receive direct as well as reflected signal with needed isolation. The novel scheme also allows enhancing the gain of individual channels by factor of 2 without use of reflecting ground plane

  20. Scattering theory of stochastic electromagnetic light waves.

    Science.gov (United States)

    Wang, Tao; Zhao, Daomu

    2010-07-15

    We generalize scattering theory to stochastic electromagnetic light waves. It is shown that when a stochastic electromagnetic light wave is scattered from a medium, the properties of the scattered field can be characterized by a 3 x 3 cross-spectral density matrix. An example of scattering of a spatially coherent electromagnetic light wave from a deterministic medium is discussed. Some interesting phenomena emerge, including the changes of the spectral degree of coherence and of the spectral degree of polarization of the scattered field.

  1. Quasielastic Neutron Scattering by Superionic Strontium Chloride

    DEFF Research Database (Denmark)

    Dickens, M. H.; Hutchings, M. T.; Kjems, Jørgen

    1978-01-01

    The scattering, from powder and single crystal samples, appears only above the superionic transition temperature, 1000K. The integrated intensity is found to be strongly dependent on the direction and magnitude of the scattering vector, Q, (which suggests the scattering is coherent) but does not ...

  2. Coherent detectors

    Energy Technology Data Exchange (ETDEWEB)

    Lawrence, C R [M/C 169-327, Jet Propulsion Laboratory, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States); Church, S [Room 324 Varian Physics Bldg, 382 Via Pueblo Mall, Stanford, CA 94305-4060 (United States); Gaier, T [M/C 168-314, Jet Propulsion Laboratory, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States); Lai, R [Northrop Grumman Corporation, Redondo Beach, CA 90278 (United States); Ruf, C [1533 Space Research Building, The University of Michigan, Ann Arbor, MI 48109-2143 (United States); Wollack, E, E-mail: charles.lawrence@jpl.nasa.go [NASA/GSFC, Code 665, Observational Cosmology Laboratory, Greenbelt, MD 20771 (United States)

    2009-03-01

    Coherent systems offer significant advantages in simplicity, testability, control of systematics, and cost. Although quantum noise sets the fundamental limit to their performance at high frequencies, recent breakthroughs suggest that near-quantum-limited noise up to 150 or even 200 GHz could be realized within a few years. If the demands of component separation can be met with frequencies below 200 GHz, coherent systems will be strong competitors for a space CMB polarization mission. The rapid development of digital correlator capability now makes space interferometers with many hundreds of elements possible. Given the advantages of coherent interferometers in suppressing systematic effects, such systems deserve serious study.

  3. PENUMBUHAN LAPISAN TIPIS SILIKON MIKROKRISTAL TERHIDROGENASI DENGAN TEKNIK HWC-VHF-PECVD

    Directory of Open Access Journals (Sweden)

    Ida Usman

    2012-02-01

    Full Text Available Telah dikembangkan teknik HWC-VHF-PECVD (Hot Wire Cell Very High Frequency Plasma Enhanced Chemical Vapor Deposition untuk menumbuhkan lapisan tipis silikon mikrokristal terhidrogenasi (mc-Si:H. Dari hasil penumbuhan lapisan tipis yang dilakukan, teknik HWC-VHF-PECVD memperlihatkan laju deposisi yang lebih tinggi dibandingkan laju deposisi lapisan tipis yang diperoleh dari teknik PECVD maupun teknik VHF-PECVD konvensional. Berdasarkan hasil pengukuran XRD dan SEM, lapisan yang diperoleh pada temperatur filamen yang rendah masih berstruktur amorf. Indikasi yang mengarah pada pembentukan lapisan tipis berstruktur mikrokristalin mulai terlihat pada temperatur filamen ≥ 500oC, dimana puncak-puncak di fraksi spektrum XRD untuk orientasi kristalin tertentu mulai terbentu, sejalan dengan pembentukan butiran-butiran kristalin dari hasil foto SEM permukaan lapisan-lapisan tersebut.

  4. Optical Coherence Microscopy

    Science.gov (United States)

    Gelikonov, Grigory V.; Gelikonov, Valentin M.; Ksenofontov, Sergey U.; Morosov, Andrey N.; Myakov, Alexey V.; Potapov, Yury P.; Saposhnikova, Veronika V.; Sergeeva, Ekaterina A.; Shabanov, Dmitry V.; Shakhova, Natalia M.; Zagainova, Elena V.

    This chapter presents the practical embodiment of two types of optical coherence microscope (OCM) modality that differ by probing method. The development and creation of a compact OCM device for imaging internal structures of biological tissue at the cellular level is presented. Ultrahigh axial resolution of 3.4 μm and lateral resolution of 3.9 μm within tissue was attained by combining broadband radiations of two spectrally shifted SLDs and implementing the dynamic focus concept, which allows in-depth scanning of a coherence gate and beam waist synchronously. This OCM prototype is portable and easy to operate; creation of a remote optical probe was feasible due to use of polarization maintaining fiber. The chapter also discusses the results of a theoretical investigation of OCM axial and lateral resolution degradation caused by light scattering in biological tissue. We demonstrate the first OCM images of biological objects using examples of plant and human tissue ex vivo.

  5. VHF radar observation of atmospheric winds, associated shears and C2n at a tropical location: interdependence and seasonal pattern

    Directory of Open Access Journals (Sweden)

    A. R. Jain

    Full Text Available The turbulence refractivity structure constant (C2n is an important parameter of the atmosphere. VHF radars have been used extensively for the measurements of C2n. Presently, most of such observations are from mid and high latitudes and only very limited observations are available for equatorial and tropical latitudes. Indian MST radar is an excellent tool for making high-resolution measurements of atmospheric winds, associated shears and turbulence refractivity structure constant (C2n. This radar is located at Gadanki (13.45° N, 79.18° E, a tropical station in India. The objective of this paper is to bring out the height structure of C2n for different seasons using the long series of data (September 1995 – August 1999 from Indian MST radar. An attempt is also made to understand such changes in the height structure of C2n in relation to background atmospheric parameters such as horizontal winds and associated shears. The height structure of C2n, during the summer monsoon and post-monsoon season, shows specific height features that are found to be related to Tropical Easterly Jet (TEJ winds. It is important to examine the nature of the radar back-scatterers and also to understand the causative mechanism of such scatterers. Aspect sensitivity of the received radar echo is examined for this purpose. It is observed that radar back-scatterers at the upper tropospheric and lower stratospheric heights are more anisotropic, with horizontal correlation length of 10–20 m, as compared to those observed at lower and middle tropospheric heights.Key words. Meteorology and atmospheric dynamics (climatology; tropical meteorology; turbulence

  6. Excitonic Coherence in Semiconductor Nanostructures Measured by Speckle Analysis

    DEFF Research Database (Denmark)

    Langbein, Wolfgang; Hvam, Jørn Märcher

    1999-01-01

    are determined separately, thus distinguishing lifetime from pure dephasing. In particular, the secondary emission of excitons in semiconductor quantum wells is investigated. Here, the combination of static disorder and inelastic scattering leads to a partially coherent emission. The temperature dependence...... is well explained by phonon scattering. Spin-relaxation is found to be dominated by disorder, and is preserving the coherence, while phonon-assisted energy-relaxation is foundto destroy the coherence....

  7. Electromagnetic theory of optical coherence [Invited].

    Science.gov (United States)

    Friberg, Ari T; Setälä, Tero

    2016-12-01

    The coherence theory of random, vector-valued optical fields has been of great research interest in recent years. In this work we formulate the foundations of electromagnetic coherence theory both in the space-time and space-frequency domains, with particular emphasis on various types of optical interferometry. Analyzing statistically stationary, two-component (paraxial) electric fields in the classical and quantum-optical contexts we show fundamental connections between the conventional (polarization) Stokes parameters and the associated two-point (coherence) Stokes parameters. Measurement of the coherence and polarization properties of random vector beams by nanoparticle scattering and two-photon absorption is also addressed.

  8. VHF and L-band scintillation characteristics over an Indian low latitude station, Waltair (17.7° N, 83.3° E

    Directory of Open Access Journals (Sweden)

    P. V. S. Rama Rao

    2005-10-01

    Full Text Available Characteristics of simultaneous VHF (244 MHz and L-band (1.5 GHz scintillations recorded at a low-latitude station, Waltair (17.7° N, 83.3° E, during the low sunspot activity year of March 2004 to March 2005, suggest that the occurrence of scintillations is mainly due to two types, namely the Plasma Bubble Induced (PBI, which maximizes during the post sunset hours of winter and equinoctial months, and the Bottom Side Sinusoidal (BSS type, which maximizes during the post-midnight hours of the summer solstice months. A detailed study on the spectral characteristics of the scintillations at both the frequencies show that the post-sunset scintillations are strong with fast fading (≈40 fad/min and are multiple in nature in scattering, giving rise to steep spectral slopes, whereas the post-midnight scintillations, which occur mostly on the VHF signal with low fading rate (≈4 fad/min, are of the BSS type, often showing typical Fresnel oscillations with reduced roll off spectral slopes, indicating that the type of irregularity resembles a thin screen structure giving rise to weak scattering. Using the onset times of several similar scintillation patches across the two satellite (FLEETSAT 73° E, INMARSAT 65° E ray paths (sub-ionospheric points are separated by 82 km, the East ward movement of the irregularity patches is found to vary from 150 to 250 m/s during the post sunset hours and decrease slowly during the post midnight hours. Further, the east-west extent of the PBI type of irregularities is found to vary from 100 to 500 km, while that of the BSS type extend up to a few thousand kilometers. Keywords. Ionosphere (Ionospheric irregularities; Auroral ionosphere; Electric fields and currents

  9. Design VHF Antennas for Space Borne Receivers for SmallSats

    Science.gov (United States)

    Deshpande, Manohar

    2017-01-01

    Space borne microwave remote sensors at VHF/UHF frequencies are important instruments to observe reflective properties of land surfaces through thick and heavy forestation on a global scale. One of the most cost effective ways of measuring land reflectivity at VHF/UHF frequencies is to use signals transmitted by existing communication satellites (operating at VHF/UHF band) as a signal of opportunity (SoOp) signal and passive receivers integrated with airborne/space borne platforms operating in the Low Earth Orbit (LEO). One of the critical components of the passive receiver is two antennas (one to receive only direct signal and other to receive only reflected signal) which need to have ideally high (>30dB) isolation. However, because of small size of host platforms and broad beam width of dipole antennas, achieving adequate isolation between two channels is a challenging problem and need to be solved for successful implementation of space borne SoOp technology for remote sensing. In this presentation a novel enabling VHF antenna technology for Cubesat platforms is presented to receive direct as well as reflected signal with needed isolation. The novel scheme also allows enhancing the gain of individual channels by factor of 2 without use of reflecting ground plane.

  10. A VHF Class E DC-DC Converter with Self-Oscillating Gate Driver

    DEFF Research Database (Denmark)

    Andersen, Toke Meyer; Christensen, Søren K.; Knott, Arnold

    2011-01-01

    This paper describes the analysis and design of a DC-DC converter topology which is operational at frequencies in the Very High Frequency (VHF) band ranging from 30 MHz − 300 MHz. The presented topology, which consists of a class E inverter, class E rectifier, and self-oscillating gate driver, is...

  11. Testing VHF/GPS collar design and safety in the study of free-roaming horses.

    Directory of Open Access Journals (Sweden)

    Gail H Collins

    Full Text Available Effective and safe monitoring techniques are needed by U.S. land managers to understand free-roaming horse behavior and habitat use and to aid in making informed management decisions. Global positioning system (GPS and very high frequency (VHF radio collars can be used to provide high spatial and temporal resolution information for detecting free-roaming horse movement. GPS and VHF collars are a common tool used in wildlife management, but have rarely been used for free-roaming horse research and monitoring in the United States. The purpose of this study was to evaluate the design, safety, and detachment device on GPS/VHF collars used to collect free-roaming horse location and movement data. Between 2009 and 2010, 28 domestic and feral horses were marked with commercial and custom designed VHF/GPS collars. Individual horses were evaluated for damage caused by the collar placement, and following initial observations, collar design was modified to reduce the potential for injury. After collar modifications, which included the addition of collar length adjustments to both sides of the collar allowing for better alignment of collar and neck shapes, adding foam padding to the custom collars to replicate the commercial collar foam padding, and repositioning the detachment device to reduce wear along the jowl, we observed little to no evidence of collar wear on horses. Neither custom-built nor commercial collars caused injury to study horses, however, most of the custom-built collars failed to collect data. During the evaluation of collar detachment devices, we had an 89% success rate of collar devices detaching correctly. This study showed that free-roaming horses can be safely marked with GPS and/or VHF collars with minimal risk of injury, and that these collars can be a useful tool for monitoring horses without creating a risk to horse health and wellness.

  12. Molecular Switching in Confined Spaces: Effects of Encapsulating the DHA/VHF Photo-Switch in Cucurbiturils

    DEFF Research Database (Denmark)

    Petersen, Michael Å.; Rasmussen, Brian; Andersen, Nicolaj N.

    2017-01-01

    complexes, the kinetics of the thermal VHF-to-DHA back-reaction is accelerated, while in CB8 inclusion complexes, the kinetics is slowed down as compared to the free photo-switch. The effect of the CB encapsulation of the photo-switch can be effectively canceled by introducing a guest that binds the CB more...... strongly. According to DFT calculations, a stabilization of the reactive s-cis VHF conformer relative to the s-trans VHF appears to be a contributing factor responsible for the accelerated back-reaction when encapsulated in CB7....

  13. A Discrete Scatterer Technique for Evaluating Electromagnetic Scattering from Trees

    Science.gov (United States)

    2016-09-01

    distribution is unlimited. 1 1. Introduction Developing sensing capabilities for the detection of ground targets concealed in a forest environment...scatterer simulation are 369 MB and 33 min/frequency, respectively, on a Dell Precision T7500 workstation with Intel Xeon CPU of 2.67 GHz, while those...2. Thirion L, Colin E, Dahon C. Capabilities of a forest coherent scattering model applied to radiometry, interferometry, and polarimetry at P

  14. Coherence and Sense of Coherence

    DEFF Research Database (Denmark)

    Dau, Susanne

    2014-01-01

    of coherence is both related to conditional matters as learning environments, structure, clarity and linkage but also preconditioned matters and prerequisites among participants related to experiences and convenience. It is stressed that this calls for continuous assessment and reflections upon these terms...

  15. Electromagnetism, Optics and Lasers: Handbook of Coherent Domain Optical Methods, Biomedical Diagnostics, Environment and Material Science

    Science.gov (United States)

    Tuchin, Valery V.

    For the first time in one set of books, coherent-domain optical methods are discussed in the framework of various applications, which are characterized by a strong light scattering. A few chapters describe basic research c ontaining the updated results on coherent and polarized light non-destructive interactions with a scattering medium, in particular, diffraction, interference, and speckle formation at multiple scattering. These chapters allow for understanding coherent-domain diagnostic techniques presented in later chapters.

  16. A system for mapping sources of VHF and electric field pulses from in-cloud lightning at KSC

    Science.gov (United States)

    Thomson, Ewen M.; Medelius, Pedro J.

    1991-01-01

    The literature concerning VHF radiation and wideband electric fields from in-cloud lightning is reviewed. VHF location systems give impressive radio images of lightning in clouds with high spatial and temporal resolution. Using systems based on long and short baseline time-or-arrival and interferometry, workers have detected VHF sources that move at speeds of 10(exp 5) to 10(exp 8) m/s. The more slowly moving sources appear to be associated with channel formation but the physical basis for the higher speeds is not clear. In contrast, wideband electric fields are directly related to physical parameters such as current and tortuosity. A long baseline system is described to measure simultaneously VHF radiation and wideband electric fields at five stations at Kennedy Space Center. All signals are detected over remote, isolated ground planes with fiber optics for data transmission. The modification of this system to map rapidly varying dE/dt pulses is discussed.

  17. Investigation into the Effects of VHF and UHF Band Radiation on Hewlett-Packard (HP) Cesium Beam Frequency Standards

    National Research Council Canada - National Science Library

    Dickens, Andrew

    1994-01-01

    This paper documents an investigation into reports which have indicated that exposure to VHF and UHF band radiation has adverse effects on the frequency stability of HP cesium beam frequency standards...

  18. Investigation into the effects of VHF and UHF band radiation on Hewlett-Packard (HP) Cesium Beam Frequency Standards

    Science.gov (United States)

    Dickens, Andrew

    1995-01-01

    This paper documents an investigation into reports which have indicated that exposure to VHF and UHF band radiation has adverse effects on the frequency stability of HP cesium beam frequency standards. Tests carried out on the basis of these reports show that sources of VHF and UHF radiation such as two-way hand held police communications devices do cause reproducible adverse effects. This investigation examines reproducible effects and explores possible causes.

  19. Coherence and Sense of Coherence

    DEFF Research Database (Denmark)

    Dau, Susanne

    2014-01-01

    examined is how activating of models of blended learning in undergraduate education for teacher and radiograph affects the knowledge development. This is approached by mixed methods. The empirical data consist of data from surveys as well as focus group interviews and some observation studies. These data...... are analyzed and interpreted through a critical hermeneutical process of prefiguration, configuration and re-figuration. The findings illustrate significantly importance of sense of coherence among participants as a condition for implementing new designs and new learning environments. It is revealed that sense...... of coherence is both related to conditional matters as learning environments, structure, clarity and linkage but also preconditioned matters and prerequisites among participants related to experiences and convenience. It is stressed that this calls for continuous assessment and reflections upon these terms...

  20. Coherence and Sense of Coherence

    DEFF Research Database (Denmark)

    Dau, Susanne

    2014-01-01

    of coherence is both related to conditional matters as learning environments, structure, clarity and linkage but also preconditioned matters and prerequisites among participants related to experiences and convenience. It is stressed that this calls for continuous assessment and reflections upon these terms......Constraints in the implementation of models of blended learning can be explained by several causes, but in this paper, it is illustrated that lack of sense of coherence is a major factor of these constraints along with the referential whole of the perceived learning environments. The question...... examined is how activating of models of blended learning in undergraduate education for teacher and radiograph affects the knowledge development. This is approached by mixed methods. The empirical data consist of data from surveys as well as focus group interviews and some observation studies. These data...

  1. Broadband VHF observations for lightning impulses from a small satellite SOHLA-1 (Maido 1)

    Science.gov (United States)

    Morimoto, T.; Kikuchi, H.; Ushio, T.; Kawasaki, Z.; Hidekazu, H.; Aoki, T.

    2009-12-01

    Lightning Research Group of Osaka University (LRG-OU) has been developing VHF Broadband Digital Interferometer (DITF) to image precise lightning channels and monitor lightning activity widely. The feature of broadband DITF is its ultrawide bandwidth (from 25MHz to 100MHz) and implicit redundancy for estimating VHF source location. LRG-OU considers an application of the broadband DITF to the spaceborne measurement system and joins the SOHLA (Space Oriented Higashi-Osaka Leading Associate) satellite project. The SOHLA satellite project represents a technology transfer program to expand the range of the space development community in Japan. The objective is to get SMEs (Small and Medium sized manufacturing Enterprises) involved in small space projects and new space technologies. Under the cooperative agreement, JAXA (Japan Aerospace Exploration Agency) intends to contribute to socio-economic development by returning its R&D results to society, and SOHLA tries to revitalize the local economy through the commercialization of versatile small satellites. According to the agreement, JAXA provides SOHLA its technical information on small satellites and other technical assistance for the development of the small satellites, SOHLA-1. The prime objective of the SOHLA-1 program is to realize low-cost and short term development of a microsatellite which utilizes the components and bus technologies of JAXA’s MicroLabSat. SOHLA-1 is a spin-stabilized microsatellite of MicroLabSat heritage (about 50 kg). The spin axis is fixed to inertial reference frame. The spin axis (z-axis) lies in the plane containing the solar direction and the normal to the orbital plane. LRG-OU takes responsibility for a science mission of SOHLA-1. To examine the feasibility of the DITF receiving VHF lightning impulses in space, LRG-OU proposes the BMW (Broadband Measurement of Waveform for VHF Lightning Impulses). BMW consists of a single pair of an antenna, a band-pass filter, an amplifier, and an

  2. Dental optical coherence domain reflectometry explorer

    Energy Technology Data Exchange (ETDEWEB)

    Everett, Matthew J. (Livermore, CA); Colston, Jr., Billy W. (Livermore, CA); Sathyam, Ujwal S. (Livermore, CA); Da Silva, Luiz B. (Pleasanton, CA)

    2001-01-01

    A hand-held, fiber optic based dental device with optical coherence domain reflectometry (OCDR) sensing capabilities provides a profile of optical scattering as a function of depth in the tissue at the point where the tip of the dental explorer touches the tissue. This system provides information on the internal structure of the dental tissue, which is then used to detect caries and periodontal disease. A series of profiles of optical scattering or tissue microstructure are generated by moving the explorer across the tooth or other tissue. The profiles are combined to form a cross-sectional, or optical coherence tomography (OCT), image.

  3. Bias-Voltage Stabilizer for HVHF Amplifiers in VHF Pulse-Echo Measurement Systems

    Directory of Open Access Journals (Sweden)

    Hojong Choi

    2017-10-01

    Full Text Available The impact of high-voltage–high-frequency (HVHF amplifiers on echo-signal quality is greater with very-high-frequency (VHF, ≥100 MHz ultrasound transducers than with low-frequency (LF, ≤15 MHz ultrasound transducers. Hence, the bias voltage of an HVHF amplifier must be stabilized to ensure stable echo-signal amplitudes. We propose a bias-voltage stabilizer circuit to maintain stable DC voltages over a wide input range, thus reducing the harmonic-distortion components of the echo signals in VHF pulse-echo measurement systems. To confirm the feasibility of the bias-voltage stabilizer, we measured and compared the deviations in the gain of the HVHF amplifier with and without a bias-voltage stabilizer. Between −13 and 26 dBm, the measured gain deviations of a HVHF amplifier with a bias-voltage stabilizer are less than that of an amplifier without a bias-voltage stabilizer. In order to confirm the feasibility of the bias-voltage stabilizer, we compared the pulse-echo responses of the amplifiers, which are typically used for the evaluation of transducers or electronic components used in pulse-echo measurement systems. From the responses, we observed that the amplitudes of the echo signals of a VHF transducer triggered by the HVHF amplifier with a bias-voltage stabilizer were higher than those of the transducer triggered by the HVHF amplifier alone. The second, third, and fourth harmonic-distortion components of the HVHF amplifier with the bias-voltage stabilizer were also lower than those of the HVHF amplifier alone. Hence, the proposed scheme is a promising method for stabilizing the bias voltage of an HVHF amplifier, and improving the echo-signal quality of VHF transducers.

  4. Bias-Voltage Stabilizer for HVHF Amplifiers in VHF Pulse-Echo Measurement Systems.

    Science.gov (United States)

    Choi, Hojong; Park, Chulwoo; Kim, Jungsuk; Jung, Hayong

    2017-10-23

    The impact of high-voltage-high-frequency (HVHF) amplifiers on echo-signal quality is greater with very-high-frequency (VHF, ≥100 MHz) ultrasound transducers than with low-frequency (LF, ≤15 MHz) ultrasound transducers. Hence, the bias voltage of an HVHF amplifier must be stabilized to ensure stable echo-signal amplitudes. We propose a bias-voltage stabilizer circuit to maintain stable DC voltages over a wide input range, thus reducing the harmonic-distortion components of the echo signals in VHF pulse-echo measurement systems. To confirm the feasibility of the bias-voltage stabilizer, we measured and compared the deviations in the gain of the HVHF amplifier with and without a bias-voltage stabilizer. Between -13 and 26 dBm, the measured gain deviations of a HVHF amplifier with a bias-voltage stabilizer are less than that of an amplifier without a bias-voltage stabilizer. In order to confirm the feasibility of the bias-voltage stabilizer, we compared the pulse-echo responses of the amplifiers, which are typically used for the evaluation of transducers or electronic components used in pulse-echo measurement systems. From the responses, we observed that the amplitudes of the echo signals of a VHF transducer triggered by the HVHF amplifier with a bias-voltage stabilizer were higher than those of the transducer triggered by the HVHF amplifier alone. The second, third, and fourth harmonic-distortion components of the HVHF amplifier with the bias-voltage stabilizer were also lower than those of the HVHF amplifier alone. Hence, the proposed scheme is a promising method for stabilizing the bias voltage of an HVHF amplifier, and improving the echo-signal quality of VHF transducers.

  5. Intensity statistics of very high frequency sound scattered from wind-driven waves.

    Science.gov (United States)

    Walstead, Sean P; Deane, Grant B

    2016-05-01

    The interaction of vhf 100-1000 kHz underwater sound with the ocean surface is explored. The bistatic forward scatter of 300 kHz sound is measured in a wind driven wave channel. Fluctuations in arrival amplitude are described by the scintillation index (SI) which is a measure of arrival intensity variance. SI initially increases with wind speed but eventually saturates to a value of 0.5 when the root-mean-square (rms) roughness is 0.5 mm. An adjusted scintillation index (SI*) is suggested that accounts for the multiple arrivals and properly saturates to a value of 1. Fluctuations in arrival time do not saturate and increase proportionately to the dominant surface wave component. Forward scattering is modeled at frequencies ranging from 50 to 2000 kHz using the Helmholtz-Kirchhoff integral with surface wave realizations derived from wave gauge data. The amplitude and temporal statistics of the simulated scattering agree well with measured data. Intensity saturation occurs at lower wind speeds for higher frequency sound. Both measured and modeled vhf sound is characterized by many surface arrivals at saturation. Doppler shifts associated with wave motion are expected to vary rapidly for vhf sound however further analysis is required.

  6. 2-D inner-shelf current observations from a single VHF WEllen RAdar (WERA) station

    Science.gov (United States)

    Voulgaris, G.; Kumar, N.; Gurgel, K.-W.; Warner, J.C.; List, J.H.

    2011-01-01

    The majority of High Frequency (HF) radars used worldwide operate at medium to high frequencies (8 to 30 MHz) providing spatial resolutions ranging from 3 to 1.5 km and ranges from 150 to 50 km. This paper presents results from the deployment of a single Very High Frequency (VHF, 48 MHz) WEllen RAdar (WERA) radar with spatial resolution of 150 m and range 10-15 km, used in the nearshore off Cape Hatteras, NC, USA. It consisted of a linear array of 12 antennas operating in beam forming mode. Radial velocities were estimated from radar backscatter for a variety of wind and nearshore wave conditions. A methodology similar to that used for converting acoustically derived beam velocities to an orthogonal system is presented for obtaining 2-D current fields from a single station. The accuracy of the VHF radar-derived radial velocities is examined using a new statistical technique that evaluates the system over the range of measured velocities. The VHF radar velocities showed a bias of 3 to 7 cm/s over the experimental period explainable by the differences in radar penetration and in-situ measurement height. The 2-D current field shows good agreement with the in-situ measurements. Deviations and inaccuracies are well explained by the geometric dilution analysis. ?? 2011 IEEE.

  7. Experimental study on partial coherence source

    CERN Document Server

    Zhao Xue Qing; Yuan Xiao; LiuJingRu; Wang Long Hua; Tang Ying; Huang, Kerson

    2002-01-01

    Partial coherence source is a key part in the laser system using echelon-free introduced spatial incoherence beam smoothing technique. Different kinds of partial coherence sources have been studied experimentally for improving the uniformity of laser intensity distribution. It is found that the source produced by excimer laser scattering on the surface of a teflon plate is ideal. The properties of this kind of source are studied. As a result, the uniformity of source beam intensity distribution, the beam spatial coherence and energy transfer efficiency of the source are obtained

  8. COHERENT constraints on nonstandard neutrino interactions

    Science.gov (United States)

    Liao, Jiajun; Marfatia, Danny

    2017-12-01

    Coherent elastic neutrino-nucleus scattering consistent with the standard model has been observed by the COHERENT experiment. We study nonstandard neutrino interactions using the detected spectrum. For the case in which the nonstandard interactions (NSI) are induced by a vector mediator lighter than 50 MeV, we obtain constraints on the coupling of the mediator. For a heavier mediator, we find that degeneracies between the NSI parameters severely weaken the constraints. However, these degeneracies do not affect COHERENT constraints on the effective NSI parameters for matter propagation in the Earth.

  9. Light Scattering Spectroscopy: From Elastic to Inelastic

    Science.gov (United States)

    Perelman, Lev T.; Modell, Mark D.; Vitkin, Edward; Hanlon, Eugene B.

    This chapter reviews light scattering spectroscopic techniques in which coherent effects are critical because they define the structure of the spectrum. In the case of elastic light scattering spectroscopy, the targets themselves, such as aerosol particles in environmental science or cells and subcellular organelles in biomedical applications, play the role of microscopic optical resonators. In the case of inelastic light scattering spectroscopy or Raman spectroscopy, the spectrum is created due to light scattering from vibrations in molecules or optical phonons in solids. We will show that light scattering spectroscopic techniques, both elastic and inelastic, are emerging as very useful tools in material and environmental science and in biomedicine.

  10. Quantum optics in multiple scattering random media

    DEFF Research Database (Denmark)

    Lodahl, Peter

    Quantum Optics in Multiple Scattering Random Media Peter Lodahl Research Center COM, Technical University of Denmark, Dk-2800 Lyngby, Denmark. Coherent transport of light in a disordered random medium has attracted enormous attention both from a fundamental and application point of view. Coherent...... quantum optics in multiple scattering media and novel fundamental phenomena have been predicted when examining quantum fluctuations instead of merely the intensity of the light [1]. Here I will present the first experimental study of the propagation of quantum noise through an elastic, multiple scattering...

  11. Structure, optical properties and thermal stability of HfErO films deposited by simultaneous RF and VHF magnetron sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, H.Y. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Nanjing University of Posts and Telecommunications, School of Tongda, Nanjing (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); He, H.J.; Zhang, Z.; Jin, C.G.; Yang, Y.; Wang, Y.Y.; Ye, C. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Zhuge, L.J. [Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Soochow University, Analysis and Testing Center, Suzhou (China); Wu, X.M. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Chinese Academy of Sciences, State Key Laboratory of Functional Materials for Informatics, Shanghai Institute of Microsystem and Information Technology, Shanghai (China)

    2015-01-23

    HfErO films are deposited on Si substrates by simultaneous radio frequency (RF) and very high frequency (VHF) magnetron sputtering technique. The content of the doped ingredient of Er and the body composition of HfO{sub x} are, respectively, controlled through the VHF and RF powers. Low content of Er doping in the HfErO films can be achieved, because the VHF source of 27.12 MHz has higher ion energy and lower ion flux than the RF source resulting in low sputtering rate in the magnetron sputtering system. The structure, optical properties and thermal stability of the HfErO films are investigated in this work. Results show that the doped content of Er is independently controlled by the VHF power. The oxygen vacancies are created by the Er incorporation. The hafnium in the HfErO films forms mixed valence of Hf{sup 2+} and Hf{sup 4+}. The HfErO films are composed with the structures of HfO{sub 2}, HfO and ErO{sub x}, which can be optimized through the VHF power. At high VHF power, the Hf-Er-O bonds are formed, which demonstrates that the Er atoms are doped into the lattice of HfO{sub 2} in the HfErO films. The HfErO films have bad thermal stability as the crystallization temperature decreases from 900 to 800 C. After thermal annealing, cubic phase of HfO{sub 2} are stabilized, which is ascribed to the oxygen vacancies creation by the Er incorporation. The optical properties such as the refractive index and the optical band gap of the HfErO films are optimized by the VHF power. (orig.)

  12. Diffuse scattering

    Energy Technology Data Exchange (ETDEWEB)

    Kostorz, G. [Eidgenoessische Technische Hochschule, Angewandte Physik, Zurich (Switzerland)

    1996-12-31

    While Bragg scattering is characteristic for the average structure of crystals, static local deviations from the average lattice lead to diffuse elastic scattering around and between Bragg peaks. This scattering thus contains information on the occupation of lattice sites by different atomic species and on static local displacements, even in a macroscopically homogeneous crystalline sample. The various diffuse scattering effects, including those around the incident beam (small-angle scattering), are introduced and illustrated by typical results obtained for some Ni alloys. (author) 7 figs., 41 refs.

  13. Coherence approach to neutron polarization propagation in instruments

    NARCIS (Netherlands)

    De Haan, V.O.; Van Well, A.A.; Plomp, J.

    2008-01-01

    The propagation of the mutual coherence function is a well known method to describe the effects of neutron’s propagation through scattering instruments. This method is extended with the description of the coherence matrix to account for neutron polarization effects and its propagation through an

  14. Light Scattering in Solid IX

    CERN Document Server

    Cardona, Manuel

    2007-01-01

    This is the ninth volume of a well-established series in which expert practitioners discuss topical aspects of light scattering in solids. It reviews recent developments concerning mainly semiconductor nanostructures and inelastic x-ray scattering, including both coherent time-domain and spontaneous scattering studies. In the past few years, light scattering has become one of the most important research and characterization methods for studying carbon nanotubes and semiconducting quantum dots, and a crucial tool for exploring the coupled exciton--photon system in semiconductor cavities. Among the novel techniques discussed in this volume are pump--probe ultrafast measurements and those which use synchrotron radiation as light source. The book addresses improvements in the intensity, beam quality and time synchronization of modern synchrotron sources, which made it possible to measure the phonon dispersion in very small samples and to determine electronic energy bands as well as enabling real-time observations...

  15. Coherence properties of exciton-polariton OPO condensates in one and two dimensions

    DEFF Research Database (Denmark)

    Spano, R.; Cuadra, J.; Anton, C.

    2012-01-01

    We give an overview of the coherence properties of exciton-polariton condensates generated by optical parametric scattering. Different aspects of the first-order coherence (g((1))) have been investigated. The spatial coherence extension of a two-dimensional (2D) polariton system, below and at the...

  16. Measurements methodology for evaluation of Digital TV operation in VHF high-band

    Science.gov (United States)

    Pudwell Chaves de Almeida, M.; Vladimir Gonzalez Castellanos, P.; Alfredo Cal Braz, J.; Pereira David, R.; Saboia Lima de Souza, R.; Pereira da Soledade, A.; Rodrigues Nascimento Junior, J.; Ferreira Lima, F.

    2016-07-01

    This paper describes the experimental setup of field measurements carried out for evaluating the operation of the ISDB-TB (Integrated Services Digital Broadcasting, Terrestrial, Brazilian version) standard digital TV in the VHF-highband. Measurements were performed in urban and suburban areas in a medium-sized Brazilian city. Besides the direct measurements of received power and environmental noise, a measurement procedure involving the injection of Gaussian additive noise was employed to achieve the signal to noise ratio threshold at each measurement site. The analysis includes results of static reception measurements for evaluating the received field strength and the signal to noise ratio thresholds for correct signal decoding.

  17. Forming and detection of digital watermarks in the System for Automatic Identification of VHF Transmissions

    Directory of Open Access Journals (Sweden)

    О. В. Шишкін

    2013-07-01

    Full Text Available Forming and detection algorithms for digital watermarks are designed for automatic identification of VHF radiotelephone transmissions in the maritime and aeronautical mobile services. An audible insensitivity and interference resistance of embedded digital data are provided by means of OFDM technology jointly with normalized distortions distribution and data packet detection by the hash-function. Experiments were carried out on the base of ship’s radio station RT-2048 Sailor and USB ADC-DAC module of type Е14-140M L-CARD in the off-line processing regime in Matlab medium

  18. Luminous phenomena and electromagnetic VHF wave emission originated from earthquake-related radon exhalation

    Science.gov (United States)

    Seki, A.; Tobo, I.; Omori, Y.; Muto, J.; Nagahama, H.

    2013-12-01

    Anomalous luminous phenomena and electromagnetic wave emission before or during earthquakes have been reported (e.g., the 1965 Matsushiro earthquake swarm). However, their mechanism is still unsolved, in spite of many models for these phenomena. Here, we propose a new model about luminous phenomena and electromagnetic wave emission during earthquake by focusing on atmospheric radon (Rn-222) and its daughter nuclides (Po-218 and Po-214). Rn-222, Po-218 and Po-214 are alpha emitters, and these alpha particles ionize atmospheric molecules. A light emission phenomenon, called 'the air luminescence', is caused by de-excitation of the ionized molecules of atmospheric nitrogen due to electron impact ionization from alpha particles. The de-excitation is from the second positive system of neutral nitrogen molecules and the first negative system of nitrogen molecule ion. Wavelengths of lights by these transitions include the visible light wavelength. So based on this mechanism, we proposed a new luminous phenomenon model before or during earthquake: 1. The concentration of atmospheric radon and its daughter nuclides increase anomalously before or during earthquakes, 2. Nitrogen molecules and their ions are excited by alpha particles emitted from Rn-222, Po-218 and Po-214, and air luminescence is generated by their de-excitation. Similarly, electromagnetic VHF wave emission can be explained by ionizing effect of radon and its daughter nuclides. Boyarchuk et al. (2005) proposed a model that electromagnetic VHF wave emission is originated when excited state of neutral clusters changes. Radon gas ionizes atmosphere and forms positively and negatively charged heavy particles. The process of ion hydration in ordinary air can be determined by the formation of complex chemically active structures of the various types of ion radicals. As a result of the association of such hydration radical ions, a neutral cluster, which is dipole quasi-molecules, is formed. A neutral cluster

  19. Thomson Scattering

    NARCIS (Netherlands)

    Donne, A. J. H.

    1994-01-01

    Thomson scattering is a very powerful diagnostic which is applied at nearly every magnetic confinement device. Depending on the experimental conditions different plasma parameters can be diagnosed. When the wave vector is much larger than the plasma Debye length, the total scattered power is

  20. Optical Coherence Tomography: Advanced Modeling

    DEFF Research Database (Denmark)

    Andersen, Peter E.; Thrane, Lars; Yura, Harold T.

    2013-01-01

    - and multiple-scattering regimes is derived. An advanced Monte Carlo model for calculating the OCT signal is also derived, and the validity of this model is shown through a mathematical proof based on the extended Huygens-Fresnel principle. From the analytical model, an algorithm for enhancing OCT images......Analytical and numerical models for describing and understanding the light propagation in samples imaged by optical coherence tomography (OCT) systems are presented. An analytical model for calculating the OCT signal based on the extended Huygens-Fresnel principle valid both for the single...

  1. Planar defects, dislocations, and coherently scattering-size in GdBa2Cu3O7-x high-Tc thin films determined by high resolution X-ray diffraction

    DEFF Research Database (Denmark)

    Csiszár, Gábor; Li, Xiaofen; Zilahi, Gyula

    2013-01-01

    The frequency of planar defects, the average dislocation densities, and coherent domain size in epitaxial GdBa2Cu3O7-x high Tc thin films, with altering CuO2 and CuO planes, are measured by fitting full widths at half maximum values of 00l type reflections using a model function based on intensity...... distribution configurations in reciprocal space. The reduction of the dislocation density during oxygenation seems to be an unavoidable condition to obtain superconductivity in GdBa 2Cu3O7-x thin films. © 2013 American Institute of Physics....

  2. Small angle neutron scattering

    Directory of Open Access Journals (Sweden)

    Cousin Fabrice

    2015-01-01

    Full Text Available Small Angle Neutron Scattering (SANS is a technique that enables to probe the 3-D structure of materials on a typical size range lying from ∼ 1 nm up to ∼ a few 100 nm, the obtained information being statistically averaged on a sample whose volume is ∼ 1 cm3. This very rich technique enables to make a full structural characterization of a given object of nanometric dimensions (radius of gyration, shape, volume or mass, fractal dimension, specific area… through the determination of the form factor as well as the determination of the way objects are organized within in a continuous media, and therefore to describe interactions between them, through the determination of the structure factor. The specific properties of neutrons (possibility of tuning the scattering intensity by using the isotopic substitution, sensitivity to magnetism, negligible absorption, low energy of the incident neutrons make it particularly interesting in the fields of soft matter, biophysics, magnetic materials and metallurgy. In particular, the contrast variation methods allow to extract some informations that cannot be obtained by any other experimental techniques. This course is divided in two parts. The first one is devoted to the description of the principle of SANS: basics (formalism, coherent scattering/incoherent scattering, notion of elementary scatterer, form factor analysis (I(q→0, Guinier regime, intermediate regime, Porod regime, polydisperse system, structure factor analysis (2nd Virial coefficient, integral equations, characterization of aggregates, and contrast variation methods (how to create contrast in an homogeneous system, matching in ternary systems, extrapolation to zero concentration, Zero Averaged Contrast. It is illustrated by some representative examples. The second one describes the experimental aspects of SANS to guide user in its future experiments: description of SANS spectrometer, resolution of the spectrometer, optimization of

  3. An HF and lower VHF spectrum assessment system exploiting instantaneously wideband capture

    Science.gov (United States)

    Barnes, Rod I.; Singh, Malkiat; Earl, Fred

    2017-09-01

    We report on a spectral environment evaluation and recording (SEER) system, for instantaneously wideband spectral capture and characterization in the HF and lower VHF band, utilizing a direct digital receiver coupled to a data recorder. The system is designed to contend with a wide variety of electromagnetic environments and to provide accurately calibrated spectral characterization and display from very short (ms) to synoptic scales. The system incorporates a novel RF front end involving automated gain and equalization filter selection which provides an analogue frequency-dependent gain characteristic that mitigates the high dynamic range found across the HF and lower VHF spectrum. The system accurately calibrates its own internal noise and automatically subtracts this from low variance, external spectral estimates, further extending the dynamic range over which robust characterization is possible. Laboratory and field experiments demonstrate that the implementation of these concepts has been effective. Sensitivity to varying antenna load impedance of the internal noise reduction process has been examined. Examples of software algorithms to provide extraction and visualization of spectral behavior over narrowband, wideband, short, and synoptic scales are provided. Application in HF noise spectral density monitoring, spectral signal strength assessment, and electromagnetic interference detection is possible with examples provided. The instantaneously full bandwidth collection provides some innovative applications, and this is demonstrated by the collection of discrete lightning emissions, which form fast ionograms called "flashagrams" in power-delay-frequency plots.

  4. PMSE strength during enhanced D region electron densities: Faraday rotation and absorption effects at VHF frequencies

    Science.gov (United States)

    Chau, Jorge L.; Röttger, Jürgen; Rapp, Markus

    2014-10-01

    In this paper we study the effects of absorption and Faraday rotation on measurements of polar mesosphere summer echoes (PMSE). We found that such effects can produce significant reduction of signal-to-noise ratio (SNR) when the D region electron densities (Ne) are enhanced, and VHF radar systems with linearly polarized antennas are used. In particular we study the expected effects during the strong solar proton event (SPE) of July 2000, also known as the Bastille day flare event. During this event, a strong anti-correlation between the PMSE SNR and the D-region Ne was found over three VHF radar sites at high latitudes: Andøya, Kiruna, and Svalbard. This anti-correlation has been explained (a) in terms of transport effects due to strong electric fields associated to the SPE and (b) due to a limited amount of aerosol particles as compared to the amount of D-region electrons. Our calculations using the Ne profiles used by previous researchers explain most, if not all, of the observed SNR reduction in both time (around the SPE peak) and altitude. This systematic effect, particularly the Faraday rotation, should be recognized and tested, and possibly avoided (e.g., using circular polarization), in future observations during the incoming solar maximum period, to contribute to the understanding of PMSE during enhanced D region Ne.

  5. VHF/UHF radar observations of tropical mesoscale convective systems over southern India

    Directory of Open Access Journals (Sweden)

    K. Kishore Kumar

    2005-07-01

    Full Text Available Several campaigns have been carried out to study the convective systems over Gadanki (13.5° N, 79.2° E, a tropical station in India, using VHF and UHF radars. The height-time sections of several convective systems are investigated in detail to study reflectivity, turbulence and vertical velocity structure. Structure and dynamics of the convective systems are the main objectives of these campaigns. The observed systems are classified into single- and multi-cell systems. It has been observed that most of the convective systems at this latitude are multi-cellular in nature. Simultaneous VHF and UHF radar observations are used to classify the observed precipitating systems as convective, intermediary and stratiform regions. Composite height profiles of vertical velocities in these regions were obtained and the same were compared with the profiles obtained at other geographical locations. These composite profiles of vertical velocity in the convective regions have shown their peaks in the mid troposphere, indicating that the maximum latent heat is being released at those heights. These profiles are very important for numerical simulations of the convective systems, which vary significantly from one geographical location to the other. Keywords. Meteorology and atmospheric dynamics (Mesoscale meteorology; Convective processes – Radio science (Remote sensing

  6. Critical scattering

    Energy Technology Data Exchange (ETDEWEB)

    Stirling, W.G. [Liverpool Univ., Dep. of Physics, Liverpool (United Kingdom); Perry, S.C. [Keele Univ. (United Kingdom). Dept. of Physics

    1996-12-31

    We outline the theoretical and experimental background to neutron scattering studies of critical phenomena at magnetic and structural phase transitions. The displacive phase transition of SrTiO{sub 3} is discussed, along with examples from recent work on magnetic materials from the rare-earth (Ho, Dy) and actinide (NpAs, NpSb, USb) classes. The impact of synchrotron X-ray scattering is discussed in conclusion. (author) 13 figs., 18 refs.

  7. Molecular Switching in Confined Spaces: Effects of Encapsulating the DHA/VHF Photo-Switch in Cucurbiturils.

    Science.gov (United States)

    Petersen, Michael Å; Rasmussen, Brian; Andersen, Nicolaj N; Sauer, Stephan P A; Nielsen, Mogens Brøndsted; Beeren, Sophie R; Pittelkow, Michael

    2017-09-18

    Confinement of reactive chemical species uniquely affects chemical reactivity by restricting the physical space available and by restricting access to interactions with the solvent. In Nature, for example, confined protein binding pockets govern processes following photoisomerization reactions and the isomerizations themselves. Here we describe the first example of a dihydroazulene/vinylheptafulvene (DHA/VHF) photo-switch functioning in water, and we show how its switching behavior is strongly influenced by supramolecular interactions with a series of cucurbit[n]uril (CB) host molecules. In CB7 inclusion complexes, the kinetics of the thermal VHF-to-DHA back-reaction is accelerated, while in CB8 inclusion complexes, the kinetics is slowed down as compared to the free photo-switch. The effect of the CB encapsulation of the photo-switch can be effectively canceled by introducing a guest that binds the CB more strongly. According to DFT calculations, a stabilization of the reactive s-cis VHF conformer relative to the s-trans VHF appears to be a contributing factor responsible for the accelerated back-reaction when encapsulated in CB7. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  8. MAGNETIC NEUTRON SCATTERING

    Energy Technology Data Exchange (ETDEWEB)

    ZALIZNYAK,I.A.; LEE,S.H.

    2004-07-30

    science, ranging from large-scale structures and dynamics of polymers and biological systems, to electronic properties of today's technological materials. Neutron scattering developed into a vast field, encompassing many different experimental techniques aimed at exploring different aspects of matter's atomic structure and dynamics. Modern magnetic neutron scattering includes several specialized techniques designed for specific studies and/or particular classes of materials. Among these are magnetic reflectometry aimed at investigating surfaces, interfaces, and multilayers, small-angle scattering for the large-scale structures, such as a vortex lattice in a superconductor, and neutron spin-echo spectroscopy for glasses and polymers. Each of these techniques and many others offer exciting opportunities for examining magnetism and warrant extensive reviews, but the aim of this chapter is not to survey how different neutron-scattering methods are used to examine magnetic properties of different materials. Here, we concentrate on reviewing the basics of the magnetic neutron scattering, and on the recent developments in applying one of the oldest methods, the triple axis spectroscopy, that still is among the most extensively used ones. The developments discussed here are new and have not been coherently reviewed. Chapter 2 of this book reviews magnetic small-angle scattering, and modern techniques of neutron magnetic reflectometry are discussed in Chapter 3.

  9. Cohering power of quantum operations

    Energy Technology Data Exchange (ETDEWEB)

    Bu, Kaifeng, E-mail: bkf@zju.edu.cn [School of Mathematical Sciences, Zhejiang University, Hangzhou 310027 (China); Kumar, Asutosh, E-mail: asukumar@hri.res.in [Harish-Chandra Research Institute, Chhatnag Road, Jhunsi, Allahabad 211019 (India); Homi Bhabha National Institute, Anushaktinagar, Mumbai 400094 (India); Zhang, Lin, E-mail: linyz@zju.edu.cn [Institute of Mathematics, Hangzhou Dianzi University, Hangzhou 310018 (China); Wu, Junde, E-mail: wjd@zju.edu.cn [School of Mathematical Sciences, Zhejiang University, Hangzhou 310027 (China)

    2017-05-18

    Highlights: • Quantum coherence. • Cohering power: production of quantum coherence by quantum operations. • Study of cohering power and generalized cohering power, and their comparison for differentmeasures of quantum coherence. • Operational interpretation of cohering power. • Bound on cohering power of a generic quantum operation. - Abstract: Quantum coherence and entanglement, which play a crucial role in quantum information processing tasks, are usually fragile under decoherence. Therefore, the production of quantum coherence by quantum operations is important to preserve quantum correlations including entanglement. In this paper, we study cohering power–the ability of quantum operations to produce coherence. First, we provide an operational interpretation of cohering power. Then, we decompose a generic quantum operation into three basic operations, namely, unitary, appending and dismissal operations, and show that the cohering power of any quantum operation is upper bounded by the corresponding unitary operation. Furthermore, we compare cohering power and generalized cohering power of quantum operations for different measures of coherence.

  10. A model for Monte Carlo simulation of low angle photon scattering in biological tissues

    CERN Document Server

    Tartari, A; Bonifazzi, C

    2001-01-01

    In order to include the molecular interference effect, a simple procedure is proposed and demonstrated to be able to update the usual cross section database for photon coherent scattering modelling in Monte Carlo codes. This effect was evaluated by measurement of coherent scattering distributions and by means of a model based on four basic materials composing biological tissues.

  11. Complementary code and digital filtering for detection of weak VHF radar signals from the mesoscale. [SOUSY-VHF radar, Harz Mountains, Germany

    Science.gov (United States)

    Schmidt, G.; Ruster, R.; Czechowsky, P.

    1983-01-01

    The SOUSY-VHF-Radar operates at a frequency of 53.5 MHz in a valley in the Harz mountains, Germany, 90 km from Hanover. The radar controller, which is programmed by a 16-bit computer holds 1024 program steps in core and controls, via 8 channels, the whole radar system: in particular the master oscillator, the transmitter, the transmit-receive-switch, the receiver, the analog to digital converter, and the hardware adder. The high-sensitivity receiver has a dynamic range of 70 dB and a video bandwidth of 1 MHz. Phase coding schemes are applied, in particular for investigations at mesospheric heights, in order to carry out measurements with the maximum duty cycle and the maximum height resolution. The computer takes the data from the adder to store it in magnetic tape or disc. The radar controller is programmed by the computer using simple FORTRAN IV statements. After the program has been loaded and the computer has started the radar controller, it runs automatically, stopping at the program end. In case of errors or failures occurring during the radar operation, the radar controller is shut off caused either by a safety circuit or by a power failure circuit or by a parity check system.

  12. Quantifying the Coherence between Coherent States

    Science.gov (United States)

    Tan, Kok Chuan; Volkoff, Tyler; Kwon, Hyukjoon; Jeong, Hyunseok

    2017-11-01

    In this Letter, we detail an orthogonalization procedure that allows for the quantification of the amount of coherence present in an arbitrary superposition of coherent states. The present construction is based on the quantum coherence resource theory introduced by Baumgratz, Cramer, and Plenio and the coherence resource monotone that we identify is found to characterize the nonclassicality traditionally analyzed via the Glauber-Sudarshan P distribution. This suggests that identical quantum resources underlie both quantum coherence in the discrete finite dimensional case and the nonclassicality of quantum light. We show that our construction belongs to a family of resource monotones within the framework of a resource theory of linear optics, thus establishing deeper connections between the class of incoherent operations in the finite dimensional regime and linear optical operations in the continuous variable regime.

  13. Frequency Reuse, Cell Separation, and Capacity Analysis of VHF Digital Link Mode 3 TDMA

    Science.gov (United States)

    Shamma, Mohammed A.; Nguyen, Thanh C.; Apaza, Rafael D.

    2003-01-01

    The most recent studies by the Federal Aviation Administration (FAA) and the aviation industry have indicated that it has become increasingly difficult to make new VHF frequency or channel assignments to meet the aviation needs for air-ground communications. FAA has planned for several aggressive improvement measures to the existing systems, but these measures would not meet the projected voice communications needs beyond 2009. FAA found that since 1974 there has been, on the average, a 4 percent annual increase in the number of channel assignments needed to satisfy the air-ground communication traffic (approximately 300 new channel assignments per year). With the planned improvement measures, the channel assignments are expected to reach a maximum number of 16615 channels by about 2010. Hence, the FAA proposed the use of VDL Mode 3 as a new integrated digital voice and data communications systems to meet the future air traffic demand. This paper presents analytical results of frequency reuse; cell separation and capacity estimation of VDL Mode 3 TDMA systems that FAA has planned to implement the future VHF air-ground communications system by the year 2010. For TDMA, it is well understood that the frequency reuse factor is a crucial parameter for capacity estimation. Formulation of this frequency reuse factor is shown, taking into account the limitation imposed by the requirement to have a sufficient Signal to Co-Channel Interference Ratio. Several different values for the Signal to Co-Channel Interference Ratio were utilized corresponding to the current analog VHF DSB-AM systems, and the future digital VDL Mode 3. The required separation of Co-Channel cells is computed for most of the Frequency Protected Service Volumes (FPSV's) currently in use by the FAA. Additionally, the ideal cell capacity for each FPSV is presented. Also, using actual traffic for the Detroit air space, a FPSV traffic distribution model is used to generate a typical cell for channel capacity

  14. Detection of structural and functional changes in biological materials using angle-resolved low coherence interferometry

    Science.gov (United States)

    Chalut, Kevin J.; Ostrander, Julie H.; Wax, Adam

    2008-02-01

    A well-established method of assessing structure is inverse light scattering analysis. With inverse light scattering analysis, the measured scattering properties of a scatterer(s) are associated with the most probable scattering distribution predicted by an appropriate light scattering model. One commonly used light scattering model is Mie theory, the electromagnetic theory of spherical scattering. Although Mie theory is a spherical scattering model, it has been used for deducing the geometry of spheroidal scatterers, which are important for studies of biological cell structure. The angle-resolved low coherence interferometry (a/LCI) technique is one method of Mie theory - based inverse light scattering analysis that has been used to evaluate biological structure both ex vivo and in vitro. In the present study, we examine the ability of a/LCI to assess structure, geometry, and cellular organization in ways that will further enable the study of function in biological materials.

  15. On Longitudinal Spectral Coherence

    DEFF Research Database (Denmark)

    Kristensen, Leif

    1979-01-01

    It is demonstrated that the longitudinal spectral coherence differs significantly from the transversal spectral coherence in its dependence on displacement and frequency. An expression for the longitudinal coherence is derived and it is shown how the scale of turbulence, the displacement between ...... observation sites and the turbulence intensity influence the results. The limitations of the theory are discussed....

  16. Disturbance-induced responses of VHF and satellite tagged harbour seals

    DEFF Research Database (Denmark)

    Andersen, Signe May; Teilmann, Jonas; Dietz, Rune

    2014-01-01

    ABSTRACT 1. The response of individual harbour seals (Phoca vitulina) to controlled and sporadic disturbances when hauled out in the Anholt seal reserve, Denmark, was studied. Sporadic disturbances from pedestrians, boats, low-flying aeroplanes and grey seals (Halichoerus grypus) were observed...... in or near the reserve. VHF and satellite transmitters were attached to eight harbour seals to determine post-disturbance and undisturbed behaviour during the pre-breeding period (25 April to 21 May 2008). 2. Both disturbed and undisturbed seals mostly returned to the haul-out site from dusk and throughout...... within 40 km from the haul-out site. The maximum extent of post-disturbance trips, however, varied among individuals and disturbance types, and was strongly correlated with the duration of trips. 3. Disturbed and undisturbed seals used the same areas, suggesting that these areas represent normal foraging...

  17. Graphene-based tunable non-foster circuit for VHF applications

    Directory of Open Access Journals (Sweden)

    Jing Tian

    2016-06-01

    Full Text Available This paper presents a negative impedance converter (NIC based on graphene field effect transistors (GFETs for VHF applications. The NIC is designed following Linvill’s open circuit stable (OCS topology. The DC modelling parameters of GFET are extracted from a device measured by Meric et al. [IEEE Electron Devices Meeting, 23.2.1 (2010] Estimated parasitics are also taken into account. Simulation results from Keysight Advanced Design System (ADS show good NIC performance up to 200 MHz and the value of negative capacitance is directly proportional to the capacitive load. In addition, it has been shown that by varying the supply voltage the value of negative capacitance can also be tuned. The NIC stability has been tested up to 2 GHz (10 times the maximum operation frequency using Nyquist stability criterion to ensure there are no oscillation issues.

  18. Final environmental assessment for vegetation control at VHF stations, microwave stations, electrical substations, and pole yards

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-10-13

    Southwestern Power Adm. operates very high frequency (VHF) and microwave radio stations, electrical substations, and pole yards for electric power transmission throughout AR, MO, and OK. Vegetation growth at the stations must be suppressed for safety of operation and personnel. Southwestern has been using a combination of mechanical/manual and herbicide control for this purpose; Federally- mandated reductions in staff and budgetary resources require Southwestern to evaluate all potentially efficient methods for vegetation control. Three alternatives were examined: no action, mechanical/manual control, and (proposed) a combination of mechanical/manual and herbicide control. Environmental impacts on air and water quality, wetlands, wildlife, endangered species, archaeological and other resources, farmland, human health, transportation, etc. were evaluated.

  19. Compton scattering

    Energy Technology Data Exchange (ETDEWEB)

    Botto, D.J.; Pratt, R.H.

    1979-05-01

    The current status of Compton scattering, both experimental observations and the theoretical predictions, is examined. Classes of experiments are distinguished and the results obtained are summarized. The validity of the incoherent scattering function approximation and the impulse approximation is discussed. These simple theoretical approaches are compared with predictions of the nonrelativistic dipole formula of Gavrila and with the relativistic results of Whittingham. It is noted that the A/sup -2/ based approximations fail to predict resonances and an infrared divergence, both of which have been observed. It appears that at present the various available theoretical approaches differ significantly in their predictions and that further and more systematic work is required.

  20. Recent Comparisons of VHF Lightning Mapping Using Interferometry and Time-of-Arrival Techniques

    Science.gov (United States)

    Lojou, J.; Cummins, K. L.

    2005-12-01

    As part of Vaisala's technology and applications test bed in the Dallas-Fort Worth area in Texas, we have been operating two overlapping Total Lightning detection networks. One network employs VHF Interferometry (both 2- and 3-timensional instrumentation) and the other employs VHF 3-dimensional Time-Of-Arrival (TOA) techniques. For the first time, these two technologies can be compared and contrasted in a common region where they both exhibit good performance. The aim of the work presented is to evaluate the spatial and temporal "description" of lightning flashes provided by these two techniques, and to compare and contrast the relative strengths of these two approaches for Total Lightning mapping. This study employs data acquired during the summer of 2005. The analysis set includes data obtained by these two networks, as well as cloud-to-ground location data from the U.S. National Lightning Detection Network (NLDN). The spatial extent and vertical profile of sources from individual in-cloud and cloud-to-ground flashes are compared for various storm conditions, with both technologies clearly contributing supplemental information not provided by the other. Leader propagation velocities show a substantially unimodal distribution centered at about 105 m/s for TOA-derived sources, whereas the velocity distribution for sources detected using interferometry exhibit a bimodal distribution with the second mode at about 107 m/s. The most-probable interval-between-sources for TOA-derived sources seems to be a few milliseconds, whereas interferometry produces large populations with intervals near 100 microseconds and 100 milliseconds.

  1. NEUTRON-SCATTERING STUDY OF DCN

    DEFF Research Database (Denmark)

    Mackenzie, Gordon A.; Pawley, G. S.

    1979-01-01

    Phonons in deuterium cyanide have been measured by neutron coherent inelastic scattering. The main subject of study was the transverse acoustic mode in the (110) direction polarised along (110) which is associated with the first-order structural phase transition at 160K. Measurements have shown...

  2. Biological cell classification by multiangle light scattering

    Science.gov (United States)

    Salzman, G.C.; Crowell, J.M.; Mullaney, P.F.

    1975-06-03

    The specification is directed to an apparatus and method for detecting light scattering from a biological cell. Light, preferably from a coherent source of radiation, intercepts an individual biological cell in a stream of cells passing through the beam. Light scattered from the cell is detected at a selected number of angles between 0 and 90/sup 0/ to the longitudinal axis of the beam with a circular array of light responsive elements which produce signals representative of the intensity of light incident thereon. Signals from the elements are processed to determine the light-scattering pattern of the cell and therefrom its identity.

  3. Scattering theory of molecules, atoms and nuclei

    CERN Document Server

    Canto, L Felipe

    2012-01-01

    The aim of the book is to give a coherent and comprehensive account of quantum scattering theory with applications to atomic, molecular and nuclear systems. The motivation for this is to supply the necessary theoretical tools to calculate scattering observables of these many-body systems. Concepts which are seemingly different for atomic/molecular scattering from those of nuclear systems, are shown to be the same once physical units such as energy and length are diligently clarified. Many-body resonances excited in nuclear systems are the same as those in atomic systems and come under the name

  4. Lensless imaging based on coherent backscattering in random media

    Directory of Open Access Journals (Sweden)

    Lei Xu

    2014-08-01

    Full Text Available We studied lensless imaging due to coherent backscattering in random media both theoretically and experimentally. The point spread function of the lensless imaging system was derived. Parameters such as the volume fraction of the scatterer in the random scattering medium, the diameter of the scatterer, the distance between the object to be imaged and the surface of the random scattering medium were optimized to improve the image contrast and resolution. Moreover, for complicated objects, high contrast and quality images were achieved through the high-order intensity correlation measurement on the image plane, which may propel this imaging technique to practical applications.

  5. Homometry in the light of coherent beams

    OpenAIRE

    Ravy, Sylvain

    2013-01-01

    Two systems are homometric if they are indistinguishable by diffraction. We first make a distinction between Bragg and diffuse scattering homometry, and show that in the last case, coherent diffraction can allow the diffraction diagrams to be differentiated. The study of the Rudin-Shapiro sequence, homometric to random sequences, allows one to manipulate independently two-point and four-point correlation functions, and to show their effect on the statistics of speckle patterns. Consequences f...

  6. Contributions to the Theories of Coherence and Polarization of Light

    Science.gov (United States)

    Lahiri, Mayukh

    In this thesis, coherence and polarization properties of stochastic optical fields are investigated. The so-called cross-spectral density matrices of polarized and natural light beams are studied. It is shown how coherence and polarization properties of stochastic beams change on superposition. The relationship between the so-called space-time and space-frequency descriptions of completely polarized fields and of completely coherent fields are investigated. An inverse scattering problem involving a random medium is discussed. In this context, the condition which ensures that a beam retains its beam-like form on scattering, is also presented. Basic polarization properties of light beams are discussed based on quantum mechanical theory of fields. A quantum theory of optical coherence in the space-frequency domain is also presented.

  7. Maximum Relative Entropy of Coherence: An Operational Coherence Measure

    Science.gov (United States)

    Bu, Kaifeng; Singh, Uttam; Fei, Shao-Ming; Pati, Arun Kumar; Wu, Junde

    2017-10-01

    The operational characterization of quantum coherence is the cornerstone in the development of the resource theory of coherence. We introduce a new coherence quantifier based on maximum relative entropy. We prove that the maximum relative entropy of coherence is directly related to the maximum overlap with maximally coherent states under a particular class of operations, which provides an operational interpretation of the maximum relative entropy of coherence. Moreover, we show that, for any coherent state, there are examples of subchannel discrimination problems such that this coherent state allows for a higher probability of successfully discriminating subchannels than that of all incoherent states. This advantage of coherent states in subchannel discrimination can be exactly characterized by the maximum relative entropy of coherence. By introducing a suitable smooth maximum relative entropy of coherence, we prove that the smooth maximum relative entropy of coherence provides a lower bound of one-shot coherence cost, and the maximum relative entropy of coherence is equivalent to the relative entropy of coherence in the asymptotic limit. Similar to the maximum relative entropy of coherence, the minimum relative entropy of coherence has also been investigated. We show that the minimum relative entropy of coherence provides an upper bound of one-shot coherence distillation, and in the asymptotic limit the minimum relative entropy of coherence is equivalent to the relative entropy of coherence.

  8. Analysis of the VHF-UHF electromagnetic radiation of lightning: Application to a model of the negative stepped leader propagation

    Science.gov (United States)

    Taudiere, Isabelle

    1991-03-01

    The space and time characteristics of the VHF-UHF radiation from lightning are analyzed on the bases of 300 MHz emission sources, localized in three dimensions by interferometric measurements. The main phases that contribute to the development of intracloud lightning are examined in detail, also using electric field measurements at the lower frequency. This research is complemented by an experimental and theoretical analysis of long discharge (8m) radio emissions generated with both polarities in the laboratory. These investigations revealed that the VHF radiation is associated with the channel reillumination phase accompanying each step in the negative spark. The outcome of this work is the creation of a simple model for the propagation of the negative leader. The current and the radiated field during this phase of the discharge are computed from an equivalent electric circuit using the physical laws governing the variation of resistance. The extrapolation of these results to the case of the stepped leader of natural lightning is discussed.

  9. Scattering theory

    CERN Document Server

    Friedrich, Harald

    2016-01-01

    This corrected and updated second edition of "Scattering Theory" presents a concise and modern coverage of the subject. In the present treatment, special attention is given to the role played by the long-range behaviour of the projectile-target interaction, and a theory is developed, which is well suited to describe near-threshold bound and continuum states in realistic binary systems such as diatomic molecules or molecular ions. It is motivated by the fact that experimental advances have shifted and broadened the scope of applications where concepts from scattering theory are used, e.g. to the field of ultracold atoms and molecules, which has been experiencing enormous growth in recent years, largely triggered by the successful realization of Bose-Einstein condensates of dilute atomic gases in 1995. The book contains sections on special topics such as near-threshold quantization, quantum reflection, Feshbach resonances and the quantum description of scattering in two dimensions. The level of abstraction is k...

  10. Meteor head echo altitude distributions and the height cutoff effect studied with the EISCAT HPLA UHF and VHF radars

    Directory of Open Access Journals (Sweden)

    A. Westman

    2004-04-01

    Full Text Available Meteor head echo altitude distributions have been derived from data collected with the EISCAT VHF (224MHz and UHF (930MHz high-power, large-aperture (HPLA radars. At the high-altitude end, the distributions cut off abruptly in a manner reminiscent of the trail echo height ceiling effect observed with classical meteor radars. The target dimensions are shown to be much smaller than both the VHF and the UHF probing wavelengths, but the cutoff heights for the two systems are still clearly different, the VHF cutoff being located several km above the UHF one. A single-collision meteor-atmosphere interaction model is used to demonstrate that meteors in the (1.3–7.2µg mass range will ionise such that critical electron density at 224MHz is first reached at or around the VHF cutoff altitude and critical density at 930MHz will be reached at the UHF cutoff altitude. The observed seasonal variation in the cutoff altitudes is shown to be a function of the seasonal variation of atmospheric density with altitude. Assuming that the electron density required for detection is in the order of the critical density, the abrupt altitude cutoffs can be explained as a consequence of the micrometeoroid joint size-speed distribution dropping off so fast at the large-mass, high-velocity end that above a certain altitude the number of detectable events becomes vanishingly small. Conversely, meteors at the low-mass end of the distribution will be gradually retarded such that the ionisation they generate never reaches critical density. These particles will remain unobservable.Key words. Radio science (instruments and techniques – Interplatery physics (interplanetary dust – General or miscellaneous (new fields

  11. Coherence Measurements for Excited to Excited State Transitions in Barium

    Science.gov (United States)

    Trajmar, S.; Kanik, I.; Karaganov, V.; Zetner, P. W.; Csanak, G.

    2000-01-01

    Experimental studies concerning elastic and inelastic electron scattering by coherently ensembles of Ba (...6s6p (sub 1)P(sub 1)) atoms with various degrees of alignment will be described. An in-plane, linearly-polarized laser beam was utilized to prepare these target ensembles and the electron scattering signal as a function of polarization angle was measured for several laser geometries at fixed impact energies and scattering angles. From these measurements, we derived cross sections and electron-impact coherence parameters associated with the electron scattering process which is time reverse of the actual experimentally studied process. This interpretation of the experiment is based on the theory of Macek and Herte. The experimental results were also interpreted in terms of cross sections and collision parameters associated with the actual experimental processes. Results obtained so far will be presented and plans for further studies will be discussed.

  12. VHF digital ultrasound three-dimensional scanning in the diagnosis of myopic regression after corneal refractive surgery.

    Science.gov (United States)

    Reinstein, Dan Z; Ameline, Barbara; Puech, Michel; Montefiore, Guy; Laroche, Laurent

    2005-01-01

    To perform VHF digital ultrasound scanning and analysis of a case of high-myopic undercorrection in an eye that had undergone multiple surgical interventions for the correction of an initial refraction of -12.00 diopters (D). A 49-year-old woman was evaluated after undergoing three surgical interventions for correction of an initial refraction of -12.00 D in the left eye. Automated lamellar keratoplasty (ALK) was followed by arcuate keratotomy (for induced astigmatism) and surface photorefractive keratectomy (PRK). The residual ametropia on presentation was -6.75 -3.50 x 95 degrees. VHF digital ultrasound scanning and analysis was performed. On ultrasound, the ALK interface was clearly visible. Residual stromal thickness beneath the cap was at least 275 microm. The absence of Bowman's layer indicated the region of PRK. New stroma and nascent stromal layers were differentiated within the flap. Neo stromal deposition and central epithelial hyperplasia were determined to be responsible for the myopic shift, as opposed to biomechanical changes. In this case, refraction, slit-lamp examination, and topography were unable to provide a diagnosis for regression following multiple corneal refractive procedures. By providing layered anatomical mapping, VHF digital ultrasound scanning was able to exclude a diagnosis of ectasia and provide anatomical diagnostic information to explain the clinical observations.

  13. Disturbances in VHF/UHF telemetry links as a possible effect of the 2003 Hokkaido Tokachi-oki earthquake

    Directory of Open Access Journals (Sweden)

    H. Nagamoto

    2008-08-01

    Full Text Available The data on radio telemetry links (for water information at VHF/UHF in Hokkaido are used to investigate the rate of disturbances on radio links (or connection failure and its association with a huge earthquake, Tokachi-oki earthquake on 26 September 2003. Especially, the telemetry links at the Tokachi region closest to the earthquake epicenter, showed a significant increase in disturbances on radio links two weeks to a few days before the earthquake on the basis of analysis during a long interval from 1 June 2002 to 3 November 2007 (over 5 years. We suggest that these severe disturbances in VHF/UHF telemetry links are attributed to the generation of seismogenic VHF/UHF radio noises (emissions. Based on this idea, we have estimated that the intensity of these seismogenic emissions is on the order of 10–19 dB μV/m. Finally, the present result was compared with other physical parameters already obtained for this earthquake.

  14. Handbook of coherent domain optical methods biomedical diagnostics, environmental and material science

    CERN Document Server

    2004-01-01

    For the first time in one set of books, coherent-domain optical methods are discussed in the framework of various applications, which are characterized by a strong light scattering. A few chapters describe basic research containing the updated results on coherent and polarized light non-destructive interactions with a scattering medium, in particular, diffraction, interference, and speckle formation at multiple scattering. These chapters allow for understanding coherent-domain diagnostic techniques presented in later chapters. A large portion of Volume I is dedicated to analysis of various aspects of optical coherence tomography (OCT) - a very new and growing field of coherent optics. Two chapters on laser scanning confocal microscopy give insight to recent extraordinary results on in vivo imaging and compare the possibilities and achievements of confocol, excitation multiphoton, and OCT microscopy. This two volume reference contains descriptions of holography, interferometry and optical heterodyning techniqu...

  15. Propagation of coherent transverse waves: Influence of the translational and rotational subwavelength resonances.

    Science.gov (United States)

    Valier-Brasier, Tony; Conoir, Jean-Marc

    2017-08-01

    The propagation of coherent transverse waves through a homogeneous elastic medium containing a set of spherical dense inclusions is an interesting topic. In such a material, in addition to the coherent longitudinal wave, two coherent transverse waves can propagate. The modeling used is based on the multiple scattering theory, which requires the scattering coefficients of the single scattering problem. These coefficients are calculated for moving rigid particles, leading to approximations of the two subwavelength dipolar resonances, one associated to a translational motion and the other to a rotational motion. Numerical simulations are carried out in order to compare the effective wavenumbers of the coherent elastic waves through the analysis of their phase velocity and attenuation. This comparison is performed for elastic and moving rigid spheres. It is shown that both dipolar resonances may have a great influence on the propagation of coherent transverse waves.

  16. Application Coherency Manager Project

    Data.gov (United States)

    National Aeronautics and Space Administration — This proposal describes an Application Coherency Manager that implements and manages the interdependencies of simulation, data, and platform information. It will...

  17. Experimental investigation of quantum effects in time-resolved resonance Rayleigh scattering from quantum well excitons

    DEFF Research Database (Denmark)

    Birkedal, Dan; Shah, Jagdeep; Shchegrov, Andrei V.

    2000-01-01

    Resonant Rayleigh scattering from quantum well excitons is investigated using ultrafast spectral interferometry. We isolate the coherent Rayleigh scattering from incoherent luminescence in a single speckle. Averaging the resonant Rayleigh intensity over several speckles allows us to identify...... features in support of quantum corrections to the classical description of the underlying scattering process....

  18. Search for Antineutrino Charged Current Coherent Pion Production at SciBooNE

    CERN Document Server

    Tanaka, Hide-Kazu

    2009-01-01

    The SciBooNE experiment (Fermilab) recently published results of a search for charged current coherent pion production in neutrino mode: muon neutrinos scattering on carbon. The results of this study are that no evidence for coherent pion production is observed, and SciBooNE set 90% confidence level upper limits on the cross section ratio of charged current coherent pion production to the total charged current cross section. Recently proposed new coherent pion models predict a production of charged current coherent pion events just below the SciBooNE's upper limit. Motivated by this, we performed a search for charged current coherent pion production using SciBooNE's collected antineutrino data since antineutrino data are expected to be more sensitive to look at coherent pion production than neutrino data. This paper describes preliminary results of a search for antineutrino charged current coherent pion production at the SciBooNE experiment.

  19. Search for neutrino charged current coherent pion production at SciBooNE

    CERN Document Server

    Hiraide, K

    2009-01-01

    SciBooNE is a neutrino experiment measuring the neutrino cross sections on carbon in the one GeV region. We have performed a search for charged current coherent pion production from muon neutrinos scattering on carbon, \

  20. First results from an iron lidar and a VHF radar at Davis, Antarctica

    Science.gov (United States)

    Luebken, F.; Morris, R. J.; Hoeffner, J.; Kaifler, B.; Viehl, T.

    2012-12-01

    We present temperature measurements at Davis, Antarctica (69°S, 78°E), and compare with simultaneous and co-located radar measurements of polar mesosphere summer echoes (PMSE). The mobile scanning iron lidar of the IAP in Kuehlungsborn was installed at Davis in December 2010. It measures iron densities, vertical winds, and temperatures in the iron layer, i. e. from approximately 80 to 100 km. It is based on probing the Doppler broadened resonance line of iron atoms at 386 nm and can operate under daylight conditions. Typical values for temperature uncertainty, altitude and time resolution are 3-5 K, 1 km, and 1 hour, respectively. The lidar also measures neutral air densities and temperatures in the stratosphere and lower mesosphere. At Davis the lidar has up to now achieved approximately 2700 hours of data which is presumably the largest nearly continuous data set in Antarctica. The mesopause altitude changes throughout the summer season by several kilometers, significantly different from the northern hemisphere summer. Depending on altitude, temperatures can be warmer or colder compared to the NH summer. Temperatures at Davis near 86 km are rather similar to the NH, but they are much colder at higher altitudes. The thermal structure around the mesopause at Davis is closely related to the general circulation in the stratosphere, namely to the transition from winter to summer conditions. Different from expectations we sometimes find the mesopause significantly higher and colder(!) compared to the NH. Furthermore, we find large thermal tides in the summer months with amplitudes of up to 6-7~K, which is much larger than expected from models. The Australien Antarctic Division operates a 55 MHz VHF radar at Davis since February 2003. We report first simultaneous measurements of PMSE and temperatures by the Fe lidar. PMSE are strong radar echoes related to ice particles and therefore require atmospheric temperatures being lower than the frost point temperature

  1. Handbook of Coherent-Domain Optical Methods Biomedical Diagnostics, Environmental Monitoring, and Materials Science

    CERN Document Server

    2013-01-01

    This Handbook provides comprehensive coverage of laser and coherent-domain methods as applied to biomedicine, environmental monitoring, and materials science. Worldwide leaders in these fields describe the fundamentals of light interaction with random media and present an overview of basic research. The latest results on coherent and polarization properties of light scattered by random media, including tissues and blood, speckles formation in multiple scattering media, and other non-destructive interactions of coherent light with rough surfaces and tissues, allow the reader to understand the principles and applications of coherent diagnostic techniques. The expanded second edition has been thoroughly updated with particular emphasis on novel coherent-domain techniques and their applications in medicine and environmental science. Volume 1 describes state-of-the-art methods of coherent and polarization optical imaging, tomography and spectroscopy; diffusion wave spectroscopy; elastic, quasi-elastic and inelasti...

  2. Refraction and Faraday rotation in the incoherent scatter radar technique

    Science.gov (United States)

    Shpynev, Boris G.

    2017-09-01

    In this paper we consider the radiolocation equation for the incoherent scatter radar (ISR) method; the equation accounts for refraction effect and Faraday rotation in the VHF frequency domain. Our research shows that we cannot ignore refraction in processing the incoherent scatter data when lag-product is used to obtain the ionospheric characteristics. Effect of refraction can explain some uncertainties that arise during processing and interpretation of the ISR data. This effect shows that together with the "ion line" of incoherent scatter spectrum, a relatively small "electron line" also plays a significant role in forming the ionosphere response. The "electron line" behaves as an additional "radar induced" wideband radiolocation signal affected by refraction and Faraday rotation; it depends on the ionosphere temperature and ion composition. The presence of a wideband "electron line" produces specific distortions of the ISR spectrum during 3D-forming of the ionosphere response inside the ISR antenna diagram pattern. During testing, we found that the signal from the ISR "electron line" can be measured at much higher altitudes comparing to the "ion line." Hence, to improve the incoherent scatter technique, we can take the "electron line" and refraction into account.

  3. Understanding Causal Coherence Relations

    NARCIS (Netherlands)

    Mulder, G.

    2008-01-01

    The research reported in this dissertation focuses on the cognitive processes and representations involved in understanding causal coherence relations in text. Coherence relations are the meaning relations between the information units in the text, such as Cause-Consequence. These relations can be

  4. Anisotropy of Doppler spectral parameters in the VHF radar observations at MU and White Sands

    Directory of Open Access Journals (Sweden)

    G. D. Nastrom

    2001-08-01

    Full Text Available Significant differences are found between the mean spectral widths from beams in the meridional plane and in the zonal plane at both the MU and the White Sands VHF radars. The spectral width in the beam directed perpendicular to the prevailing wind is greater than that in the beam parallel to the wind. The magnitudes of the differences in spectral width show a linear relationship with wind speed, with the greatest differences at the greatest wind speeds. The differences in spectral width show a positive correlation with the differences in backscattered power. The anisotropy in backscattered power is well-known and is usually attributed to aspect sensitivity effects. However, the anisotropy in spectral width does not appear to be due to the same mechanism, and while several hypotheses to account for this are considered, including finite range-volume effects, effects from the tilting of isentropic layers, and anisotropic turbulence effects, it is seen that each of these suggestions has its shortcomings.Key words. Meteorology and atmospheric dynamics (turbulence; instruments and techniques

  5. Anisotropy of Doppler spectral parameters in the VHF radar observations at MU and White Sands

    Directory of Open Access Journals (Sweden)

    G. D. Nastrom

    Full Text Available Significant differences are found between the mean spectral widths from beams in the meridional plane and in the zonal plane at both the MU and the White Sands VHF radars. The spectral width in the beam directed perpendicular to the prevailing wind is greater than that in the beam parallel to the wind. The magnitudes of the differences in spectral width show a linear relationship with wind speed, with the greatest differences at the greatest wind speeds. The differences in spectral width show a positive correlation with the differences in backscattered power. The anisotropy in backscattered power is well-known and is usually attributed to aspect sensitivity effects. However, the anisotropy in spectral width does not appear to be due to the same mechanism, and while several hypotheses to account for this are considered, including finite range-volume effects, effects from the tilting of isentropic layers, and anisotropic turbulence effects, it is seen that each of these suggestions has its shortcomings.

    Key words. Meteorology and atmospheric dynamics (turbulence; instruments and techniques

  6. Study of CNT growth using nanocatalyst Ag precursor by HWC-VHF-PECVD

    Energy Technology Data Exchange (ETDEWEB)

    Eliyana, Ajeng; Rosikin, Ahmad; Winata, Toto, E-mail: toto@fi.itb.ac.id [Physics of Electronics Material Research Division, Physics Programme, Faculty of Mathematics and Natural Sciences, Institut Teknologi Bandung, Jl. Ganesha 10, Bandung 40132, West Java (Indonesia)

    2015-04-16

    The study of CNT growth has been done by using silver (Ag) nanocatalyst as a guide precursor on corning glass 7059 substrate. The silver catalyst was prepared by the evaporation method by varying deposition time for 50, 25, and 14 seconds. The silver films were then annealed at temperature of 400°C for 4 hours. From Scanning Electron Microscope (SEM) and Energy Dispersive X-ray Spectroscopy (EDX) results the grain sizes are 65 nm, 57 nm, and 33 nm, and also the atomic compositions are 6,06%, 4,52%, and 3,73% for 14, 25 and 50 seconds samples, respectively. The 33 nm samples were then used for CNT growth by using Hot Wire Cell (HWC) – Very High Frequency (VHF) – Plasma Enhanced Chemical Vapor Deposition (PECVD) at 275 ° C deposition temperature and pressure of 300 mTorr. The rf power was varied from 8 to 20 watts, with deposition time for 60 minutes. The methane (CH4) 99.999% was used as Carbon sources. Hydrogen gas (H2) was used to etch the oxide layer formed during the pre-deposition process. The diameter and length for the CNT are 125 nm and 1.650 to 2.989 nm respectively.

  7. On the VHF source retrieval errors associated with Lightning Mapping Arrays (LMAs)

    Science.gov (United States)

    Koshak, W. J.

    2016-12-01

    A common method for retrieving the lightning Very High Frequency (VHF) radio source (x, y, z, t) emission is to minimize a (reduced) chi-squared function that indicates how well the model arrival times associated with the model source represent the arrival time measurements at each Lightning Mapping Array (LMA) site. The Levenberg-Marquardt (LM) algorithm is usually employed to find the minimum of the chi-squared function, and the model source producing this minimum is considered to be the optimal source solution. Because the chi-squared mathematical surface is nonlinear, it is important to feed the LM algorithm an accurate initial guess (xo, yo, zo, to) in parameter space to avoid parameter searches that terminate at a relative minima of the chi-squared surface. Source initialization is commonly performed using a linear retrieval algorithm first introduced in Koshak and Solakiewicz (1996), and further applied in Koshak et al. (2004). Monte Carlo simulations and theoretical inferences both show that source retrieval errors (particularly source altitude errors) increase with horizontal source range. In the present study, the effect of modifying certain elements of the retrieval (i. e., the LMA site locations, the number of sites employed, and the retrieval algorithm characteristics) are examined to assess and quantify associated improvements in retrieval results.

  8. Signal processing techniques for phase-coded HF-VHF radars

    Directory of Open Access Journals (Sweden)

    J. A. Baskaradas

    2003-06-01

    Full Text Available HF-VHF radar techniques are easy to employ and commonly used in geophysical applications. They include deep radio soundings, used for probing the ionosphere, stratosphere-mesosphere measurement, weather forecast and radio-glaciology. Fast algorithms and powerful processors facilitate the development of several kinds of low power radars, but the reduction of the transmitted power has to be compensated by on-line processing of an encoded signal to maintain a favorable signal-to-noise ratio suitable for detection. Moreover, radars have to reconstruct return echoes with different travel times due to various origins (multi-path, adjacent objects, etc.. Such needs can be accomplished by means of signal phase coding and one of the most attractive is the reversal phase code. The composite echo signal must be processed to extract the physical information useful for the measurement considered. In this paper some algorithms used for on-line processing of phase-coded signals will be described, both in time and frequency domain.

  9. Multi-contrast imaging of human posterior eye by Jones matrix optical coherence tomography

    Science.gov (United States)

    Yasuno, Yoshiaki

    2017-04-01

    A multi-contrast imaging of pathologic posterior eyes is demonstrated by Jones matrix optical coherence tomography (Jones matrix OCT). The Jones matrix OCT provides five tomographies, which includes scattering, local attenuation, birefringence, polarization uniformity, and optical coherence angiography, by a single scan. The hardware configuration, algorithms of the Jones matrix OCT as well as its application to ophthalmology is discussed.

  10. Simultaneous coherent imaging and strain measurement using coupled photorefractive holography and shearography.

    Science.gov (United States)

    Rosso, Vanessa; Béland, Rémy; Renotte, Yvon; Habraken, Serge; Lion, Yves; Charette, Paul

    2008-04-15

    By coupling photorefractive holography with speckle shearography, it is possible to simultaneously perform both coherent imaging and strain measurement. Use of the photorefractive effect, which is insensitive to incoherently scattered light, is a significant advantage in coherent imaging as described. Experimental results obtained from a centrally loaded steel plate are presented.

  11. Measuring coherence with entanglement concurrence

    Science.gov (United States)

    Qi, Xianfei; Gao, Ting; Yan, Fengli

    2017-07-01

    Quantum coherence is a fundamental manifestation of the quantum superposition principle. Recently, Baumgratz et al (2014 Phys. Rev. Lett. 113 140401) presented a rigorous framework to quantify coherence from the view of theory of physical resource. Here we propose a new valid quantum coherence measure which is a convex roof measure, for a quantum system of arbitrary dimension, essentially using the generalized Gell-Mann matrices. Rigorous proof shows that the proposed coherence measure, coherence concurrence, fulfills all the requirements dictated by the resource theory of quantum coherence measures. Moreover, strong links between the resource frameworks of coherence concurrence and entanglement concurrence is derived, which shows that any degree of coherence with respect to some reference basis can be converted to entanglement via incoherent operations. Our work provides a clear quantitative and operational connection between coherence and entanglement based on two kinds of concurrence. This new coherence measure, coherence concurrence, may also be beneficial to the study of quantum coherence.

  12. Higher twist, heavy quark, and coherent phenomena in QCD

    Energy Technology Data Exchange (ETDEWEB)

    Brodsky, S.J.

    1984-09-01

    Scaling violations in QCD arise in two basic ways: (1) logarithmic corrections, associated with the variation of the running coupling constant and the radiative corrections which produce structure- and fragmentation-function evolution; and (2) power-law corrections, due to finite mass effects, multiparticle scattering processes, coherent wavefunction effects, and other non-perturbative phenomena. Aspects are briefly discussed.

  13. Arctic and Antarctic polar mesosphere summer echoes observed with oblique incidence HF radars: analysis using simultaneous MF and VHF radar data

    Directory of Open Access Journals (Sweden)

    T. Ogawa

    2004-12-01

    Full Text Available Polar mesosphere summer echoes (PMSEs have been well studied using vertical incidence VHF radars at northern high-latitudes. In this paper, two PMSE events detected with the oblique incidence SuperDARN HF radars at Hankasalmi, Finland (62.3° N and Syowa Station, Antarctica (69.0° S, are analyzed, together with simultaneous VHF and medium-frequency (MF radar data. Altitude resolutions of the HF radars in the mesosphere and the lower thermosphere are too poor to know exact PMSE altitudes. However, a comparison of Doppler velocity from the HF radar and neutral wind velocity from the MF radar shows that PMSEs at the HF band appeared at altitudes within 80-90km, which are consistent with those from previous vertical incidence HF-VHF radar results. The HF-VHF PMSE occurrences exhibit a semidiurnal behavior, as observed by other researchers. It is found that in one event, PMSEs occurred when westward semidiurnal winds with large amplitude at 85-88km altitudes attained a maximum. When the HF-VHF PMSEs were observed at distances beyond 180km from MF radar sites, the MF radars detected no appreciable signatures of echo enhancement. Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; thermospheric dynamics; waves and tides

  14. Arctic and Antarctic polar mesosphere summer echoes observed with oblique incidence HF radars: analysis using simultaneous MF and VHF radar data

    Directory of Open Access Journals (Sweden)

    T. Ogawa

    2004-12-01

    Full Text Available Polar mesosphere summer echoes (PMSEs have been well studied using vertical incidence VHF radars at northern high-latitudes. In this paper, two PMSE events detected with the oblique incidence SuperDARN HF radars at Hankasalmi, Finland (62.3° N and Syowa Station, Antarctica (69.0° S, are analyzed, together with simultaneous VHF and medium-frequency (MF radar data. Altitude resolutions of the HF radars in the mesosphere and the lower thermosphere are too poor to know exact PMSE altitudes. However, a comparison of Doppler velocity from the HF radar and neutral wind velocity from the MF radar shows that PMSEs at the HF band appeared at altitudes within 80-90km, which are consistent with those from previous vertical incidence HF-VHF radar results. The HF-VHF PMSE occurrences exhibit a semidiurnal behavior, as observed by other researchers. It is found that in one event, PMSEs occurred when westward semidiurnal winds with large amplitude at 85-88km altitudes attained a maximum. When the HF-VHF PMSEs were observed at distances beyond 180km from MF radar sites, the MF radars detected no appreciable signatures of echo enhancement.

    Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; thermospheric dynamics; waves and tides

  15. Coherent Polariton Laser

    Science.gov (United States)

    Kim, Seonghoon; Zhang, Bo; Wang, Zhaorong; Fischer, Julian; Brodbeck, Sebastian; Kamp, Martin; Schneider, Christian; Höfling, Sven; Deng, Hui

    2016-01-01

    The semiconductor polariton laser promises a new source of coherent light, which, compared to conventional semiconductor photon lasers, has input-energy threshold orders of magnitude lower. However, intensity stability, a defining feature of a coherent state, has remained poor. Intensity noise many times the shot noise of a coherent state has persisted, attributed to multiple mechanisms that are difficult to separate in conventional polariton systems. The large intensity noise, in turn, limits the phase coherence. Thus, the capability of the polariton laser as a source of coherence light is limited. Here, we demonstrate a polariton laser with shot-noise-limited intensity stability, as expected from a fully coherent state. This stability is achieved by using an optical cavity with high mode selectivity to enforce single-mode lasing, suppress condensate depletion, and establish gain saturation. Moreover, the absence of spurious intensity fluctuations enables the measurement of a transition from exponential to Gaussian decay of the phase coherence of the polariton laser. It suggests large self-interaction energies in the polariton condensate, exceeding the laser bandwidth. Such strong interactions are unique to matter-wave lasers and important for nonlinear polariton devices. The results will guide future development of polariton lasers and nonlinear polariton devices.

  16. Coherent Polariton Laser

    Directory of Open Access Journals (Sweden)

    Seonghoon Kim

    2016-03-01

    Full Text Available The semiconductor polariton laser promises a new source of coherent light, which, compared to conventional semiconductor photon lasers, has input-energy threshold orders of magnitude lower. However, intensity stability, a defining feature of a coherent state, has remained poor. Intensity noise many times the shot noise of a coherent state has persisted, attributed to multiple mechanisms that are difficult to separate in conventional polariton systems. The large intensity noise, in turn, limits the phase coherence. Thus, the capability of the polariton laser as a source of coherence light is limited. Here, we demonstrate a polariton laser with shot-noise-limited intensity stability, as expected from a fully coherent state. This stability is achieved by using an optical cavity with high mode selectivity to enforce single-mode lasing, suppress condensate depletion, and establish gain saturation. Moreover, the absence of spurious intensity fluctuations enables the measurement of a transition from exponential to Gaussian decay of the phase coherence of the polariton laser. It suggests large self-interaction energies in the polariton condensate, exceeding the laser bandwidth. Such strong interactions are unique to matter-wave lasers and important for nonlinear polariton devices. The results will guide future development of polariton lasers and nonlinear polariton devices.

  17. Coherence in Industrial Transformation

    DEFF Research Database (Denmark)

    Jørgensen, Ulrik; Lauridsen, Erik Hagelskjær

    2003-01-01

    The notion of coherence is used to illustrate the general finding, that the impact of environmental management systems and environmental policy is highly dependent of the context and interrelatedness of the systems, procedures and regimes established in society....

  18. VCSEL Based Coherent PONs

    DEFF Research Database (Denmark)

    Jensen, Jesper Bevensee; Rodes, Roberto; Caballero Jambrina, Antonio

    2014-01-01

    We present a review of research performed in the area of coherent access technologies employing vertical cavity surface emitting lasers (VCSELs). Experimental demonstrations of optical transmission over a passive fiber link with coherent detection using VCSEL local oscillators and directly...... modulated VCSEL transmitters at bit rates up to 10 Gbps in the C-band as well as in the O-band are presented. The broad linewidth and frequency chirp associated with directly modulated VCSELs are utilized in an envelope detection receiver scheme which is demonstrated digitally (off-line) as well as analog...... (real-time). Additionally, it is shown that in the optical front-end of a coherent receiver for access networks, the 90 ° hybrid can be replaced by a 3-dB coupler. The achieved results show that VCSELs are attractive light source candidates for transmitter as well as local oscillator for coherent...

  19. Effect of solar and magnetic activity on VHF scintillations near the equatorial anomaly crest

    Directory of Open Access Journals (Sweden)

    R. P. Singh

    2004-09-01

    Full Text Available The VHF amplitude scintillation recorded during the period January 1991 to December 1993 in the declining phase of a solar cycle and April 1998 to December 1999 in the ascending phase of the next solar cycle at Varanasi (geogr. lat.=25.3°, long.=83.0°, dip=37°N have been analyzed to study the behavior of ionospheric irregularities during active solar periods and magnetic storms. It is shown that irregularities occur at arbitrary times and may last for <30min. A rise in solar activity increases scintillations during winter (November-February and near equinoxes (March-April; September-October, whereas it depresses the scintillations during the summer (May-July. In general, the role of magnetic activity is to suppress scintillations in the pre-midnight period and to increase it in the post-midnight period during equinox and winter seasons, whilst during summer months the effect is reversed. The pre-midnight scintillation is sometimes observed when the main phase of Dst corresponds to the pre-midnight period. The annual variation shows suppression of scintillations on disturbed days, both during pre-midnight and post-midnight period, which becomes more effective during years of high solar activity. It is observed that for magnetic storms for which the recovery phase starts post-midnight, the probability of occurrence of irregularities is enhanced during this time. If the magnetic storm occurred during daytime, then the probability of occurrence of scintillations during the night hours is decreased. The penetration of magnetospheric electric fields to the magnetic equator affects the evolution of low-latitude irregularities. A delayed disturbance dynamo electric field also affects the development of irregularities.

  20. Simulation of Controller Pilot Data Link Communications over VHF Digital Link Mode 3

    Science.gov (United States)

    Bretmersky, Steven C.; Murawski, Robert; Nguyen, Thanh C.; Raghavan, Rajesh S.

    2004-01-01

    The Federal Aviation Administration (FAA) has established an operational plan for the future Air Traffic Management (ATM) system, in which the Controller Pilot Data Link Communications (CPDLC) is envisioned to evolve into digital messaging that will take on an ever increasing role in controller to pilot communications, significantly changing the way the National Airspace System (NAS) is operating. According to FAA, CPDLC represents the first phase of the transition from the current analog voice system to an International Civil Aviation Organization (ICAO) compliant system in which digital communication becomes the alternate and perhaps primary method of routine communication. The CPDLC application is an Air Traffic Service (ATS) application in which pilots and controllers exchange messages via an addressed data link. CPDLC includes a set of clearance, information, and request message elements that correspond to existing phraseology employed by current Air Traffic Control (ATC) procedures. These message elements encompass altitude assignments, crossing constraints, lateral deviations, route changes and clearances, speed assignments, radio frequency assignments, and various requests for information. The pilot is provided with the capability to respond to messages, to request clearances and information, to report information, and to declare/rescind an emergency. A 'free text' capability is also provided to exchange information not conforming to defined formats. This paper presents simulated results of the aeronautical telecommunication application Controller Pilot Data Link Communications over VHF Digital Link Mode 3 (VDL Mode 3). The objective of this simulation study was to determine the impact of CPDLC traffic loads, in terms of timely message delivery and capacity of the VDL Mode 3 subnetwork. The traffic model is based on and is used for generating air/ground messages with different priorities. Communication is modeled for the en route domain of the Cleveland

  1. Seasonal and diurnal changes in wind variability from Flatland VHF profiler observations

    Energy Technology Data Exchange (ETDEWEB)

    Nastrom, G.D. [Saint Cloud State Univ., MN (United States). Dept. of Earth Sci.; Clark, W.L. [National Oceanic and Atmospheric Administration, Boulder, CO (United States). Aeronomy Lab.; Zandt, T.E. van [National Oceanic and Atmospheric Administration, Boulder, CO (United States). Aeronomy Lab.; Warnock, J.M. [National Oceanic and Atmospheric Administration, Boulder, CO (United States). Aeronomy Lab.

    1996-02-01

    Climatological results are presented on the hourly variance of the wind observed in the mid-troposphere (3 to 9 km MSL). This quantity roughly indicates the energy in the atmospheric wind field for variations with periods roughly less than 1 hour. Observations are from the Flatland VHF research wind profiler, located near Champaign/Urbana, Illinois, well away from significant orographic features. The period of record covers two years, September 1990 through August 1992. The values of the variance of the winds along vertical and oblique (15 degrees from zenith in the cardinal directions) beams are presented versus height, season, time-of-day, and beam pointing direction. It is found that the hourly variance values have approximately lognormal frequency distribution. The mean hourly variance is significantly larger for the oblique wind observations than for the vertical. Mean wind variances also tend to be larger in the east/west steering plane than in the north/south plane. The mean variance generally increases with height, but faster than would be expected if it were due solely to the decrease in atmospheric density, implying the presence of local source/sinks of wind energy. The rate of change with height is noticeably different for the vertical and oblique beams, being much less for the vertical beam, in some seasons even decreasing with height. With respect to season, the mean hourly variance is smallest in the summer and largest in the winter. With respect to diurnal changes, the variance is maximum during the afternoon for spring, summer, and autumn, with the maximum up to a factor of two larger than the minimum. In winter, the diurnal change is much smaller, with little indication of an afternoon maximum. (orig.)

  2. VHF radar observations of turbulent structures in the polar mesopause region

    Directory of Open Access Journals (Sweden)

    P. Czechowsky

    Full Text Available The mobile SOUSY VHF Radar was operated in the summer of 1987 during the MAC/SINE campaign in northern Norway to study the polar mesosphere summer echoes (PMSE. Measurements of the spectral width indicate that two types of structures occur. In general mesospheric layers are bifurcated exhibiting a narrow spectral width and a well-defined aspect sensitivity. However, for about 10% of the observation time cells of enhanced turbulence characterized by extremely broad spectral widths appear predominantly in the upper sublayer above 86 km. Identification and separation of beam and shear broadening allows a determination of the turbulence-induced component of the spectral width. This case study reveals that during several events these cloud-like structures of enhanced turbulence move with an apparent velocity of several tens of meters per second which is almost identical with the phase trace velocity of simultaneously observed waves. Since, at that time, the Richardson number was less than a quarter, it was concluded that these turbulent cells were generated by a Kelvin-Helmholtz mechanism. The horizontal extent of these structures was calculated to be less than 40 km. A general relation between spectral width and echo power was not detected. The turbulent component of the spectral width was used to calculate typical values of the energy dissipation rate at times where narrow spectral width dominates and during periods of enhanced turbulence. In addition, the outer scale of the inertial subrange (buoyancy scale was estimated. For the first time the occurrence and motion of this type of structures of enhanced spectral width is analyzed and discussed in detail.

  3. VHF radar observations of turbulent structures in the polar mesopause region

    Directory of Open Access Journals (Sweden)

    P. Czechowsky

    1997-08-01

    Full Text Available The mobile SOUSY VHF Radar was operated in the summer of 1987 during the MAC/SINE campaign in northern Norway to study the polar mesosphere summer echoes (PMSE. Measurements of the spectral width indicate that two types of structures occur. In general mesospheric layers are bifurcated exhibiting a narrow spectral width and a well-defined aspect sensitivity. However, for about 10% of the observation time cells of enhanced turbulence characterized by extremely broad spectral widths appear predominantly in the upper sublayer above 86 km. Identification and separation of beam and shear broadening allows a determination of the turbulence-induced component of the spectral width. This case study reveals that during several events these cloud-like structures of enhanced turbulence move with an apparent velocity of several tens of meters per second which is almost identical with the phase trace velocity of simultaneously observed waves. Since, at that time, the Richardson number was less than a quarter, it was concluded that these turbulent cells were generated by a Kelvin-Helmholtz mechanism. The horizontal extent of these structures was calculated to be less than 40 km. A general relation between spectral width and echo power was not detected. The turbulent component of the spectral width was used to calculate typical values of the energy dissipation rate at times where narrow spectral width dominates and during periods of enhanced turbulence. In addition, the outer scale of the inertial subrange (buoyancy scale was estimated. For the first time the occurrence and motion of this type of structures of enhanced spectral width is analyzed and discussed in detail.

  4. Statistics of 150-km echoes over Jicamarca based on low-power VHF observations

    Directory of Open Access Journals (Sweden)

    J. L. Chau

    2006-07-01

    Full Text Available In this work we summarize the statistics of the so-called 150-km echoes obtained with a low-power VHF radar operation at the Jicamarca Radio Observatory (11.97 S, 76.87 W, and 1.3 dip angle at 150-km altitude in Peru. Our results are based on almost four years of observations between August 2001 and July 2005 (approximately 150 days per year. The majority of the observations have been conducted between 08:00 and 17:00 LT. We present the statistics of occurrence of the echoes for each of the four seasons as a function of time of day and altitude. The occurrence frequency of the echoes is ~75% around noon and start decreasing after 15:00 LT and disappear after 17:00 LT in all seasons. As shown in previous campaign observations, the 150-echoes appear at a higher altitude (>150 km in narrow layers in the morning, reaching lower altitudes (~135 km around noon, and disappear at higher altitudes (>150 km after 17:00 LT. We show that although 150-km echoes are observed all year long, they exhibit a clear seasonal variability on altitudinal coverage and the percentage of occurrence around noon and early in the morning. We also show that there is a strong day-to-day variability, and no correlation with magnetic activity. Although our results do not solve the 150-km riddle, they should be taken into account when a reasonable theory is proposed.

  5. Cut-off low monitoring by the French VHF-ST-radar network during the ESTIME campaign

    Science.gov (United States)

    Caccia, J.-L.; Bertin, F.; Campistron, B.; Klaus, V.; Pointin, Y.; van Baelen, J.; Wilson, R.

    2000-05-01

    In order to investigate mesoscale strato-tropospheric exchanges, the field campaign `Echanges Stratosphère-Troposphère: Investigations à Moyenne Echelle' was conducted in France from late 1993 to mid 1995 and focused on cut-off low events. It involved the French research network of five VHF (Very High Frequency) ST (Strato-Tropospheric) radars deployed in southern France. Observations corresponding to three Intensive Observing Periods are reported here. The radar data analyzed and discussed are time-height diagrams of the aspect ratio (AR), that is, the vertical to oblique beam-returned power ratio, used for monitoring three cut-off low events. In order to discuss the validity of the method, 506 h of radar AR data were compared with time-height diagrams of the static stability and the humidity obtained from synoptic European Center for Medium-range Weather Forecasts model analyses. A dataset corresponding to 297 h of observations is analyzed and discussed here. It is concluded that the AR is a good tracer to document cut-off low events, including tropopause folding identification and the detection of tropospheric air masses of enhanced stability, in dry or weakly humid cases. On the other hand, although the effects of the specific humidity and its gradients on VHF radar echo power could not be extensively investigated, our results suggest that the same parameter cannot be used at mid- and lower-tropospheric levels when the effects of specific humidity significantly reinforce the moist static stability. It is important to take into account these insights in the context of future observing campaigns in which a network of VHF-ST-radars will be involved, and where their role will be to observe and to document the evolution of upper-level features or potential vorticity streamers, or more generally stratospheric-tropospheric exchanges.

  6. Interferometric visibility and coherence

    Science.gov (United States)

    Biswas, Tanmoy; García Díaz, María; Winter, Andreas

    2017-07-01

    Recently, the basic concept of quantum coherence (or superposition) has gained a lot of renewed attention, after Baumgratz et al. (Phys. Rev. Lett. 113, 140401. (doi:10.1103/PhysRevLett.113.140401)), following Åberg (http://arxiv.org/abs/quant-ph/0612146), have proposed a resource theoretic approach to quantify it. This has resulted in a large number of papers and preprints exploring various coherence monotones, and debating possible forms for the resource theory. Here, we take the view that the operational foundation of coherence in a state, be it quantum or otherwise wave mechanical, lies in the observation of interference effects. Our approach here is to consider an idealized multi-path interferometer, with a suitable detector, in such a way that the visibility of the interference pattern provides a quantitative expression of the amount of coherence in a given probe state. We present a general framework of deriving coherence measures from visibility, and demonstrate it by analysing several concrete visibility parameters, recovering some known coherence measures and obtaining some new ones.

  7. Scattering of electromagnetic waves from a half space of densely distributed dielectric scatterers

    Science.gov (United States)

    Tsang, L.; Kong, J. A.

    1983-01-01

    The scattering of a plane wave obliquely incident on a half space of densely distributed spherical dielectric scatterers is studied. The quasi-crystalline approximation is applied to truncate the hierarchy of multiple scattering equations, and the Percus-Yevick and the Verlet-Weis results are used to represent the pair distribution function. The coherent reflected wave is studied with these approximations. The incoherent scattered wave is calculated with the distorted Born approximation. In the low-frequency limit, closed-form expressions are obtained for the effective propagation constants, the coherent reflected wave, and the bistatic scattering coeficients. Results at higher frequencies are calculated numerically. The advantage of the present approach is that, in the low-frequency limit, it reproduces the effects of specular reflection, Fresnel reflection coefficient, Brewster angle, and Clausius-Mosotti relation. In addition to the classical results, the bistatic scattering coefficients are also calculated. The theory is also applied to match backscattering data from dry snow at microwave frequencies.

  8. Deeply virtual Compton scattering off nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Voutier, Eric

    2009-01-01

    Deeply virtual Compton scattering (DVCS) is the golden exclusive channel for the study of the partonic structure of hadrons, within the universal framework of generalized parton distributions (GPDs). This paper presents the aim and general ideas of the DVCS experimental program off nuclei at the Jefferson Laboratory. The benefits of the study of the coherent and incoherent channels to the understanding of the EMC (European Muon Collaboration) effect are discussed, along with the case of nuclear targets to access neutron GPDs.

  9. On scattered subword complexity

    CERN Document Server

    Kása, Zoltán

    2011-01-01

    Special scattered subwords, in which the gaps are of length from a given set, are defined. The scattered subword complexity, which is the number of such scattered subwords, is computed for rainbow words.

  10. Development of a passive VHF radar system using software-defined radio for equatorial plasma instability studies

    Science.gov (United States)

    Tuysuz, B.; Urbina, J.; Lind, F. D.

    2013-07-01

    In this paper, a bistatic passive radar receiver system named "Coherent-scatter Atmospheric Passive Radar Imager (CAPRI)" is described. It is primarily designed to study the dynamics of the upper atmosphere by utilizing "transmitters of opportunity" as the RF target illuminators. CAPRI is constructed using the open source software-defined radio toolkit, GNU Radio, to meet the signal processing requirements in combination with the open source hardware, Universal Software Radio Peripheral 2, for data acquisition. The resultant system is highly flexible, and we present the details of the design as well as a performance analysis. CAPRI will be deployed in Peru, near the magnetic equator, for long-term operations in the area. FM stations near Lima, Peru, will be utilized with the targets of interest being the equatorial electrojet and the spread F. The results will then be compared to the Jicamarca Unattended Long-term investigations of the Ionosphere and Atmosphere (JULIA) radar data, and CAPRI will be used to improve the simultaneous time and spatial coverage in the region in a more cost-effective manner.

  11. Homometry in the light of coherent beams.

    Science.gov (United States)

    Ravy, Sylvain

    2013-11-01

    Two systems are homometric if they are indistinguishable by diffraction. A distinction is first made between Bragg and diffuse scattering homometry, and it is shown that in the last case coherent diffraction can allow the diffraction diagrams to be differentiated. The study of the Rudin-Shapiro sequence, homometric to random sequences, allows one to manipulate independently two-point and four-point correlation functions, and to show their effect on the statistics of speckle patterns. This study provides evidence that long-range order in high-order correlation functions has a measurable effect on the speckle statistics.

  12. Coherent collisional spin dynamics in optical lattices.

    Science.gov (United States)

    Widera, Artur; Gerbier, Fabrice; Fölling, Simon; Gericke, Tatjana; Mandel, Olaf; Bloch, Immanuel

    2005-11-04

    We report on the observation of coherent, purely collisionally driven spin dynamics of neutral atoms in an optical lattice. For high lattice depths, atom pairs confined to the same lattice site show weakly damped Rabi-type oscillations between two-particle Zeeman states of equal magnetization, induced by spin-changing collisions. Moreover, measurement of the oscillation frequency allows for precise determination of the spin-changing collisional coupling strengths, which are directly related to fundamental scattering lengths describing interatomic collisions at ultracold temperatures.

  13. Compact fibre-based coherent anti-Stokes Raman scattering ...

    Indian Academy of Sciences (India)

    Abstract. We demonstrate a new approach to CARS spectroscopy by efficiently syn- thesizing synchronized narrow-bandwidth (less than 10 cm−1) pump and Stokes pulses. (frequency difference continuously tunable upto ~3000 cm−1) based on spectral compres- sion together with second harmonic generation (in ...

  14. Compact fibre-based coherent anti-Stokes Raman scattering ...

    Indian Academy of Sciences (India)

    We demonstrate a new approach to CARS spectroscopy by efficiently synthesizing synchronized narrow-bandwidth (less than 10 cm-1) pump and Stokes pulses (frequency difference continuously tunable upto ∼ 3000 cm-1) based on spectral compression together with second harmonic generation (in periodically-poled ...

  15. On measuring the neutron coherent scattering length with ultrahigh ...

    Indian Academy of Sciences (India)

    to account for the neutron beam refraction at the sample-ambient interfaces, to infer the correct bc from the observed phase. The formula for the phase used hitherto is approxi- mate and would significantly overestimate bc. The refractive index for neutrons can thus be determined to a phenomenal precision of a few parts in ...

  16. Retrieving time-dependent Green's functions in optics with low-coherence interferometry.

    Science.gov (United States)

    Badon, Amaury; Lerosey, Geoffroy; Boccara, Albert C; Fink, Mathias; Aubry, Alexandre

    2015-01-16

    We report on the passive measurement of time-dependent Green's functions in the optical frequency domain with low-coherence interferometry. Inspired by previous studies in acoustics and seismology, we show how the correlations of a broadband and incoherent wave field can directly yield the Green's functions between scatterers of a complex medium. Both the ballistic and multiple scattering components of the Green's function are retrieved. This approach opens important perspectives for optical imaging and characterization in complex scattering media.

  17. Bidirectional optical scattering facility

    Data.gov (United States)

    Federal Laboratory Consortium — Goniometric optical scatter instrument (GOSI)The bidirectional reflectance distribution function (BRDF) quantifies the angular distribution of light scattered from a...

  18. Advanced modelling of optical coherence tomography systems

    DEFF Research Database (Denmark)

    Andersen, Peter E.; Thrane, L.; Yura, H.T.

    2004-01-01

    Analytical and numerical models for describing and understanding the light propagation in samples imaged by optical coherence tomography (OCT) systems are presented. An analytical model for calculating the OCT signal based on the extended Huygens–Fresnel principle valid both for the single...... and multiple scattering regimes is reviewed. An advanced Monte Carlo model for calculating the OCT signal is also reviewed, and the validity of this model is shown through a mathematical proof based on the extended Huygens–Fresnel principle. Moreover, for the first time the model is verified experimentally....... From the analytical model, an algorithm for enhancing OCT images is developed; the so-called true-reflection algorithm in which the OCT signal may be corrected for the attenuation caused by scattering. For the first time, the algorithm is demonstrated by using the Monte Carlo model as a numerical...

  19. Multi-Frequency Investigation into Scattering from Vegetation over the Growth Cycle

    Science.gov (United States)

    Lang, R. H.; Kurum, M.; O'Neill, P. E.; Joseph, A. T.; Deshpande, M. D.; Cosh, M. H.

    2016-01-01

    In this investigation, we aim to collect and use time-series multi-frequency microwave data over winter wheat during entire growth cycle to characterize vegetation dynamics and to quantify its effects on soil moisture retrievals. We plan to incorporate C-band radar and VHF receiver within the existing L-band radarradiometer system called ComRAD (SMAPs ground based simulator). With C-bands ability to sense vegetation details and VHFs root-zone soil moisture within ComRADs footprint, we will be able to test our discrete scatterer vegetation models and parameters at various surface conditions. The purpose of this study is to determine optical depth and effective scattering albedo of vegetation of a given type (i.e. winter wheat) at various stages of growth that are need to refine soil moisture retrieval algorithms being developed for the SMAP mission.

  20. Stimulated coherent transition radiation

    Energy Technology Data Exchange (ETDEWEB)

    Hung-chi Lihn

    1996-03-01

    Coherent radiation emitted from a relativistic electron bunch consists of wavelengths longer than or comparable to the bunch length. The intensity of this radiation out-numbers that of its incoherent counterpart, which extends to wavelengths shorter than the bunch length, by a factor equal to the number of electrons in the bunch. In typical accelerators, this factor is about 8 to 11 orders of magnitude. The spectrum of the coherent radiation is determined by the Fourier transform of the electron bunch distribution and, therefore, contains information of the bunch distribution. Coherent transition radiation emitted from subpicosecond electron bunches at the Stanford SUNSHINE facility is observed in the far-infrared regime through a room-temperature pyroelectric bolometer and characterized through the electron bunch-length study. To measure the bunch length, a new frequency-resolved subpicosecond bunch-length measuring system is developed. This system uses a far-infrared Michelson interferometer to measure the spectrum of coherent transition radiation through optical autocorrelation with resolution far better than existing time-resolved methods. Hence, the radiation spectrum and the bunch length are deduced from the autocorrelation measurement. To study the stimulation of coherent transition radiation, a special cavity named BRAICER is invented. Far-infrared light pulses of coherent transition radiation emitted from electron bunches are delayed and circulated in the cavity to coincide with subsequent incoming electron bunches. This coincidence of light pulses with electron bunches enables the light to do work on electrons, and thus stimulates more radiated energy. The possibilities of extending the bunch-length measuring system to measure the three-dimensional bunch distribution and making the BRAICER cavity a broadband, high-intensity, coherent, far-infrared light source are also discussed.

  1. Antenna array geometry optimization for a passive coherent localisation system

    Science.gov (United States)

    Knott, Peter; Kuschel, Heiner; O'Hagan, Daniel

    2012-11-01

    Passive Coherent Localisation (PCL), also known as Passive Radar, making use of RF sources of opportunity such as Radio or TV Broadcasting Stations, Cellular Phone Network Base Stations, etc. is an advancing technology for covert operation because no active radar transmitter is required. It is also an attractive addition to existing active radar stations because it has the potential to discover low-flying and low-observable targets. The CORA (Covert Radar) experimental passive radar system currently developed at Fraunhofer-FHR features a multi-channel digital radar receiver and a circular antenna array with separate elements for the VHF- and the UHF-range and is used to exploit alternatively Digital Audio (DAB) or Video Broadcasting (DVB-T) signals. For an extension of the system, a wideband antenna array is being designed for which a new discone antenna element has been developed covering the full DVB-T frequency range. The present paper describes the outline of the system and the numerical modelling and optimisation methods applied to solve the complex task of antenna array design: Electromagnetic full wave analysis is required for the parametric design of the antenna elements while combinatorial optimization methods are applied to find the best array positions and excitation coefficients for a regular omni-directional antenna performance. The different steps are combined in an iterative loop until the optimum array layout is found. Simulation and experimental results for the current system will be shown.

  2. Retinal Optical Coherence Tomography Imaging

    Science.gov (United States)

    Drexler, Wolfgang; Fujimoto, James G.

    The eye is essentially transparent, transmitting light with only minimal optical attenuation and scattering providing easy optical access to the anterior segment as well as the retina. For this reason, ophthalmic and especially retinal imaging has been not only the first but also most successful clinical application for optical coherence tomography (OCT). This chapter focuses on the development of OCT technology for retinal imaging. OCT has significantly improved the potential for early diagnosis, understanding of retinal disease pathogenesis, as well as monitoring disease progression and response to therapy. Development of ultrabroad bandwidth light sources and high-speed detection techniques has enabled significant improvements in ophthalmic OCT imaging performance, demonstrating the potential of three-dimensional, ultrahigh-resolution OCT (UHR OCT) to perform noninvasive optical biopsy of the living human retina, i.e., the in vivo visualization of microstructural, intraretinal morphology in situ approaching the resolution of conventional histopathology. Significant improvements in axial resolution and speed not only enable three-dimensional rendering of retinal volumes but also high-definition, two-dimensional tomograms, topographic thickness maps of all major intraretinal layers, as well as volumetric quantification of pathologic intraretinal changes. These advances in OCT technology have also been successfully applied in several animal models of retinal pathologies. The development of light sources emitting at alternative wavelengths, e.g., around #1,060 nm, not only enabled three-dimensional OCT imaging with enhanced choroidal visualization but also improved OCT performance in cataract patients due to reduced scattering losses in this wavelength region. Adaptive optics using deformable mirror technology, with unique high stroke to correct higher-order ocular aberrations, with specially designed optics to compensate chromatic aberration of the human eye, in

  3. SAR image effects on coherence and coherence estimation.

    Energy Technology Data Exchange (ETDEWEB)

    Bickel, Douglas Lloyd

    2014-01-01

    Radar coherence is an important concept for imaging radar systems such as synthetic aperture radar (SAR). This document quantifies some of the effects in SAR which modify the coherence. Although these effects can disrupt the coherence within a single SAR image, this report will focus on the coherence between separate images, such as for coherent change detection (CCD) processing. There have been other presentations on aspects of this material in the past. The intent of this report is to bring various issues that affect the coherence together in a single report to support radar engineers in making decisions about these matters.

  4. Lightning VHF radiation location system based on short-baseline TDOA technique — Validation in rocket-triggered lightning

    Science.gov (United States)

    Sun, Zhuling; Qie, Xiushu; Liu, Mingyuan; Cao, Dongjie; Wang, Dongfang

    2013-07-01

    A lightning VHF radiation location system based on short-baseline time-difference of arrival (TDOA) technology is newly developed. Based on the orthogonal 10 m-baseline antenna array with four identical broadband flat plane antennas, this system receives the lightning broadband VHF radiation signals and calculates TDOA between antennas in order to determine the location of lightning radiation sources in two dimensions (elevation and azimuth). To reduce noise and improve estimation accuracy of time delay, a general correlation time delay estimation algorithm based on direct correlation method and wavelet transform is proposed. Moreover, parabolic interpolation algorithm is used in the fractional delay estimation to improve the time resolution of the positioning system. In this paper, a rocket-triggered lightning discharge and a cloud lightning discharge are analyzed respectively, combining with simultaneous observations of high-speed camera and fast/slow electric field changes. The results indicate that the TDOA location system could effectively map the lightning radiation sources in 2 dimensions and are in a good agreement with the high-speed video camera images.

  5. Pulsed holographic system for imaging through spatially extended scattering media

    Science.gov (United States)

    Kanaev, A. V.; Judd, K. P.; Lebow, P.; Watnik, A. T.; Novak, K. M.; Lindle, J. R.

    2017-10-01

    Imaging through scattering media is a highly sought capability for military, industrial, and medical applications. Unfortunately, nearly all recent progress was achieved in microscopic light propagation and/or light propagation through thin or weak scatterers which is mostly pertinent to medical research field. Sensing at long ranges through extended scattering media, for example turbid water or dense fog, still represents significant challenge and the best results are demonstrated using conventional approaches of time- or range-gating. The imaging range of such systems is constrained by their ability to distinguish a few ballistic photons that reach the detector from the background, scattered, and ambient photons, as well as from detector noise. Holography can potentially enhance time-gating by taking advantage of extra signal filtering based on coherence properties of the ballistic photons as well as by employing coherent addition of multiple frames. In a holographic imaging scheme ballistic photons of the imaging pulse are reflected from a target and interfered with the reference pulse at the detector creating a hologram. Related approaches were demonstrated previously in one-way imaging through thin biological samples and other microscopic scale scatterers. In this work, we investigate performance of holographic imaging systems under conditions of extreme scattering (less than one signal photon per pixel signal), demonstrate advantages of coherent addition of images recovered from holograms, and discuss image quality dependence on the ratio of the signal and reference beam power.

  6. Neutron scattering. Lectures

    Energy Technology Data Exchange (ETDEWEB)

    Brueckel, Thomas; Heger, Gernot; Richter, Dieter; Roth, Georg; Zorn, Reiner (eds.)

    2010-07-01

    The following topics are dealt with: Neutron sources, symmetry of crystals, diffraction, nanostructures investigated by small-angle neutron scattering, the structure of macromolecules, spin dependent and magnetic scattering, structural analysis, neutron reflectometry, magnetic nanostructures, inelastic scattering, strongly correlated electrons, dynamics of macromolecules, applications of neutron scattering. (HSI)

  7. Maintaining Web Cache Coherency

    Directory of Open Access Journals (Sweden)

    2000-01-01

    Full Text Available Document coherency is a challenging problem for Web caching. Once the documents are cached throughout the Internet, it is often difficult to keep them coherent with the origin document without generating a new traffic that could increase the traffic on the international backbone and overload the popular servers. Several solutions have been proposed to solve this problem, among them two categories have been widely discussed: the strong document coherency and the weak document coherency. The cost and the efficiency of the two categories are still a controversial issue, while in some studies the strong coherency is far too expensive to be used in the Web context, in other studies it could be maintained at a low cost. The accuracy of these analysis is depending very much on how the document updating process is approximated. In this study, we compare some of the coherence methods proposed for Web caching. Among other points, we study the side effects of these methods on the Internet traffic. The ultimate goal is to study the cache behavior under several conditions, which will cover some of the factors that play an important role in the Web cache performance evaluation and quantify their impact on the simulation accuracy. The results presented in this study show indeed some differences in the outcome of the simulation of a Web cache depending on the workload being used, and the probability distribution used to approximate updates on the cached documents. Each experiment shows two case studies that outline the impact of the considered parameter on the performance of the cache.

  8. Coherent light microscopy

    CERN Document Server

    Ferraro, Pietro; Zalevsky, Zeev

    2011-01-01

    This book deals with the latest achievements in the field of optical coherent microscopy. While many other books exist on microscopy and imaging, this book provides a unique resource dedicated solely to this subject. Similarly, many books describe applications of holography, interferometry and speckle to metrology but do not focus on their use for microscopy. The coherent light microscopy reference provided here does not focus on the experimental mechanics of such techniques but instead is meant to provide a users manual to illustrate the strengths and capabilities of developing techniques. Th

  9. Diffusion tensor optical coherence tomography

    Science.gov (United States)

    Marks, Daniel L.; Blackmon, Richard L.; Oldenburg, Amy L.

    2018-01-01

    In situ measurements of diffusive particle transport provide insight into tissue architecture, drug delivery, and cellular function. Analogous to diffusion-tensor magnetic resonance imaging (DT-MRI), where the anisotropic diffusion of water molecules is mapped on the millimeter scale to elucidate the fibrous structure of tissue, here we propose diffusion-tensor optical coherence tomography (DT-OCT) for measuring directional diffusivity and flow of optically scattering particles within tissue. Because DT-OCT is sensitive to the sub-resolution motion of Brownian particles as they are constrained by tissue macromolecules, it has the potential to quantify nanoporous anisotropic tissue structure at micrometer resolution as relevant to extracellular matrices, neurons, and capillaries. Here we derive the principles of DT-OCT, relating the detected optical signal from a minimum of six probe beams with the six unique diffusion tensor and three flow vector components. The optimal geometry of the probe beams is determined given a finite numerical aperture, and a high-speed hardware implementation is proposed. Finally, Monte Carlo simulations are employed to assess the ability of the proposed DT-OCT system to quantify anisotropic diffusion of nanoparticles in a collagen matrix, an extracellular constituent that is known to become highly aligned during tumor development.

  10. The Stonehenge technique. A method for aligning coherent bremsstrahlung radiators

    Science.gov (United States)

    Livingston, Ken

    2009-05-01

    This paper describes a technique for the alignment of crystal radiators used to produce high energy, linearly polarized photons via coherent bremsstrahlung scattering at electron beam facilities. In these experiments the crystal is mounted on a goniometer which is used to adjust its orientation relative to the electron beam. The angles and equations which relate the crystal lattice, goniometer and electron beam direction are presented here, and the method of alignment is illustrated with data taken at MAMI (the Mainz microtron). A practical guide to setting up a coherent bremsstrahlung facility and installing new crystals using this technique is also included.

  11. High-Rate Fabrication of a-Si-Based Thin-Film Solar Cells Using Large-Area VHF PECVD Processes

    Energy Technology Data Exchange (ETDEWEB)

    Deng, Xunming [University of Toledo; Fan, Qi Hua

    2011-12-31

    The University of Toledo (UT), working in concert with it’s a-Si-based PV industry partner Xunlight Corporation (Xunlight), has conducted a comprehensive study to develop a large-area (3ft x 3ft) VHF PECVD system for high rate uniform fabrication of silicon absorber layers, and the large-area VHF PECVD processes to achieve high performance a-Si/a-SiGe or a-Si/nc-Si tandem junction solar cells during the period of July 1, 2008 to Dec. 31, 2011, under DOE Award No. DE-FG36-08GO18073. The project had two primary goals: (i) to develop and improve a large area (3 ft × 3 ft) VHF PECVD system for high rate fabrication of > = 8 Å/s a-Si and >= 20 Å/s nc-Si or 4 Å/s a-SiGe absorber layers with high uniformity in film thicknesses and in material structures. (ii) to develop and optimize the large-area VHF PECVD processes to achieve high-performance a-Si/nc-Si or a-Si/a-SiGe tandem-junction solar cells with >= 10% stable efficiency. Our work has met the goals and is summarized in “Accomplishments versus goals and objectives”.

  12. Neutron scattering. Lectures

    Energy Technology Data Exchange (ETDEWEB)

    Brueckel, Thomas; Heger, Gernot; Richter, Dieter; Roth, Georg; Zorn, Reiner (eds.)

    2010-07-01

    The following topics are dealt with: Neutron sources, neutron properties and elastic scattering, correlation functions measured by scattering experiments, symmetry of crystals, applications of neutron scattering, polarized-neutron scattering and polarization analysis, structural analysis, magnetic and lattice excitation studied by inelastic neutron scattering, macromolecules and self-assembly, dynamics of macromolecules, correlated electrons in complex transition-metal oxides, surfaces, interfaces, and thin films investigated by neutron reflectometry, nanomagnetism. (HSI)

  13. Improved van Zyl Polarimetric Decomposition Lessening the Overestimation of Volume Scattering Power

    Directory of Open Access Journals (Sweden)

    Xiaoguang Cheng

    2014-07-01

    Full Text Available This paper improves van Zyl’s Nonnegative Eigenvalue Decomposition (NNED. Orientation angle compensation and helix scattering are introduced to the decomposition. The volume scattering parameters that explain the most cross-polarized power are selected. If volume scattering and helix scattering explain all cross-polarized power in the measured coherency matrix, then simply perform van Zyl decomposition to the remainder matrix; otherwise, the measured coherency matrix is decomposed into three components, i.e., helix scattering, volume scattering, and one ground scattering. The latter two scattering are all modeled by Neumann’s adaptive depolarizing model, according to which some cross-polarized power is attributed to ground scattering hence the orientation angle randomness of volume scattering and the dominant ground scattering are obtained. In this way, all cross-polarized power could be well explained. Experiments using UAVSAR data showed that more than 99.8% of total pixels are well fitted. Negative power is avoided. Compared with van Zyl decomposition, volume scattering power is reduced by up to 8.73% on average. The given volume scattering power is often lower than that by three latest NNED.

  14. Time-Resolved Speckle Analysis: A New Approach to Coherence and Dephasing of Optical Excitations in Solids

    DEFF Research Database (Denmark)

    Langbein, Wolfgang Werner; Hvam, Jørn Märcher; Zimmermann, R.

    1999-01-01

    ). This method determines the decays of intensity and coherence separately, thus distinguishing lifetime from pure dephasing. The secondary emission of excitons in semiconductor quantum wells is investigated. Here the combination of static disorder and inelastic scattering leads to a partially coherent emission...

  15. Focal Molography: Coherent Microscopic Detection of Biomolecular Interaction

    Directory of Open Access Journals (Sweden)

    Christof Fattinger

    2014-08-01

    Full Text Available We introduce and theoretically investigate here a novel analytical method that we have called focal molography, in which molecular interactions are made visible through scattering of coherent light by a coherent pattern of molecules. The scattered light quantifies the presence of molecules at molecular interaction sites. It is separated from noncoherent background scatter by a combination of local dark-field illumination, interference enhancement, and spatial filtering. The latter is achieved by holographic focusing of the wave field generated by the coherently assembled molecules onto an Airy disk and by subtraction of the noncoherent irradiance in the focal plane outside the disk from the irradiance in the disk. This new microscopic method allows distinct detection of low-refractive-index contrast in the nanoenvironment of biomolecules from which information on the interaction of the coherently assembled molecules with molecules in a liquid or gaseous sample may be deduced. The noncoherent surroundings of the coherently assembled molecules consist of freely diffusing solvent and solute molecules. The surroundings, as well as changes in temperature, do not contribute to the coherent signal in the diffraction focus. Interference lithography or high-resolution-imaging lithography can be used to synthesize the coherent pattern of molecules on a monolithic substrate. The coherent pattern of molecules constitutes a synthetic phase hologram that creates a diffraction-limited light wave. We suggest the term “mologram” for the coherent assembly of functional nanostructures and the term “focal molography” for label-free or labeled analysis of molecular interactions through the measurement of the properties of light in the focus of the mologram. We derive analytical formulas that express the detection signal and the sensitivity of focal molography on the surface of a high-refractive-index thin-film optical waveguide in terms of known parameters

  16. Dental Optical Coherence Tomography

    Directory of Open Access Journals (Sweden)

    Kun-Feng Lin

    2013-07-01

    Full Text Available This review paper describes the applications of dental optical coherence tomography (OCT in oral tissue images, caries, periodontal disease and oral cancer. The background of OCT, including basic theory, system setup, light sources, spatial resolution and system limitations, is provided. The comparisons between OCT and other clinical oral diagnostic methods are also discussed.

  17. Coherence in quantum estimation

    Science.gov (United States)

    Giorda, Paolo; Allegra, Michele

    2018-01-01

    The geometry of quantum states provides a unifying framework for estimation processes based on quantum probes, and it establishes the ultimate bounds of the achievable precision. We show a relation between the statistical distance between infinitesimally close quantum states and the second order variation of the coherence of the optimal measurement basis with respect to the state of the probe. In quantum phase estimation protocols, this leads to propose coherence as the relevant resource that one has to engineer and control to optimize the estimation precision. Furthermore, the main object of the theory i.e. the symmetric logarithmic derivative, in many cases allows one to identify a proper factorization of the whole Hilbert space in two subsystems. The factorization allows one to discuss the role of coherence versus correlations in estimation protocols; to show how certain estimation processes can be completely or effectively described within a single-qubit subsystem; and to derive lower bounds for the scaling of the estimation precision with the number of probes used. We illustrate how the framework works for both noiseless and noisy estimation procedures, in particular those based on multi-qubit GHZ-states. Finally we succinctly analyze estimation protocols based on zero-temperature critical behavior. We identify the coherence that is at the heart of their efficiency, and we show how it exhibits the non-analyticities and scaling behavior proper of a large class of quantum phase transitions.

  18. Coherent x-ray optics

    CERN Document Server

    Paganin, David M

    2006-01-01

    'Coherent X-Ray Optics' gives a thorough treatment of the rapidly expanding field of coherent x-ray optics, which has recently experienced something of a renaissance with the availability of third-generation synchrotron sources.

  19. The thermal neutron scattering cross section of {sup 86}Kr

    Energy Technology Data Exchange (ETDEWEB)

    Terburg, B.P.

    1992-05-01

    The availability of 27 1 STP krypton-86 gas, an isotope with unknown thermal neutron scattering cross section, was an excellent occasion to determine the (bound atom) scattering cross section and its coherent part by application of the neutron transmission method and neutron interferometry. The transmission method was applied in a diffractometer, a Larmor spectrometer and a TOF-spectrometer. In addition to {sup 86}Kr also natural krypton ({sup n}Kr) was used for sample in the diffractometer. The diffractometer measurements result in bound atom scattering cross sections {sigma}{sub s}=8.92(46) b for {sup 86}Kr and {sigma}{sub s}=7.08(95) b for {sup n}Kr. The Larmor transmission measurements lead to a final result {sigma}{sub s}=8.44(9) b for {sup 86}Kr. In the TOF-spectrometer the wavelength-dependent total cross section of water was determined. Coherent neutron scattering lengths were determined using the neutron interferometry method with a skew symmetric neutron interferometer. Scans with {sup 86}Kr and {sup n}Kr led to b{sub c}=8.07(26) fm for {sup 86}Kr and 7.72(33) fm for {sup n}Kr, corresponding to coherent scattering cross sections {sigma}{sub c}=8.18(53) b and 7.49(64) b respectively. Due to the large errors in the bound atom scattering cross section and coherent scattering cross section of {sup 86}Kr and {sup n}Kr, the incoherent cross section of both gases, {sigma}{sub i} = 0 within its inaccuracy, {sigma}{sub i}=0.26(54) b for {sup 86}Kr and {sigma}{sub i}=0.41(1.15) b for {sup n}Kr. (orig.).

  20. Coherent states in quantum mechanics

    CERN Document Server

    Rodrigues, R D L; Fernandes, D

    2001-01-01

    We present a review work on the coherent states is non-relativistic quantum mechanics analysing the quantum oscillators in the coherent states. The coherent states obtained via a displacement operator that act on the wave function of ground state of the oscillator and the connection with Quantum Optics which were implemented by Glauber have also been considered. A possible generalization to the construction of new coherent states it is point out.

  1. Inelastic neutron scattering and lattice dynamics studies in complex ...

    Indian Academy of Sciences (India)

    At Trombay, lattice dynamics studies employing coherent inelastic neutron scattering (INS) experiments have been carried out at the two research reactors, CIRUS and Dhruva. While the early work at CIRUS involved many elemental solids and ionic molecular solids, recent experiments at Dhruva have focussed on certain ...

  2. Analysis of multiple scattering effects in optical Doppler tomography

    DEFF Research Database (Denmark)

    Yura, H.T.; Thrane, L.; Andersen, Peter E.

    2005-01-01

    Optical Doppler tomography (ODT) combines Doppler velocimetry and optical coherence tomography (OCT) to obtain high-resolution cross-sectional imaging of particle flow velocity in scattering media such as the human retina and skin. Here, we present the results of a theoretical analysis of ODT where...... Doppler frequency spectrum. Thus, in the present analysis, the dependence of the mean and standard deviation of the Doppler shift on the scattering properties of the flowing medium are obtained. Taking the multiple scattering effects into account, we are able to explain previous measurements of depth...

  3. Indoor Measurement Research on Polarimetric Scattering Characteristics of UAV

    Directory of Open Access Journals (Sweden)

    Bai Yang

    2016-12-01

    Full Text Available Knowledge of target polarization characteristics is valuable for radar target detection, classification, and identification. We conducted experimental research on an Unmanned Aerial Vehicle (UAV with complex materials and structures to determine the differences in polarimetric scattering between the UAV and its perfect electric conductor model. To illustrate the coherence of the entire UAV and its components using polarimetric scattering, we measured and analyzed each part. The results reveal that the airframe and aerofoils directly influence the depolarization, and that the polarimetric scattering characteristics of the airframe represent the primary source for the whole UAV.

  4. Experimental generation of Bessel-Gauss coherence functions

    Science.gov (United States)

    Reddy, Salla Gangi; Singh, R. P.; Miyamoto, Yoko

    2017-04-01

    We experimentally generate the Bessel-Gauss coherence functions using the cross-correlations between the two speckle patterns obtained using the perfect optical vortices (POV) of different orders. POV beams are generated using the Fourier transform of Bessel-Gauss beams by displaying the axicon hologram on spatial light modulator. A ground glass plate is used for scattering POV beams and the speckles are recorded. The cross-correlation function of two speckle patterns is Bessel-Gauss functions whose order is given by the difference in the orders of two POV beams used for scattering. The auto-correlation function of these speckles is Bessel-Gauss function of order zero.

  5. Lectures in scattering theory

    CERN Document Server

    Sitenko, A G

    1971-01-01

    Lectures in Scattering Theory discusses problems in quantum mechanics and the principles of the non-relativistic theory of potential scattering. This book describes in detail the properties of the scattering matrix and its connection with physically observable quantities. This text presents a stationary formulation of the scattering problem and the wave functions of a particle found in an external field. This book also examines the analytic properties of the scattering matrix, dispersion relations, complex angular moments, as well as the separable representation of the scattering amplitude. Th

  6. Electromagnetic cloak to restore the antenna radiation patterns affected by nearby scatter

    Energy Technology Data Exchange (ETDEWEB)

    Teperik, Tatiana V., E-mail: tatiana.teperik@u-psud.fr [Univ. Paris-Sud, Institut d’Electronique Fondamentale, UMR 8622, Orsay F-91405 (France); Donostia International Physics Center, Aptdo. 1072, 20080 San Sebastian (Spain); Lustrac, André de [Univ. Paris-Sud, Institut d’Electronique Fondamentale, UMR 8622, Orsay F-91405 (France); Univ. Paris-Ouest, 92410 Ville d’Avray (France)

    2015-12-15

    We have theoretically verified the feasibility of the concept of mantle cloak for very high frequency (VHF) antenna communications. While the applicability of the concept has been demonstrated for an infinitely long cylindrical obstacle and infinitely long electric source [Y.R. Padooru, A.B. Yakovlev, and P.-Y. Chen and Andrea Alù, J. Appl. Phys., 112, 104902, (2012)], the use of this cloak in realistic conditions is not straightforward. In this paper as an electric source we consider a typical VHF monopole antenna mounted on ground plane together with a metallic cylindrical obstacle. The both ground plane and obstacle affect the antenna radiation scattering. Nevertheless, we could show that the mantle cloak can bee successfully applied to restore the radiation patterns of antenna even when the source, the cylindrical metallic obstacle, and the ground plane have finite length. We have studied the antenna adaptation in the presence of the cloaked obstacle and found that the complete radiation system is still functional in the bandwidth that is reduced only by 11%.

  7. Mirror-assisted coherent backscattering from the Mollow sidebands

    Science.gov (United States)

    Piovella, N.; Teixeira, R. Celistrino; Kaiser, R.; Courteille, Ph. W.; Bachelard, R.

    2017-11-01

    In front of a mirror, the radiation of weakly driven large disordered clouds presents an interference fringe in the backward direction, on top of an incoherent background. Although strongly driven atoms usually present little coherent scattering, we show here that the mirror-assisted version can produce high contrast fringes, for arbitrarily high saturation parameters. The contrast of the fringes oscillates with the Rabi frequency of the atomic transition and the distance between the mirror and the atoms, due to the coherent interference between the carrier and the Mollow sidebands of the saturated resonant fluorescence spectrum emitted by the atoms. The setup thus represents a powerful platform to study the spectral properties of ensembles of correlated scatterers.

  8. Velocity measurement by coherent x-ray heterodyning

    Energy Technology Data Exchange (ETDEWEB)

    Lhermitte, Julien R. M.; Rogers, Michael C.; Manet, Sabine; Sutton, Mark

    2017-01-01

    We present a small-angle coherent x-ray scattering technique used for measuring flow velocities in slow moving materials. The technique is an extension of X-ray Photon Correlation Spectroscopy (XPCS): It involves mixing the scattering from moving tracer particles with a static reference that heterodynes the signal. This acts to elongate temporal effects caused by flow in homodyne measurements, allowing for a more robust measurement of flow properties. Using coherent x-ray heterodyning, velocities ranging from 0.1 to 10 μm/s were measured for a viscous fluid pushed through a rectangular channel. We describe experimental protocols and theory for making these Poiseuille flow profile measurements and also develop the relevant theory for using heterodyne XPCS to measure velocities in uniform and Couette flows.

  9. Low angle X-ray scattering in biological tissues

    Energy Technology Data Exchange (ETDEWEB)

    Lemos, Carla; Braz, Delson; Pinto, Nivia G.V.; Lima, Joao C.; Castro, Carlos R.F.; Filgueiras, R.A.; Mendonca, Leonardo; Lopes, Ricardo T. [Universidade Federal do Rio de Janeiro (UFRJ), RJ (Brazil). Coordenacao dos Programas de Pos-graduacao de Engenharia (COPPE). Lab. de Instrumentacao Nuclear]. E-mail: delson@lin.ufrj.br; Barroso, Regina C. [Universidade do Estado do Rio de Janeiro (UERJ), Rio de Janeiro, RJ (Brazil). Inst. de Fisica]. E-mail: cely@uerj.br

    2007-07-01

    Low-angle x-ray scatter (LAXS) for tissue characterization is based on the differences which result from the interference of photons coherently scattered from molecules of each sample. Biological samples (bone, blood and blood components) have been studied in recent years in our laboratory using powder diffractometer. The scattering information was obtained using a Shimadzu DRX 6000 diffractometer at the Nuclear Instrumentation Laboratory, Rio de Janeiro, Brazil. Unpolarized monoenergetic K{alpha} radiation from Cu provided 8.04 keV photons. The measurements were made in reflection mode ({theta}-2{theta} geometry), with the sample stationary on a goniometer which rotates the sample and detector about an axis lying in the plane of the top of the sample holder. LAXS profiles from whole blood, plasma and formed elements were measured to investigate the nature of scattering from such lyophilized samples. The statistical analysis shows that the variation found for the characterization parameters is significant for whole blood considering the age. Gender was positively associated with the variation of the second peak position for the profiles obtained for formed elements. The correlation of the measured relative coherent intensity with the mineral content in the bone samples was investigated. These results suggest that the measurement of bone mineral content within trabecular bone can be performed by using quantitative coherent scattering information. (author)

  10. Wideband VHF radio channel modelling and characterisation beyond line-or-sight.

    OpenAIRE

    Feramez, Michael

    2017-01-01

    The dawn of the information age brought to light technical and economic challenges in delivering broadband telecommunication services to subscribers in rural and remote areas; challenges created by tiny pockets of subscribers scattered over a vast network service area. Dealing with such challenges calls for an appropriate system engineering approach and the utilisation of suitable network building blocks, which could differ significantly from those of the urban areas. The aim of this thesis, ...

  11. Coherent and Incoherent Structural Dynamics in Laser-Excited Antimony

    CERN Document Server

    Waldecker, Lutz; Bertoni, Roman; Vasileiadis, Thomas; Garcia, Martin E; Zijlstra, Eeuwe S; Ernstorfer, Ralph

    2016-01-01

    We investigate the excitation of phonons in photoexcited antimony and demonstrate that the entire electron-lattice interactions, in particular coherent and incoherent electron-phonon coupling, can be probed simultaneously. Using femtosecond electron diffraction (FED) with high temporal resolution, we observe the coherent excitation of the fully symmetric \\Ag\\ optical phonon mode via the shift of the minimum of the atomic potential energy surface. Molecular dynamics simulations are performed to quantify the change in lattice potential and the associated real-space amplitude of the coherent atomic oscillations. In addition, our experimental configuration allows observing the energy transfer from electrons to phonons via incoherent electron-lattice scattering events. Applying a modified two-temperature model, the electron-phonon coupling is determined from the data as a function of electronic temperature.

  12. Noise Characterization of Supercontinuum Sources for Low Coherence Interferometry Applications

    Science.gov (United States)

    Brown, William J.; Kim, Sanghoon; Wax, Adam

    2015-01-01

    We examine the noise properties of supercontinuum light sources when used in low coherence interferometry applications. The first application is a multiple-scattering low-coherence interferometry (ms2/LCI) system where high power and long image acquisition times are required to image deep into tissue. For this system we compare the noise characteristics of two supercontinuum sources from different suppliers. Both sources have long term drift that limits the amount of time over which signal averaging is advantageous for reducing noise. The second application is a high resolution optical coherence tomography system where broadband light is needed for high axial resolution. For this system we compare the noise performance of the two supercontinuum sources and a light source based on four superluminescent diodes (SLDs) using imaging contrast as a comparative metric. We find that the NKT SuperK has superior noise performance compared to the Fianium SC-450-4 but neither meets the performance of the SLDs. PMID:25606759

  13. Dissipatively coupled waveguide networks for coherent diffusive photonics.

    Science.gov (United States)

    Mukherjee, Sebabrata; Mogilevtsev, Dmitri; Slepyan, Gregory Ya; Doherty, Thomas H; Thomson, Robert R; Korolkova, Natalia

    2017-12-04

    A photonic circuit is generally described as a structure in which light propagates by unitary exchange and transfers reversibly between channels. In contrast, the term 'diffusive' is more akin to a chaotic propagation in scattering media, where light is driven out of coherence towards a thermal mixture. Based on the dynamics of open quantum systems, the combination of these two opposites can result in novel techniques for coherent light control. The crucial feature of these photonic structures is dissipative coupling between modes, via an interaction with a common reservoir. Here, we demonstrate experimentally that such systems can perform optical equalisation to smooth multimode light, or act as a distributor, guiding it into selected channels. Quantum thermodynamically, these systems can act as catalytic coherent reservoirs by performing perfect non-Landauer erasure. For lattice structures, localised stationary states can be supported in the continuum, similar to compacton-like states in conventional flat-band lattices.

  14. Dense Matter Characterization by X-ray Thomson Scattering

    Energy Technology Data Exchange (ETDEWEB)

    Landen, O L; Glenzer, S H; Edwards, M J; Lee, R W; Collins, G W; Cauble, R C; Hsing, W W; Hammel, B A

    2000-12-29

    We discuss the extension of the powerful technique of Thomson scattering to the x-ray regime for providing an independent measure of plasma parameters for dense plasmas. By spectrally-resolving the scattering, the coherent (Rayleigh) unshifted scattering component can be separated from the incoherent Thomson component, which is both Compton and Doppler shifted. The free electron density and temperature can then be inferred from the spectral shape of the high frequency Thomson scattering component. In addition, as the plasma temperature is decreased, the electron velocity distribution as measured by incoherent Thomson scattering will make a transition from the traditional Gaussian Boltzmann distribution to a density-dependent parabolic Fermi distribution to. We also present a discussion for a proof-of-principle experiment appropriate for a high energy laser facility.

  15. Coherent branching feature bisimulation

    Directory of Open Access Journals (Sweden)

    Tessa Belder

    2015-04-01

    Full Text Available Progress in the behavioral analysis of software product lines at the family level benefits from further development of the underlying semantical theory. Here, we propose a behavioral equivalence for feature transition systems (FTS generalizing branching bisimulation for labeled transition systems (LTS. We prove that branching feature bisimulation for an FTS of a family of products coincides with branching bisimulation for the LTS projection of each the individual products. For a restricted notion of coherent branching feature bisimulation we furthermore present a minimization algorithm and show its correctness. Although the minimization problem for coherent branching feature bisimulation is shown to be intractable, application of the algorithm in the setting of a small case study results in a significant speed-up of model checking of behavioral properties.

  16. Ultrafast coherent nanoscopy

    Science.gov (United States)

    Chen, Xue-Wen; Mohammadi, Ahmad; Baradaran Ghasemi, Amir Hossein; Agio, Mario

    2013-10-01

    The dramatic advances of nanotechnology experienced in recent years enabled us to fabricate optical nanostructures or nano-antennas that greatly enhance the conversion of localised electromagnetic energy into radiation and vice versa. Nano-antennas offer the required improvements in terms of bandwidth, interaction strength and resolution for combining ultrafast spectroscopy, nano-optics and quantum optics to fundamentally push forward the possibility of the coherent optical access on individual nanostructures or even molecules above cryogenic temperatures, where dephasing processes typically occur at very short time scales. In this context, we discuss recent progress in the theoretical description of light-matter interaction at the nanoscale and related experimental findings. Moreover, we present concrete examples in support of our vision and propose a series of experiments that aim at exploring novel promising regimes of optical coherence and quantum optics in advanced spectroscopy. We envisage extensions to ultrafast and nonlinear phenomena, especially in the direction of multidimensional nanoscopy.

  17. Coherent and neutral pion production results from MINERνA

    Energy Technology Data Exchange (ETDEWEB)

    Palomino, J. L. [Centro Brasileiro de Pesquisas Físicas, Rua Dr. Xavier Sigaud 150, Urca, Rio de Janeiro, 22290-180 (Brazil); Department of Physics and Astronomy, University of Pittsburgh, Pittsburgh, Pennsylvania 15260 (United States); Higuera, A. [Universidad de Guanajuato, Lascuraín de Retana No. 5, Col. Centro. Guanajuato 36000, Guanajuato. México (Mexico)

    2015-05-15

    MINERνA is a neutrino-nucleus scattering experiment employing multiple nuclear targets. The experiment is studying neutral pion production due to coherent, resonant and deep-inelastic processes, from both charged current and neutral current reactions. Neutral pions are detected through their two photon decay and the resultant electromagnetic showers. We will describe the analysis for the cross sections of inclusive and exclusive processes.

  18. Spectral coherence in windturbine wakes

    Energy Technology Data Exchange (ETDEWEB)

    Hojstrup, J. [Riso National Lab., Roskilde (Denmark)

    1996-12-31

    This paper describes an experiment at a Danish wind farm to investigate the lateral and vertical coherences in the nonequilibrium turbulence of a wind turbine wake. Two meteorological masts were instrumented for measuring profiles of mean speed, turbulence, and temperature. Results are provided graphically for turbulence intensities, velocity spectra, lateral coherence, and vertical coherence. The turbulence was somewhat influenced by the wake, or possibly from aggregated wakes further upstream, even at 14.5 diameters. Lateral coherence (separation 5m) seemed to be unaffected by the wake at 7.5 diameters, but the flow was less coherent in the near wake. The wake appeared to have little influence on vertical coherence (separation 13m). Simple, conventional models for coherence appeared to be adequate descriptions for wake turbulence except for the near wake situation. 3 refs., 7 figs., 1 tab.

  19. The Puzzle of Coherence

    DEFF Research Database (Denmark)

    Andersen, Anne Bendix; Frederiksen, Kirsten; Beedholm, Kirsten

    2016-01-01

    Background During the past decade, politicians and healthcare providers have strived to create a coherent healthcare system across primary and secondary healthcare sectors in Denmark. Nevertheless, elderly patients with chronic diseases (EPCD) continue to report experiences of poor-quality care...... to an acute care ward to discharge and later in meetings with healthcare providers in general practice, outpatient clinics, home care and physiotherapy. Furthermore, field observations were conducted in general practice, home care and rehabilitation settings. Research design An explorative design based...

  20. Optical Coherency Matrix Tomography

    Science.gov (United States)

    2015-10-19

    Esat Kondakci, Ayman F. Abouraddy & Bahaa E. A. Saleh The coherence of an optical beam having multiple degrees of freedom (DoFs) is described by a...measurement yields a real number Ilm (projection l for polarization and m for the spatial DoF) corresponding to the projection of a tomographic...hermiticity, and semi-positive-definiteness of G50. We portray the real and imaginary components of G using the standard visualization from quantum state

  1. The Puzzle of Coherence

    DEFF Research Database (Denmark)

    Andersen, Anne Bendix; Frederiksen, Kirsten; Beedholm, Kirsten

    2016-01-01

    During the past decade, politicians and health care providers have strived to create a coherent health care system across primary and secondary health care systems in Denmark. Nevertheless, elderly patients with chronic diseases (EPCD) continue to report experiences of poor-quality care and lack ...... both nationally and internationally in preparation of health agreements, implementation of new collaboration forms among health care providers, and in improvement of delegation and transfer of information and assignments across sectors in health care....

  2. PERSISTENT SCATTERER INTERFEROMETRY USING SENTINEL-1 DATA

    Directory of Open Access Journals (Sweden)

    M. Crosetto

    2016-06-01

    Full Text Available This paper is focused on deformation monitoring using a Persistent Scatterer Interferometry technique and the interferometric SAR data acquired by the Sentinel-1 satellite of the European Space Agency. The first part of the paper describes the procedure used to process and analyze Sentinel-1 interferometric SAR data. Two main approaches are described. The first one is a simplified Persistent Scatterer Interferometry approach that exploits two key properties of the Sentinel-1 data: the high coherence of the 12-day interferograms and the reduced orbital tube. The second approach is a full Persistent Scatterer Interferometry approach, where a more sophisticate data treatment is employed. The second part of the paper illustrates the results obtained with the two processing approaches. Two case studies are described. The first one concerns landslide detection and monitoring. In this case, the simplified Persistent Scatterer Interferometry approach was used. The second one regards the deformation monitoring of an urban area. In this case, a full Persistent Scatterer Interferometry approach was used.

  3. Electron scattering and transport in liquid argon

    Energy Technology Data Exchange (ETDEWEB)

    Boyle, G. J.; Cocks, D. G.; White, R. D. [College of Science, Technology and Engineering, James Cook University, Townsville 4810 (Australia); McEachran, R. P. [Research School of Physical Sciences and Engineering, Australian National University, Canberra ACT 0200 (Australia)

    2015-04-21

    The transport of excess electrons in liquid argon driven out of equilibrium by an applied electric field is revisited using a multi-term solution of Boltzmann’s equation together with ab initio liquid phase cross-sections calculated using the Dirac-Fock scattering equations. The calculation of liquid phase cross-sections extends previous treatments to consider multipole polarisabilities and a non-local treatment of exchange, while the accuracy of the electron-argon potential is validated through comparison of the calculated gas phase cross-sections with experiment. The results presented highlight the inadequacy of local treatments of exchange that are commonly used in liquid and cluster phase cross-section calculations. The multi-term Boltzmann equation framework accounting for coherent scattering enables the inclusion of the full anisotropy in the differential cross-section arising from the interaction and the structure factor, without an a priori assumption of quasi-isotropy in the velocity distribution function. The model, which contains no free parameters and accounts for both coherent scattering and liquid phase screening effects, was found to reproduce well the experimental drift velocities and characteristic energies.

  4. Coherent laser vision system

    Energy Technology Data Exchange (ETDEWEB)

    Sebastion, R.L. [Coleman Research Corp., Springfield, VA (United States)

    1995-10-01

    The Coherent Laser Vision System (CLVS) is being developed to provide precision real-time 3D world views to support site characterization and robotic operations and during facilities Decontamination and Decommissioning. Autonomous or semiautonomous robotic operations requires an accurate, up-to-date 3D world view. Existing technologies for real-time 3D imaging, such as AM laser radar, have limited accuracy at significant ranges and have variability in range estimates caused by lighting or surface shading. Recent advances in fiber optic component technology and digital processing components have enabled the development of a new 3D vision system based upon a fiber optic FMCW coherent laser radar. The approach includes a compact scanner with no-moving parts capable of randomly addressing all pixels. The system maintains the immunity to lighting and surface shading conditions which is characteristic to coherent laser radar. The random pixel addressability allows concentration of scanning and processing on the active areas of a scene, as is done by the human eye-brain system.

  5. Coherency Sensitive Hashing.

    Science.gov (United States)

    Korman, Simon; Avidan, Shai

    2016-06-01

    Coherency Sensitive Hashing (CSH) extends Locality Sensitivity Hashing (LSH) and PatchMatch to quickly find matching patches between two images. LSH relies on hashing, which maps similar patches to the same bin, in order to find matching patches. PatchMatch, on the other hand, relies on the observation that images are coherent, to propagate good matches to their neighbors in the image plane, using random patch assignment to seed the initial matching. CSH relies on hashing to seed the initial patch matching and on image coherence to propagate good matches. In addition, hashing lets it propagate information between patches with similar appearance (i.e., map to the same bin). This way, information is propagated much faster because it can use similarity in appearance space or neighborhood in the image plane. As a result, CSH is at least three to four times faster than PatchMatch and more accurate, especially in textured regions, where reconstruction artifacts are most noticeable to the human eye. We verified CSH on a new, large scale, data set of 133 image pairs and experimented on several extensions, including: k nearest neighbor search, the addition of rotation and matching three dimensional patches in videos.

  6. High-precision positioning of radar scatterers

    Science.gov (United States)

    Dheenathayalan, Prabu; Small, David; Schubert, Adrian; Hanssen, Ramon F.

    2016-05-01

    Remote sensing radar satellites cover wide areas and provide spatially dense measurements, with millions of scatterers. Knowledge of the precise position of each radar scatterer is essential to identify the corresponding object and interpret the estimated deformation. The absolute position accuracy of synthetic aperture radar (SAR) scatterers in a 2D radar coordinate system, after compensating for atmosphere and tidal effects, is in the order of centimeters for TerraSAR-X (TSX) spotlight images. However, the absolute positioning in 3D and its quality description are not well known. Here, we exploit time-series interferometric SAR to enhance the positioning capability in three dimensions. The 3D positioning precision is parameterized by a variance-covariance matrix and visualized as an error ellipsoid centered at the estimated position. The intersection of the error ellipsoid with objects in the field is exploited to link radar scatterers to real-world objects. We demonstrate the estimation of scatterer position and its quality using 20 months of TSX stripmap acquisitions over Delft, the Netherlands. Using trihedral corner reflectors (CR) for validation, the accuracy of absolute positioning in 2D is about 7 cm. In 3D, an absolute accuracy of up to ˜ 66 cm is realized, with a cigar-shaped error ellipsoid having centimeter precision in azimuth and range dimensions, and elongated in cross-range dimension with a precision in the order of meters (the ratio of the ellipsoid axis lengths is 1/3/213, respectively). The CR absolute 3D position, along with the associated error ellipsoid, is found to be accurate and agree with the ground truth position at a 99 % confidence level. For other non-CR coherent scatterers, the error ellipsoid concept is validated using 3D building models. In both cases, the error ellipsoid not only serves as a quality descriptor, but can also help to associate radar scatterers to real-world objects.

  7. Quantum coherence versus quantum uncertainty

    Science.gov (United States)

    Luo, Shunlong; Sun, Yuan

    2017-08-01

    The notion of measurement is of both foundational and instrumental significance in quantum mechanics, and coherence destroyed by measurements (decoherence) lies at the very heart of quantum to classical transition. Qualitative aspects of this spirit have been widely recognized and analyzed ever since the inception of quantum theory. However, axiomatic and quantitative investigations of coherence are attracting great interest only recently with several figures of merit for coherence introduced [Baumgratz, Cramer, and Plenio, Phys. Rev. Lett. 113, 140401 (2014), 10.1103/PhysRevLett.113.140401]. While these resource theoretic approaches have many appealing and intuitive features, they rely crucially on various notions of incoherent operations which are sophisticated, subtle, and not uniquely defined, as have been critically assessed [Chitambar and Gour, Phys. Rev. Lett. 117, 030401 (2016), 10.1103/PhysRevLett.117.030401]. In this paper, we elaborate on the idea that coherence and quantum uncertainty are dual viewpoints of the same quantum substrate, and address coherence quantification by identifying coherence of a state (with respect to a measurement) with quantum uncertainty of a measurement (with respect to a state). Consequently, coherence measures may be set into correspondence with measures of quantum uncertainty. In particular, we take average quantum Fisher information as a measure of quantum uncertainty, and introduce the corresponding measure of coherence, which is demonstrated to exhibit desirable properties. Implications for interpreting quantum purity as maximal coherence, and quantum discord as minimal coherence, are illustrated.

  8. Possible Precise Measurement of Delbrück Scattering Using Polarized Photon Beams.

    Science.gov (United States)

    Koga, James K; Hayakawa, Takehito

    2017-05-19

    The advent of high-flux-polarized γ-ray sources makes possible the nearly isolated precise measurement of the vacuum contribution, Delbrück scattering, to the elastic scattering of these photons off nuclei. Because of the fact that the elastic scattering of the photons is a coherent summation of four processes and that up to now unpolarized sources have been used, the isolated measurement of Delbrück scattering has not been performed. We show that for the appropriate choice of scattering angles, photon polarization, and energies this scattering can be measured nearly independently of other scattering processes. This makes possible the precise measurement of the vacuum contribution to scattering and the possibility of the detection of new physics.

  9. Digital controller for the Wave Propagation Laboratory's VHF and UHF wind-profiling radars

    Science.gov (United States)

    Moran, K.

    1984-09-01

    Principles are described for operation of a digital system that is used to control the operations of a multiple beam stratospheric-tropospheric (ST) radar system. The digital system, referred to as the radar controller, contains the digital logic for generating the necessary pulse sequences for modulation of the radar transmitter, gating the radar's receiver channels, and sequencing the antenna beams. The radar controller also performs digital-to-analog conversion and coherent averaging of the receiver necessary for signal detection in ST radars. The radar controller is controlled internally by a Z80 microprocessor, and the entire system functions as a peripheral device to a host minicomputer. Block diagrams and detailed circuit schematics for all the custom designed electronics are included.

  10. Complex Magnetic Systems Studied with Neutron Scattering

    DEFF Research Database (Denmark)

    Jacobsen, Henrik

    the spins in the nanoparticle move coherently. One part of the thesis explores the structure and dynamic of magnetic nanoparticles, with emphasis being placed on hematite. Hematite has easy-axis and in-plane anisotropy, as well as being strongly antiferromagnetic. The excitation energies have been derived...... of the lack of conventional long range order in GGG. Several members of the La2􀀀xSrxCuO4+y cuprate family of high-temperature superconductors were investigated using neutron scattering. In La2􀀀xSrxCuO4 with x = 0:12 the correlations along the c-axis were investigated. It was found...

  11. Volitional Control of Neuromagnetic Coherence

    Directory of Open Access Journals (Sweden)

    Matthew D Sacchet

    2012-12-01

    Full Text Available Coherence of neural activity between circumscribed brain regions has been implicated as an indicator of intracerebral communication in various cognitive processes. While neural activity can be volitionally controlled with neurofeedback, the volitional control of coherence has not yet been explored. Learned volitional control of coherence could elucidate mechanisms of associations between cortical areas and its cognitive correlates and may have clinical implications. Neural coherence may also provide a signal for brain-computer interfaces (BCI. In the present study we used the Weighted Overlapping Segment Averaging (WOSA method to assess coherence between bilateral magnetoencephalograph (MEG sensors during voluntary digit movement as a basis for BCI control. Participants controlled an onscreen cursor, with a success rate of 124 of 180 (68.9%, sign-test p < 0.001 and 84 out of 100 (84%, sign-test p < 0.001. The present findings suggest that neural coherence may be volitionally controlled and may have specific behavioral correlates.

  12. Coherent orthogonal polynomials

    Energy Technology Data Exchange (ETDEWEB)

    Celeghini, E., E-mail: celeghini@fi.infn.it [Dipartimento di Fisica, Università di Firenze and INFN–Sezione di Firenze, I50019 Sesto Fiorentino, Firenze (Italy); Olmo, M.A. del, E-mail: olmo@fta.uva.es [Departamento de Física Teórica and IMUVA, Universidad de Valladolid, E-47005, Valladolid (Spain)

    2013-08-15

    We discuss a fundamental characteristic of orthogonal polynomials, like the existence of a Lie algebra behind them, which can be added to their other relevant aspects. At the basis of the complete framework for orthogonal polynomials we include thus–in addition to differential equations, recurrence relations, Hilbert spaces and square integrable functions–Lie algebra theory. We start here from the square integrable functions on the open connected subset of the real line whose bases are related to orthogonal polynomials. All these one-dimensional continuous spaces allow, besides the standard uncountable basis (|x〉), for an alternative countable basis (|n〉). The matrix elements that relate these two bases are essentially the orthogonal polynomials: Hermite polynomials for the line and Laguerre and Legendre polynomials for the half-line and the line interval, respectively. Differential recurrence relations of orthogonal polynomials allow us to realize that they determine an infinite-dimensional irreducible representation of a non-compact Lie algebra, whose second order Casimir C gives rise to the second order differential equation that defines the corresponding family of orthogonal polynomials. Thus, the Weyl–Heisenberg algebra h(1) with C=0 for Hermite polynomials and su(1,1) with C=−1/4 for Laguerre and Legendre polynomials are obtained. Starting from the orthogonal polynomials the Lie algebra is extended both to the whole space of the L{sup 2} functions and to the corresponding Universal Enveloping Algebra and transformation group. Generalized coherent states from each vector in the space L{sup 2} and, in particular, generalized coherent polynomials are thus obtained. -- Highlights: •Fundamental characteristic of orthogonal polynomials (OP): existence of a Lie algebra. •Differential recurrence relations of OP determine a unitary representation of a non-compact Lie group. •2nd order Casimir originates a 2nd order differential equation that defines

  13. Bragg-Scattering Four-Wave Mixing in Nonlinear Fibers with Intracavity Frequency-Shifted Laser Pumps

    Directory of Open Access Journals (Sweden)

    Katarzyna Krupa

    2012-01-01

    Full Text Available We experimentally study four-wave mixing in highly nonlinear fibers using two independent and partially coherent laser pumps and a third coherent signal. We focus our attention on the Bragg-scattering frequency conversion. The two pumps were obtained by amplifying two Intracavity frequency-shifted feedback lasers working in a continuous wave regime.

  14. Effect of light assisted collisions on matter wave coherence in superradiant Bose-Einstein condensates

    DEFF Research Database (Denmark)

    Kampel, Nir Shlomo; Griesmaier, Axel Rudolf; Steenstrup, Mads Peter Hornbak

    2012-01-01

    We investigate experimentally the effects of light assisted collisions on the coherence between momentum states in Bose-Einstein condensates. The onset of superradiant Rayleigh scattering serves as a sensitive monitor for matter-wave coherence. A subtle interplay of binary and collective effects...... leads to a profound asymmetry between the two sides of the atomic resonance and provides far bigger coherence loss rates for a condensate bathed in blue detuned light than previously estimated. We present a simplified quantitative model containing the essential physics to explain our experimental data...

  15. Quantum-fluctuation-initiated coherence in multioctave Raman optical frequency combs.

    Science.gov (United States)

    Wang, Y Y; Wu, Chunbai; Couny, F; Raymer, M G; Benabid, F

    2010-09-17

    We show experimentally and theoretically that the spectral components of a multioctave frequency comb spontaneously created by stimulated Raman scattering in a hydrogen-filled hollow-core photonic crystal fiber exhibit strong self-coherence and mutual coherence within each 12 ns driving laser pulse. This coherence arises in spite of the field's initiation being from quantum zero-point fluctuations, which causes each spectral component to show large phase and energy fluctuations. This points to the possibility of an optical frequency comb with nonclassical correlations between all comb lines.

  16. Coherent beam combination of three two-tone fiber amplifiers using stochastic parallel gradient descent algorithm.

    Science.gov (United States)

    Zhou, Pu; Ma, Yanxing; Wang, Xiaolin; Ma, Haotong; Xu, Xiaojun; Liu, Zejin

    2009-10-01

    Multitone radiation is a promising technique to mitigate stimulated Brillouin scattering effects in narrow-linewidth fiber amplifiers. We demonstrate coherent beam combination of three two-tone fiber amplifiers using a stochastic parallel gradient descent (SPGD) algorithm. Phase control on the fiber amplifiers are performed by running the SPGD algorithm on a digital signal processor. The contrast of far-field intensity pattern of a coherently combined beam is more than 85%. Experimental results validate that a single-frequency seed laser is not indispensable for coherent beam combination in master oscillator power amplifier configuration.

  17. Imaging and graphing of cortical vasculature using dynamically focused optical coherence microscopy angiography.

    Science.gov (United States)

    Leahy, Conor; Radhakrishnan, Harsha; Bernucci, Marcel; Srinivasan, Vivek J

    2016-02-01

    Recently, optical coherence tomography (OCT) angiography has enabled label-free imaging of vasculature based on dynamic scattering in vessels. However, quantitative volumetric analysis of the vascular networks depicted in OCT angiography data has remained challenging. Multiple-scattering tails (artifacts specific to the imaging geometry) make automated assessment of vascular morphology problematic. We demonstrate that dynamically focused optical coherence microscopy (OCM) angiography with a high numerical aperture, chosen so the scattering length greatly exceeds the depth-of-field, significantly reduces the deleterious effect of multiple-scattering tails in synthesized angiograms. Capitalizing on the improved vascular image quality, we devised and tailored a self-correcting automated graphing approach that achieves a reconstruction of cortical microvasculature from OCM angiography data sets with accuracy approaching that attained by trained operators. The automated techniques described here will facilitate more widespread study of vascular network topology in health and disease.

  18. Autocorrelation low coherence interferometry

    Science.gov (United States)

    Modell, Mark D.; Ryabukho, Vladimir; Lyakin, Dmitry; Lychagov, Vladislav; Vitkin, Edward; Itzkan, Irving; Perelman, Lev T.

    2008-04-01

    This paper describes the development of a new modality of optical low coherence interferometry (LCI) that is called autocorrelation LCI (ALCI). The ALCI system employs a Michelson interferometer to measure longitudinal autocorrelation properties of the sample optical field and does not require a reference beam. As the result, there is no restrictions applied on the distance between the sample and the ALCI system, moreover, this distance can even change during the measurements. We report experiments using a proof-of-principle ALCI system on a multilayer phantom consisting of three surfaces defining two regions of different refractive indices. The experimental data are in excellent agreement with the predictions of the theoretical model.

  19. The Puzzle of Coherence

    DEFF Research Database (Denmark)

    Andersen, Anne Bendix; Frederiksen, Kirsten; Beedholm, Kirsten

    2016-01-01

    During the past decade, politicians and health care providers have strived to create a coherent health care system across primary and secondary health care systems in Denmark. Nevertheless, elderly patients with chronic diseases (EPCD) continue to report experiences of poor-quality care and lack...... in general practice, outpatient clinics, home care and physiotherapy. Furthermore, field observations are conducted in general practice, home care and rehabilitation settings. Perspectives Knowledge about the practice of cross-sectorial collaboration is crucial to the future planning of collaborating...

  20. Diffraction coherence in optics

    CERN Document Server

    Françon, M; Green, L L

    2013-01-01

    Diffraction: Coherence in Optics presents a detailed account of the course on Fraunhofer diffraction phenomena, studied at the Faculty of Science in Paris. The publication first elaborates on Huygens' principle and diffraction phenomena for a monochromatic point source and diffraction by an aperture of simple form. Discussions focus on diffraction at infinity and at a finite distance, simplified expressions for the field, calculation of the path difference, diffraction by a rectangular aperture, narrow slit, and circular aperture, and distribution of luminous flux in the airy spot. The book th