WorldWideScience

Sample records for vhe gamma astrophysics

  1. VHE Gamma-ray Supernova Remnants

    Energy Technology Data Exchange (ETDEWEB)

    Funk, Stefan; /KIPAC, Menlo Park

    2007-01-22

    Increasing observational evidence gathered especially in X-rays and {gamma}-rays during the course of the last few years support the notion that Supernova remnants (SNRs) are Galactic particle accelerators up to energies close to the ''knee'' in the energy spectrum of Cosmic rays. This review summarizes the current status of {gamma}-ray observations of SNRs. Shell-type as well as plerionic type SNRs are addressed and prospect for observations of these two source classes with the upcoming GLAST satellite in the energy regime above 100 MeV are given.

  2. VHE and UHE gamma ray astronomy: transients and sources

    International Nuclear Information System (INIS)

    Fegan, D.J.

    1987-01-01

    The transient and sporadic nature of a number of Cosmic gamma ray sources is examined in relation to VHE (10 11 to 10 14 eV) observations of pulsars and X-ray binary systems. Transients are not all that common but when they occur they generally produce emission of sufficient intensity and duration to obtain statistically significant effects which are gradually helping to establish a source catalog. A brief review is also made of the staus of UHE (>10 14 eV) gamma ray astronomy

  3. Early warning for VHE gamma-ray flares with the ARGO-YBJ detector

    Energy Technology Data Exchange (ETDEWEB)

    Bartoli, B. [Dipartimento di Fisica dell' Universita di Napoli ' Federico II' , Complesso Universitario di Monte Sant' Angelo, via Cinthia, 80126 Napoli (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Napoli, Complesso Universitario di Monte Sant' Angelo, via Cinthia, 80126 Napoli (Italy); Bernardini, P. [Dipartimento di Fisica dell' Universita del Salento, via per Arnesano, 73100 Lecce (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Lecce, via per Arnesano, 73100 Lecce (Italy); Bi, X.J. [Key Laboratory of Particle Astrophysics, Institute of High Energy Physics, Chinese Academy of Sciences, P.O. Box 918, 100049 Beijing (China); Bleve, C. [Dipartimento di Fisica dell' Universita del Salento, via per Arnesano, 73100 Lecce (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Lecce, via per Arnesano, 73100 Lecce (Italy); Bolognino, I. [Dipartimento di Fisica Nucleare e Teorica dell' Universita di Pavia, via Bassi 6, 27100 Pavia (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Pavia, via Bassi 6, 27100 Pavia (Italy); Branchini, P.; Budano, A. [Istituto Nazionale di Fisica Nucleare, Sezione di Roma Tre, via della Vasca Navale 84, 00146 Roma (Italy); Calabrese Melcarne, A.K. [Istituto Nazionale di Fisica Nucleare - CNAF, Viale Berti-Pichat 6/2, 40127 Bologna (Italy); Camarri, P. [Dipartimento di Fisica dell' Universita di Roma ' Tor Vergata' , via della Ricerca Scientifica 1, 00133 Roma (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Roma Tor Vergata, via della Ricerca Scientifica 1, 00133 Roma (Italy); Cao, Z. [Key Laboratory of Particle Astrophysics, Institute of High Energy Physics, Chinese Academy of Sciences, P.O. Box 918, 100049 Beijing (China); and others

    2011-12-11

    Detecting and monitoring emissions from flaring gamma-ray sources in the very-high-energy (VHE, > 100 GeV) band is a very important topic in gamma-ray astronomy. The ARGO-YBJ detector is characterized by a high duty cycle and a wide field of view. Therefore, it is particularly capable of detecting flares from extragalactic objects. Based on fast reconstruction and analysis, real-time monitoring of 33 selected VHE extragalactic sources is implemented. Flares exceeding a specific threshold are reported timely, hence enabling the follow-up observation of these objects using more sensitive detectors, such as Cherenkov telescopes.

  4. Extragalactic Gamma-Ray Astrophysics

    CERN Multimedia

    CERN. Geneva

    2016-01-01

    During the last decades, various classes of radio-loud active galactic nuclei have been established as sources of high-energy radiation extending over a very broad range from soft gamma-rays (photon energies E~MeV) up to very-high-energy gamma-rays (E>100 GeV). These include blazars of different types, as well as young and evolved radio galaxies. The observed gamma-ray emission from such implies efficient particle acceleration processes taking place in highly magnetized and relativistic jets produced by supermassive black holes, processes that have yet to be identified and properly understood. In addition, nearby starforming and starburst galaxies, some of which host radio-quiet Seyfert-type nuclei, have been detected in the gamma-ray range as well. In their cases, the observed gamma-ray emission is due to non-thermal activity in the interstellar medium, possibly including also a contribution from accretion disks and nuclear outflows. Finally, the high-energy emission from clusters of galaxies remains elusive...

  5. The Future of Gamma Ray Astrophysics

    CERN Multimedia

    CERN. Geneva

    2016-01-01

    Over the past decade, gamma ray astrophysics has entered the astrophysical mainstream. Extremely successful space-borne (GeV) and ground-based (TeV) detectors, combined with a multitude of partner telescopes, have revealed a fascinating “astroscape" of active galactic nuclei, pulsars, gamma ray bursts, supernova remnants, binary stars, star-forming galaxies, novae much more, exhibiting major pathways along which large energy releases can flow. From  a basic physics perspective, exquisitely sensitive measurements have constrained the nature of dark matter, the cosmological origin of magnetic field and the properties of black holes. These advances have motivated the development of new facilities, including HAWC, DAMPE, CTA and SVOM, which will further our understanding of the high energy universe. Topics that will receive special attention include merging neutron star binaries, clusters of galaxies, galactic cosmic rays and putative, TeV dark matter.

  6. Attenuation of VHE Gamma Rays by the Milky Way Interstellar Radiation Field

    Energy Technology Data Exchange (ETDEWEB)

    Moskalenko, Igor V.; /Stanford U., HEPL; Porter, Troy A.; /Louisiana State U.; Strong, Andrew W.; /Garching, Max Planck Inst., MPE

    2006-04-19

    The attenuation of very high energy gamma rays by pair production on the Galactic interstellar radiation field has long been thought of as negligible. However, a new calculation of the interstellar radiation field consistent with multi-wavelength observations by DIRBE and FIRAS indicates that the energy density of the Galactic interstellar radiation field is higher, particularly in the Galactic center, than previously thought. We have made a calculation of the attenuation of very high energy gamma rays in the Galaxy using this new interstellar radiation field which takes into account its nonuniform spatial and angular distributions. We find that the maximum attenuation occurs around 100 TeV at the level of about 25% for sources located at the Galactic center, and is important for both Galactic and extragalactic sources.

  7. Detection of VHE gamma-ray emission from the vicinity of PSR B1706-44 with H.E.S.S.

    Energy Technology Data Exchange (ETDEWEB)

    Chaves, Ryan C.G.; Ona Wilhelmi, Emma de [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Terrier, Regis [APC, CNRS, Univ. Paris-7 (France); Stegmann, Christian [Universitaet Erlangen-Nuernberg, Erlangen (Germany). Physikalisches Institut; Khelifi, Bruno [LLR, Ecole Polytechnique, CNRS/IN2P3, Palaiseau (France); Jager, Okkie C. de [Unit for Space Physics, North-West Univ., Potchefstroom (South Africa)

    2010-07-01

    The gamma-ray pulsar PSR B1706-44 and the adjacent supernova remnant (SNR) candidate G343.1-2.3 were observed by H.E.S.S. during a dedicated observational campaign in 2007. A new source of very-high-energy (VHE;E>100 GeV) gamma-ray emission, HESS J1708-443, was discovered with its centroid at RA(J2000.0)=17 h 8 m 10 s and Dec (J2000.0)=-44 d 21{sup '} ({+-}3{sup '} statistical error on each axis). The VHE gamma-ray source is significantly more extended than the H.E.S.S. point-spread function and has an intrinsic Gaussian width of 0.29 {+-}0.04 . Its energy spectrum can be described by a power law with a photon index=2.0{+-}0.1 (stat){+-}0.2 (syst). The integral flux measured between 1 and 10 TeV is {proportional_to}17% of the Crab Nebula flux in the same energy range. The possible associations with the energetic PSR B1706-44, also recently detected in the GeV domain with Fermi/LAT and AGILE, and SNR G343.1-2.3 are discussed.

  8. Gamma-ray bursts: astrophysical puzzle of the century

    International Nuclear Information System (INIS)

    Hudec, R.

    1998-01-01

    An overview is given of the problems of gamma-ray bursts /GRB/. As GRB became one of the greatest mysteries in modern astrophysics, this field of astrophysics is a subject of intensive research. The article covers some topical aspects of experiments related to the indentification of gamma-ray bursts. The preparation and results of experiments in the Astronomical Institute of the Academy of Sciences of the Czech Republic are described. (Z.J.)

  9. Very high energy gamma ray astrophysics. Progress report, August 1, 1980-July 31, 1981

    International Nuclear Information System (INIS)

    Lamb, R.C.

    1981-04-01

    Very high energy (VHE) gamma ray astronomy gives insight into fundamental questions regarding the origins of cosmic rays and the types of particle acceleration mechanisms which operate in nature. VHE photons are detected by means of the Cerenkov light their secondaries produce in the atmosphere. During June - September 1981 the solar collectors at Edwards Air Force Base will be used to detect the Cerenkov light from the photons from Cygnus X-3 thus extending its observation into a previously unexplored region. The time of each detector event will be recorded to the nearest 0.5 ms. If Cygnus X-3 is the neutron star remnant of a recent (unseen) supernova, then the VHE gamma rays may be pulsed at its rotation rate, and the data obtained will allow a sensitive test of this possibility. The equipment for the summer observations is nearly ready and will be tested in May prior to any early run in June

  10. Very high energy gamma ray astrophysics

    International Nuclear Information System (INIS)

    Lamb, R.C.; Lewis, D.A.

    1991-01-01

    The Whipple Observatory High Resolution Camera will be used in a vigorous program of observations to search for new sources of very-high-energy gamma rays. In addition, a search for antimatter using the moon-earth system as an ion spectrometer will be begun. The first phase of GRANITE, the new 37-element 11-m camera, will be concluded with first light scheduled for September, 1991. The two cameras will operate in support of the Gamma Ray Observatory mission in the winter of 1991/2

  11. Very high energy gamma ray astrophysics

    International Nuclear Information System (INIS)

    Lamb, R.C.; Lewis, D.A.

    1986-01-01

    The Whipple Observatory's atmospheric Cerenkov camera has detected TeV radiation from four galactic sources: the Crab Nebula, Cygnus X-3, Hercules X-1, and 4U0115+63. Recent simulations encourage the view that unwanted cosmic-ray background showers may be suppressed by a large factor. Emphasis in the coming year will be on determining optimum selection criteria for enhancing gamma-ray signals and in developing a prototype camera with finer angular resolution as a first step towards implementation of the HERCULES concept

  12. Constraints on a Proton Synchrotron Origin of VHE Gamma Rays from the Extended Jet of AP Librae

    Energy Technology Data Exchange (ETDEWEB)

    Basumallick, Partha Pratim; Gupta, Nayantara, E-mail: basuparth314@gmail.com [Raman Research Institute, C. V. Raman Avenue, Sadashivanagar, Bangalore 560080 (India)

    2017-07-20

    The multiwavelength photon spectrum from the BL Lac object AP Librae extends from radio to TeV gamma rays. The X-ray to very high-energy gamma-ray emission from the extended jet of this source has been modeled with inverse Compton (IC) scattering of relativistic electrons off the cosmic microwave background (CMB) photons. The IC/CMB model requires the kpc-scale extended jet to be highly collimated with a bulk Lorentz factor close to 10. Here we discuss the possibility of a proton synchrotron origin of X-rays and gamma rays from the extended jet with a bulk Lorentz factor of 3. This scenario requires an extreme proton energy of 3.98 × 10{sup 21} eV and a high magnetic field of 1 mG of the extended jet with jet power ∼5 × 10{sup 48} erg s{sup −1} in particles and the magnetic field (which is more than 100 times the Eddington luminosity of AP Librae) to explain the very high-energy gamma-ray emission. Moreover, we have shown that X-ray emission from the extended jets of 3C 273 and PKS 0637-752 could be possible by proton synchrotron emission with jet power comparable to the Eddington luminosities.

  13. Effect of stars in the field of view of the VHE gamma-ray atmospheric Cherenkov telescope

    International Nuclear Information System (INIS)

    Badran, H.M.

    2004-01-01

    Very high energy gamma-ray astronomy in the energy range above 100 GeV has made dramatic progress through the development of imaging atmospheric Cherenkov telescopes (lACTs). The technique has been pivotal in the establishing the existence of a number of discrete gamma-ray sources. Normally due to the presence of stars in the field of view (FOV), a number of photomultiplier tubes (pmts) in the camera has to be turned off. This may have the effect of distorting some images that happens to be in that part of the camera. This may in turn affect the gamma-ray sensitivity of the telescope. The present study aims to shade some light on this possible effect. Experimental data on the extragalactic gamma-ray source Mrk 421 measured using the 10-m Whipple IACT were used for this purpose because of its relative dark FOV compared with other sources; e.g. the Crab nebula. To simulate the presence of star(s) in the FOV, the analysis program selects randomly a number of clusters of pmts to be turned off in the software. The pmts in each cluster have to be adjacent to each other (neighbors) and the selected clusters have to be separated from each other. The significance of the detected signal and the gamma-ray rate were then determined and compared with the original results. Clusters of 2, 3 and 4 pmts were used. The number of clusters was increased up to 12 clusters at various distances from the center of the FOV

  14. Very high energy gamma ray astrophysics

    International Nuclear Information System (INIS)

    Lamb, R.C.; Lewis, D.A.

    1990-02-01

    Our scientific goal is to discover and study by means of gamma-ray astronomy those regions of the universe where particles are accelerated to extreme energies. The atmospheric Cherenkov technique provides a unique and potentially sensitive window in the region of 10 11 to approximately 10 14 eV for this purpose. The Whipple Observatory Collaboration is currently engaged in the development of a Cherenkov camera which has the ultimate capability of distinguishing gamma-ray showers from the numerous cosmic-ray background showers by imaging the Cherenkov light from each shower. We have recently demonstrated the potential of the imaging technique with our 18 sigma detection of TeV photons from the Crab Nebula using a camera of 10 elements, pixel spacing 0.25 degrees. This detection represents a factor of 10 improvement in sensitivity compared to a non-imaging detector. The next step in the development of the detector is to obtain a second large reflector, similar to the present 10 meter instrument, for stereoscopic viewing of showers. This project, named GRANITE, is now approved by DOE. With GRANITE it should be possible to probe more deeply in space by a factor of 7, and to fully investigate the possibility of new physics which has been suggested by reports of anomalous radiation from Hercules X-1. 18 refs

  15. High energy astrophysics with ground-based gamma ray detectors

    International Nuclear Information System (INIS)

    Aharonian, F; Buckley, J; Kifune, T; Sinnis, G

    2008-01-01

    Recent advances in ground-based gamma ray astronomy have led to the discovery of more than 70 sources of very high energy (E γ ≥ 100 GeV) gamma rays, falling into a number of source populations including pulsar wind nebulae, shell type supernova remnants, Wolf-Rayet stars, giant molecular clouds, binary systems, the Galactic Center, active galactic nuclei and 'dark' (yet unidentified) galactic objects. We summarize the history of TeV gamma ray astronomy up to the current status of the field including a description of experimental techniques and highlight recent astrophysical results. We also discuss the potential of ground-based gamma ray astronomy for future discoveries and describe possible directions for future instrumental developments

  16. Physics and astrophysics with gamma-ray telescopes

    Energy Technology Data Exchange (ETDEWEB)

    Vandenbroucke, J. [Kavli Institute for Particle Astrophysics and Cosmology, Department of Physics and SLAC National Accelerator Laboratory, Stanford University, Stanford, CA 94305 (United States)

    2012-08-15

    In the past few years gamma-ray astronomy has entered a golden age. A modern suite of telescopes is now scanning the sky over both hemispheres and over six orders of magnitude in energy. At {approx}TeV energies, only a handful of sources were known a decade ago, but the current generation of ground-based imaging atmospheric Cherenkov telescopes (H.E.S.S., MAGIC, and VERITAS) has increased this number to nearly one hundred. With a large field of view and duty cycle, the Tibet and Milagro air shower detectors have demonstrated the promise of the direct particle detection technique for TeV gamma rays. At {approx}GeV energies, the Fermi Gamma-ray Space Telescope has increased the number of known sources by nearly an order of magnitude in its first year of operation. New classes of sources that were previously theorized to be gamma-ray emitters have now been confirmed observationally. Moreover, there have been surprise discoveries of GeV gamma-ray emission from source classes for which no theory predicted it was possible. In addition to elucidating the processes of high-energy astrophysics, gamma-ray telescopes are making essential contributions to fundamental physics topics including quantum gravity, gravitational waves, and dark matter. I summarize the current census of astrophysical gamma-ray sources, highlight some recent discoveries relevant to fundamental physics, and describe the synergetic connections between gamma-ray and neutrino astronomy. This is a brief overview intended in particular for particle physicists and neutrino astronomers, based on a presentation at the Neutrino 2010 conference in Athens, Greece. I focus in particular on results from Fermi (which was launched soon after Neutrino 2008), and conclude with a description of the next generation of instruments, namely HAWC and the Cherenkov Telescope Array.

  17. Study on the optimization of the water Cherenkov detector array of the LHAASO project for surveying VHE gamma ray sources

    Science.gov (United States)

    Li, Hui-Cai; Chen, Ming-Jun; Jia, Huan-Yu; Gao, Bo; Wu, Han-Rong; Yao, Zhi-Guo; Yuo, Xiao-Hao; Zhou, Bin; Zhu, Feng-Rong

    2014-01-01

    It is prpopsed that a water Cherenkov detector array, LHAASO-WCDA, is to be built at Shangri-la, Yunnan Province, China. As one of the major components of the LHAASO project, the main purpose of it is to survey the northern sky for gamma ray sources in the energy range of 100 GeV-30 TeV. In order to design the water Cherenkov array efficiently to economize the budget, a Monte Carlo simulation is carried out. With the help of the simulation, the cost performance of different configurations of the array are obtained and compared with each other, serving as a guide for the more detailed design of the experiment in the next step.

  18. Study on the optimization of the water Cherenkov detector array of the LHAASO project for surveying VHE gamma ray sources

    International Nuclear Information System (INIS)

    Li Huicai; Chen Mingjun; Gao Bo; Wu Hanrong; Yao Zhiguo; Zhou Bin; Jia Huanyu; Zhu Fengrong; You Xiaohao

    2014-01-01

    It is proposed that a water Cherenkov detector array, LHAASO-WCDA, is to be built at Shangri-la, Yunnan Province, China. As one of the major components of the LHAASO project, the main purpose of it is to survey the northern sky for gamma ray sources in the energy range of 100 GeV-30 TeV. In order to design the water Cherenkov array efficiently to economize the budget, a Monte Carlo simulation is carried out. With the help of the simulation, the cost performance of different configurations of the array are obtained and compared with each other, serving as a guide for the more detailed design of the experiment in the next step. (authors)

  19. Astrophysical applications of Delbrück scattering: Dust scattered gamma radiation from gamma ray bursts

    International Nuclear Information System (INIS)

    Kunwar, B.; Bhadra, A.; Gupta, S.K. Sen

    2014-01-01

    A preliminary, and perhaps the first, study of astrophysical applications of Delbrück scattering in a gamma-ray emitting celestial object like a gamma-ray burst (GRB) has been made. At energies≥100 MeV the elastic scattering of gamma-ray photons off the molecular dust surrounding the GRB site is dominated by Delbrück scattering. Expressions for Delbrück-scattered gamma-ray flux as a function of time has been obtained for a few selected energies by assuming a simple model of GRB. These are compared with Compton-scattered flux. At certain situations, interestingly, the former is found to exceed the latter for the first few milliseconds of the burst. The issue of detectability of Delbrück-scattered gamma-ray echo from the cloud of a GRB is discussed. Although it is observed that the detection of such an echo is not within the capability of the presently operating gamma-ray missions such as Fermi LAT, a rough estimate shows that one can be optimistic that future generation gamma-ray telescopes might be able to see such photons' contribution to the total flux. - Highlights: ► Astrophysical application of Delbrück scattering in a GRB has been made. ► Initially, the Delbrück scattering may dominate the scattering of GeV γ-rays. ► The issue of detectability of such radiations is discussed

  20. Computational Astrophysics Consortium 3 - Supernovae, Gamma-Ray Bursts and Nucleosynthesis

    Energy Technology Data Exchange (ETDEWEB)

    Woosley, Stan [Univ. of California, Santa Cruz, CA (United States)

    2014-08-29

    Final project report for UCSC's participation in the Computational Astrophysics Consortium - Supernovae, Gamma-Ray Bursts and Nucleosynthesis. As an appendix, the report of the entire Consortium is also appended.

  1. The goals of gamma-ray spectroscopy in high energy astrophysics

    Science.gov (United States)

    Lingenfelter, Richard E.; Higdon, James C.; Leventhal, Marvin; Ramaty, Reuven; Woosley, Stanford E.

    1990-01-01

    The use of high resolution gamma-ray spectroscopy in astrophysics is discussed with specific attention given to the application of the Nuclear Astrophysics Explorer (NAE). The gamma-ray lines from nuclear transitions in radionucleic decay and positron annihilation permits the study of current sites, rates and models of nucleosynthesis, and galactic structure. Diffuse galactic emission is discussed, and the high-resolution observations of gamma-ray lines from discrete sites are also described. Interstellar mixing and elemental abundances can also be inferred from high-resolution gamma-ray spectroscopy of nucleosynthetic products. Compact objects can also be examined by means of gamma-ray emissions, allowing better understanding of neutron stars and the accreting black hole near the galactic center. Solar physics can also be investigated by examining such features as solar-flare particle acceleration and atmospheric abundances.

  2. Gamma-ray transients and related astrophysical phenomena

    International Nuclear Information System (INIS)

    Lingenfelter, R.E.; Hudson, H.S.; Worrall, D.M.

    1982-01-01

    The workshop covered the study of the explosive phenomena responsible for the various gamma ray transients. X-ray burster observations and theories were also reviewed with emphasis on their relationship to gamma ray bursts. Recent observational data, particularly from the SMM, HEAO, and VENERA satellites made the workshop especially timely. Major headings include: gamma-ray transients, x-ray bursts, solar transients, and instrumental concepts. Individual items from the workshop were prepared separately for the data base

  3. Cosmic ray and gamma astrophysics with the AMS-02 experiment

    International Nuclear Information System (INIS)

    Natale, Sonia

    2006-01-01

    The Alpha Magnetic Spectrometer (AMS) is a particle physics detector designed to operate on the International Space Station (ISS) for a minimum period of three years. The aim of AMS is the direct detection of charged particles in the rigidity range from 0.5 GV to few TV to perform high statistics studies of cosmic rays in space and a search for antimatter and dark matter. AMS will provide precise gamma measurements in the GeV range. In addition, the good angular resolution and identification capabilities of the detector will allow clean studies of galactic and extra-galactic sources, the diffuse gamma background and gamma ray bursts

  4. CELESTE: an atmospheric Cherenkov telescope for high energy gamma astrophysics

    Czech Academy of Sciences Publication Activity Database

    Paré, E.; Balauge, B.; Bazer-Bachi, R.; Bergeret, H.; Berny, F.; Briand, N.; Bruel, P.; Cerutti, M.; Collon, J.; Cordier, A.; Cornbise, P.; Debiais, G.; Dezalay, J. P.; Dumora, D.; Durand, E.; Eschstruth, P.; Espigat, P.; Fabre, B.; Fleury, P.; Gilly, J.; Gouillaud, J. C.; Gregory, C.; Hérault, N.; Holder, J.; Hrabovský, Miroslav; Incerti, S.; Jouenne, A.; Kalt, L.; LeGallou, R.; Lott, B.; Manigot, P.; Neveu, J.; Olive, J. F.; Palatka, Miroslav; Perez, A.; Rebii, A.; Rob, L.; Sans, J. L.; Schovánek, Petr; Villard, G.

    2002-01-01

    Roč. 490, - (2002), s. 71-89 ISSN 0168-9002 R&D Projects: GA MŠk LN00A006 Institutional research plan: CEZ:AV0Z1010920 Keywords : gamma-ray astronopy * atmospheric Cherenkov detector Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 1.167, year: 2002

  5. CELESTE an atmospheric Cherenkov telescope for high energy gamma astrophysics

    CERN Document Server

    Paré, E; Bazer-Bachi, R; Bergeret, H; Berny, F; Briand, N; Bruel, P; Cerutti, M; Collon, J; Cordier, A; Cornebise, P; Debiais, G; Dezalay, J P; Dumora, D; Durand, E; Eschstruth, P T; Espigat, P; Fabre, B; Fleury, P; Gilly, J; Gouillaud, J C; Gregory, C; Herault, N; Holder, J; Hrabovsky, M; Incerti, S; Jouenne, A; Kalt, L; Legallou, R; Lott, B; Lodygensky, O; Manigot, P; Manseri, H; Manitaz, H; Martin, M; Morano, R; Morineaud, G; Muenz, F; Musquere, A; Naurois, M D; Neveu, J; Noppe, J M; Olive, J F; Palatka, M; Pérez, A; Quebert, J; Rebii, A; Reposeur, T; Rob, L; Roy, P; Sans, J L; Sako, T; Schovanek, P; Smith, D A; Snabre, P; Villard, G

    2002-01-01

    CELESTE is an atmospheric Cherenkov telescope based on the sampling method which makes use of the de-commissioned THEMIS solar electrical plant in the French Pyrenees. A large (2000 m sup 2) mirror surface area from 40 independent heliostats followed by a secondary optic, a trigger system using analog summing techniques and signal digitization with 1 GHz flash ADCs make possible the detection of cosmic gamma-rays down to 30 GeV. This paper provides a detailed technical description of the CELESTE installation.

  6. The Advanced Gamma-ray Imaging System (AGIS): Galactic Astrophysics

    Science.gov (United States)

    Digel, Seth William; Funk, S.; Kaaret, P. E.; Tajima, H.; AGIS Collaboration

    2010-03-01

    The Advanced Gamma-ray Imaging System (AGIS), a concept for a next-generation atmospheric Cherenkov telescope array, would provide unprecedented sensitivity and resolution in the energy range >50 GeV, allowing great advances in the understanding of the populations and physics of sources of high-energy gamma rays in the Milky Way. Extrapolation based on the known source classes and the performance parameters for AGIS indicates that a survey of the Galactic plane with AGIS will reveal hundreds of TeV sources in exquisite detail, for population studies of a variety of source classes, and detailed studies of individual sources. AGIS will be able to study propagation effects on the cosmic rays produced by Galactic sources by detecting the diffuse glow from their interactions in dense interstellar gas. AGIS will complement and extend results now being obtained in the GeV range with the Fermi mission, by providing superior angular resolution and sensitivity to variability on short time scales, and of course by probing energies that Fermi cannot reach.

  7. Dicty_cDB: VHE138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE138 (Link to dictyBase) - - - Contig-U15767-1 VHE138P (Link... to Original site) VHE138F 569 VHE138Z 621 VHE138P 1170 - - Show VHE138 Library VH (Link to library) Clone ID VHE138 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...FVDNQAGDSXSAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQGF NDVSYP--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICT...rsi*i**fkllpn*rtrf q*ckls--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTPVDCG ANDEDKCKTWSCDPTKGG

  8. Gamma-Ray Lenses for Astrophysics-and the Gamma-Ray Imager Mission GRI

    DEFF Research Database (Denmark)

    Wunderer, C. B.; Ballmoos, P. V.; Barriere, N.

    2009-01-01

    Observations of the gamma-ray sky reveal the most powerful sources and the most violent events in the Universe. While at lower wavebands the observed emission is generally dominated by thermal processes, the gamma-ray sky provides us with a view on the non-thermal Universe. Here particles are acc...

  9. Topics in Astrophysical X-Ray and Gamma Ray Spectroscopy. Ph.D. Thesis - Maryland Univ.

    Science.gov (United States)

    Bussard, R. W.

    1978-01-01

    A number of topics relating to astrophysical observations that have already been made or are currently planned of spectral features, mostly emission lines, in the X-ray and gamma ray region of the electromagnetic spectrum are investigated. These topics include: the production of characteristic X-ray and gamma ray lines by nonthermal ions, spectral features induced by processes occurring in strong magnetic fields, and the positron annihilation line at 0.5 MeV. The rate of X-ray production at 6.8 keV by the 2p to 1s transition in fast hydrogen- and helium-like iron ions, following both electron capture to excited levels and collisional excitation is calculated. The cross section for electron-ion Coulomb collisions in strong fields is also calculated.

  10. Very high energy gamma ray astrophysics: Progress report, May 1, 1987-February 1, 1988

    International Nuclear Information System (INIS)

    Lamb, R.G.; Lewis, D.A.

    1988-02-01

    The Whipple observatory Gamma Ray Collaboration has continued to make steady progress in its development of a highly sensitive stereoscopic imaging gamma-ray telescope (known as the HERCULES project). The milestones in this year's development include: the demonstration of the success of the imaging concept with a single camera by the detection of a very weak flux of gamma rays from the Crab Nebula at a high level of statistical significance (7 sigma), the confirmation of our detection of an anomalous pulsed flux from Hercules X-1 in the summer of 1986 by two other groups; this result has serious implications for the mechanism for gamma-ray emission in this binary source. The construction and installation of the new high resolution camera on the 10 m reflector; the realistic simulation of the sensitivity of this camera as well as that of the full HERCULES system was also undertaken. These, and other highlights of this year's program at the Iowa State University and the Smithsonian Astrophysical Observatory, are discussed in this paper. 6 figs

  11. Developing a Laue Lens for Nuclear Astrophysics: The Challenge of Focusing Soft Gamma-rays

    Science.gov (United States)

    Barriere, Nicolas

    Soft gamma rays provide a unique window on the high-energy Universe, especially for studying nuclear astrophysics through nuclear line emission. However, the sensitivity of state-of-the-art gamma-ray telescopes is severely limited by the intense instrumental background when flown in space. A solution is to decouple the photon collection area from the photon detection area. Focusing source photons from a large collection area onto a small detector volume would dramatically improve the signal-to-noise ratio, and hence provide the long awaited sensitivity leap in this challenging energy band. Laue crystal diffraction can be utilized to focus soft gamma rays when configured in a Laue lens. While this technology has been demonstrated on balloon flights, the type of crystals used and the process of assembling many crystals into a lens have not been optimized yet. We propose to address all the technical aspects of the construction of a scientifically exploitable Laue lens in order to bring this technology to TRL-6. To this end, two small prototypes representative of the diversity of Laue lenses will be built and tested in relevant environments, leveraging the work accomplished under a previous APRA grant. This project will establish the real performances, the cost, and the construction duration of a full-scale lens, allowing us to propose a Laue lens telescope for suborbital or satellite missions.

  12. Multi-TeV gamma ray and cosmic ray astrophysics with TAIGA

    Energy Technology Data Exchange (ETDEWEB)

    Tluczykont, Martin [Hamburg Univ. (Germany). Institut fuer Experimentalphysik; Collaboration: TAIGA Kollaboration

    2016-07-01

    The very high energy gamma-ray regime is the key to several questions in high energy astrophysics, the most prominent being the search for the origin of cosmic rays. Observations of gamma rays up to several 100 TeV are particularly important to spectrally resolve the cutoff regime of the long-sought Pevatrons, the accelerators of PeV cosmic rays. TAIGA is an international collaboration that has, in the past 3 years, installed the air Cherenkov timing array HiSCORE on an area of 0.25 square-km, and are currently installing a first 4m diameter imaging air Cherenkov telescope (IACT), to be operated in parallel with the timing array. Our aim is to combine the timing and imaging techniques on a large scale in order to optimize the air Cherenkov detection technique for energies above 10 TeV and up to several 100 TeV. Simulations show a clear potential of the planned hybrid event reconstruction, especially in the energy regime from 10 TeV to 100 TeV. The TAIGA experiment will be complemented by scintillator based particle detectors for a measurement of the muon content of the air shower at higher energies. The status of our experiment and the planned 1 square-km stage of TAIGA are discussed.

  13. Laue optics for nuclear astrophysics: New detector requirements for focused gamma-ray beams

    Energy Technology Data Exchange (ETDEWEB)

    Barriere, N. [INAF - IASF Roma, via Fosso del Cavaliere 100, 00133 Roma (Italy)], E-mail: nicolas.barriere@iasf-roma.inaf.it; Ballmoos, P. von [CESR - UMR 5187, 9 Av. du Colonel Roche, 31028 Toulouse (France); Abrosimov, N.V. [IKZ, Max Born-Str. 2, D-12489 Berlin (Germany); Bastie, P. [LSP UMR 5588, 140 Av. de la physique, 38402 Saint Martin d' Heres (France); Camus, T. [CESR - UMR 5187, 9 Av. du Colonel Roche, 31028 Toulouse (France); Courtois, P.; Jentschel, M. [ILL, 6 rue Jules Horowitz, 38042 Grenoble (France); Knoedlseder, J. [CESR - UMR 5187, 9 Av. du Colonel Roche, 31028 Toulouse (France); Natalucci, L. [INAF - IASF Roma, via Fosso del Cavaliere 100, 00133 Roma (Italy); Roudil, G.; Rousselle, J. [CESR - UMR 5187, 9 Av. du Colonel Roche, 31028 Toulouse (France); Wunderer, C.B. [SSL, University of California at Berkeley, CA 94708 (United States); Kurlov, V.N. [Institute of Solid State Physics of Russian Academy of Sciences, 142432 Chernogolovka (Russian Federation)

    2009-10-21

    Nuclear astrophysics presents an extraordinary scientific potential for the study of the most powerful sources and the most violent events in the Universe. But in order to take full advantage of this potential, telescopes should be at least an order of magnitude more sensitive than present technologies. Today, Laue lenses have demonstrated their capability of focusing gamma-rays in the 100 keV-1 MeV domain, enabling the possibility of building a new generation of instruments for which sensitive area is decoupled from collecting area. Thus we have now the opportunity of dramatically increase the signal/background ratio and hence improve significantly the sensitivity. With a lens, the best detector is no longer the largest possible within a mission envelope. The point spread function of a Laue lens measures a few centimeters in diameter, but the field of view is limited by the detector size. Requirements for a focal plane instrument are presented in the context of the Gamma-Ray Imager mission (proposed to European Space Agency, ESA in the framework of the first Cosmic Vision AO): a 15-20 cm a side finely pixellated detector capable of Compton events reconstruction seems to be optimal, giving polarization and background rejection capabilities and 30 arcsec of angular resolution within a field of view of 5 arc min.

  14. Status of the GILDA project for the 30 MeV-100 GeV high energy gamma ray astrophysics

    Energy Technology Data Exchange (ETDEWEB)

    Casolino, M.; Sparvoli, R.; Morselli, A.; Picozza, P. [Rome Univ. `Tor Vergata` (Italy)]|[INFN, Rome (Italy); Barbiellini, G. [Trieste Univ. (Italy)]|[INFN, Trieste (Italy); Fuglesang, C. [ESA-EAC, Cologne (Germany); Ozerov, Yu.V.; Zemskov, V.M.; Zverev, V.G.; Galper, A.M. [Moscow Engineering Physics Institute, Moscow (Russian Federation)

    1995-09-01

    High energy gamma-ray astrophysics has greatly developed in the last few years because of the results of EGRET, on the Compton gamma ray observatory. The satellite observations have shown the importance of continuing the investigation of high energy gamma radiation but the emerging of new astrophysical and cosmological problems require for future experiments the realization of telescopes with parameters significatively improved with respect to the previous missions. In a traditional point of view, this is achieved with the increase of the length L of the device and, consequently, the mass of the telescope and satellite (growing as L{sup 3}). Such kinds of experiments are becoming rather expensive and are approaching the maximum value in cost, satellite mass and consuming resources. The telescope project GILDA presented in this paper is based on the use of silicon strip detectors. The silicon technique consents to obtain a much wider solid angle aperture; in this way there is more sensitivity without a growing in the size of the

  15. Status of the GILDA project for the 30 MeV-100 GeV high energy gamma ray astrophysics

    International Nuclear Information System (INIS)

    Casolino, M.; Sparvoli, R.; Morselli, A.; Picozza, P.; Barbiellini, G.; Fuglesang, C.; Ozerov, Yu.V.; Zemskov, V.M.; Zverev, V.G.; Galper, A.M.

    1995-01-01

    High energy gamma-ray astrophysics has greatly developed in the last few years because of the results of EGRET, on the Compton gamma ray observatory. The satellite observations have shown the importance of continuing the investigation of high energy gamma radiation but the emerging of new astrophysical and cosmological problems require for future experiments the realization of telescopes with parameters significatively improved with respect to the previous missions. In a traditional point of view, this is achieved with the increase of the length L of the device and, consequently, the mass of the telescope and satellite (growing as L 3 ). Such kinds of experiments are becoming rather expensive and are approaching the maximum value in cost, satellite mass and consuming resources. The telescope project GILDA presented in this paper is based on the use of silicon strip detectors. The silicon technique consents to obtain a much wider solid angle aperture; in this way there is more sensitivity without a growing in the size of the

  16. Statistical gamma-ray emission of gold and its astrophysical implications

    Directory of Open Access Journals (Sweden)

    Giacoppo F.

    2014-03-01

    Full Text Available The properties of the excited states of gold isotopes were investigated at the Oslo Cyclotron Laboratory. This study is important for the understanding of neutron capture rates in astrophysical plasmas relevant for heavy element nucleosynthesys.

  17. Magnetic absorption of VHE photons in the magnetosphere of the Crab pulsar

    Science.gov (United States)

    Bogovalov, S. V.; Contopoulos, I.; Prosekin, A.; Tronin, I.; Aharonian, F. A.

    2018-05-01

    The detection of the pulsed ˜1 TeV gamma-ray emission from the Crab pulsar reported by MAGIC and VERITAS collaborations demands a substantial revision of existing models of particle acceleration in the pulsar magnetosphere. In this regard model independent restrictions on the possible production site of the very high energy (VHE) photons become an important issue. In this paper, we consider limitations imposed by the process of conversion of VHE gamma-rays into e± pairs in the magnetic field of the pulsar magnetosphere. Photons with energies exceeding 1 TeV are effectively absorbed even at large distances from the surface of the neutron star. Our calculations of magnetic absorption in the force-free magnetosphere show that the twisting of the magnetic field due to the pulsar rotation makes the magnetosphere more transparent compared to the dipole magnetosphere. The gamma-ray absorption appears stronger for photons emitted in the direction of rotation than in the opposite direction. There is a small angular cone inside which the magnetosphere is relatively transparent and photons with energy 1.5 TeV can escape from distances beyond 0.1 light cylinder radius (Rlc). The emission surface from where photons can be emitted in the observer's direction further restricts the sites of VHE gamma-ray production. For the observation angle 57° relative to the Crab pulsar axis of rotation and the orthogonal rotation, the emission surface in the open field line region is located as close as 0.4 Rlc from the stellar surface for a dipole magnetic field, and 0.1 Rlc for a force-free magnetic field.

  18. Development of a low-level setup for gamma spectroscopy: Application for nuclear astrophysics using reverse kinematics

    International Nuclear Information System (INIS)

    Genard, G.; Nuttens, V.E.; Bouchat, V.; Terwagne, G.

    2010-01-01

    It is more and more necessary to improve the sensitivity of gamma-ray spectroscopy systems, especially in nuclear astrophysics. In the case of radiative proton capture reactions, one means is to avoid the reactions on the target impurities by using reverse kinematics. This technique is possible with the LARN accelerator and can provide very clean cross-section measurements. For that purpose, a hydrogen standard has been carried out by means of ion implantation in silicon. In addition, a low-level setup has been put in place on a new beam line of the accelerator. A high efficiency and high resolution germanium detector is used conjointly with a double shielding. A passive lead castle shielding system is used to reduce the natural radioactivity and an active shielding consisting of an anti-cosmic veto is provided by an anticoincidence between the plastic scintillator and the gamma-ray detector. The setup allows a reduction of 70% of the background interference and provides an approximately 200 fold sensitivity gain of between 600 and 3000 keV. Some other developments have also been carried out to optimize the setup. The entire setup and the reverse kinematics have been validated by measuring the cross-section of the 13 C(p,γ) 14 N and 15 N(p,γ) 16 O reactions that present some astrophysical interest.

  19. Dicty_cDB: VHE867 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE867 (Link to dictyBase) - G02701 DDB0204977 Contig-U14789-1... - (Link to Original site) VHE867F 383 - - - - - - Show VHE867 Library VH (Link to library) Clone ID VHE867 (Link to dict...yBase) Atlas ID - NBRP ID G02701 dictyBase ID DDB0204977 Link to Contig Contig-U14789-1 Original site URL http://dict...one) Salmo salar clone ssal-rgb2-599-16... 116 2e-25 DQ363469_1( DQ363469 |pid:none) Ict...m_ : 1.00 40.0 %: cytoplasmic 36.0 %: nuclear 12.0 %: cytoskeletal 8.0 %: mitochondrial 4.0 %: peroxisomal >> predict

  20. Exploring the extreme gamma-ray sky with HESS

    International Nuclear Information System (INIS)

    Sol, Helene

    2006-01-01

    The international HESS experiment. High Energy Stereoscopic System, fully operational since January 2004, is opening a new era for extreme gamma-ray astronomy. Located in Namibia, it is now the most sensitive detector for cosmic sources of very high energy (VHE) gamma-rays, in the tera-electron-volt (TeV) range. In July 2005, it had already more than double the number of sources detected at such energies, with the discovery of several active galactic nuclei (AGN), supernova remnants and plerions, a binary pulsar system, a microquasar candidate, and a sample of yet unidentified sources. HESS has also provide for the first time gamma-ray images of extended sources with the first astrophysical jet resolved in gamma-rays, and the first mapping of a shell supernova remnant, which proves the efficiency of in situ acceleration of particles up to 100 TeV and beyond

  1. PKS 2005-489 at VHE: four years of monitoring with HESS and simultaneous multi-wavelength observations

    Science.gov (United States)

    H.E.S.S. Collaboration; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Barres de Almeida, U.; Bazer-Bachi, A. R.; Becherini, Y.; Behera, B.; Benbow, W.; Bernlöhr, K.; Bochow, A.; Boisson, C.; Bolmont, J.; Borrel, V.; Brucker, J.; Brun, F.; Brun, P.; Bühler, R.; Bulik, T.; Büsching, I.; Boutelier, T.; Chadwick, P. M.; Charbonnier, A.; Chaves, R. C. G.; Cheesebrough, A.; Chounet, L.-M.; Clapson, A. C.; Coignet, G.; Costamante, L.; Dalton, M.; Daniel, M. K.; Davids, I. D.; Degrange, B.; Deil, C.; Dickinson, H. J.; Djannati-Ataï, A.; Domainko, W.; O'C. Drury, L.; Dubois, F.; Dubus, G.; Dyks, J.; Dyrda, M.; Egberts, K.; Eger, P.; Espigat, P.; Fallon, L.; Farnier, C.; Fegan, S.; Feinstein, F.; Fiasson, A.; Förster, A.; Fontaine, G.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Gérard, L.; Gerbig, D.; Giebels, B.; Glicenstein, J. F.; Glück, B.; Goret, P.; Göring, D.; Hauser, M.; Heinz, S.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hoffmann, A.; Hofmann, W.; Hofverberg, P.; Holleran, M.; Hoppe, S.; Horns, D.; Jacholkowska, A.; de Jager, O. C.; Jahn, C.; Jung, I.; Katarzyński, K.; Katz, U.; Kaufmann, S.; Kerschhaggl, M.; Khangulyan, D.; Khélifi, B.; Keogh, D.; Klochkov, D.; Kluźniak, W.; Kneiske, T.; Komin, Nu.; Kosack, K.; Kossakowski, R.; Lamanna, G.; Lenain, J.-P.; Lohse, T.; Marandon, V.; Martineau-Huynh, O.; Marcowith, A.; Masbou, J.; Maurin, D.; McComb, T. J. L.; Medina, M. C.; Méhault, J.; Moderski, R.; Moulin, E.; Naumann-Godo, M.; de Naurois, M.; Nedbal, D.; Nekrassov, D.; Nicholas, B.; Niemiec, J.; Nolan, S. J.; Ohm, S.; Olive, J.-F.; de Oña Wilhelmi, E.; Orford, K. J.; Ostrowski, M.; Panter, M.; Paz Arribas, M.; Pedaletti, G.; Pelletier, G.; Petrucci, P.-O.; Pita, S.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raubenheimer, B. C.; Raue, M.; Rayner, S. M.; Renaud, M.; Rieger, F.; Ripken, J.; Rob, L.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Ruppel, J.; Sahakian, V.; Santangelo, A.; Schlickeiser, R.; Schöck, F. M.; Schwanke, U.; Schwarzburg, S.; Schwemmer, S.; Shalchi, A.; Sikora, M.; Skilton, J. L.; Sol, H.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Superina, G.; Szostek, A.; Tam, P. H.; Tavernet, J.-P.; Terrier, R.; Tibolla, O.; Tluczykont, M.; van Eldik, C.; Vasileiadis, G.; Venter, C.; Venter, L.; Vialle, J. P.; Vincent, P.; Vivier, M.; Völk, H. J.; Volpe, F.; Wagner, S. J.; Ward, M.; Zdziarski, A. A.; Zech, A.

    2010-02-01

    Aims: Our aim is to study the very high energy (VHE; E>100 GeV) γ-ray emission from BL Lac objects and the evolution in time of their broad-band spectral energy distribution (SED). Methods: VHE observations of the high-frequency peaked BL Lac object PKS 2005-489 were made with the High Energy Stereoscopic System (HESS) from 2004 through 2007. Three simultaneous multi-wavelength campaigns at lower energies were performed during the HESS data taking, consisting of several individual pointings with the XMM-Newton and RXTE satellites. Results: A strong VHE signal, ~17σ total, from PKS 2005-489 was detected during the four years of HESS observations (90.3 h live time). The integral flux above the average analysis threshold of 400 GeV is ~3% of the flux observed from the Crab Nebula and varies weakly on time scales from days to years. The average VHE spectrum measured from ~300 GeV to ~5 TeV is characterized by a power law with a photon index, Γ = 3.20± 0.16_stat± 0.10_syst. At X-ray energies the flux is observed to vary by more than an order of magnitude between 2004 and 2005. Strong changes in the X-ray spectrum (ΔΓX ≈ 0.7) are also observed, which appear to be mirrored in the VHE band. Conclusions: The SED of PKS 2005-489, constructed for the first time with contemporaneous data on both humps, shows significant evolution. The large flux variations in the X-ray band, coupled with weak or no variations in the VHE band and a similar spectral behavior, suggest the emergence of a new, separate, harder emission component in September 2005. Supported by CAPES Foundation, Ministry of Education of Brazil.Now at Harvard-Smithsonian Center for Astrophysics, Cambridge, USA.Now at W.W. Hansen Experimental Physics Laboratory & Kavli Institute for Particle Astrophysics and Cosmology, Stanford University, Stanford, USA.

  2. Hard X-ray/soft gamma-ray telescope designs for future astrophysics missions

    DEFF Research Database (Denmark)

    Ferreira, Desiree Della Monica; Christensen, Finn Erland; Pivovaroff, Michael J.

    2013-01-01

    We present several concept designs of hard X-ray/soft λ-ray focusing telescopes for future astrophysics missions. The designs are based on depth graded multilayer coatings. These have been successfully employed on the NuSTAR mission for energies up to 80 keV. Recent advances in demonstrating...

  3. High energy astrophysics

    International Nuclear Information System (INIS)

    Engel, A.R.

    1979-01-01

    High energy astrophysical research carried out at the Blackett Laboratory, Imperial College, London is reviewed. Work considered includes cosmic ray particle detection, x-ray astronomy, gamma-ray astronomy, gamma and x-ray bursts. (U.K.)

  4. The future of high energy gamma ray astronomy and its potential astrophysical implications

    Science.gov (United States)

    Fichtel, C. E.

    1982-01-01

    Future satellites should carry instruments having over an order of magnitude greater sensitivity than those flown thus far as well as improved energy and angular resolution. The information to be obtained from these experiments should greatly enhance knowledge of: the very energetic and nuclear processes associated with compact objects; the structure of our galaxy; the origin and dynamic pressure effects of the cosmic rays; the high energy particles and energetic processes in other galaxies; and the degree of matter-antimatter symmetry of the universe. The relevant aspects of extragalactic gamma ray phenomena are emphasized along with the instruments planned. The high energy gamma ray results of forthcoming programs such as GAMMA-1 and the Gamma Ray Observatory should justify even more sophisticated telescopes. These advanced instruments might be placed on the space station currently being considered by NASA.

  5. Very high energy gamma ray astrophysics: Progress report for period May 1, 1986-February 15, 1987

    International Nuclear Information System (INIS)

    Lamb, R.C.; Lewis, D.A.

    1987-02-01

    Highlights of research are noted. These include new electronics, noise and gain analysis, tests of imaging, new sources of gamma radiation observed, development of a 37-element mini camera, computer capabilities, and new detector capabilities

  6. Nuclear transfer reaction measurements at the ESR-for the investigation of the astrophysical O-15(alpha,gamma)Ne-19 reaction

    NARCIS (Netherlands)

    Doherty, D. T.; Woods, P. J.; Litvinov, Yu A.; Najafi, M. Ali; Bagchi, S.; Bishop, S.; Bo, M.; Brandau, C.; Davinson, T.; Dillmann, I.; Estrade, A.; Egelhof, P.; Evdokimov, A.; Gumberidze, A.; Heil, M.; Lederer, C.; Litvinov, S. A.; Lotay, G.; Kalantar-Nayestanaki, N.; Kiselev, O.; Kozhuharov, C.; Kroell, T.; Mahjour-Shafei, M.; Mutterer, M.; Nolden, F.; Petridis, N.; Popp, U.; Reifarth, R.; Rigollet, C.; Roy, S.; Steck, M.; Stoehlker, Th; Streicher, B.; Trotsenko, S.; von Schmid, M.; Yan, X. L.; Zamora, J. C.

    Astrophysical x-ray bursts are thought to be a result of thermonuclear explosions on the atmosphere of an accreting neutron star. Between these bursts, energy is thought to be generated by the hot CNO cycles. The O-15(alpha,gamma)Ne-19 reaction is one reaction that allows breakout from these CNO

  7. Nuclear transfer reaction measurements at the ESR-for the investigation of the astrophysical O-15(alpha,gamma)Ne-19 reaction

    NARCIS (Netherlands)

    Doherty, D. T.; Woods, P. J.; Litvinov, Yu A.; Najafi, M. Ali; Bagchi, S.; Bishop, S.; Bo, M.; Brandau, C.; Davinson, T.; Dillmann, I.; Estrade, A.; Egelhof, P.; Evdokimov, A.; Gumberidze, A.; Heil, M.; Lederer, C.; Litvinov, S. A.; Lotay, G.; Kalantar-Nayestanaki, N.; Kiselev, O.; Kozhuharov, C.; Kroell, T.; Mahjour-Shafei, M.; Mutterer, M.; Nolden, F.; Petridis, N.; Popp, U.; Reifarth, R.; Rigollet, C.; Roy, S.; Steck, M.; Stoehlker, Th; Streicher, B.; Trotsenko, S.; von Schmid, M.; Yan, X. L.; Zamora, J. C.

    2015-01-01

    Astrophysical x-ray bursts are thought to be a result of thermonuclear explosions on the atmosphere of an accreting neutron star. Between these bursts, energy is thought to be generated by the hot CNO cycles. The O-15(alpha,gamma)Ne-19 reaction is one reaction that allows breakout from these CNO

  8. Relevance of axionlike particles for very-high-energy astrophysics

    International Nuclear Information System (INIS)

    De Angelis, Alessandro; Galanti, Giorgio; Roncadelli, Marco

    2011-01-01

    Several extensions of the standard model and, in particular, superstring theories suggest the existence of axionlike particles (ALPs), which are very light spin-zero bosons with a two-photon coupling. As a consequence, photon-ALP oscillations occur in the presence of an external magnetic field, and ALPs can lead to observable effects on the measured photon spectrum of astrophysical sources. An intriguing situation arises when blazars are observed in the very-high-energy (VHE) band--namely, above 100 GeV--as it is the case with the presently operating Imaging Atmospheric Cherenkov Telescopes H.E.S.S, Major Atmospheric Gamma Imaging Cherenkov telescope, Collaboration of Australia and Nippon for a Gamma Ray Observatory in the Outback III, and VERITAS. The extragalactic background light produced by galaxies during cosmic evolution gives rise to a source dimming which becomes important in the VHE band and increases with energy, since hard photons from a blazar scatter off soft extragalactic background light photons thereby disappearing into e + e - pairs. This dimming can be considerably reduced by photon-ALP oscillations, and since they are energy independent the resulting blazar spectra become harder than expected. We consider throughout a scenario first proposed by De Angelis, Roncadelli, and Mansutti in which the above strategy is implemented with photon-ALP oscillations triggered by large-scale magnetic fields, and we systematically investigate its implications for VHE blazars. We find that for ALPs lighter than 5·10 -10 eV the photon survival probability is larger than predicted by conventional physics above a few hundred GeV. Specifically, a boost factor of 10 can easily occur for sources at large distance and large energy, e.g. at 8 TeV for the blazar 1ES 0347-121 at redshift z=0.188. This is a clear-cut prediction which can be tested with the planned Cherenkov Telescope Array and the High Altitude Water Cherenkov Experiment (HAWC) water Cherenkov

  9. Design and expected performance of a novel hybrid detector for very-high-energy gamma-ray astrophysics

    Science.gov (United States)

    Assis, P.; Barres de Almeida, U.; Blanco, A.; Conceição, R.; D'Ettorre Piazzoli, B.; De Angelis, A.; Doro, M.; Fonte, P.; Lopes, L.; Matthiae, G.; Pimenta, M.; Shellard, R.; Tomé, B.

    2018-05-01

    Current detectors for Very-High-Energy γ-ray astrophysics are either pointing instruments with a small field of view (Cherenkov telescopes), or large field-of-view instruments with relatively large energy thresholds (extensive air shower detectors). In this article, we propose a new hybrid extensive air shower detector sensitive in an energy region starting from about 100 GeV. The detector combines a small water-Cherenkov detector, able to provide a calorimetric measurement of shower particles at ground, with resistive plate chambers which contribute significantly to the accurate shower geometry reconstruction. A full simulation of this detector concept shows that it is able to reach better sensitivity than any previous gamma-ray wide field-of-view experiment in the sub-TeV energy region. It is expected to detect with a 5σ significance a source fainter than the Crab Nebula in one year at 100 GeV and, above 1 TeV a source as faint as 10% of it. As such, this instrument is suited to detect transient phenomena making it a very powerful tool to trigger observations of variable sources and to detect transients coupled to gravitational waves and gamma-ray bursts.

  10. Astrophysical interpretation of the anisotropies in the unresolved gamma-ray background

    Science.gov (United States)

    Ando, Shin'ichiro; Fornasa, Mattia; Fornengo, Nicolao; Regis, Marco; Zechlin, Hannes-S.

    2017-06-01

    Recently, a new measurement of the auto- and cross-correlation angular power spectrum (APS) of the isotropic gamma-ray background was performed, based on 81 months of data of the Fermi Large-Area Telescope (LAT). Here, we fit, for the first time, the new APS data with a model describing the emission of unresolved blazars. These sources are expected to dominate the anisotropy signal. The model we employ in our analysis reproduces well the blazars resolved by Fermi LAT. When considering the APS obtained by masking the sources listed in the 3FGL catalog, we find that unresolved blazars underproduce the measured APS below ˜1 GeV . Contrary to past results, this suggests the presence of a new contribution to the low-energy APS, with a significance of, at least, 5 σ . The excess can be ascribed to a new class of faint gamma-ray emitters. If we consider the APS obtained by masking the sources in the 2FGL catalog, there is no underproduction of the APS below 1 GeV, but the new source class is still preferred over the blazars-only scenario (with a significance larger than 10 σ ). The properties of the new source class and the level of anisotropies induced in the isotropic gamma-ray background are the same, independent of the APS data used. In particular, the new gamma-ray emitters must have a soft energy spectrum, with a spectral index ranging, approximately, from 2.7 to 3.2. This complicates their interpretation in terms of known sources, since, normally, star-forming and radio galaxies are observed with a harder spectrum. The new source class identified here is also expected to contribute significantly to the intensity of the isotropic gamma-ray background.

  11. VHE gamma-rays from radio pulsars and cataclysmic variables

    International Nuclear Information System (INIS)

    De Jager, O.C.; Brink, C.; Meintjies, P.J.; Nel, H.I.; North, A.R.; Raubenheimer, B.C.; Van der Walt, D.J.

    1990-01-01

    We present the results of observations (above 1 TeV) of radio pulsars and cataclysmic variables with the Potchefstroom air Cerenkov facility. We were able to confirm our previous detection of PSR 1509-58 and the final significance is 1.7x10 -5 . A DC enhancement at the 10 -3 significance level was seen from the L 4 Lagrange position in the PSR 1957+20 system. This result was confirmed by COS-B data. We were also able to detect the 5.4 ms pulsar PSR 1855+09 at a marginal significance level of 5%. However, the best and longest observation indicates non-uniformity at the 0.005 significance level. The TeV light curve resembles the radio light curve. The latter is also reminiscent of other millisecond pulsar observed above 1 TeV. The intermediate polar AEAQR (P = 33.08s) shows a period shift which is consistent with recent model predictions. However, the present significance of this results does not allow an unambiguous claim. (orig.)

  12. ASTROPHYSICAL PARAMETERS OF LS 2883 AND IMPLICATIONS FOR THE PSR B1259-63 GAMMA-RAY BINARY

    International Nuclear Information System (INIS)

    Negueruela, Ignacio; Lorenzo, Javier; Ribo, Marc; Herrero, Artemio; Khangulyan, Dmitry; Aharonian, Felix A.

    2011-01-01

    Only a few binary systems with compact objects display TeV emission. The physical properties of the companion stars represent basic input for understanding the physical mechanisms behind the particle acceleration, emission, and absorption processes in these so-called gamma-ray binaries. Here we present high-resolution and high signal-to-noise optical spectra of LS 2883, the Be star forming a gamma-ray binary with the young non-accreting pulsar PSR B1259-63, showing it to rotate faster and be significantly earlier and more luminous than previously thought. Analysis of the interstellar lines suggests that the system is located at the same distance as (and thus is likely a member of) Cen OB1. Taking the distance to the association, d = 2.3 kpc, and a color excess of E(B - V) = 0.85 for LS 2883 results in M V ∼ -4.4. Because of fast rotation, LS 2883 is oblate (R eq ≅ 9.7 R sun and R pole ≅ 8.1 R sun ) and presents a temperature gradient (T eq ∼ 27,500 K, log g eq = 3.7; T pole ∼ 34,000 K, log g pole = 4.1). If the star did not rotate, it would have parameters corresponding to a late O-type star. We estimate its luminosity at log(L * /L sun ) ≅ 4.79 and its mass at M * ∼ 30 M sun . The mass function then implies an inclination of the binary system i orb ∼ 23 0 , slightly smaller than previous estimates. We discuss the implications of these new astrophysical parameters of LS 2883 for the production of high-energy and very high-energy gamma rays in the PSR B1259-63/LS 2883 gamma-ray binary system. In particular, the stellar properties are very important for prediction of the line-like bulk Comptonization component from the unshocked ultrarelativistic pulsar wind.

  13. Topics in High-Energy Astrophysics: X-ray Time Lags and Gamma-ray Flares

    Science.gov (United States)

    Kroon, John J.

    2016-03-01

    The Universe is host to a wide variety of high-energy processes that convert gravitational potential energy or rest-mass energy into non-thermal radiation such as bremsstrahlung and synchrotron. Prevailing models of X-ray emission from accreting Black Hole Binaries (BHBs) struggle to simultaneously fit the quiescent X-ray spectrum and the transients which result in the phenomenon known as X-ray time lags. And similarly, classical models of diffusive shock acceleration in pulsar wind nebulae fail to explain the extreme particle acceleration in very short timescales as is inferred from recent gamma-ray flares from the Crab nebula. In this dissertation, I develop new exact analytic models to shed light on these intriguing processes. I take a fresh look at the formation of X-ray time lags in compact sources using a new mathematical approach in which I obtain the exact Green's function solution. The resulting Green's function allows one to explore a variety of injection scenarios, including both monochromatic and broadband (bremsstrahlung) seed photon injection. I obtain the exact solution for the dependence of the time lags on the Fourier frequency, for both homogeneous and inhomogeneous clouds. The model can successfully reproduce both the observed time lags and the quiescent X-ray spectrum using a single set of coronal parameters. I show that the implied coronal radii in the new model are significantly smaller than those obtained in the Monte Carlo simulations, hence greatly reducing the coronal heating problem. Recent bright gamma-ray flares from the Crab nebula observed by AGILE and Fermi reaching GeV energies and lasting several days challenge the contemporary model for particle acceleration in pulsar wind nebulae, specifically the diffusive shock acceleration model. Simulations indicate electron/positron pairs in the Crab nebula pulsar wind must be accelerated up to PeV energies in the presence of ambient magnetic fields with strength B ~100 microG. No

  14. Studying explosive phenomena in astrophysics by the example of gamma-ray bursts and supernovae

    International Nuclear Information System (INIS)

    Filina, Anastasia

    2015-01-01

    The formation of the first stars hundreds of millions of years after the Big-Bang marks the end of the Dark Ages. Currently, we have no direct observations on how the primordial stars formed, but according to modern theory of stellar evolution these stars should be very massive (about 100 Msun) Population III stars have a potential to produce probably most energetic flashes in the Universe - gamma-ray bursts. GRBs may provide one of the most promising methods to probe directly final stage of life of primordial stars. Today's telescopes cannot look far enough into the cosmic past to observe the formation of the first stars, but the new generation of telescopes will test theoretical ideas about the formation of the first stars.Thanks to many years of observations we have good GRB's data -statistics of occurrence, spectrum, light curves. But there are still a lot of questions in the theory of GRBs. We know that GRBs are related to the death of stars and that they are connected with supernovae. So gamma-ray bursts are one of the classes of explosive processes in stellar physics that should have a lot of common with supernovae explosions. In that case GRBs should follow the same physical laws of explosion as supernovae. This work tries to approach the problem of GRBs as a problem of stellar explosion.Necessary instruments of studying stellar explosion were developed as a part of doctoral research: code for solving systems of nuclear reaction equations was incorporated into hydrodynamical code. These tools were applied for supernovae simulations in order to find possible connection with GRBs. Basing on analysis of supernovae simulations spectral analysis of GRBs was performed. (author)

  15. FAST TIMING ANALYSIS OF CYGNUS X-1 USING THE SPECTROMETER ON THE INTERNATIONAL GAMMA-RAY ASTROPHYSICS LABORATORY

    International Nuclear Information System (INIS)

    Cabanac, Clement; Roques, Jean-Pierre; Jourdain, Elisabeth

    2011-01-01

    We report for the first time the high-frequency analysis of Cyg X-1 up to hard X-ray using the spectrometer on International Gamma-Ray Astrophysics Laboratory (INTEGRAL). After analyzing the possible contribution from the background, and using the INTEGRAL archive from 2005 March to 2008 May, power density spectra were obtained up to 130 keV. First, we show that their overall shape is very similar to that observed at lower energies as they are well described by sets of Lorentzians. The strength of this fast variability (up to 40 Hz) does not drop at high energy since we show that it remains at ∼25% rms, even in the highest energy bands. Second, the hard X-ray variability patterns of Cyg X-1 are state dependent: the softer the spectrum (or the lower the hardness ratio), the lower the total fractional variability and the higher the typical frequencies observed. The strength of the total variability as a function of energy and state is then investigated. By comparison with simultaneous and published RXTE/Proportional Counter Array data, we show that in the hard state it remains quite constant in the 2-130 keV energy range. In the softer state it is also flat up to 50 keV and may increase at higher energy. The implications of this behavior on the models are then discussed.

  16. The History of Ground-Based Very High Energy Gamma-Ray Astrophysics with the Atmospheric Air Cherenkov Telescope Technique

    Energy Technology Data Exchange (ETDEWEB)

    Mirzoyan, Razmik

    2013-06-15

    In the recent two decades the ground-based technique of imaging atmosphericescopes has established itself as a powerful new discipline in science. As of today some ∼ 150 sources of gamma rays of very different types, of both galactic and extragalactic origin, have been discovered due to this technique. The study of these sources is providing clues to many basic questions in astrophysics, astro-particle physics, physics of cosmic rays and cosmology. The current generation of telescopes, despite the young age of the technique, offers a solid performance. The technique is still maturing, leading to the next generation large instrument known under the name Cherenkov Telescope Array. The latter's sensitivity will be an order of magnitude higher than that of the currently best instruments VERITAS, H.E.S.S. and MAGIC. This article is devoted to outlining the milestones in a long history that step-by-step have given shape to this technique and have brought about today's successful source marathon.

  17. Science with the Advanced Gamma Ray Imaging System (AGIS)

    Science.gov (United States)

    Coppi, Paolo

    2009-05-01

    We present the scientific drivers for the Advanced Gamma Ray Imaging System (AGIS), a concept for the next-generation ground- based gamma-ray experiment, comprised of an array of ˜100 imaging atmospheric Cherenkov telescopes. Design requirements for AGIS include achieving a sensitivity an order of magnitude better than the current generation of space or ground-based instruments in the energy range of 40 GeV to ˜100 TeV. We present here an overview of the scientific goals of AGIS, including the prospects for understanding VHE phenomena in the vicinity of accreting black holes, particle acceleration in a variety of astrophysical environments, indirect detection of dark matter, study of cosmological background radiation fields, and particle physics beyond the standard model.

  18. Observational astrophysics

    CERN Document Server

    Smith, Robert C

    1995-01-01

    Combining a critical account of observational methods (telescopes and instrumentation) with a lucid description of the Universe, including stars, galaxies and cosmology, Smith provides a comprehensive introduction to the whole of modern astrophysics beyond the solar system. The first half describes the techniques used by astronomers to observe the Universe: optical telescopes and instruments are discussed in detail, but observations at all wavelengths are covered, from radio to gamma-rays. After a short interlude describing the appearance of the sky at all wavelengths, the role of positional astronomy is highlighted. In the second half, a clear description is given of the contents of the Universe, including accounts of stellar evolution and cosmological models. Fully illustrated throughout, with exercises given in each chapter, this textbook provides a thorough introduction to astrophysics for all physics undergraduates, and a valuable background for physics graduates turning to research in astronomy.

  19. A search for gamma-ray imprints of annihilating dark matter in the galaxy, and the astrophysical implications of ultra-light fundamental vector bosons

    International Nuclear Information System (INIS)

    Zechlin, Hannes-Sebastian

    2013-12-01

    Standard Model extensions imply new elementary particles that can lead to specific astrophysical signatures. In particular, weakly interacting massive particles (WIMPs) can constitute the unknown non-luminous cold dark matter, which contributes approximately 84% to the matter content of the Universe. Annihilation or decay of WIMPs may lead to high-energy gamma-rays. In this thesis, new methods of searching for gamma-ray signals from annihilating dark matter are developed and applied. Moreover, astrophysical imprints of new ultra-light hidden U(1) gauge bosons in radio data are investigated. Hierarchical structure formation predicts a variety of smaller bound dark matter sub-halos in Milky-Way-like galactic hosts. It is shown that the Fermi-LAT is sufficiently sensitive for detecting up to a few nearby dark matter subhalos in terms of faint gamma-ray sources with a moderate angular extent. Searches in the first and second Fermi-LAT source catalogs reveal about ten candidate sources each. To discriminate the source candidates from conventional astrophysical objects, an analysis for spectral, spatial, positional, and temporal gamma-ray properties using 3.5 years of Fermi-LAT data is carried out. In addition, a multi-wavelength analysis of archival data or follow-up observations in the radio, infrared, optical, UV, X-ray, high-energy, and very-high energy gamma-ray bands is carried out. The broad-band spectra of all promising candidates are compatible with AGN, in particular high-energy peaked BL-Lac type objects (HBLs). Dark matter annihilation can contribute to the small-scale angular anisotropy spectrum of the diffuse gamma-ray background (DGB). The detection capabilities of currently operating imaging atmospheric Cherenkov telescopes and the planned Cherenkov Telescope Array (CTA) are studied. With CTA, a relative gamma-ray contribution from annihilating dark matter of 10% to the extragalactic DGB can be resolved via angular anisotropies. In terms of the dark

  20. Gamma-ray astrophysics

    International Nuclear Information System (INIS)

    Fichtel, C.E.

    1977-01-01

    The most striking feature of the celestial sphere when viewed in the frequency range of γ-rays is the emission from the galactic plane, which is particularly intense in the galactic longitudinal region from 300 0 to 50 0 . The longitudinal and latitudinal distributions are generally correlated with galactic structural features and when studied in detail suggest a non-uniform distribution of cosmic rays in the galaxy. Several point γ-ray sources have now been observed, including four radio pulsars. This last result is particularly striking since only one radio pulsar has been seen at either optical or X-ray frequencies. Nuclear γ-ray lines have been seen from the Sun during a large solar flare and future satellite experiments are planned to search for γ-ray lines from supernovae and their remnants. A general apparently diffuse flux of γ-rays has also been seen whose energy spectrum has interesting implications; however, in view of the possible contribution of point sources and the observation of galactic features such as Gould's belt, its interpretation must await γ-ray experiments with finer spatial and energy resolution, as well as greater sensitivity. (Auth.)

  1. Minicourses in Astrophysics, Modular Approach, Vol. I.

    Science.gov (United States)

    Illinois Univ., Chicago.

    This is the first volume of a two-volume minicourse in astrophysics. It contains chapters on the following topics: planetary atmospheres; X-ray astronomy; radio astrophysics; molecular astrophysics; and gamma-ray astrophysics. Each chapter gives much technical discussion, mathematical treatment, diagrams, and examples. References are included with…

  2. Very high-energy gamma rays from gamma-ray bursts.

    Science.gov (United States)

    Chadwick, Paula M

    2007-05-15

    Very high-energy (VHE) gamma-ray astronomy has undergone a transformation in the last few years, with telescopes of unprecedented sensitivity having greatly expanded the source catalogue. Such progress makes the detection of a gamma-ray burst at the highest energies much more likely than previously. This paper describes the facilities currently operating and their chances for detecting gamma-ray bursts, and reviews predictions for VHE gamma-ray emission from gamma-ray bursts. Results to date are summarized.

  3. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... The field of Very High Energy (VHE) gamma ray astronomy using the Atmospheric Cerenkov Technique has entered an interesting phase with detection of various galactic and extragalactic sources. Among galactic sources, only the Crab nebula has been established as a standard candle.

  4. Search for VHE γ-ray emission from the direction of the two millisecond pulsars PSR J0437-4715 and PSR J1824-2452 and the composite supernova remnant Kes 75 with H.E.S.S

    International Nuclear Information System (INIS)

    Fuessling, Matthias

    2012-01-01

    This work reports on the search for pulsed and steady very-high energy (VHE) gamma-ray emission in the energy range extending from 100 GeV up to 100 TeV from the direction of three pulsars with the High Energy Stereoscopic System (H.E.S.S.). Pulsed gamma-ray radiation from pulsars with energies beyond 100 GeV was found thus far only for the young and energetic Crab pulsar. A special class of pulsar wind nebulae (PWNe) is associated with composite supernova remnants (SNRs) where the PWN is centered in an expanding SNR shell. In the first part of this thesis, the results on the search for pulsed and steady VHE gamma-ray emission from the two millisecond pulsars, PSR J0437-4715 and PSR J1824-2452, are presented. Parts of the observations were conducted in a special trigger setup (the topological trigger with convergent pointing) to reduce the energy threshold of the instrument. No signal of pulsed or steady emission is found and upper limits on the pulsed and steady gamma-ray flux are derived. The upper limits on the pulsed gamma-ray flux are compared to existing model predictions and, in the case of PSR J1824-2452, allow the range of possible viewing geometries in some models to be constrained. In the second part of this work, results on the search for pulsed and steady VHE gamma-ray emission from the direction of the composite SNR Kes 75 are presented. The PWN in the center of Kes 75 is powered by a very young and powerful pulsar, PSR J1846-0258, that has an exceptionally high magnetic field. While no hint for pulsed emission is found, steady VHE gamma-ray emission is detected with a statistical significance of 10 sigma from a point-like source. The VHE gamma-ray emission is spatially coincident with the PWN and the SNR shell. Both are discussed as a possible origin for the observed emission. The pulsar of Kes 75 would be the youngest pulsar known to date to power a VHE PWN.

  5. The B-10((p)over-right-arrow, gamma)C-11 reaction at astrophysically relevant energies

    NARCIS (Netherlands)

    Tonchev, AP; Nelson, SO; Sabourov, K; Crowley, BT; Joshi, K; Weller, HR; Kelley, JH; Prior, RM; Spraker, M; Kalantar-Nayestanaki, N

    2003-01-01

    The B-10(, gamma)C-11 reaction was studied by detecting the gamma-rays produced when 100, 130-, and 160-keV polarized protons were stopped in a thick B-10 target. Polarized and unpolarized incident beams were used to measure the cross section and vector analyzing power as a function of angle and

  6. A search for gamma-ray imprints of annihilating dark matter in the galaxy, and the astrophysical implications of ultra-light fundamental vector bosons

    Energy Technology Data Exchange (ETDEWEB)

    Zechlin, Hannes-Sebastian

    2013-12-15

    Standard Model extensions imply new elementary particles that can lead to specific astrophysical signatures. In particular, weakly interacting massive particles (WIMPs) can constitute the unknown non-luminous cold dark matter, which contributes approximately 84% to the matter content of the Universe. Annihilation or decay of WIMPs may lead to high-energy gamma-rays. In this thesis, new methods of searching for gamma-ray signals from annihilating dark matter are developed and applied. Moreover, astrophysical imprints of new ultra-light hidden U(1) gauge bosons in radio data are investigated. Hierarchical structure formation predicts a variety of smaller bound dark matter sub-halos in Milky-Way-like galactic hosts. It is shown that the Fermi-LAT is sufficiently sensitive for detecting up to a few nearby dark matter subhalos in terms of faint gamma-ray sources with a moderate angular extent. Searches in the first and second Fermi-LAT source catalogs reveal about ten candidate sources each. To discriminate the source candidates from conventional astrophysical objects, an analysis for spectral, spatial, positional, and temporal gamma-ray properties using 3.5 years of Fermi-LAT data is carried out. In addition, a multi-wavelength analysis of archival data or follow-up observations in the radio, infrared, optical, UV, X-ray, high-energy, and very-high energy gamma-ray bands is carried out. The broad-band spectra of all promising candidates are compatible with AGN, in particular high-energy peaked BL-Lac type objects (HBLs). Dark matter annihilation can contribute to the small-scale angular anisotropy spectrum of the diffuse gamma-ray background (DGB). The detection capabilities of currently operating imaging atmospheric Cherenkov telescopes and the planned Cherenkov Telescope Array (CTA) are studied. With CTA, a relative gamma-ray contribution from annihilating dark matter of 10% to the extragalactic DGB can be resolved via angular anisotropies. In terms of the dark

  7. Astrophysical hints of axion-like particles

    Science.gov (United States)

    Roncadelli, M.; Galanti, G.; Tavecchio, F.; Bonnoli, G.

    2015-01-01

    After reviewing three astrophysical hints of the existence of axion-like particles (ALPs), we describe in more detail a new similar hint involving flat spectrum radio quasars (FSRQs). Detection of FSRQs above about 20GeV pose a challenge to very-high-energy (VHE) astrophysics, because at those energies the ultraviolet emission from their broad line region should prevent photons produced by the central engine to leave the source. Although a few astrophysical explanations have been put forward, they are totally ad hoc. We show that a natural explanation instead arises within the conventional models of FSRQs provided that photon-ALP oscillations occur inside the source. Our analysis takes the FSRQ PKR 1222+206 as an example, and it looks tantalizing that basically the same choice of the free model parameters adopted in this case is consistent with those that provide the other three hints of the existence of ALPs.

  8. The Cherenkov Telescope Array For Very High-Energy Astrophysics

    Science.gov (United States)

    Kaaret, Philip

    2015-08-01

    The field of very high energy (VHE) astrophysics had been revolutionized by the results from ground-based gamma-ray telescopes, including the current imaging atmospheric Cherenkov telescope (IACT) arrays: HESS, MAGIC and VERITAS. A worldwide consortium of scientists from 29 countries has formed to propose the Cherenkov Telescope Array (CTA) that will capitalize on the power of this technique to greatly expand the scientific reach of ground-based gamma-ray telescopes. CTA science will include key topics such as the origin of cosmic rays and cosmic particle acceleration, understanding extreme environments in regions close to neutron stars and black holes, and exploring physics frontiers through, e.g., the search for WIMP dark matter, axion-like particles and Lorentz invariance violation. CTA is envisioned to consist of two large arrays of Cherenkov telescopes, one in the southern hemisphere and one in the north. Each array will contain telescopes of different sizes to provide a balance between cost and array performance over an energy range from below 100 GeV to above 100 TeV. Compared to the existing IACT arrays, CTA will have substantially better angular resolution and energy resolution, will cover a much wider energy range, and will have up to an order of magnitude better sensitivity. CTA will also be operated as an open observatory and high-level CTA data will be placed into the public domain; these aspects will enable broad participation in CTA science from the worldwide scientific community to fully capitalize on CTA's potential. This talk will: 1) review the scientific motivation and capabilities of CTA, 2) provide an overview of the technical design and the status of prototype development, and 3) summarize the current status of the project in terms of its proposed organization and timeline. The plans for access to CTA data and opportunities to propose for CTA observing time will be highlighed.Presented on behalf of the CTA Consortium.

  9. THE 2010 VERY HIGH ENERGY gamma-RAY FLARE AND 10 YEARS OF MULTI-WAVELENGTH OBSERVATIONS OF M 87

    OpenAIRE

    Abramowski, A.; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Balzer, A.; Barnacka, A.; de Almeida, U. Barres; Becherini, Y.; Becker, J.; Behera, B.; Bernloehr, K.; Birsin, E.; Biteau, J.; Bochow, A.

    2012-01-01

    The giant radio galaxy M 87 with its proximity (16 Mpc), famous jet, and very massive black hole ((3-6) x 10(9) M-circle dot) provides a unique opportunity to investigate the origin of very high energy (VHE; E > 100 GeV) gamma-ray emission generated in relativistic outflows and the surroundings of supermassive black holes. M 87 has been established as a VHE gamma-ray emitter since 2006. The VHE gamma-ray emission displays strong variability on timescales as short as a day. In this paper, resu...

  10. The digital ASIC for the digital front end electronics of the SPI astrophysics gamma-ray experiment

    International Nuclear Information System (INIS)

    Lafond, E.; Mur, M.; Schanne, S.

    1998-01-01

    The SPI spectrometer is one of the gamma-ray astronomy instruments that will be installed on the ESA INTEGRAL satellite, intended to be launched in 2001 by the European Space Agency. The Digital Front-End Electronics sub-system (DFEE) is in charge of the real time data processing of the various measurements produced by the Germanium (Ge) detectors and the Bismuth Germanate (BGO) anti-coincidence shield. The central processing unit of the DFEE is implemented in a digital ASIC circuit, which provides the real time association of the various time signals, acquires the associated energy measurements, and classifies the various types of physics events. The paper gives the system constraints of the DFEE, the architecture of the ASIC circuit, the technology requirements, and the strategy for test and integration. Emphasis is given to the high level language development and simulation, the automatic circuit synthesis approach, and the performance estimation

  11. The new astrophysics

    International Nuclear Information System (INIS)

    Longair, M.

    1989-01-01

    The author offers a review of advances in astrophysics since 1945 when astronomers started to explore the universe beyond the bounds of the optical wavelength of the electromagnetic spectrum, especially in the fields of radio, x ray and gamma ray, cosmic ray, ultraviolet and infrared astronomies, as well as neutral hydrogen and molecular line studies. Theoretical and technological advances have also kept pace. An overview of the new astrophysics is offered focusing on the large-scale distribution of matter and the background microwave radiation, galaxies, stellar evolution and the interstellar media (dust, gas and high energy particles). Nucleosynthesis in stars is mentioned in a broader discussion of stellar evolution, and dead stars including supernovae. Active galaxies and quasars are discussed. After considering what should be included in astrophysical cosmology, the author looks to the future of the science. (U.K.)

  12. Relativistic Astrophysics

    International Nuclear Information System (INIS)

    Font, J. A.

    2015-01-01

    The relativistic astrophysics is the field of astrophysics employing the theory of relativity Einstein as physical-mathematical model is to study the universe. This discipline analyzes astronomical contexts in which the laws of classical mechanics of Newton's law of gravitation are not valid. (Author)

  13. Essential astrophysics

    CERN Document Server

    Lang, Kenneth R

    2013-01-01

    Essential Astrophysics is a book to learn or teach from, as well as a fundamental reference volume for anyone interested in astronomy and astrophysics. It presents astrophysics from basic principles without requiring any previous study of astronomy or astrophysics. It serves as a comprehensive introductory text, which takes the student through the field of astrophysics in lecture-sized chapters of basic physical principles applied to the cosmos. This one-semester overview will be enjoyed by undergraduate students with an interest in the physical sciences, such as astronomy, chemistry, engineering or physics, as well as by any curious student interested in learning about our celestial science. The mathematics required for understanding the text is on the level of simple algebra, for that is all that is needed to describe the fundamental principles. The text is of sufficient breadth and depth to prepare the interested student for more advanced specialized courses in the future. Astronomical examples are provide...

  14. The new astrophysics

    International Nuclear Information System (INIS)

    Longair, M.

    1993-01-01

    The various themes developed are: radioastronomy, X-ray and gamma-ray astronomy, cosmic ray, ultraviolet, neutral hydrogen and molecular line astronomy, optical and theoretical astronomy; the large scale distribution of matter and radiation in the universe, the galaxies, stars and stellar evolution, the interstellar medium (gas, dust) and star formation, galaxies and clusters of galaxies, active galaxies and quasars, astrophysical cosmology, the astronomy of the future. 86 figs., 60 refs

  15. Very high energy gamma ray astronomy from Hanle

    International Nuclear Information System (INIS)

    Chitnis, Varsha R.

    2015-01-01

    Over a past decade very high energy (VHE) gamma ray astronomy has emerged as a major astronomical discipline. In India, we have a long tradition of experiments in this field. Few years ago, multi-institutional Himalayan Gamma Ray Observatory (HiGRO) collaboration was formed to set up VHE gamma rays experiments at Hanle, a high altitude location in Himalayas. HAGAR, the first phase of this collaboration is operational since 2008. HAGAR has successfully detected VHE gamma ray emission from some of the extragalactic objects like Mrk 421, Mrk 501 as well as galactic sources including Crab nebula/pulsar. Details of HAGAR telescope system and results obtained will be discussed. HiGRO is now gearing up for the next phase, i.e. 21 m diameter MACE telescope, which is being installed at Hanle at present. Details of MACE telescope system and future plans will be discussed. (author)

  16. Astrophysical Flows

    Science.gov (United States)

    Pringle, James E.; King, Andrew

    2003-07-01

    Almost all conventional matter in the Universe is fluid, and fluid dynamics plays a crucial role in astrophysics. This new graduate textbook provides a basic understanding of the fluid dynamical processes relevant to astrophysics. The mathematics used to describe these processes is simplified to bring out the underlying physics. The authors cover many topics, including wave propagation, shocks, spherical flows, stellar oscillations, the instabilities caused by effects such as magnetic fields, thermal driving, gravity, shear flows, and the basic concepts of compressible fluid dynamics and magnetohydrodynamics. The authors are Directors of the UK Astrophysical Fluids Facility (UKAFF) at the University of Leicester, and editors of the Cambridge Astrophysics Series. This book has been developed from a course in astrophysical fluid dynamics taught at the University of Cambridge. It is suitable for graduate students in astrophysics, physics and applied mathematics, and requires only a basic familiarity with fluid dynamics.• Provides coverage of the fundamental fluid dynamical processes an astrophysical theorist needs to know • Introduces new mathematical theory and techniques in a straightforward manner • Includes end-of-chapter problems to illustrate the course and introduce additional ideas

  17. First Accurate Normalization of the $\\beta$-delayed $\\alpha$ Decay of $^{16}$N and Implications for the $^{12}$C$(\\alpha,\\gamma)^{16}$O Astrophysical Reaction Rate arXiv

    CERN Document Server

    Kirsebom, O.S.; Lica, R.; Munch, M.; Riisager, K.; Fynbo, H.O.U.; Borge, M.J.G.; Madurga, M.; Marroquin, I.; Andreyev, A.N.; Berry, T.A.; Christensen, E.R.; Fernández, P. Díaz; Doherty, D.T.; Van Duppen, P.; Fraile, L.M.; Gallardo, M.C.; Greenlees, P.T.; Harkness-Brennan, L.J.; Hubbard, N.; Huyse, M.; Jensen, J.H.; Johansson, H.; Jonson, B.; Judson, D.S.; Konki, J.; Lazarus, I.; Lund, M.V.; Marginean, N.; Marginean, R.; Perea, A.; Mihai, C.; Negret, A.; Page, R.D.; Pucknell, V.; Rahkila, P.; Sorlin, O.; Sotty, C.; Swartz, J.A.; Sørensen, H.B.; Törnqvist, H.; Vedia, V.; Warr, N.; De Witte, H.

    The $^{12}$C$(\\alpha,\\gamma)^{16}$O reaction plays a central role in astrophysics, but its cross section at energies relevant for astrophysical applications is only poorly constrained by laboratory data. The reduced $\\alpha$ width, $\\gamma_{11}$, of the bound $1^-$ level in $^{16}$O is particularly important to determine the cross section. The magnitude of $\\gamma_{11}$ is determined via sub-Coulomb $\\alpha$-transfer reactions or the $\\beta$-delayed $\\alpha$ decay of $^{16}$N, but the latter approach is presently hampered by the lack of sufficiently precise data on the $\\beta$-decay branching ratios. Here we report improved branching ratios for the bound $1^-$ level and for $\\beta$-delayed $\\alpha$ emission. In the case of the $\\beta$-delayed $\\alpha$ branch, we find a $5\\sigma$ deviation from the literature value. With our new branching ratios, the constraints imposed on $\\gamma_{11}$ by the $\\beta\\alpha$-decay and $\\alpha$-transfer data are of similar precision and, for the first time, in good agreement. Th...

  18. Nuclear astrophysics

    International Nuclear Information System (INIS)

    Haxton, W.C.

    1992-01-01

    The problem of core-collapse supernovae is used to illustrate the many connections between nuclear astrophysics and the problems nuclear physicists study in terrestrial laboratories. Efforts to better understand the collapse and mantle ejection are also motivated by a variety of interdisciplinary issues in nuclear, particle, and astrophysics, including galactic chemical evolution, neutrino masses and mixing, and stellar cooling by the emission of new particles. The current status of theory and observations is summarized

  19. Relativistic astrophysics

    CERN Document Server

    Demianski, Marek

    2013-01-01

    Relativistic Astrophysics brings together important astronomical discoveries and the significant achievements, as well as the difficulties in the field of relativistic astrophysics. This book is divided into 10 chapters that tackle some aspects of the field, including the gravitational field, stellar equilibrium, black holes, and cosmology. The opening chapters introduce the theories to delineate gravitational field and the elements of relativistic thermodynamics and hydrodynamics. The succeeding chapters deal with the gravitational fields in matter; stellar equilibrium and general relativity

  20. Nuclear astrophysics lessons from INTEGRAL.

    Science.gov (United States)

    Diehl, Roland

    2013-02-01

    Measurements of high-energy photons from cosmic sources of nuclear radiation through ESA's INTEGRAL mission have advanced our knowledge: new data with high spectral resolution showed that characteristic gamma-ray lines from radioactive decays occur throughout the Galaxy in its interstellar medium. Although the number of detected sources and often the significance of the astrophysical results remain modest, conclusions derived from this unique astronomical window of radiation originating from nuclear processes are important, complementing the widely-employed atomic-line based spectroscopy. We review the results and insights obtained in the past decade from gamma-ray line measurements of cosmic sources in the context of their astrophysical questions.

  1. Nuclear astrophysics

    International Nuclear Information System (INIS)

    Lehoucq, Roland; Klotz, Gregory

    2015-11-01

    Astronomy deals with the position and observation of the objects in our Universe, from planets to galaxies. It is the oldest of the sciences. Astrophysics is the study of the physical properties of these objects. It dates from the start of the 20. century. Nuclear astrophysics is the marriage of nuclear physics, a laboratory science concerned with the infinitely small, and astrophysics, the science of what is far away and infinitely large. Its aim is to explain the origin, evolution and abundance of the elements in the Universe. It was born in 1938 with the work of Hans Bethe, an American physicist who won the Nobel Prize for physics in 1967, on the nuclear reactions that can occur at the center of stars. It explains where the incredible energy of the stars and the Sun comes from and enables us to understand how they are born, live and die. The matter all around us and from which we are made, is made up of ninety-two chemical elements that can be found in every corner of the Universe. Nuclear astrophysics explains the origin of these chemical elements by nucleosynthesis, which is the synthesis of atomic nuclei in different astrophysical environments such as stars. Nuclear astrophysics provides answers to fundamental questions: - Our Sun and the stars in general shine because nuclear reactions are taking place within them. - The stars follow a sequence of nuclear reaction cycles. Nucleosynthesis in the stars enables us to explain the origin and abundance of elements essential to life, such as carbon, oxygen, nitrogen and iron. - Star explosions, in the form of supernovae, disperse the nuclei formed by nucleosynthesis into space and explain the formation of the heaviest chemical elements such as gold, platinum and lead. Nuclear astrophysics is still a growing area of science. (authors)

  2. Astrophysical Concepts

    CERN Document Server

    Harwit, Martin

    2006-01-01

    This classic text, aimed at senior undergraduates and beginning graduate students in physics and astronomy, presents a wide range of astrophysical concepts in sufficient depth to give the reader a quantitative understanding of the subject. Emphasizing physical concepts, the book outlines cosmic events but does not portray them in detail: it provides a series of astrophysical sketches. For this fourth edition, nearly every part of the text has been reconsidered and rewritten, new sections have been added to cover recent developments, and others have been extensively revised and brought up to date. The book begins with an outline of the scope of modern astrophysics and enumerates some of the outstanding problems faced in the field today. The basic physics needed to tackle these questions are developed in the next few chapters using specific astronomical processes as examples. The second half of the book enlarges on these topics and shows how we can obtain quantitative insight into the structure and evolution of...

  3. Nuclear astrophysics

    International Nuclear Information System (INIS)

    Arnould, M.; Takahashi, K.

    1999-01-01

    Nuclear astrophysics is that branch of astrophysics which helps understanding of the Universe, or at least some of its many faces, through the knowledge of the microcosm of the atomic nucleus. It attempts to find as many nuclear physics imprints as possible in the macrocosm, and to decipher what those messages are telling us about the varied constituent objects in the Universe at present and in the past. In the last decades much advance has been made in nuclear astrophysics thanks to the sometimes spectacular progress made in the modelling of the structure and evolution of the stars, in the quality and diversity of the astronomical observations, as well as in the experimental and theoretical understanding of the atomic nucleus and of its spontaneous or induced transformations. Developments in other subfields of physics and chemistry have also contributed to that advance. Notwithstanding the accomplishment, many long-standing problems remain to be solved, and the theoretical understanding of a large variety of observational facts needs to be put on safer grounds. In addition, new questions are continuously emerging, and new facts endangering old ideas. This review shows that astrophysics has been, and still is, highly demanding to nuclear physics in both its experimental and theoretical components. On top of the fact that large varieties of nuclei have to be dealt with, these nuclei are immersed in highly unusual environments which may have a significant impact on their static properties, the diversity of their transmutation modes, and on the probabilities of these modes. In order to have a chance of solving some of the problems nuclear astrophysics is facing, the astrophysicists and nuclear physicists are obviously bound to put their competence in common, and have sometimes to benefit from the help of other fields of physics, like particle physics, plasma physics or solid-state physics. Given the highly varied and complex aspects, we pick here some specific nuclear

  4. Plasma astrophysics

    CERN Document Server

    Kaplan, S A; ter Haar, D

    2013-01-01

    Plasma Astrophysics is a translation from the Russian language; the topics discussed are based on lectures given by V.N. Tsytovich at several universities. The book describes the physics of the various phenomena and their mathematical formulation connected with plasma astrophysics. This book also explains the theory of the interaction of fast particles plasma, their radiation activities, as well as the plasma behavior when exposed to a very strong magnetic field. The text describes the nature of collective plasma processes and of plasma turbulence. One author explains the method of elementary

  5. Neutrino astrophysics

    International Nuclear Information System (INIS)

    Roulet, E.

    2001-01-01

    A general overview of neutrino physics and astrophysics is given, starting with a historical account of the development of our understanding of neutrinos and how they helped to unravel the structure of the Standard Model. We discuss why it is so important to establish if neutrinos are massive and introduce the main scenarios to provide them a mass. The present bounds and the positive indications in favor of non-zero neutrino masses are discussed, including the recent results on atmospheric and solar neutrinos. The major role that neutrinos play in astrophysics and cosmology is illustrated. (author)

  6. Astrophysics a new approach

    CERN Document Server

    Kundt, Wolfgang

    2005-01-01

    For a quantitative understanding of the physics of the universe - from the solar system through the milky way to clusters of galaxies all the way to cosmology - these edited lecture notes are perhaps among the most concise and also among the most critical ones: Astrophysics has not yet stood the redundancy test of laboratory physics, hence should be wary of early interpretations. Special chapters are devoted to magnetic and radiation processes, supernovae, disks, black-hole candidacy, bipolar flows, cosmic rays, gamma-ray bursts, image distortions, and special sources. At the same time, planet earth is viewed as the arena for life, with plants and animals having evolved to homo sapiens during cosmic time. -- This text is unique in covering the basic qualitative and quantitative tools, formulae as well as numbers, needed for the precise interpretation of frontline phenomena in astrophysical research. The author compares mainstream interpretations with new and even controversial ones he wishes to emphasize. The...

  7. Allen's astrophysical quantities

    CERN Document Server

    2000-01-01

    This new, fourth, edition of Allen's classic Astrophysical Quantities belongs on every astronomer's bookshelf. It has been thoroughly revised and brought up to date by a team of more than ninety internationally renowned astronomers and astrophysicists. While it follows the basic format of the original, this indispensable reference has grown to more than twice the size of the earlier editions to accommodate the great strides made in astronomy and astrophysics. It includes detailed tables of the most recent data on: - General constants and units - Atoms, molecules, and spectra - Observational astronomy at all wavelengths from radio to gamma-rays, and neutrinos - Planetary astronomy: Earth, planets and satellites, and solar system small bodies - The Sun, normal stars, and stars with special characteristics - Stellar populations - Cataclysmic and symbiotic variables, supernovae - Theoretical stellar evolution - Circumstellar and interstellar material - Star clusters, galaxies, quasars, and active galactic nuclei ...

  8. Relativistic astrophysics

    CERN Document Server

    Price, R H

    1993-01-01

    Work reported in the workshop on relativistic astrophysics spanned a wide varicy of topics. Two specific areas seemed of particular interest. Much attention was focussed on gravitational wave sources, especially on the waveforms they produce, and progress was reported in theoretical and observational aspects of accretion disks.

  9. Astrophysics today

    International Nuclear Information System (INIS)

    Cameron, A.G.W.

    1984-01-01

    Examining recent history, current trends, and future possibilities, the author reports the frontiers of research on the solar system, stars, galactic physics, and cosmological physics. The book discusses the great discoveries in astronomy and astrophysics and examines the circumstances in which they occurred. It discusses the physics of white dwarfs, the inflationary universe, the extinction of dinosaurs, black hole, cosmological models, and much more

  10. Astrophysics at very high energies

    International Nuclear Information System (INIS)

    Aharonian, Felix; Bergstroem, Lars; Dermer, Charles

    2013-01-01

    Presents three complementary lectures on very-high-energy astrophysics given by worldwide leaders in the field. Reviews the recent advances in and prospects of gamma-ray astrophysics and of multi-messenger astronomy. Prepares readers for using space and ground-based gamma-ray observatories, as well as neutrino and other multi-messenger detectors. With the success of Cherenkov Astronomy and more recently with the launch of NASA's Fermi mission, very-high-energy astrophysics has undergone a revolution in the last years. This book provides three comprehensive and up-to-date reviews of the recent advances in gamma-ray astrophysics and of multi-messenger astronomy. Felix Aharonian and Charles Dermer address our current knowledge on the sources of GeV and TeV photons, gleaned from the precise measurements made by the new instrumentation. Lars Bergstroem presents the challenges and prospects of astro-particle physics with a particular emphasis on the detection of dark matter candidates. The topics covered by the 40th Saas-Fee Course present the capabilities of current instrumentation and the physics at play in sources of very-high-energy radiation to students and researchers alike. This book will encourage and prepare readers for using space and ground-based gamma-ray observatories, as well as neutrino and other multi-messenger detectors.

  11. Observational astrophysics

    CERN Document Server

    Léna, Pierre; Lebrun, François; Mignard, François; Pelat, Didier

    2012-01-01

    This is the updated, widely revised, restructured and expanded third edition of Léna et al.'s successful work Observational Astrophysics. It presents a synthesis on tools and methods of observational astrophysics of the early 21st century. Written specifically for astrophysicists and graduate students, this textbook focuses on fundamental and sometimes practical limitations on the ultimate performance that an astronomical system may reach, rather than presenting particular systems in detail. In little more than a decade there has been extraordinary progress in imaging and detection technologies, in the fields of adaptive optics, optical interferometry, in the sub-millimetre waveband, observation of neutrinos, discovery of exoplanets, to name but a few examples. The work deals with ground-based and space-based astronomy and their respective fields. And it also presents the ambitious concepts behind space missions aimed for the next decades. Avoiding particulars, it covers the whole of the electromagnetic spec...

  12. astrophysical significance

    Directory of Open Access Journals (Sweden)

    Dartois E.

    2014-02-01

    Full Text Available Clathrate hydrates, ice inclusion compounds, are of major importance for the Earth’s permafrost regions and may control the stability of gases in many astrophysical bodies such as the planets, comets and possibly interstellar grains. Their physical behavior may provide a trapping mechanism to modify the absolute and relative composition of icy bodies that could be the source of late-time injection of gaseous species in planetary atmospheres or hot cores. In this study, we provide and discuss laboratory-recorded infrared signatures of clathrate hydrates in the near to mid-infrared and the implications for space-based astrophysical tele-detection in order to constrain their possible presence.

  13. Stellar astrophysics

    International Nuclear Information System (INIS)

    1987-01-01

    A number of studies in the field of steller astrophysics were undertaken by the South African Astronomical Observatory in 1986. These studies included; evolutionary effects on the surface abundances of an early-type supergiant; hydrogen deficient stars; t tauri stars; rotational modulation and flares on RS CVn and BY Dra stars; carbon and heavy element stars, and slow variability and circumstellar shells of red variable stars. 4 figs

  14. Focusing Telescopes in Nuclear Astrophysics

    CERN Document Server

    Ballmoos, Peter von

    2007-01-01

    This volume is the first of its kind on focusing gamma-ray telescopes. Forty-eight refereed papers provide a comprehensive overview of the scientific potential and technical challenges of this nascent tool for nuclear astrophysics. The book features articles dealing with pivotal technologies such as grazing incident mirrors, multilayer coatings, Laue- and Fresnel-lenses - and even an optic using the curvature of space-time. The volume also presents an overview of detectors matching the ambitious objectives of gamma ray optics, and facilities for operating such systems on the ground and in space. The extraordinary scientific potential of focusing gamma-ray telescopes for the study of the most powerful sources and the most violent events in the Universe is emphasized in a series of introductory articles. Practicing professionals, and students interested in experimental high-energy astrophysics, will find this book a useful reference

  15. Recent results in nuclear astrophysics

    Energy Technology Data Exchange (ETDEWEB)

    Coc, Alain; Kiener, Juergen [CNRS/IN2P3 et Universite Paris Sud 11, UMR 8609, Centre de Sciences Nucleaires et de Sciences de la Matiere (CSNSM), Orsay Campus (France); Hammache, Fairouz [CNRS/IN2P3 et Universite Paris Sud 11, UMR 8608, Institut de Physique Nucleaire d' Orsay (IPNO), Orsay Campus (France)

    2015-03-01

    In this review, we emphasize the interplay between astrophysical observations, modeling, and nuclear physics laboratory experiments. Several important nuclear cross sections for astrophysics have long been identified, e.g., {sup 12}C(α, γ){sup 16}O for stellar evolution, or {sup 13}C(α, n){sup 16}O and {sup 22}Ne(α, n){sup 25}Mg as neutron sources for the s-process. More recently, observations of lithium abundances in the oldest stars, or of nuclear gamma-ray lines from space, have required new laboratory experiments. New evaluation of thermonuclear reaction rates now includes the associated rate uncertainties that are used in astrophysical models to i) estimate final uncertainties on nucleosynthesis yields and ii) identify those reactions that require further experimental investigation. Sometimes direct cross section measurements are possible, but more generally the use of indirect methods is compulsory in view of the very low cross sections. Non-thermal processes are often overlooked but are also important for nuclear astrophysics, e.g., in gamma-ray emission from solar flares or in the interaction of cosmic rays with matter, and also motivate laboratory experiments. Finally, we show that beyond the historical motivations of nuclear astrophysics, understanding i) the energy sources that drive stellar evolution and ii) the origin of the elements can also be used to give new insights into physics beyond the standard model. (orig.)

  16. Recent results in nuclear astrophysics

    International Nuclear Information System (INIS)

    Coc, Alain; Kiener, Juergen; Hammache, Fairouz

    2015-01-01

    In this review, we emphasize the interplay between astrophysical observations, modeling, and nuclear physics laboratory experiments. Several important nuclear cross sections for astrophysics have long been identified, e.g., 12 C(α, γ) 16 O for stellar evolution, or 13 C(α, n) 16 O and 22 Ne(α, n) 25 Mg as neutron sources for the s-process. More recently, observations of lithium abundances in the oldest stars, or of nuclear gamma-ray lines from space, have required new laboratory experiments. New evaluation of thermonuclear reaction rates now includes the associated rate uncertainties that are used in astrophysical models to i) estimate final uncertainties on nucleosynthesis yields and ii) identify those reactions that require further experimental investigation. Sometimes direct cross section measurements are possible, but more generally the use of indirect methods is compulsory in view of the very low cross sections. Non-thermal processes are often overlooked but are also important for nuclear astrophysics, e.g., in gamma-ray emission from solar flares or in the interaction of cosmic rays with matter, and also motivate laboratory experiments. Finally, we show that beyond the historical motivations of nuclear astrophysics, understanding i) the energy sources that drive stellar evolution and ii) the origin of the elements can also be used to give new insights into physics beyond the standard model. (orig.)

  17. THE 2010 VERY HIGH ENERGY {gamma}-RAY FLARE AND 10 YEARS OF MULTI-WAVELENGTH OBSERVATIONS OF M 87

    Energy Technology Data Exchange (ETDEWEB)

    Abramowski, A. [Institut fuer Experimentalphysik, Universitaet Hamburg, Luruper Chaussee 149, D 22761 Hamburg (Germany); Acero, F. [Laboratoire Univers et Particules de Montpellier, Universite Montpellier 2, CNRS/IN2P3, CC 72, Place Eugene Bataillon, F-34095 Montpellier Cedex 5 (France); Aharonian, F.; Bernloehr, K.; Bochow, A. [Max-Planck-Institut fuer Kernphysik, P.O. Box 103980, D 69029 Heidelberg (Germany); Akhperjanian, A. G. [National Academy of Sciences of the Republic of Armenia, 24 Marshall Baghramian Avenue, 0019 Yerevan (Armenia); Anton, G.; Balzer, A. [Physikalisches Institut, Universitaet Erlangen-Nuernberg, Erwin-Rommel-Str. 1, D 91058 Erlangen (Germany); Barnacka, A. [Nicolaus Copernicus Astronomical Center, ul. Bartycka 18, 00-716 Warsaw (Poland); Barres de Almeida, U. [Department of Physics, University of Durham, South Road, Durham DH1 3LE (United Kingdom); Becherini, Y. [Astroparticule et Cosmologie (APC), CNRS, Universite Paris 7 Denis Diderot, 10, rue Alice Domon et Leonie Duquet, F-75205 Paris Cedex 13 (France); Becker, J. [Institut fuer Theoretische Physik, Lehrstuhl IV: Weltraum und Astrophysik, Ruhr-Universitaet Bochum, D 44780 Bochum (Germany); Behera, B. [Landessternwarte, Universitaet Heidelberg, Koenigstuhl, D 69117 Heidelberg (Germany); Birsin, E. [Institut fuer Physik, Humboldt-Universitaet zu Berlin, Newtonstr. 15, D 12489 Berlin (Germany); Biteau, J. [Laboratoire Leprince-Ringuet, Ecole Polytechnique, CNRS/IN2P3, F-91128 Palaiseau (France); Boisson, C. [LUTH, Observatoire de Paris, CNRS, Universite Paris Diderot, 5 Place Jules Janssen, 92190 Meudon (France); Bolmont, J. [LPNHE, Universite Pierre et Marie Curie Paris 6, Universite Denis Diderot Paris 7, CNRS/IN2P3, 4 Place Jussieu, F-75252, Paris Cedex 5 (France); Bordas, P., E-mail: martin.raue@desy.de [Institut fuer Astronomie und Astrophysik, Universitaet Tuebingen, Sand 1, D 72076 Tuebingen (Germany); Collaboration: H.E.S.S. Collaboration; MAGIC Collaboration; VERITAS Collaboration; and others

    2012-02-20

    The giant radio galaxy M 87 with its proximity (16 Mpc), famous jet, and very massive black hole ((3 - 6) Multiplication-Sign 10{sup 9} M{sub Sun }) provides a unique opportunity to investigate the origin of very high energy (VHE; E > 100 GeV) {gamma}-ray emission generated in relativistic outflows and the surroundings of supermassive black holes. M 87 has been established as a VHE {gamma}-ray emitter since 2006. The VHE {gamma}-ray emission displays strong variability on timescales as short as a day. In this paper, results from a joint VHE monitoring campaign on M 87 by the MAGIC and VERITAS instruments in 2010 are reported. During the campaign, a flare at VHE was detected triggering further observations at VHE (H.E.S.S.), X-rays (Chandra), and radio (43 GHz Very Long Baseline Array, VLBA). The excellent sampling of the VHE {gamma}-ray light curve enables one to derive a precise temporal characterization of the flare: the single, isolated flare is well described by a two-sided exponential function with significantly different flux rise and decay times of {tau}{sup rise}{sub d} = (1.69 {+-} 0.30) days and {tau}{sup decay}{sub d} = (0.611 {+-} 0.080) days, respectively. While the overall variability pattern of the 2010 flare appears somewhat different from that of previous VHE flares in 2005 and 2008, they share very similar timescales ({approx}day), peak fluxes ({Phi}{sub >0.35TeV} {approx_equal} (1-3) Multiplication-Sign 10{sup -11} photons cm{sup -2} s{sup -1}), and VHE spectra. VLBA radio observations of 43 GHz of the inner jet regions indicate no enhanced flux in 2010 in contrast to observations in 2008, where an increase of the radio flux of the innermost core regions coincided with a VHE flare. On the other hand, Chandra X-ray observations taken {approx}3 days after the peak of the VHE {gamma}-ray emission reveal an enhanced flux from the core (flux increased by factor {approx}2; variability timescale <2 days). The long-term (2001-2010) multi-wavelength (MWL

  18. A Very High Energy Gamma-Ray Spectrum of 1ES 2344+514

    OpenAIRE

    Schroedter, M.; Badran, H. M.; Buckley, J. H.; Gordo, J. Bussons; Carter-Lewis, D. A.; Duke, C.; Fegan, D. J.; Fegan, S. F.; Finley, J. P.; Gillanders, G. H.; Grube, J.; Horan, D.; Kenny, G. E.; Kertzman, M.; Kosack, K.

    2005-01-01

    The BL Lacertae (BL Lac) object 1ES 2344+514 (1ES 2344), at a redshift of 0.044, was discovered as a source of very high energy (VHE) gamma rays by the Whipple Collaboration in 1995 \\citep{2344Catanese98}. This detection was recently confirmed by the HEGRA Collaboration \\citep{2344Hegra03}. As is typical for high-frequency peaked blazars, the VHE gamma-ray emission is highly variable. On the night of 20 December, 1995, a gamma-ray flare of 5.3-sigma significance was detected, the brightest ou...

  19. Astrophysical cosmology

    Science.gov (United States)

    Bardeen, J. M.

    The last several years have seen a tremendous ferment of activity in astrophysical cosmology. Much of the theoretical impetus has come from particle physics theories of the early universe and candidates for dark matter, but what promise to be even more significant are improved direct observations of high z galaxies and intergalactic matter, deeper and more comprehensive redshift surveys, and the increasing power of computer simulations of the dynamical evolution of large scale structure. Upper limits on the anisotropy of the microwave background radiation are gradually getting tighter and constraining more severely theoretical scenarios for the evolution of the universe.

  20. Astrophysical cosmology

    International Nuclear Information System (INIS)

    Bardeen, J.M.

    1986-01-01

    The last several years have seen a tremendous ferment of activity in astrophysical cosmology. Much of the theoretical impetus has come from particle physics theories of the early universe and candidates for dark matter, but what promise to be even more significant are improved direct observations of high z galaxies and intergalactic matter, deeper and more comprehensive redshift surveys, and the increasing power of computer simulations of the dynamical evolution of large scale structure. Upper limits on the anisotropy of the microwave background radiation are gradually getting tighter and constraining more severely theoretical scenarios for the evolution of the universe. 47 refs

  1. High Energy Density Laboratory Astrophysics

    CERN Document Server

    Lebedev, Sergey V

    2007-01-01

    During the past decade, research teams around the world have developed astrophysics-relevant research utilizing high energy-density facilities such as intense lasers and z-pinches. Every two years, at the International conference on High Energy Density Laboratory Astrophysics, scientists interested in this emerging field discuss the progress in topics covering: - Stellar evolution, stellar envelopes, opacities, radiation transport - Planetary Interiors, high-pressure EOS, dense plasma atomic physics - Supernovae, gamma-ray bursts, exploding systems, strong shocks, turbulent mixing - Supernova remnants, shock processing, radiative shocks - Astrophysical jets, high-Mach-number flows, magnetized radiative jets, magnetic reconnection - Compact object accretion disks, x-ray photoionized plasmas - Ultrastrong fields, particle acceleration, collisionless shocks. These proceedings cover many of the invited and contributed papers presented at the 6th International Conference on High Energy Density Laboratory Astrophys...

  2. Discovery of the hard spectrum VHE γ-ray source HESS J1641-463

    International Nuclear Information System (INIS)

    Abramowski, A.; Ait Benkhali, F.

    2014-10-01

    This letter reports the discovery of a remarkably hard spectrum source, HESS J1641.463, by the High Energy Stereoscopic System (H.E.S.S.) in the very high energy (VHE) domain. HESS J1641.463 remained unnoticed by the usual analysis techniques due to confusion with the bright nearby source HESS J1640.465. It emerged at a significance level of 8.5 standard deviations after restricting the analysis to events with energies above 4 TeV. It shows a moderate flux level of φ (E>1 TeV)=(3.64 ± 0.44 stat ± 0.73 sys ) x 10 -13 cm -2 s -1 , corresponding to 1.8% of the Crab Nebula flux above the same energy, and a hard spectrum with a photon index of Γ=2.07±0.11 stat ±0.20 sys . It is a point-like source, although an extension up to a Gaussian width of σ=3 arcmin cannot be discounted due to uncertainties in the H.E.S.S. point-spread function. The VHE γ-ray flux of HESS J1641.463 is found to be constant over the observed period when checking time binnings from the year-by-year to the 28 minute exposure timescales. HESS J1641.463 is positionally coincident with the radio supernova remnant SNR G338.5+0.1. No X-ray candidate stands out as a clear association; however, Chandra and XMM-Newton data reveal some potential weak counterparts. Various VHE γ-ray production scenarios are discussed. If the emission from HESS J1641.463 is produced by cosmic ray protons colliding with the ambient gas, then their spectrum must extend close to 1 PeV. This object may represent a source population contributing significantly to the galactic cosmic ray flux around the knee.

  3. Astrophysical techniques

    CERN Document Server

    Kitchin, CR

    2013-01-01

    DetectorsOptical DetectionRadio and Microwave DetectionX-Ray and Gamma-Ray DetectionCosmic Ray DetectorsNeutrino DetectorsGravitational Radiation Dark Matter and Dark Energy Detection ImagingThe Inverse ProblemPhotographyElectronic ImagingScanningInterferometrySpeckle InterferometryOccultationsRadarElectronic ImagesPhotometryPhotometryPhotometersSpectroscopySpectroscopy SpectroscopesOther TechniquesAstrometryPolarimetrySolar StudiesMagnetometryComputers and The Internet.

  4. High energy astrophysics. An introduction

    Energy Technology Data Exchange (ETDEWEB)

    Courvoisier, Thierry J.L. [Geneva Univ., Versoix (Switzerland). ISDC, Data Centre for Astrophysics

    2013-07-01

    Based on observational examples this book reveals and explains high-energy astrophysical processes. Presents the theory of astrophysical processes in a didactic approach by deriving equations step by step. With several attractive astronomical pictures. High-energy astrophysics has unveiled a Universe very different from that only known from optical observations. It has revealed many types of objects in which typical variability timescales are as short as years, months, days, and hours (in quasars, X-ray binaries, and other objects), and even down to milli-seconds in gamma ray bursts. The sources of energy that are encountered are only very seldom nuclear fusion, and most of the time gravitation, a paradox when one thinks that gravitation is, by many orders of magnitude, the weakest of the fundamental interactions. The understanding of these objects' physical conditions and the processes revealed by high-energy astrophysics in the last decades is nowadays part of astrophysicists' culture, even of those active in other domains of astronomy. This book evolved from lectures given to master and PhD students at the University of Geneva since the early 1990s. It aims at providing astronomers and physicists intending to be active in high-energy astrophysics a broad basis on which they should be able to build the more specific knowledge they will need. While in the first part of the book the physical processes are described and derived in detail, the second part studies astrophysical objects in which high-energy astrophysics plays a crucial role. This two-pronged approach will help students recognise physical processes by their observational signatures in contexts that may differ widely from those presented here.

  5. High energy astrophysical techniques

    CERN Document Server

    Poggiani, Rosa

    2017-01-01

    This textbook presents ultraviolet and X-ray astronomy, gamma-ray astronomy, cosmic ray astronomy, neutrino astronomy, and gravitational wave astronomy as distinct research areas, focusing on the astrophysics targets and the requirements with respect to instrumentation and observation methods. The purpose of the book is to bridge the gap between the reference books and the specialized literature. For each type of astronomy, the discussion proceeds from the orders of magnitude for observable quantities. The physical principles of photon and particle detectors are then addressed, and the specific telescopes and combinations of detectors, presented. Finally the instruments and their limits are discussed with a view to assisting readers in the planning and execution of observations. Astronomical observations with high-energy photons and particles represent the newest additions to multimessenger astronomy and this book will be of value to all with an interest in the field.

  6. Results of search for the point superhigh-energy gamma ray sources carried out in the Crimean Astrophysical Observatory in the years 1969-1973

    International Nuclear Information System (INIS)

    Stepanyan, A.A.; Vladimirskij, B.M.; Neshpor, Yu.I.; Fomin, V.P.

    1975-01-01

    Astrophysical objects possessing high density of ultrahigh energy γ-particles are observed. The observations have been carried out in the Crimean astrophysical observatory of the AN SSSR for the period of 1969-1973. 43 celestial objects have been chosen for observation, among them are both the supposed and well-known sources of hard electromaanetic radiation (x-ray or γ-radiation with the energy of quanta up to 10 -8 eV). Regular observations of celestial bodies are followed by recording Cherenkov bursts by method of scanning with two groups of detectors, each consisting of two parallel-directed light detectors switched on to coincidences. Criteria for selecting the material are described. Paricular attention is paid to stability of the equipment parameters, permanent atmospheric transparency, presence of such atmospheric phenomena as meteors, summer lightings, and so on. As the objects under observation the authors involve x-ray sources, pulsars, supernovae, novae, supernovae remnants, radiogalaxies, point γ-sources. The data obtained and also those of other authors are summarized in a catalog including 72 objects from the Northern part of the celestial sphere

  7. Simulated gamma-ray pulse profile of the Crab pulsar with the Cherenkov Telescope Array

    Science.gov (United States)

    Burtovoi, A.; Zampieri, L.

    2016-07-01

    We present simulations of the very high energy (VHE) gamma-ray light curve of the Crab pulsar as observed by the Cherenkov Telescope Array (CTA). The CTA pulse profile of the Crab pulsar is simulated with the specific goal of determining the accuracy of the position of the interpulse. We fit the pulse shape obtained by the Major Atmospheric Gamma-Ray Imaging Cherenkov (MAGIC) telescope with a three-Gaussian template and rescale it to account for the different CTA instrumental and observational configurations. Simulations are performed for different configurations of CTA and for the ASTRI (Astrofisica con Specchi a Tecnologia Replicante Italiana) mini-array. The northern CTA configuration will provide an improvement of a factor of ˜3 in accuracy with an observing time comparable to that of MAGIC (73 h). Unless the VHE spectrum above 1 TeV behaves differently from what we presently know, unreasonably long observing times are required for a significant detection of the pulsations of the Crab pulsar with the high-energy-range sub-arrays. We also found that an independent VHE timing analysis is feasible with Large Size Telescopes. CTA will provide a significant improvement in determining the VHE pulse shape parameters necessary to constrain theoretical models of the gamma-ray emission of the Crab pulsar. One of such parameters is the shift in phase between peaks in the pulse profile at VHE and in other energy bands that, if detected, may point to different locations of the emission regions.

  8. Astrophysical techniques

    Energy Technology Data Exchange (ETDEWEB)

    Kitchin, C R

    1984-01-01

    The subject is covered in chapters, entitled: detectors (optical and infrared detection; radio and microwave detection; X-ray and gamma-ray detection; cosmic ray detectors; neutrino detectors; gravitational radiation); imaging (photography; electronic imaging; scanning; interferometry; speckle interferometry; occultations; radar); photometry and photometers; spectroscopy and spectroscopes; other techniques (astrometry; polarimetry; solar studies; magnetometry). Appendices: magnitudes and spectral types of bright stars; north polar sequence; standard stars for the UBV photometric system; standard stars for the UVBY photometric system; standard stars for MK spectral types; standard stars for polarimetry; Julian date; catalogues; answers to the exercises.

  9. The Astrophysics Science Division Annual Report 2008

    Science.gov (United States)

    Oegerle, William; Reddy, Francis; Tyler, Pat

    2009-01-01

    The Astrophysics Science Division (ASD) at Goddard Space Flight Center (GSFC) is one of the largest and most diverse astrophysical organizations in the world, with activities spanning a broad range of topics in theory, observation, and mission and technology development. Scientific research is carried out over the entire electromagnetic spectrum from gamma rays to radio wavelengths as well as particle physics and gravitational radiation. Members of ASD also provide the scientific operations for three orbiting astrophysics missions WMAP, RXTE, and Swift, as well as the Science Support Center for the Fermi Gamma-ray Space Telescope. A number of key technologies for future missions are also under development in the Division, including X-ray mirrors, and new detectors operating at gamma-ray, X-ray, ultraviolet, infrared, and radio wavelengths. This report includes the Division's activities during 2008.

  10. Event-sequence time series analysis in ground-based gamma-ray astronomy

    International Nuclear Information System (INIS)

    Barres de Almeida, U.; Chadwick, P.; Daniel, M.; Nolan, S.; McComb, L.

    2008-01-01

    The recent, extreme episodes of variability detected from Blazars by the leading atmospheric Cerenkov experiments motivate the development and application of specialized statistical techniques that enable the study of this rich data set to its furthest extent. The identification of the shortest variability timescales supported by the data and the actual variability structure observed in the light curves of these sources are some of the fundamental aspects being studied, that answers can bring new developments on the understanding of the physics of these objects and on the mechanisms of production of VHE gamma-rays in the Universe. Some of our efforts in studying the time variability of VHE sources involve the application of dynamic programming algorithms to the problem of detecting change-points in a Poisson sequence. In this particular paper we concentrate on the more primary issue of the applicability of counting statistics to the analysis of time-series on VHE gamma-ray astronomy.

  11. DISCOVERY OF THE HARD SPECTRUM VHE γ-RAY SOURCE HESS J1641–463

    Energy Technology Data Exchange (ETDEWEB)

    Abramowski, A. [Institut für Experimentalphysik, Universität Hamburg, Luruper Chaussee 149, D-22761 Hamburg (Germany); Aharonian, F.; Ait Benkhali, F.; Bernlöhr, K. [Max-Planck-Institut für Kernphysik, PO Box 103980, D-69029 Heidelberg (Germany); Akhperjanian, A. G. [National Academy of Sciences of the Republic of Armenia, Marshall Baghramian Avenue, 24, 0019 Yerevan, Republic of Armenia (Armenia); Angüner, E. O.; Birsin, E. [Institut für Physik, Humboldt-Universität zu Berlin, Newtonstr. 15, D-12489 Berlin (Germany); Backes, M. [Department of Physics, University of Namibia, Private Bag 13301, Windhoek (Namibia); Balenderan, S. [Department of Physics, University of Durham, South Road, Durham DH1 3LE (United Kingdom); Balzer, A. [GRAPPA, Anton Pannekoek Institute for Astronomy, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Barnacka, A. [Obserwatorium Astronomiczne, Uniwersytet Jagielloński, ul. Orla 171, 30-244 Kraków (Poland); Becherini, Y. [Department of Physics and Electrical Engineering, Linnaeus University, 351 95 Växjö (Sweden); Becker Tjus, J. [Institut für Theoretische Physik, Lehrstuhl IV: Weltraum und Astrophysik, Ruhr-Universität Bochum, D-44780 Bochum (Germany); Berge, D. [GRAPPA, Anton Pannekoek Institute for Astronomy and Institute of High-Energy Physics, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Bernhard, S. [Institut für Astro- und Teilchenphysik, Leopold-Franzens-Universität Innsbruck, A-6020 Innsbruck (Austria); Biteau, J. [Laboratoire Leprince-Ringuet, Ecole Polytechnique, CNRS/IN2P3, F-91128 Palaiseau (France); Böttcher, M. [Centre for Space Research, North-West University, Potchefstroom 2520 (South Africa); Boisson, C., E-mail: sabrina.casanova@ifj.edu.pl, E-mail: sabrina.casanova@mpi-hd.mpg.de [LUTH, Observatoire de Paris, CNRS, Université Paris Diderot, 5 Place Jules Janssen, F-92190 Meudon (France); Collaboration: H.E.S.S. Collaboration; and others

    2014-10-10

    This Letter reports the discovery of a remarkably hard spectrum source, HESS J1641–463, by the High Energy Stereoscopic System (H.E.S.S.) in the very high energy (VHE) domain. HESS J1641–463 remained unnoticed by the usual analysis techniques due to confusion with the bright nearby source HESS J1640–465. It emerged at a significance level of 8.5 standard deviations after restricting the analysis to events with energies above 4 TeV. It shows a moderate flux level of φ(E>1 TeV) = (3.64 ± 0.44{sub stat} ± 0.73{sub sys}) × 10{sup –13} cm{sup –2} s{sup –1}, corresponding to 1.8% of the Crab Nebula flux above the same energy, and a hard spectrum with a photon index of Γ = 2.07 ± 0.11{sub stat} ± 0.20{sub sys}. It is a point-like source, although an extension up to a Gaussian width of σ = 3 arcmin cannot be discounted due to uncertainties in the H.E.S.S. point-spread function. The VHE γ-ray flux of HESS J1641–463 is found to be constant over the observed period when checking time binnings from the year-by-year to the 28 minute exposure timescales. HESS J1641–463 is positionally coincident with the radio supernova remnant SNR G338.5+0.1. No X-ray candidate stands out as a clear association; however, Chandra and XMM-Newton data reveal some potential weak counterparts. Various VHE γ-ray production scenarios are discussed. If the emission from HESS J1641–463 is produced by cosmic ray protons colliding with the ambient gas, then their spectrum must extend close to 1 PeV. This object may represent a source population contributing significantly to the galactic cosmic ray flux around the knee.

  12. Coulomb dissociation studies for astrophysical thermonuclear reactions

    Energy Technology Data Exchange (ETDEWEB)

    Motobayashi, T [Dept. of Physics, Rikkyo Univ., Toshima, Tokyo (Japan)

    1998-06-01

    The Coulomb dissociation method was applied to several radiative capture processes of astrophysical interest. The method has an advantage of high experimental efficiency, which allow measurements with radioactive nuclear beams. The reactions {sup 13}N(p,{gamma}){sup 14}O and {sup 7}Be(p,{gamma}){sup 8}B are mainly discussed. They are the key reaction in the hot CNO cycle in massive stars and the one closely related to the solar neutrino problem, respectively. (orig.)

  13. Summary for astrophysics and non-accelerator physics

    International Nuclear Information System (INIS)

    Kahana, S.H.

    1988-01-01

    This paper summarizes the presentations at the astrophysics and non-accelerator physics conference. Discussed in this paper are: supernovae, neutrinos, x-rays, gamma rays, cosmic rays, monopoles and primordial nucleosynthesis. 15 refs

  14. Investigations in γ-Ray Astrophysics and Astroparticle Physics

    Energy Technology Data Exchange (ETDEWEB)

    Krennrich, Frank [Iowa State Univ., Ames, IA (United States). Dept. of Physics and Astronomy

    2016-06-28

    This report describes the status of data analysis efforts, results and publications of research grant DE-SC0009917. The research is focused on TeV gamma-ray studies of astrophysical sources and related particle physics questions.

  15. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy. Pantea Davoudifar. Articles written in Journal of Astrophysics and Astronomy. Volume 32 Issue 3 September 2011 pp 359-370. Extragalactic Gamma Ray Excess from Coma Supercluster Direction · Pantea Davoudifar S. Jalil Fatemi · More Details Abstract Fulltext ...

  16. Nuclear physics and astrophysics

    International Nuclear Information System (INIS)

    Schramm, D.N.; Olinto, A.V.

    1992-09-01

    We have investigated a variety of research topics on the interface of nuclear physics and astrophysics during the past year. We have continued our study of dihyperon states in dense matter and have started to make a connection between their properties in the core of neutron stars with the ongoing experimental searches at Brookhaven National Laboratory. We started to build a scenario for the origin of gamma-ray bursts using the conversion of neutron stars to strange stars close to an active galactic nucleous. We have been reconsidering the constraints due to neutron star cooling rates on the equation of state for high density matter in the light, of recent findings which show that the faster direct Urca cooling process is possible for a range of nuclear compositions. We have developed a model for the formation of primordial magnetic fields due to the dynamics of the quark-hadron phase transition. Encouraged by the most recent observational developments, we have investigated the possible origin of the boron and beryllium abundances. We have greatly improved the calculations of the primordial abundances of these elements I>y augmenting the reaction networks and by updating the most recent experimental nuclear reaction rates. Our calculations have shown that the primordial abundances are much higher than previously thought but that the observed abundances cannot be explained by primordial sources alone. We have also studied the origin of the boron and beryllium abundances due to cosmic ray spallation. Finally, we have continued to address the solar neutrino problem by investigating the impact of astrophysical uncertainties on the MSW solution for a full three-family treatment of MSW mixing

  17. Nuclear physics and astrophysics

    Energy Technology Data Exchange (ETDEWEB)

    Schramm, D.N.; Olinto, A.V.

    1992-09-01

    We have investigated a variety of research topics on the interface of nuclear physics and astrophysics during the past year. We have continued our study of dihyperon states in dense matter and have started to make a connection between their properties in the core of neutron stars with the ongoing experimental searches at Brookhaven National Laboratory. We started to build a scenario for the origin of gamma-ray bursts using the conversion of neutron stars to strange stars close to an active galactic nucleous. We have been reconsidering the constraints due to neutron star cooling rates on the equation of state for high density matter in the light, of recent findings which show that the faster direct Urca cooling process is possible for a range of nuclear compositions. We have developed a model for the formation of primordial magnetic fields due to the dynamics of the quark-hadron phase transition. Encouraged by the most recent observational developments, we have investigated the possible origin of the boron and beryllium abundances. We have greatly improved the calculations of the primordial abundances of these elements I>y augmenting the reaction networks and by updating the most recent experimental nuclear reaction rates. Our calculations have shown that the primordial abundances are much higher than previously thought but that the observed abundances cannot be explained by primordial sources alone. We have also studied the origin of the boron and beryllium abundances due to cosmic ray spallation. Finally, we have continued to address the solar neutrino problem by investigating the impact of astrophysical uncertainties on the MSW solution for a full three-family treatment of MSW mixing.

  18. Discovery of TeV gamma-ray emission from the pulsar wind nebula 3C 58 by MAGIC

    Directory of Open Access Journals (Sweden)

    López-Coto Rubén

    2016-01-01

    Full Text Available The pulsar wind nebula (PWN 3C 58 is one of the historical very-high-energy (VHE; E>100 GeV gamma-ray source candidates. It has been compared to the Crab Nebula due to their morphological similarities. This object was detected by Fermi-LAT with a spectrum extending beyond 100 GeV. We analyzed 81 hours of 3C 58 data taken with the MAGIC telescopes and we detected VHE gamma-ray emission for the first time at TeV energies with a significance of 5.7 sigma and an integral flux of 0.65% C.U. above 1 TeV. According to our results 3C 58 is the least luminous PWN ever detected at VHE and the one with the lowest flux at VHE to date. We compare our results with the expectations of time-dependent models in which electrons up-scatter photon fields. The best representation favors a distance to the PWN of 2 kpc and Far Infrared (FIR comparable to CMB photon fields. Hadronic contribution from the hosting supernova remnant (SNR requires unrealistic energy budget given the density of the medium, disfavoring cosmic ray acceleration in the SNR as origin of the VHE gamma-ray emission.

  19. SEARCH FOR A CORRELATION BETWEEN VERY-HIGH-ENERGY GAMMA RAYS AND GIANT RADIO PULSES IN THE CRAB PULSAR

    Energy Technology Data Exchange (ETDEWEB)

    Aliu, E. [Department of Physics and Astronomy, Barnard College, Columbia University, NY 10027 (United States); Archambault, S. [Physics Department, McGill University, Montreal, QC H3A 2T8 (Canada); Arlen, T. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Aune, T.; Bouvier, A. [Santa Cruz Institute for Particle Physics and Department of Physics, University of California, Santa Cruz, CA 95064 (United States); Beilicke, M.; Buckley, J. H.; Bugaev, V.; Dickherber, R. [Department of Physics, Washington University, St. Louis, MO 63130 (United States); Benbow, W. [Fred Lawrence Whipple Observatory, Harvard-Smithsonian Center for Astrophysics, Amado, AZ 85645 (United States); Byrum, K. [Argonne National Laboratory, 9700 S. Cass Avenue, Argonne, IL 60439 (United States); Cesarini, A.; Connolly, M. P. [School of Physics, National University of Ireland Galway, University Road, Galway (Ireland); Ciupik, L. [Astronomy Department, Adler Planetarium and Astronomy Museum, Chicago, IL 60605 (United States); Collins-Hughes, E. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Cui, W. [Department of Physics, Purdue University, West Lafayette, IN 47907 (United States); Duke, C. [Department of Physics, Grinnell College, Grinnell, IA 50112-1690 (United States); Dumm, J. [School of Physics and Astronomy, University of Minnesota, Minneapolis, MN 55455 (United States); Falcone, A. [Department of Astronomy and Astrophysics, 525 Davey Lab, Pennsylvania State University, University Park, PA 16802 (United States); Federici, S., E-mail: schroedter@veritas.sao.arizona.edu, E-mail: mccann@kicp.uchicago.edu, E-mail: nepomuk.otte@gmail.com [DESY, Platanenallee 6, 15738 Zeuthen (Germany); and others

    2012-12-01

    We present the results of a joint observational campaign between the Green Bank radio telescope and the VERITAS gamma-ray telescope, which searched for a correlation between the emission of very-high-energy (VHE) gamma rays (E {sub {gamma}} > 150 GeV) and giant radio pulses (GRPs) from the Crab pulsar at 8.9 GHz. A total of 15,366 GRPs were recorded during 11.6 hr of simultaneous observations, which were made across four nights in 2008 December and in 2009 November and December. We searched for an enhancement of the pulsed gamma-ray emission within time windows placed around the arrival time of the GRP events. In total, eight different time windows with durations ranging from 0.033 ms to 72 s were positioned at three different locations relative to the GRP to search for enhanced gamma-ray emission which lagged, led, or was concurrent with, the GRP event. Furthermore, we performed separate searches on main pulse GRPs and interpulse GRPs and on the most energetic GRPs in our data sample. No significant enhancement of pulsed VHE emission was found in any of the preformed searches. We set upper limits of 5-10 times the average VHE flux of the Crab pulsar on the flux simultaneous with interpulse GRPs on single-rotation-period timescales. On {approx}8 s timescales around interpulse GRPs, we set an upper limit of 2-3 times the average VHE flux. Within the framework of recent models for pulsed VHE emission from the Crab pulsar, the expected VHE-GRP emission correlations are below the derived limits.

  20. Search for a Correlation Between Very-High-Energy Gamma Rays and Giant Radio Pulses in the Crab Pulsar

    Science.gov (United States)

    Aliu, E.; Archambault, S.; Arlen, T.; Aune, T.; Beilicke, M.; Benbow, W.; Bouvier, A.; Buckley, J. H.; Bugaev, V.; Byrum, K.; hide

    2012-01-01

    We present the results of a joint observational campaign between the Green Bank radio telescope and the VERITAS gamma-ray telescope, which searched for a correlation between the emission of very-high-energy (VHE) gamma rays ( E(sub Gamma) > 150 GeV) and giant radio pulses (GRPs) from the Crab pulsar at 8.9 GHz. A total of 15,366 GRPs were recorded during 11.6 hr of simultaneous observations, which were made across four nights in 2008 December and in 2009 November and December. We searched for an enhancement of the pulsed gamma-ray emission within time windows placed around the arrival time of the GRP events. In total, eight different time windows with durations ranging from 0.033 ms to 72 s were positioned at three different locations relative to the GRP to search for enhanced gamma-ray emission which lagged, led, or was concurrent with, the GRP event. Furthermore, we performed separate searches on main pulse GRPs and interpulse GRPs and on the most energetic GRPs in our data sample. No significant enhancement of pulsed VHE emission was found in any of the preformed searches. We set upper limits of 5-10 times the average VHE flux of the Crab pulsar on the flux simultaneous with interpulse GRPs on single-rotation-period timescales. On approx. 8 s timescales around interpulse GRPs, we set an upper limit of 2-3 times the average VHE flux. Within the framework of recent models for pulsed VHE emission from the Crab pulsar, the expected VHE-GRP emission correlations are below the derived limits.

  1. The High-Energy Astrophysics Learning Center, Version 1. [CD-ROM].

    Science.gov (United States)

    Whitlock, Laura A.; Allen, Jesse S.; Lochner, James C.

    The High-Energy Astrophysics (HEA) Learning Center gives students, teachers, and the general public a window into the world of high-energy astrophysics. The universe is revealed through x-rays and gamma rays where matter exists under extreme conditions. Information is available on astrophysics at a variety of reading levels, and is illustrated…

  2. Gamma-Ray Bursts

    Science.gov (United States)

    Pellizza, L. J.

    Gamma-ray bursts are the brightest transient sources in the gamma-ray sky. Since their discovery in the late 1960s, the investigation of the astrophysical sys- tems in which these phenomena take place, and the physical mechanisms that drive them, has become a vast and prolific area of modern astrophysics. In this work I will briefly describe the most relevant observations of these sources, and the models that describe their nature, emphasizing on the in- vestigations about the progenitor astrophysical systems. FULL TEXT IN SPANISH

  3. Nuclear physics and astrophysics

    International Nuclear Information System (INIS)

    Schramm, D.N.; Olinto, A.V.

    1993-06-01

    The authors report on recent progress of research at the interface of nuclear physics and astrophysics. During the past year, the authors continued to work on Big Bang and stellar nucleosynthesis, the solar neutrino problem, the equation of state for dense matter, the quark-hadron phase transition, and the origin of gamma-ray bursts; and began studying the consequences of nuclear reaction rates in the presence of strong magnetic fields. They have shown that the primordial production of B and Be cannot explain recent detections of these elements in halo stars and have looked at spallation as the likely source of these elements. By looking at nucleosynthesis with inhomogeneous initial conditions, they concluded that the Universe must have been very smooth before nucleosynthesis. They have also constrained neutrino oscillations and primordial magnetic fields by Big Bang nucleosynthesis. On the solar neutrino problem, they have analyzed the implications of the SAGE and GALLEX experiments. They also showed that the presence of dibaryons in neutron stars depends weakly on uncertainties of nuclear equations of state. They have started to investigate the consequences of strong magnetic fields on nuclear reactions and implications for neutron star cooling and supernova nucleosynthesis

  4. High energy astrophysics an introduction

    CERN Document Server

    Courvoisier, Thierry J -L

    2013-01-01

    High-energy astrophysics has unveiled a Universe very different from that only known from optical observations. It has revealed many types of objects in which typical variability timescales are as short as years, months, days, and hours (in quasars, X-ray binaries, and other objects), and even down to milli-seconds in gamma ray bursts. The sources of energy that are encountered are only very seldom nuclear fusion, and most of the time gravitation, a paradox when one thinks that gravitation is, by many orders of magnitude, the weakest of the fundamental interactions. The understanding of these objects' physical conditions and the processes revealed by high-energy astrophysics in the last decades is nowadays part of astrophysicists' culture, even of those active in other domains of astronomy. This book evolved from lectures given to master and PhD students at the University of Geneva since the early 1990s. It aims at providing astronomers and physicists intending to be active in high-energy astrophysics a broad...

  5. Detection of variable VHE γ-ray emission from the extra-galactic γ-ray binary LMC P3

    Science.gov (United States)

    HESS Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Angüner, E. O.; Arakawa, M.; Armand, C.; Arrieta, M.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bonnefoy, S.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Büchele, M.; Bulik, T.; Capasso, M.; Caroff, S.; Carosi, A.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Colafrancesco, S.; Condon, B.; Conrad, J.; Davids, I. D.; Decock, J.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Donath, A.; Drury, L. O.'C.; Dyks, J.; Edwards, T.; Egberts, K.; Emery, G.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Funk, S.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Garrigoux, T.; Gaté, F.; Giavitto, G.; Glawion, D.; Glicenstein, J. F.; Gottschall, D.; Grondin, M.-H.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holch, T. L.; Holler, M.; Horns, D.; Ivascenko, A.; Iwasaki, H.; Jacholkowska, A.; Jamrozy, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katsuragawa, M.; Katz, U.; Kerszberg, D.; Khangulyan, D.; Khélifi, B.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lefaucheur, J.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Malyshev, D.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Nakashima, S.; de Naurois, M.; Ndiyavala, H.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poireau, V.; Prokhorov, D. A.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Rauth, R.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Rieger, F.; Rinchiuso, L.; Romoli, C.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Saito, S.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seglar-Arroyo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Shiningayamwe, K.; Simoni, R.; Sol, H.; Spanier, F.; Spir-Jacob, M.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Steppa, C.; Sushch, I.; Takahashi, T.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tsirou, M.; Tsuji, N.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Zorn, J.; Żywucka, N.

    2018-03-01

    Context. Recently, the high-energy (HE, 0.1-100 GeV) γ-ray emission from the object LMC P3 in the Large Magellanic Cloud (LMC) has been discovered to be modulated with a 10.3-day period, making it the first extra-galactic γ-ray binary. Aim. This work aims at the detection of very-high-energy (VHE, >100 GeV) γ-ray emission and the search for modulation of the VHE signal with the orbital period of the binary system. Methods: LMC P3 has been observed with the High Energy Stereoscopic System (H.E.S.S.); the acceptance-corrected exposure time is 100 h. The data set has been folded with the known orbital period of the system in order to test for variability of the emission. Results: VHE γ-ray emission is detected with a statistical significance of 6.4 σ. The data clearly show variability which is phase-locked to the orbital period of the system. Periodicity cannot be deduced from the H.E.S.S. data set alone. The orbit-averaged luminosity in the 1-10 TeV energy range is (1.4 ± 0.2) × 1035 erg s-1. A luminosity of (5 ± 1) × 1035 erg s-1 is reached during 20% of the orbit. HE and VHE γ-ray emissions are anti-correlated. LMC P3 is the most luminous γ-ray binary known so far.

  6. Ground-based VHE γ ray astronomy with air Cherenkov imaging telescopes

    International Nuclear Information System (INIS)

    Mirzoyan, R.

    2000-01-01

    The history of astronomy has been one of the scientific discovery following immediately the introduction of new technology. In this report, we will review shortly the basic development of the atmospheric air Cherenkov light detection technique, particularly the imaging telescope technique, which in the last years led to the firm establishment of a new branch in experimental astronomy, namely ground-based very high-energy (VHE) γ ray astronomy. Milestones in the technology and in the analysis of imaging technique will be discussed. The design of the 17 m diameter MAGIC Telescope, being currently under construction, is based on the development of new technologies for all its major parts and sets new standards in the performance of the ground-based γ detectors. MAGIC is one of the next major steps in the development of the technique being the first instrument that will allow one to carry out measurements also in the not yet investigated energy gap i.e. between 10 and 300 GeV

  7. Measurements of Cyclotron Features and Pulse Periods in the High-Mass X-Ray Binaries 4U 1538-522 and 4U 1907+09 with the International Gamma-Ray Astrophysics Laboratory

    Science.gov (United States)

    Hemphill, Paul B.; Rothschild, Richard E.; Caballero, Isabel; Pottschmidt, Katja; Kuhnel, Matthias; Furst, Felix; Wilms, Jorn

    2013-01-01

    We present a spectral and timing analysis of International Gamma-Ray Astrophysics Laboratory (INTEGRAL) observations of two high-mass X-ray binaries, 4U 1538-522 and 4U 1907+09. Our timing measurements for 4U 1538-522 find the pulse period to have exhibited a spin-up trend until approximately 2009, after which there is evidence for a torque reversal, with the source beginning to spin down to the most recently measured period of 525.407 plus or minus 0.001 seconds. The most recent INTEGRAL observations of 4U 1907+09 are not found to yield statistically significant pulse periods due to the significantly lower flux from the source compared with 4U 1538-522. A spectral model consisting of a power-law continuum with an exponential cutoff and modified by two cyclotron resonance scattering features is found to fit both sources well, with the cyclotron scattering features detected at approximately 22 and approximately 49 kiloelectronvolts for 4U 1538-522 and at approximately 18 and approximately 36 kiloelectronvolts for 4U 1907+09. The spectral parameters of 4U 1538-522 are generally not found to vary significantly with flux and there is little to no variation across the torque reversal. Examining our results in conjunction with previous work, we find no evidence for a correlation between cyclotron line energy and luminosity for 4U 1538-522. 4U 1907+09 shows evidence for a positive correlation between cyclotron line energy and luminosity, which would make it the fourth, and lowest luminosity, cyclotron line source to exhibit this relationship.

  8. Astrophysical Hydrodynamics An Introduction

    CERN Document Server

    Shore, Steven N

    2007-01-01

    This latest edition of the proven and comprehensive treatment on the topic -- from the bestselling author of ""Tapestry of Modern Astrophysics"" -- has been updated and revised to reflect the newest research results. Suitable for AS0000 and AS0200 courses, as well as advanced astrophysics and astronomy lectures, this is an indispensable theoretical backup for studies on celestial body formation and astrophysics. Includes exercises with solutions.

  9. Gravity, particles and astrophysics

    International Nuclear Information System (INIS)

    Wesson, P.S.

    1980-01-01

    The author deals with the relationship between gravitation and elementary particle physics, and the implications of these subjects for astrophysics. The text is split up into two parts. The first part represents a relatively non-technical overview of the subject, while the second part represents a technical examination of the most important aspects of non-Einsteinian gravitational theory and its relation to astrophysics. Relevant references from the fields of gravitation, elementary particle theory and astrophysics are included. (Auth.)

  10. Particle Physics & Astrophysics (PPA)

    Data.gov (United States)

    Federal Laboratory Consortium — Scientists at SLAC's Particle Physics and Astrophysics develop and utilize unique instruments from underground to outer space to explore the ultimate laws of nature...

  11. LHC, Astrophysics and Cosmology

    Directory of Open Access Journals (Sweden)

    Giulio Auriemma

    2014-12-01

    Full Text Available In this paper we discuss the impact on cosmology of recent results obtained by the LHC (Large Hadron Collider experiments in the 2011-2012 runs, respectively at √s = 7 and 8 TeV. The capital achievement of LHC in this period has been the discovery of a spin-0 particle with mass 126 GeV/c2, very similar to the Higgs boson of the Standard Model of Particle Physics. Less exciting, but not less important, negative results of searches for Supersymmetric particles or other exotica in direct production or rare decays are discussed in connection with particles and V.H.E. astronomy searches for Dark Matter.

  12. Astrophysical Institute, Potsdam

    Science.gov (United States)

    Murdin, P.

    2000-11-01

    Built upon a tradition of almost 300 years, the Astrophysical Institute Potsdam (AIP) is in an historical sense the successor of one of the oldest astronomical observatories in Germany. It is the first institute in the world which incorporated the term `astrophysical' in its name, and is connected with distinguished scientists such as Karl Schwarzschild and Albert Einstein. The AIP constitutes on...

  13. Black hole astrophysics

    International Nuclear Information System (INIS)

    Blandford, R.D.; Thorne, K.S.

    1979-01-01

    Following an introductory section, the subject is discussed under the headings: on the character of research in black hole astrophysics; isolated holes produced by collapse of normal stars; black holes in binary systems; black holes in globular clusters; black holes in quasars and active galactic nuclei; primordial black holes; concluding remarks on the present state of research in black hole astrophysics. (U.K.)

  14. Plasma in astrophysics

    International Nuclear Information System (INIS)

    Kulsrud, R.M.

    1982-10-01

    Two examples of plasma phenomena of importance to astrophysics are reviewed. These are examples where astrophysical understanding hinges on further progress in plasma physics understanding. The two examples are magnetic reconnection and the collisionless interaction between a population of energetic particles and a cooler gas or plasma, in particular the interaction between galactic cosmic rays and the interstellar medium

  15. Astrophysical s-factor measurements for {sup 1}20Te(p,{gamma}){sup 1}21I and {sup 1}20Te(p,n){sup 1}20I reactions; {sup 1}20Te(p,{gamma}){sup 1}21I ve {sup 1}20Te(p,n){sup 1}20I reaksiyonlarinin astrofiziksel s-factor oelcuemleri

    Energy Technology Data Exchange (ETDEWEB)

    Gueray, R T; Oezkan, N; Yalcin, C [Kocaeli University, Kocaeli (Turkey); Goerres, J; DeBoer, R; Palumbo, A; Tan, W P; Wiescher, M [University of Notre Dame, (United States); Fueloep, Zs; Somorjai, E [Institute of Nuclear Research ATOMKI (Hungary); Lee, H Y [Argonne National Laboratory (United States)

    2009-07-01

    Astrophysical S-factors for the {sup 1}20Te(p,{gamma}){sup 1}21I and {sup 1}20Te(p,n){sup 1}20I reactions have been measured in the effective center-of-mass energies between 2.47 MeV and 7.93 MeV. Experimental data have been compared with the Hauser-Fesbach statistical model calculations obtained with the model codes NON-SMOKER and TALYS. The discrepancies between the experimental results and calculations can mainly be attributed to the optical model potentials used in the codes.

  16. VERITAS OBSERVATIONS OF GAMMA-RAY BURSTS DETECTED BY SWIFT

    International Nuclear Information System (INIS)

    Acciari, V. A.; Benbow, W.; Aliu, E.; Errando, M.; Arlen, T.; Aune, T.; Beilicke, M.; Buckley, J. H.; Bugaev, V.; Bradbury, S. M.; Byrum, K.; Cannon, A.; Collins-Hughes, E.; Cesarini, A.; Connolly, M. P.; Christiansen, J. L.; Ciupik, L.; Cui, W.; Duke, C.; Falcone, A.

    2011-01-01

    We present the results of 16 Swift-triggered Gamma-ray burst (GRB) follow-up observations taken with the Very Energetic Radiation Imaging Telescope Array System (VERITAS) telescope array from 2007 January to 2009 June. The median energy threshold and response time of these observations were 260 GeV and 320 s, respectively. Observations had an average duration of 90 minutes. Each burst is analyzed independently in two modes: over the whole duration of the observations and again over a shorter timescale determined by the maximum VERITAS sensitivity to a burst with a t –1.5 time profile. This temporal model is characteristic of GRB afterglows with high-energy, long-lived emission that have been detected by the Large Area Telescope on board the Fermi satellite. No significant very high energy (VHE) gamma-ray emission was detected and upper limits above the VERITAS threshold energy are calculated. The VERITAS upper limits are corrected for gamma-ray extinction by the extragalactic background light and interpreted in the context of the keV emission detected by Swift. For some bursts the VHE emission must have less power than the keV emission, placing constraints on inverse Compton models of VHE emission.

  17. Very high energy gamma-ray astronomy with H.E.S.S. Development of a multivariate analysis and application to study of pulsar wind nebulae

    International Nuclear Information System (INIS)

    Dubois, Florent

    2009-01-01

    H.E.S.S. (High Energy Stereoscopic System) is one of the leading systems of four Imaging Atmospheric Cherenkov Telescopes that investigates very high energy (VHE) cosmic gamma-rays in the 100 GeV to 100 TeV energy range. H.E.S.S. is located in Namibia, near the Gamsberg mountain and operational since December 2003. The H.E.S.S. experiment is mainly aimed to the observation of the southern sky including the galactic plan and the numerous astrophysics sources therein. Three analysis methods have been developed using various properties of the electromagnetic showers generated by the interaction of primary cosmic gamma-rays within the Earth atmosphere. The first goal of this thesis was to combine the information from these methods for the selection and the energy and direction reconstruction of gamma-ray events. The new analysis called X eff improves significantly the quality of the selection and the precision of the reconstruction. This analysis has been afterwards applied to the study of pulsar wind nebulae like Vela X, G0.9+0.1 and MSH 15-52. New results were found concerning the source extension (Vela X) or spectral analysis (G0.9+0.1 and MSH 15-52) at TeV energies, thanks to additional data and to the improved efficiency of the new method. In 2010, a new phase will begin with the achievement of a fifth telescope dedicated to gamma-ray observation from tens GeV. The calibration processes of the photomultipliers equipping the camera of the new telescope, as well as the results of the tests, are also described in this thesis. (author)

  18. Goddard's Astrophysics Science Division Annual Report 2013

    Science.gov (United States)

    Weaver, Kimberly A. (Editor); Reddy, Francis J. (Editor); Tyler, Patricia A. (Editor)

    2014-01-01

    The Astrophysics Science Division (ASD) at Goddard Space Flight Center (GSFC) is one of the largest and most diverse astrophysical organizations in the world, with activities spanning a broad range of topics in theory, observation, and mission and technology development. Scientific research is carried out over the entire electromagnetic spectrum from gamma rays to radio wavelengths as well as particle physics and gravitational radiation. Members of ASD also provide the scientific operations for two orbiting astrophysics missions Fermi Gamma-ray Space Telescope and Swift as well as the Science Support Center for Fermi. A number of key technologies for future missions are also under development in the Division, including X-ray mirrors, space-based interferometry, high contrast imaging techniques to search for exoplanets, and new detectors operating at gamma-ray, X-ray, ultraviolet, infrared, and radio wavelengths. The overriding goals of ASD are to carry out cutting-edge scientific research, provide Project Scientist support for spaceflight missions, implement the goals of the NASA Strategic Plan, serve and support the astronomical community, and enable future missions by conceiving new concepts and inventing new technologies.

  19. The Astrophysics Science Division Annual Report 2009

    Science.gov (United States)

    Oegerle, William (Editor); Reddy, Francis (Editor); Tyler, Pat (Editor)

    2010-01-01

    The Astrophysics Science Division (ASD) at Goddard Space Flight Center (GSFC) is one of the largest and most diverse astrophysical organizations in the world, with activities spanning a broad range of topics in theory, observation, and mission and technology development. Scientific research is carried out over the entire electromagnetic spectrum - from gamma rays to radio wavelengths - as well as particle physics and gravitational radiation. Members of ASD also provide the scientific operations for three orbiting astrophysics missions - WMAP, RXTE, and Swift, as well as the Science Support Center for the Fermi Gamma-ray Space Telescope. A number of key technologies for future missions are also under development in the Division, including X-ray mirrors, space-based interferometry, high contrast imaging techniques to search for exoplanets, and new detectors operating at gamma-ray, X-ray, ultraviolet, infrared, and radio wavelengths. The overriding goals of ASD are to carry out cutting-edge scientific research, provide Project Scientist support for spaceflight missions, implement the goals of the NASA Strategic Plan, serve and support the astronomical community, and enable future missions by conceiving new concepts and inventing new technologies.

  20. Goddard's Astrophysics Science Division Annual Report 2011

    Science.gov (United States)

    Centrella, Joan; Reddy, Francis; Tyler, Pat

    2012-01-01

    The Astrophysics Science Division(ASD) at Goddard Space Flight Center(GSFC)is one of the largest and most diverse astrophysical organizations in the world, with activities spanning a broad range of topics in theory, observation, and mission and technology development. Scientific research is carried out over the entire electromagnetic spectrum from gamma rays to radiowavelengths as well as particle physics and gravitational radiation. Members of ASD also provide the scientific operations for three orbiting astrophysics missions WMAP, RXTE, and Swift, as well as the Science Support Center for the Fermi Gamma-ray Space Telescope. A number of key technologies for future missions are also under development in the Division, including X-ray mirrors, space-based interferometry, high contract imaging techniques to serch for exoplanets, and new detectors operating at gamma-ray, X-ray, ultraviolet, infrared, and radio wavelengths. The overriding goals of ASD are to carry out cutting-edge scientific research, and provide Project Scientist support for spaceflight missions, implement the goals of the NASA Strategic Plan, serve and suppport the astronomical community, and enable future missions by conceiving new conepts and inventing new technologies.

  1. Focusing telescopes in nuclear astrophysics

    International Nuclear Information System (INIS)

    Von Ballmoos, P.; Knodlseder, R.; Sazonov, S.; Griffiths, R.; Bastie, P.; Halloin, H.; Pareschi, G.; Ramsey, B.; Jensen, C.; Buis, E.J.; Ulmer, M.; Giommi, P.; Colafrancesco, S.; Comastri, A.; Barret, D.; Leising, M.; Hernanz, M.; Smith, D.; Abrosimov, N.; Smither, B.; Ubertini, P.; Olive, J.F.; Lund, N.; Pisa, A.; Courtois, P.; Roa, D.; Harrison, F.; Pareschi, G.; Frontera, F.; Von Ballmoos, P.; Barriere, N.; Rando, N.; Borde, J.; Hinglais, E.; Cledassou, R.; Duchon, P.; Sghedoni, M.; Huet, B.; Takahashi, T.; Caroli, E.; Quadrinin, L.; Buis, E.J.; Skinner, G.; Krizmanic, J.; Pareschi, G.; Loffredo, G.; Wunderer, C.; Weidenspointner, G.; Wunderer, C.; Koechlin, L.; Bignami, G.; Von Ballmoos, P.; Tueller, J.; Andritschke, T.; Laurens, A.; Evrard, J.

    2005-01-01

    The objective of this workshop is to consider the next generation of instrumentation to be required within the domain of nuclear astrophysics. A small, but growing community has been pursuing various techniques for the focusing of hard X-rays and gamma-rays with the aim of achieving a factor of up to 100 improvement in sensitivity over present technologies. Balloon flight tests of both multilayer mirrors and a Laue lens have been performed and ideas abound. At present, implementation scenarios for space missions are being studied at Esa, CNES, and elsewhere. The workshop will provide a first opportunity for this new community to meet, exchange technological know-how, discuss scientific objectives and synergies, and consolidate implementation approaches within National and European Space Science programs. This document gathers the slides of all the presentations

  2. Focusing telescopes in nuclear astrophysics

    Energy Technology Data Exchange (ETDEWEB)

    Von Ballmoos, P; Knodlseder, R; Sazonov, S; Griffiths, R; Bastie, P; Halloin, H; Pareschi, G; Ramsey, B; Jensen, C; Buis, E J; Ulmer, M; Giommi, P; Colafrancesco, S; Comastri, A; Barret, D; Leising, M; Hernanz, M; Smith, D; Abrosimov, N; Smither, B; Ubertini, P; Olive, J F; Lund, N; Pisa, A; Courtois, P; Roa, D; Harrison, F; Pareschi, G; Frontera, F; Von Ballmoos, P; Barriere, N; Rando, N; Borde, J; Hinglais, E; Cledassou, R; Duchon, P; Sghedoni, M; Huet, B; Takahashi, T; Caroli, E; Quadrinin, L; Buis, E J; Skinner, G; Krizmanic, J; Pareschi, G; Loffredo, G; Wunderer, C; Weidenspointner, G; Wunderer, C; Koechlin, L; Bignami, G; Von Ballmoos, P; Tueller, J; Andritschke, T; Laurens, A; Evrard, J

    2005-07-01

    The objective of this workshop is to consider the next generation of instrumentation to be required within the domain of nuclear astrophysics. A small, but growing community has been pursuing various techniques for the focusing of hard X-rays and gamma-rays with the aim of achieving a factor of up to 100 improvement in sensitivity over present technologies. Balloon flight tests of both multilayer mirrors and a Laue lens have been performed and ideas abound. At present, implementation scenarios for space missions are being studied at Esa, CNES, and elsewhere. The workshop will provide a first opportunity for this new community to meet, exchange technological know-how, discuss scientific objectives and synergies, and consolidate implementation approaches within National and European Space Science programs. This document gathers the slides of all the presentations.

  3. Astrophysics in a nutshell

    CERN Document Server

    Maoz, Dan

    2007-01-01

    A concise but thorough introduction to the observational data and theoretical concepts underlying modern astronomy, Astrophysics in a Nutshell is designed for advanced undergraduate science majors taking a one-semester course. This well-balanced and up-to-date textbook covers the essentials of modern astrophysics--from stars to cosmology--emphasizing the common, familiar physical principles that govern astronomical phenomena, and the interplay between theory and observation. In addition to traditional topics such as stellar remnants, galaxies, and the interstellar medium, Astrophysics in a N

  4. An invitation to astrophysics

    CERN Document Server

    Padmanabhan, Thanu

    2006-01-01

    This unique book provides a clear and lucid description of several aspects of astrophysics and cosmology in a language understandable to a physicist or beginner in astrophysics. It presents the key topics in all branches of astrophysics and cosmology in a simple and concise language. The emphasis is on currently active research areas and exciting new frontiers rather than on more pedantic topics. Many complicated results are introduced with simple, novel derivations which strengthen the conceptual understanding of the subject. The book also contains over one hundred exercises which will help s

  5. Searching for gamma-ray counterparts to gravitational waves from merging binary neutron stars with the Cherenkov Telescope Array

    Science.gov (United States)

    Patricelli, B.; Stamerra, A.; Razzano, M.; Pian, E.; Cella, G.

    2018-05-01

    The merger of binary neutron star (BNS) systems are predicted to be progenitors of short gamma-ray bursts (GRBs); the definitive probe of this association came with the recent detection of gravitational waves (GWs) from a BNS merger by Advanced LIGO and Advanced Virgo (GW170817), in coincidence with the short GRB 170817A observed by Fermi-GBM and INTEGRAL. Short GRBs are also expected to emit very-high energy (VHE, > 10S0 GeV) photons and VHE electromagnetic (EM) upper limits have been set with observations performed by ground-based gamma-ray detectors and during the intense EM follow-up campaign associated with GW170817/GRB 170817A. In the next years, the searches for VHE EM counterparts will become more effective thanks to the Cherenkov Telescope Array (CTA): this instrument will be fundamental for the EM follow-up of transient GW events at VHE, owing to its unprecedented sensitivity, rapid response (few tens of seconds) and capability to monitor large sky areas via survey-mode operation. We present a comprehensive study on the prospects for joint GW and VHE EM observations of merging BNSs with Advanced LIGO, Advanced Virgo and CTA, based on detailed simulations of the multi-messenger emission and detection. We propose a new observational strategy optimized on the prior assumptions about the EM emission. The method can be further generalized to include other electromagnetic emission models. According to this study CTA will cover most of the region of the GW skymap for the intermediate and most energetic on-axis GRBs associated to the GW event. We estimate the expected joint GW and VHE EM detection rates and we found this rate goes from 0.08 up to 0.5 events per year for the most energetic EM sources.

  6. 12th Italian-Korean Symposium on Relativistic Astrophysics

    International Nuclear Information System (INIS)

    Won Lee, Hyung; Remo Riffini; Vereshchagin

    2013-01-01

    This series of biannual symposia, since 1987, has been boosting exchange of information and collaborations between Italian and Korean astrophysicists on new and hot issues in the field of Relativistic Astrophysics. These symposia cover relativistic field theories, astrophysics and cosmology, topics such as gamma-ray bursts and compact stars, high energy cosmic rays, dark energy and dark matter, general relativity, black holes, and new physics related to cosmology. The organizers are confident that this symposium could deepen the understanding of not only astrophysics and cosmology but also Eastern and Western cultures.

  7. 2004 ASTRONOMY & ASTROPHYSICS

    Indian Academy of Sciences (India)

    user

    This publication of the Academy on Astronomy and Astrophysics is unique in ... bring out position papers on societal issues where science plays a major ..... funding agencies, the Astronomical Society of ..... orbit very close to the parent star.

  8. Topics in Nuclear Astrophysics

    International Nuclear Information System (INIS)

    Chung, K.C.

    1982-01-01

    Some topics in nuclear astrophysics are discussed, e.g.: highly evolved stellar cores, stellar evolution (through the temperature analysis of stellar surface), nucleosynthesis and finally the solar neutrino problem. (L.C.) [pt

  9. Astrophysics Decoding the cosmos

    CERN Document Server

    Irwin, Judith A

    2007-01-01

    Astrophysics: Decoding the Cosmos is an accessible introduction to the key principles and theories underlying astrophysics. This text takes a close look at the radiation and particles that we receive from astronomical objects, providing a thorough understanding of what this tells us, drawing the information together using examples to illustrate the process of astrophysics. Chapters dedicated to objects showing complex processes are written in an accessible manner and pull relevant background information together to put the subject firmly into context. The intention of the author is that the book will be a 'tool chest' for undergraduate astronomers wanting to know the how of astrophysics. Students will gain a thorough grasp of the key principles, ensuring that this often-difficult subject becomes more accessible.

  10. Collisionless plasmas in astrophysics

    CERN Document Server

    Belmont, Gerard; Mottez, Fabrice; Pantellini, Filippo; Pelletier, Guy

    2013-01-01

    Collisionless Plasmas in Astrophysics examines the unique properties of media without collisions in plasma physics. Experts in this field, the authors present the first book to concentrate on collisionless conditions in plasmas, whether close or not to thermal equilibrium. Filling a void in scientific literature, Collisionless Plasmas in Astrophysics explains the possibilities of modeling such plasmas, using a fluid or a kinetic framework. It also addresses common misconceptions that even professionals may possess, on phenomena such as "collisionless (Landau) damping". Abundant illustrations

  11. Nonlinear dynamics and astrophysics

    International Nuclear Information System (INIS)

    Vallejo, J. C.; Sanjuan, M. A. F.

    2000-01-01

    Concepts and techniques from Nonlinear Dynamics, also known as Chaos Theory, have been applied successfully to several astrophysical fields such as orbital motion, time series analysis or galactic dynamics, providing answers to old questions but also opening a few new ones. Some of these topics are described in this review article, showing the basis of Nonlinear Dynamics, and how it is applied in Astrophysics. (Author)

  12. High-Energy Spectroscopic Astrophysics Swiss Society for Astrophysics and Astronomy

    CERN Document Server

    Kahn, Steven M; von Ballmoos, Peter

    2005-01-01

    After three decades of intense research in X-ray and gamma-ray astronomy, the time was ripe to summarize basic knowledge on X-ray and gamma-ray spectroscopy for interested students and researchers ready to become involved in new high-energy missions. This volume exposes both the scientific basics and modern methods of high-energy spectroscopic astrophysics. The emphasis is on physical principles and observing methods rather than a discussion of particular classes of high-energy objects, but many examples and new results are included in the three chapters as well.

  13. Laboratory Astrophysics Prize: Laboratory Astrophysics with Nuclei

    Science.gov (United States)

    Wiescher, Michael

    2018-06-01

    Nuclear astrophysics is concerned with nuclear reaction and decay processes from the Big Bang to the present star generation controlling the chemical evolution of our universe. Such nuclear reactions maintain stellar life, determine stellar evolution, and finally drive stellar explosion in the circle of stellar life. Laboratory nuclear astrophysics seeks to simulate and understand the underlying processes using a broad portfolio of nuclear instrumentation, from reactor to accelerator from stable to radioactive beams to map the broad spectrum of nucleosynthesis processes. This talk focuses on only two aspects of the broad field, the need of deep underground accelerator facilities in cosmic ray free environments in order to understand the nucleosynthesis in stars, and the need for high intensity radioactive beam facilities to recreate the conditions found in stellar explosions. Both concepts represent the two main frontiers of the field, which are being pursued in the US with the CASPAR accelerator at the Sanford Underground Research Facility in South Dakota and the FRIB facility at Michigan State University.

  14. Toward observational neutrino astrophysics

    International Nuclear Information System (INIS)

    Koshiba, M.

    1988-01-01

    It is true that: (1) The first observation of the neutrino burst from the supernova SN1987a by Kamiokande-II which was immediately confirmed by IBM; and (2) the first real-time, directional, and spectral observation of solar 8 B neutrinos also by Kamiokande-II could perhaps be considered as signalling the birth of observational astrophysics. The field, however, is still in its infancy and is crying out for tender loving care. Namely, while the construction of astronomy requires the time and the direction of the signal and that of astrophysics requires, in addition to the spectral information, the observations of (1) could not give the directional information and the results of both (1) and (2) are still suffering from the meager statistics. How do we remedy this situation to let this new born science of observational neutrino astrophysics grow healthy. This is what the author addresses in this talk. 15 refs., 8 figs

  15. Numerical simulation in astrophysics

    International Nuclear Information System (INIS)

    Miyama, Shoken

    1985-01-01

    There have been many numerical simulations of hydrodynamical problems in astrophysics, e.g. processes of star formation, supernova explosion and formation of neutron stars, and general relativistic collapse of star to form black hole. The codes are made to be suitable for computing such problems. In astrophysical hydrodynamical problems, there are the characteristics: problems of self-gravity or external gravity acting, objects of scales very large or very short, objects changing by short period or long time scale, problems of magnetic force and/or centrifugal force acting. In this paper, we present one of methods of numerical simulations which may satisfy these requirements, so-called smoothed particle methods. We then introduce the methods briefly. Then, we show one of the applications of the methods to astrophysical problem (fragmentation and collapse of rotating isothermal cloud). (Mori, K.)

  16. Nuclear reactions in astrophysics

    International Nuclear Information System (INIS)

    Arnould, M.; Rayet, M.

    1990-01-01

    At all times and at all astrophysical scales, nuclear reactions have played and continue to play a key role. This concerns the energetics as well as the production of nuclides (nucleosynthesis). After a brief review of the observed composition of various objects in the universe, and especially of the solar system, the basic ingredients that are required in order to build up models for the chemical evolution of galaxies are sketched. Special attention is paid to the evaluation of the stellar yields through an overview of the important burning episodes and nucleosynthetic processes that can develop in non-exploding or exploding stars. Emphasis is put on the remaining astrophysical and nuclear physics uncertainties that hamper a clear understanding of the observed characteristics, and especially compositions, of a large variety of astrophysical objects

  17. Characterising the VHE diffuse emission in the central 200 parsecs of our Galaxy with H.E.S.S.

    Science.gov (United States)

    H.E.S.S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Akhperjanian, A. G.; Andersson, T.; Angüner, E. O.; Arakawa, M.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bonnefoy, S.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Büchele, M.; Bulik, T.; Capasso, M.; Carr, J.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Coffaro, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Cui, Y.; Davids, I. D.; Decock, J.; Degrange, B.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dutson, K.; Dyks, J.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holch, T. L.; Holler, M.; Horns, D.; Ivascenko, A.; Iwasaki, H.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jogler, T.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katsuragawa, M.; Katz, U.; Kerszberg, D.; Khangulyan, D.; Khélifi, B.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Nakashima, S.; de Naurois, M.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Rauth, R.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Richter, S.; Rieger, F.; Romoli, C.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Saito, S.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seglar-Arroyo, M.; Settimo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stycz, K.; Sushch, I.; Takahashi, T.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tsuji, N.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Żywucka, N.

    2018-04-01

    The diffuse very high-energy (VHE; >100 GeV) γ-ray emission observed in the central 200 pc of the Milky Way by H.E.S.S. was found to follow dense matter distribution in the central molecular zone (CMZ) up to a longitudinal distance of about 130 pc to the Galactic centre (GC), where the flux rapidly decreases. This was initially interpreted as the result of a burst-like injection of energetic particles 104 yr ago, but a recent more sensitive H.E.S.S. analysis revealed that the cosmic-ray (CR) density profile drops with the distance to the centre, making data compatible with a steady cosmic PeVatron at the GC. In this paper, we extend this analysis to obtain, for the first time, a detailed characterisation of the correlation with matter and to search for additional features and individual γ-ray sources in the inner 200 pc. Taking advantage of 250 h of H.E.S.S. data and improved analysis techniques, we perform a detailed morphology study of the diffuse VHE emission observed from the GC ridge and reconstruct its total spectrum. To test the various contributions to the total γ-ray emission, we used an iterative 2D maximum-likelihood approach that allows us to build a phenomenological model of the emission by summing a number of different spatial components. We show that the emission correlated with dense matter covers the full CMZ and that its flux is about half the total diffuse emission flux. We also detect some emission at higher latitude that is likely produced by hadronic collisions of CRs in less dense regions of the GC interstellar medium. We detect an additional emission component centred on the GC and extending over about 15 pc that is consistent with the existence of a strong CR density gradient and confirms the presence of a CR accelerator at the very centre of our Galaxy. We show that the spectrum of full ridge diffuse emission is compatible with that previously derived from the central regions, suggesting that a single population of particles fills the

  18. Astrophysics Update 2

    CERN Document Server

    Mason, John W

    2006-01-01

    "Astrophysics Updates" is intended to serve the information needs of professional astronomers and postgraduate students about areas of astronomy, astrophysics and cosmology that are rich and active research spheres. Observational methods and the latest results of astronomical research are presented as well as their theoretical foundations and interrelations. The contributed commissioned articles are written by leading exponents in a format that will appeal to professional astronomers and astrophysicists who are interested in topics outside their own specific areas of research. This collection of timely reviews may also attract the interest of advanced amateur astronomers seeking scientifically rigorous coverage.

  19. Astrophysical opacity library

    International Nuclear Information System (INIS)

    Huebner, W.F.; Merts, A.L.; Magee, N.H. Jr.; Argo, M.F.

    1977-08-01

    The astrophysical elements opacity library includes equation of state data, various mean opacities, and 2000 values of the frequency-dependent extinction coefficients in equally spaced intervals u identical with hν/kT from 0 to 20 for 41 degeneracy parameters eta from -28 (nondegenerate) to 500 and 46 temperatures kT from 1 eV to 100 keV. Among available auxiliary quantities are the free electron density, mass density, and plasma cutoff frequency. A library-associated program can produce opacities for mixtures with up to 20 astrophysically abundant constituent elements at 4 levels of utility for the user

  20. Theoretical astrophysics an introduction

    CERN Document Server

    Bartelmann, Matthias

    2013-01-01

    A concise yet comprehensive introduction to the central theoretical concepts of modern astrophysics, presenting hydrodynamics, radiation, and stellar dynamics all in one textbook. Adopting a modular structure, the author illustrates a small number of fundamental physical methods and principles, which are sufficient to describe and understand a wide range of seemingly very diverse astrophysical phenomena and processes. For example, the formulae that define the macroscopic behavior of stellar systems are all derived in the same way from the microscopic distribution function. This function it

  1. Astrophysics in a nutshell

    CERN Document Server

    Maoz, Dan

    2016-01-01

    Winner of the American Astronomical Society's Chambliss Award, Astrophysics in a Nutshell has become the text of choice in astrophysics courses for science majors at top universities in North America and beyond. In this expanded and fully updated second edition, the book gets even better, with a new chapter on extrasolar planets; a greatly expanded chapter on the interstellar medium; fully updated facts and figures on all subjects, from the observed properties of white dwarfs to the latest results from precision cosmology; and additional instructive problem sets. Throughout, the text features the same focused, concise style and emphasis on physics intuition that have made the book a favorite of students and teachers.

  2. Introduction to Nuclear Astrophysics

    International Nuclear Information System (INIS)

    Iliadis, Christian

    2010-01-01

    In the first lecture of this volume, we will present the basic fundamental ideas regarding nuclear processes occurring in stars. We start from stellar observations, will then elaborate on some important quantum-mechanical phenomena governing nuclear reactions, continue with how nuclear reactions proceed in a hot stellar plasma and, finally, we will provide an overview of stellar burning stages. At the end, the current knowledge regarding the origin of the elements is briefly summarized. This lecture is directed towards the student of nuclear astrophysics. Our intention is to present seemingly unrelated phenomena of nuclear physics and astrophysics in a coherent framework.

  3. Search for very high-energy gamma-ray emission from the microquasar Cygnus X-1 with the MAGIC telescopes

    Science.gov (United States)

    Ahnen, M. L.; Ansoldi, S.; Antonelli, L. A.; Arcaro, C.; Babić, A.; Banerjee, B.; Bangale, P.; Barres de Almeida, U.; Barrio, J. A.; Becerra González, J.; Bednarek, W.; Bernardini, E.; Berti, A.; Bhattacharyya, W.; Biasuzzi, B.; Biland, A.; Blanch, O.; Bonnefoy, S.; Bonnoli, G.; Carosi, R.; Carosi, A.; Chatterjee, A.; Colin, P.; Colombo, E.; Contreras, J. L.; Cortina, J.; Covino, S.; Cumani, P.; da Vela, P.; Dazzi, F.; de Angelis, A.; de Lotto, B.; de Oña Wilhelmi, E.; di Pierro, F.; Doert, M.; Domínguez, A.; Dominis Prester, D.; Dorner, D.; Doro, M.; Einecke, S.; Eisenacher Glawion, D.; Elsaesser, D.; Engelkemeier, M.; Fallah Ramazani, V.; Fernández-Barral, A.; Fidalgo, D.; Fonseca, M. V.; Font, L.; Fruck, C.; Galindo, D.; García López, R. J.; Garczarczyk, M.; Gaug, M.; Giammaria, P.; Godinović, N.; Gora, D.; Guberman, D.; Hadasch, D.; Hahn, A.; Hassan, T.; Hayashida, M.; Herrera, J.; Hose, J.; Hrupec, D.; Ishio, K.; Konno, Y.; Kubo, H.; Kushida, J.; Kuveždić, D.; Lelas, D.; Lindfors, E.; Lombardi, S.; Longo, F.; López, M.; Maggio, C.; Majumdar, P.; Makariev, M.; Maneva, G.; Manganaro, M.; Mannheim, K.; Maraschi, L.; Mariotti, M.; Martínez, M.; Mazin, D.; Menzel, U.; Minev, M.; Mirzoyan, R.; Moralejo, A.; Moreno, V.; Moretti, E.; Neustroev, V.; Niedzwiecki, A.; Nievas Rosillo, M.; Nilsson, K.; Ninci, D.; Nishijima, K.; Noda, K.; Nogués, L.; Paiano, S.; Palacio, J.; Paneque, D.; Paoletti, R.; Paredes, J. M.; Paredes-Fortuny, X.; Pedaletti, G.; Peresano, M.; Perri, L.; Persic, M.; Prada Moroni, P. G.; Prandini, E.; Puljak, I.; Garcia, J. R.; Reichardt, I.; Rhode, W.; Ribó, M.; Rico, J.; Righi, C.; Saito, T.; Satalecka, K.; Schroeder, S.; Schweizer, T.; Sitarek, J.; Šnidarić, I.; Sobczynska, D.; Stamerra, A.; Strzys, M.; Surić, T.; Takalo, L.; Tavecchio, F.; Temnikov, P.; Terzić, T.; Tescaro, D.; Teshima, M.; Torres, D. F.; Torres-Albà, N.; Treves, A.; Vanzo, G.; Vazquez Acosta, M.; Vovk, I.; Ward, J. E.; Will, M.; Zarić, D.; MAGIC Collaboration; Bosch-Ramon, V.; Pooley, G. G.; Trushkin, S. A.; Zanin, R.

    2017-12-01

    The microquasar Cygnus X-1 displays the two typical soft and hard X-ray states of a black hole transient. During the latter, Cygnus X-1 shows a one-sided relativistic radio-jet. Recent detection of the system in the high energy (HE; E ≳ 60 MeV) gamma-ray range with Fermi-LAT associates this emission with the outflow. Former MAGIC observations revealed a hint of flaring activity in the very high-energy (VHE; E ≳ 100 GeV) regime during this X-ray state. We analyse ∼97 h of Cygnus X-1 data taken with the MAGIC telescopes between July 2007 and October 2014. To shed light on the correlation between hard X-ray and VHE gamma rays as previously suggested, we study each main X-ray state separately. We perform an orbital phase-folded analysis to look for variability in the VHE band. Additionally, to place this variability behaviour in a multiwavelength context, we compare our results with Fermi-LAT, AGILE, Swift-BAT, MAXI, RXTE-ASM, AMI and RATAN-600 data. We do not detect Cygnus X-1 in the VHE regime. We establish upper limits for each X-ray state, assuming a power-law distribution with photon index Γ = 3.2. For steady emission in the hard and soft X-ray states, we set integral upper limits at 95 per cent confidence level for energies above 200 GeV at 2.6 × 10-12 photons cm-2 s-1 and 1.0 × 10-11 photons cm-2 s-1, respectively. We rule out steady VHE gamma-ray emission above this energy range, at the level of the MAGIC sensitivity, originating in the interaction between the relativistic jet and the surrounding medium, while the emission above this flux level produced inside the binary still remains a valid possibility.

  4. VLBI OBSERVATIONS OF THE JET IN M 87 DURING THE VERY HIGH ENERGY {gamma}-RAY FLARE IN 2010 APRIL

    Energy Technology Data Exchange (ETDEWEB)

    Hada, Kazuhiro; Giroletti, Marcello; Giovannini, Gabriele [INAF Istituto di Radioastronomia, via Gobetti 101, I-40129 Bologna (Italy); Kino, Motoki; Nagai, Hiroshi [National Astronomical Observatory of Japan, Osawa, Mitaka, Tokyo 181-8588 (Japan); Doi, Akihiro [Institute of Space and Astronautical Science, Japan Aerospace Exploration Agency, 3-1-1 Yoshinodai, Chuo, Sagamihara 252-5210 (Japan); Hagiwara, Yoshiaki; Honma, Mareki; Kawaguchi, Noriyuki [Department of Astronomical Science, Graduate University for Advanced Studies (SOKENDAI), 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan)

    2012-11-20

    We report on the detailed radio status of the M 87 jet during the very high energy (VHE) {gamma}-ray flaring event in 2010 April, obtained from high-resolution, multi-frequency, phase-referencing Very Long Baseline Array observations. We especially focus on the properties of the jet base (the radio core) and the peculiar knot HST-1, which are currently favored as the {gamma}-ray emitting sites. During the VHE flaring event, the HST-1 region remains stable in terms of its structure and flux density in the optically thin regime above 2 GHz, being consistent with no signs of enhanced activities reported at X-ray for this feature. The radio core shows an inverted spectrum at least up to 43 GHz during this event. Astrometry of the core position, which is specified as {approx}20 R {sub s} from the central engine in our previous study, shows that the core position is stable on a level of 4 R {sub s}. The core at 43 and 22 GHz tends to show slightly ({approx}10%) higher flux level near the date of the VHE flux peak compared with the epochs before/after the event. The size of the 43 GHz core is estimated to be {approx}17 R {sub s}, which is close to the size of the emitting region suggested from the observed timescale of rapid variability at VHE. These results tend to favor the scenario that the VHE {gamma}-ray flare in 2010 April is associated with the radio core.

  5. 14th International School of Cosmic Ray Astrophysics

    CERN Document Server

    Stanev, Todor; Wefel, John P; Neutrinos and explosive events in the universe

    2005-01-01

    This volume contains the Lectures and selected participant contributions to the 14th Course of the International School of Cosmic Rays Astrophysics, a NATO Advanced Study Institute. Well known astrophysicists and astronomers discuss different aspects of the generation of high energy signals in powerful astrophysical objects concentrating on the production of neutrinos and gamma rays from high energy particle interactions. Recent results from new experiments and observatories are presented. Topics cover a wide range including the Spitzer infrared observatory, TeV gamma ray observations, dark matter, and neutrino telescopes. The combination of basic knowledge about the production of high energy signals with information about the data analysis of ongoing observations places the book between the usual levels of a textbook and a conference proceedings. It will give the reader a good introduction to the current field of astroparticle physics, and some of the fascinating astrophysics being addressed.

  6. Astrophysical Russian Dolls

    OpenAIRE

    Loeb, Abraham; Imara, Nia

    2017-01-01

    Are there examples of "astrophysical Russian dolls," and what could we learn from their similarities? In this article, we list a few such examples, including disks, filaments, and clusters. We suggest that forging connections across disciplinary borders enhances our perception of beauty, while simultaneously leading to a more comprehensive understanding of the Universe.

  7. High energy astrophysics

    International Nuclear Information System (INIS)

    Shklorsky, I.S.

    1979-01-01

    A selected list of articles of accessible recent review articles and conference reports, wherein up-to-date summaries of various topics in the field of high energy astrophysics can be found, is presented. A special report outlines work done in the Soviet Union in this area. (Auth.)

  8. The NASA Astrophysics Program

    Science.gov (United States)

    Zebulum, Ricardo S.

    2011-01-01

    NASA's scientists are enjoying unprecedented access to astronomy data from space, both from missions launched and operated only by NASA, as well as missions led by other space agencies to which NASA contributed instruments or technology. This paper describes the NASA astrophysics program for the next decade, including NASA's response to the ASTRO2010 Decadal Survey.

  9. Astrophysics of “Extreme” Solar-Like Stars

    Czech Academy of Sciences Publication Activity Database

    Caballero-García, María Dolores; Castro-Tirado, A.J.; Claret, A.; Gazeas, K.; Šimon, Vojtěch; Jelínek, Martin; Cwiek, A.; Zarnecki, A.F.; Oates, S.; Jeong, S.; Hudec, René

    2016-01-01

    Roč. 48, č. 2 (2016), s. 59-63 ISSN 1405-2059. [Workshop on Robotic Autonomous Observatories /4./. Malaga, 28.09.2015-02.10.2015] Grant - others:GA ČR(CZ) GA13-33324S Institutional support: RVO:67985815 Keywords : gamma-rays * observations * stars Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  10. CZT drift strip detectors for high energy astrophysics

    DEFF Research Database (Denmark)

    Kuvvetli, Irfan; Budtz-Jørgensen, Carl; Caroli, E.

    2010-01-01

    Requirements for X- and gamma ray detectors for future High Energy Astrophysics missions include high detection efficiency and good energy resolution as well as fine position sensitivity even in three dimensions.We report on experimental investigations on the CZT drift detector developed DTU Space...

  11. Encyclopedia of Astronomy and Astrophysics

    CERN Document Server

    2002-01-01

    Interstellar medium, Light, Magnetisphere, Matter, Planet Earth, Public Impact, Solar Activity, Solar Heliosphere, Solar Interior, Solar Systems, Space, Stellar Astrophysics, Stellar Populations, Telescopes, Time The Encyclopedia of Astronomy and Astrophysics covers 30 major subject areas, such as Active galaxies, Astrometry, Astrophysical theory, Atmospheres, Binary stars, Biography, Clusters, Coordinates, Cosmology, Earth, Education, Galaxies,

  12. Quark matter in astrophysics and cosmology

    International Nuclear Information System (INIS)

    Olinto, A.V.

    1987-10-01

    We dicuss the role of quark matter in astrophysics and cosmology. The implications of the dynamics of the quark-hadron phase transition in the early universe for the element abundances from big bang nucleosynthesis and the composition of the dark matter in the universe are addressed. We discuss the possibility of deciding on an equation of state for high density matter by observing the cooling of a neutron star remnant of SN1987A. Quark matter models for the Centauros events, Cygnus X-3 cosmic ray events, high energy gamma-ray bursts and the solar neutrino problem are described. 25 refs., 3 figs

  13. Indirect techniques in nuclear astrophysics

    International Nuclear Information System (INIS)

    Mukhamedzhanov, A.M.; Tribble, R.E.; Blokhintsev, L.D.; Cherubini, S.; Spitaleri, C.; Kroha, V.; Nunes, F.M.

    2005-01-01

    It is very difficult or often impossible to measure in the lab conditions nuclear cross sections at astrophysically relevant energies. That is why different indirect techniques are used to extract astrophysical information. In this talk different experimental possibilities to get astrophysical information using radioactive and stable beams will be addressed. 1. The asymptotic normalization coefficient (ANC) method. 2. Radiative neutron captures are determined by the spectroscopic factors (SP). A new experimental technique to determine the neutron SPs will be addressed. 3. 'Trojan Horse' is another unique indirect method, which allows one to extract the astrophysical factors for direct and resonant nuclear reactions at astrophysically relevant energies. (author)

  14. Scaling law in laboratory astrophysics

    International Nuclear Information System (INIS)

    Xia Jiangfan; Zhang Jie

    2001-01-01

    The use of state-of-the-art lasers makes it possible to produce, in the laboratory, the extreme conditions similar to those in astrophysical processes. The introduction of astrophysics-relevant ideas in laser-plasma interaction experiments is propitious to the understanding of astrophysical phenomena. However, the great difference between laser-produced plasma and astrophysical objects makes it awkward to model the latter by laser-plasma experiments. The author presents the physical reasons for modeling astrophysical plasmas by laser plasmas, connecting these two kinds of plasmas by scaling laws. This allows the creation of experimental test beds where observation and models can be quantitatively compared with laboratory data

  15. Frontier Research in Astrophysics - II

    Science.gov (United States)

    2016-05-01

    The purpose of this international workshop is to bring together astrophysicists and physicists who are involved in various topics at the forefront of modern astrophysics and particle physics. The workshop will discuss the most recent experimental and theoretical results in order to advance our understanding of the physics governing our Universe. To accomplish the goals of the workshop, we believe it is necessary to use data from ground-based and space-based experiments and results from theoretical developments: work on the forefront of science which has resulted (or promises to result in) high-impact scientific papers. Hence, the main purpose of the workshop is to discuss in a unique and collaborative setting a broad range of topics in modern astrophysics, from the Big Bang to Planets and Exoplanets. We believe that this can provide a suitable framework for each participant who (while obviously not involved in all the topics discussed), will be able to acquire a general view of the main experimental and theoretical results currently obtained. Such an up-to-date view of the current research on cosmic sources can help guide future research projects by the participants, and will encourage collaborative efforts across various topical areas of research. The proceedings will be published in Proceedings of Science (PoS)- SISSA and will provide a powerful resource for all the scientific community and will be especially helpful for PhD students. The following items will be reviewed: Cosmology: Cosmic Background, Dark Matter, Dark Energy, Clusters of Galaxies. Physics of the Diffuse Cosmic Sources. Physics of Cosmic Rays. Physics of Discrete Cosmic Sources. Extragalactic Sources: Active Galaxies, Normal Galaxies, Gamma-Ray Bursts. Galactic Sources: Star Formation, Pre-Main-Sequence and Main- Sequence Stars, the Sun, Cataclysmic Variables and Novae, Supernovae and SNRs, X-Ray Binary Systems, Pulsars, Black Holes, Gamma-Ray Sources, Nucleosynthesis, Asteroseismology

  16. High Time Resolution Astrophysics

    CERN Document Server

    Phelan, Don; Shearer, Andrew

    2008-01-01

    High Time Resolution Astrophysics (HTRA) is an important new window to the universe and a vital tool in understanding a range of phenomena from diverse objects and radiative processes. This importance is demonstrated in this volume with the description of a number of topics in astrophysics, including quantum optics, cataclysmic variables, pulsars, X-ray binaries and stellar pulsations to name a few. Underlining this science foundation, technological developments in both instrumentation and detectors are described. These instruments and detectors combined cover a wide range of timescales and can measure fluxes, spectra and polarisation. These advances make it possible for HTRA to make a big contribution to our understanding of the Universe in the next decade.

  17. Astrophysics of Red Supergiants

    Science.gov (United States)

    Levesque, Emily M.

    2017-12-01

    'Astrophysics of Red Supergiants' is the first book of its kind devoted to our current knowledge of red supergiant stars, a key evolutionary phase that is critical to our larger understanding of massive stars. It provides a comprehensive overview of the fundamental physical properties of red supergiants, their evolution, and their extragalactic and cosmological applications. It serves as a reference for researchers from a broad range of fields (including stellar astrophysics, supernovae, and high-redshift galaxies) who are interested in red supergiants as extreme stages of stellar evolution, dust producers, supernova progenitors, extragalactic metallicity indicators, members of massive binaries and mergers, or simply as compelling objects in their own right. The book is accessible to a range of experience levels, from graduate students up to senior researchers.

  18. Astrophysical black holes

    CERN Document Server

    Gorini, Vittorio; Moschella, Ugo; Treves, Aldo; Colpi, Monica

    2016-01-01

    Based on graduate school lectures in contemporary relativity and gravitational physics, this book gives a complete and unified picture of the present status of theoretical and observational properties of astrophysical black holes. The chapters are written by internationally recognized specialists. They cover general theoretical aspects of black hole astrophysics, the theory of accretion and ejection of gas and jets, stellar-sized black holes observed in the Milky Way, the formation and evolution of supermassive black holes in galactic centers and quasars as well as their influence on the dynamics in galactic nuclei. The final chapter addresses analytical relativity of black holes supporting theoretical understanding of the coalescence of black holes as well as being of great relevance in identifying gravitational wave signals. With its introductory chapters the book is aimed at advanced graduate and post-graduate students, but it will also be useful for specialists.

  19. Nuclear astrophysics at DRAGON

    International Nuclear Information System (INIS)

    Hager, U.

    2014-01-01

    The DRAGON recoil separator is located at the ISAC facility at TRIUMF, Vancouver. It is designed to measure radiative alpha and proton capture reactions of astrophysical importance. Over the last years, the DRAGON collaboration has measured several reactions using both radioactive and high-intensity stable beams. For example, the 160(a, g) cross section was recently measured. The reaction plays a role in steady-state helium burning in massive stars, where it follows the 12C(a, g) reaction. At astrophysically relevant energies, the reaction proceeds exclusively via direct capture, resulting in a low rate. In this measurement, the unique capabilities of DRAGON enabled determination not only of the total reaction rates, but also of decay branching ratios. In addition, results from other recent measurements will be presented

  20. Nuclear reactions in astrophysics

    International Nuclear Information System (INIS)

    Cardenas, M.

    1976-01-01

    It is revised the nuclear reactions which present an interest in astrophysics regarding the explanation of some problems such as the relative quantity of the elements, the structure and evolution of the stars. The principal object of the study is the determination of the experimental possibilities in the field of astrophysics, of an accelerator Van de Graaff's 700 KeV type. Two hundred nuclear reactions approximately, were found, and nothing or very little has been done in the intervals of energy which are of interest. Since the bombardment energies and the involved sections are low in some cases, there are real possibilities, for the largest number of stars to obtain important statistical data with the above mentioned accelerator, taking some necessary precautions. (author)

  1. Extended VHE γ-ray emission towards SGR1806-20, LBV 1806-20, and stellar cluster Cl* 1806-20

    Science.gov (United States)

    H.E.S.S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Akhperjanian, A. G.; Angüner, E. O.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Birsin, E.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Bulik, T.; Capasso, M.; Carr, J.; Casanova, S.; Chakraborty, N.; Chalme-Calvet, R.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Chrétien, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Couturier, C.; Cui, Y.; Davids, I. D.; Degrange, B.; Deil, C.; deWilt, P.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dubus, G.; Dutson, K.; Dyks, J.; Dyrda, M.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gajdus, M.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Grudzińska, M.; Hadasch, D.; Hahn, J.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hervet, O.; Hillert, A.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holler, M.; Horns, D.; Ivascenko, A.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jogler, T.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katz, U.; Kerszberg, D.; Khélifi, B.; Kieffer, M.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krayzel, F.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; Lypova, I.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Menzler, U.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Morå, K.; Moulin, E.; Murach, T.; de Naurois, M.; Niederwanger, F.; Niemiec, J.; Oakes, L.; Odaka, H.; Öttl, S.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Paz Arribas, M.; Pekeur, N. W.; Pelletier, G.; Petrucci, P.-O.; Peyaud, B.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Reimer, A.; Reimer, O.; Renaud, M.; de Reyes, R.; Rieger, F.; Romoli, C.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Stycz, K.; Sushch, I.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tluczykont, M.; Trichard, C.; Tuffs, R.; van der Walt, J.; van Eldik, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zabalza, V.; Zaborov, D.; Zacharias, M.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Żywucka, N.

    2018-04-01

    Using the High Energy Spectroscopic System (H.E.S.S.) telescopes we have discovered a steady and extended very high-energy (VHE) γ-ray source towards the luminous blue variable candidate LBV 1806-20, massive stellar cluster Cl* 1806-20, and magnetar SGR 1806-20. The new VHE source, HESS J1808-204, was detected at a statistical significance of >6σ (post-trial) with a photon flux normalisation (2.9 ± 0.4stat ± 0.5sys) × 10-13 ph cm-2 s-1 TeV-1 at 1 TeV and a power-law photon index of 2.3 ± 0.2stat ± 0.3sys. The luminosity of this source (0.2 to 10 TeV; scaled to distance d = 8.7 kpc) is LVHE 1.6 × 1034(d/8.7 kpc)2 erg s-1. The VHE γ-ray emission is extended and is well fit by a single Gaussian with statistical standard deviation of 0.095° ± 0.015°. This extension is similar to that of the synchrotron radio nebula G10.0-0.3, which is thought to be powered by LBV 1806-20. The VHE γ-ray luminosity could be provided by the stellar wind luminosity of LBV 1806-20 by itself and/or the massive star members of Cl* 1806-20. Alternatively, magnetic dissipation (e.g. via reconnection) from SGR 1806-20 can potentially account for the VHE luminosity. The origin and hadronic and/or leptonic nature of the accelerated particles responsible for HESS J1808-204 is not yet clear. If associated with SGR 1806-20, the potentially young age of the magnetar (650 yr) can be used to infer the transport limits of these particles to match the VHE source size. This discovery provides new interest in the potential for high-energy particle acceleration from magnetars, massive stars, and/or stellar clusters.

  2. Astrophysical fluid dynamics

    Science.gov (United States)

    Ogilvie, Gordon I.

    2016-06-01

    > These lecture notes and example problems are based on a course given at the University of Cambridge in Part III of the Mathematical Tripos. Fluid dynamics is involved in a very wide range of astrophysical phenomena, such as the formation and internal dynamics of stars and giant planets, the workings of jets and accretion discs around stars and black holes and the dynamics of the expanding Universe. Effects that can be important in astrophysical fluids include compressibility, self-gravitation and the dynamical influence of the magnetic field that is `frozen in' to a highly conducting plasma. The basic models introduced and applied in this course are Newtonian gas dynamics and magnetohydrodynamics (MHD) for an ideal compressible fluid. The mathematical structure of the governing equations and the associated conservation laws are explored in some detail because of their importance for both analytical and numerical methods of solution, as well as for physical interpretation. Linear and nonlinear waves, including shocks and other discontinuities, are discussed. The spherical blast wave resulting from a supernova, and involving a strong shock, is a classic problem that can be solved analytically. Steady solutions with spherical or axial symmetry reveal the physics of winds and jets from stars and discs. The linearized equations determine the oscillation modes of astrophysical bodies, as well as their stability and their response to tidal forcing.

  3. Systematic search for very-high-energy gamma-ray emission from bow shocks of runaway stars

    Science.gov (United States)

    H.E.S.S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Akhperjanian, A. G.; Andersson, T.; Angüner, E. O.; Arakawa, M.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Büchele, M.; Bulik, T.; Capasso, M.; Carr, J.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chalme-Calvet, R.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Chrétien, M.; Coffaro, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Cui, Y.; Davids, I. D.; Decock, J.; Degrange, B.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dutson, K.; Dyks, J.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gajdus, M.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hervet, O.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holler, M.; Horns, D.; Ivascenko, A.; Iwasaki, H.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jogler, T.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katsuragawa, M.; Katz, U.; Kerszberg, D.; Khangulyan, D.; Khélifi, B.; Kieffer, M.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Nakashima, S.; de Naurois, M.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Öttl, S.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Richter, S.; Rieger, F.; Romoli, C.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Saito, S.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seglar-Arroyo, M.; Settimo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stycz, K.; Sushch, I.; Takahashi, T.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tsuji, N.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zabalza, V.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Żywucka, N.

    2018-04-01

    Context. Runaway stars form bow shocks by ploughing through the interstellar medium at supersonic speeds and are promising sources of non-thermal emission of photons. One of these objects has been found to emit non-thermal radiation in the radio band. This triggered the development of theoretical models predicting non-thermal photons from radio up to very-high-energy (VHE, E ≥ 0.1 TeV) gamma rays. Subsequently, one bow shock was also detected in X-ray observations. However, the data did not allow discrimination between a hot thermal and a non-thermal origin. Further observations of different candidates at X-ray energies showed no evidence for emission at the position of the bow shocks either. A systematic search in the Fermi-LAT energy regime resulted in flux upper limits for 27 candidates listed in the E-BOSS catalogue. Aim. Here we perform the first systematic search for VHE gamma-ray emission from bow shocks of runaway stars. Methods: Using all available archival H.E.S.S. data we search for very-high-energy gamma-ray emission at the positions of bow shock candidates listed in the second E-BOSS catalogue release. Out of the 73 bow shock candidates in this catalogue, 32 have been observed with H.E.S.S. Results: None of the observed 32 bow shock candidates in this population study show significant emission in the H.E.S.S. energy range. Therefore, flux upper limits are calculated in five energy bins and the fraction of the kinetic wind power that is converted into VHE gamma rays is constrained. Conclusions: Emission from stellar bow shocks is not detected in the energy range between 0.14 and 18 TeV.The resulting upper limits constrain the level of VHE gamma-ray emission from these objects down to 0.1-1% of the kinetic wind energy.

  4. Goddard's Astrophysics Science Divsion Annual Report 2014

    Science.gov (United States)

    Weaver, Kimberly (Editor); Reddy, Francis (Editor); Tyler, Pat (Editor)

    2015-01-01

    The Astrophysics Science Division (ASD, Code 660) is one of the world's largest and most diverse astronomical organizations. Space flight missions are conceived, built and launched to observe the entire range of the electromagnetic spectrum, from gamma rays to centimeter waves. In addition, experiments are flown to gather data on high-energy cosmic rays, and plans are being made to detect gravitational radiation from space-borne missions. To enable these missions, we have vigorous programs of instrument and detector development. Division scientists also carry out preparatory theoretical work and subsequent data analysis and modeling. In addition to space flight missions, we have a vibrant suborbital program with numerous sounding rocket and balloon payloads in development or operation. The ASD is organized into five labs: the Astroparticle Physics Lab, the X-ray Astrophysics Lab, the Gravitational Astrophysics Lab, the Observational Cosmology Lab, and the Exoplanets and Stellar Astrophysics Lab. The High Energy Astrophysics Science Archive Research Center (HEASARC) is an Office at the Division level. Approximately 400 scientists and engineers work in ASD. Of these, 80 are civil servant scientists, while the rest are resident university-based scientists, contractors, postdoctoral fellows, graduate students, and administrative staff. We currently operate the Swift Explorer mission and the Fermi Gamma-ray Space Telescope. In addition, we provide data archiving and operational support for the XMM mission (jointly with ESA) and the Suzaku mission (with JAXA). We are also a partner with Caltech on the NuSTAR mission. The Hubble Space Telescope Project is headquartered at Goddard, and ASD provides Project Scientists to oversee operations at the Space Telescope Science Institute. Projects in development include the Neutron Interior Composition Explorer (NICER) mission, an X-ray timing experiment for the International Space Station; the Transiting Exoplanet Sky Survey (TESS

  5. Observations of VHE γ-Ray Sources with the MAGIC Telescope

    Science.gov (United States)

    Bartko, H.

    2008-10-01

    The MAGIC telescope with its 17m diameter mirror is today the largest operating single-dish Imaging Air Cherenkov Telescope (IACT). It is located on the Canary Island La Palma, at an altitude of 2200m above sea level, as part of the Roque de los Muchachos European Northern Observatory. The MAGIC telescope detects celestial very high energy γ-radiation in the energy band between about 50 GeV and 10 TeV. Since Autumn of 2004 MAGIC has been taking data routinely, observing various objects like supernova remnants (SNRs), γ-ray binaries, Pulsars, Active Galactic Nuclei (AGN) and Gamma-ray Bursts (GRB). We briefly describe the observational strategy, the procedure implemented for the data analysis, and discuss the results for individual sources. An outlook to the construction of the second MAGIC telescope is given.

  6. Astrophysics and the exploration of the universe

    International Nuclear Information System (INIS)

    Turck-Chieze, S.; Garcia, R.A.; Brun, A.S.; Minier, V.; Andre, Ph.; Motte, F.; Mathis, St.; Foglizzo, Th.; Decourchelle, A.; Ballet, J.; Chaty, S.; Corbel, St.; Rodriguez, J.; Brahic, A.; Charnoz, S.; Ferrari, C.; Lagage, P.O.; Masset, F.; Pantin, E.; Sauvage, M.; Galliano, F.; Goldwurm, A.; Ballet, J.; Decourchelle, A.; Grenier, I.; Daddi, E.; Elbaz, D.; Bournaud, F.; Yvon, D.; Arnaud, M.; Teyssier, R.; Lehoucq, R.; Palanque-Delabrouille, N.; Lehoucq, R.; Cirelli, M.; Bonvin, C.; Mansoulie, B.; Ruhlmann-Kleider, V.; Refregier, A.; Brax, Ph.; Lavignac, St.; Starck, J.L.; Talvard, M.; Sauvage, M.; Cara, Ch.; Lagage, P.O.; Ferrari, C.; Rodriguez, L.; Sauvageot, J.L.; Lebrun, F.; Grenier, I.; Glicenstein, J.F.; Gerbier, G.

    2009-01-01

    This special issue of Clefs CEA journal is entirely devoted to astrophysics and to the exploration and probing of the Universe. A first part of this dossier, described here, makes a status of our present day knowledge about stars, planets, galaxies, the Universe structure and dark matter. Content: 1 - Stars seed the Universe: What does the Sun tell us?, Probing stellar interiors, From the Sun to the stars, A tour of stellar nurseries, How heavy elements arise, How supernovae explode, Supernova remnants, High-energy objects - sources for astonishment, Focus: A Probing the Universe across the entire light spectrum; 2 - Planets: a dance of small bodies, swirling around up to the finale of their birth: How our world was born, The rings of Saturn: a magnificent research laboratory, Planetary cocoons; 3 - Galaxies: a richly paradoxical evolution: The active life of galaxies, A mysterious black hole, Elucidating the cosmic ray acceleration mechanism, Seeking out the great ancestors, The formation of galaxies: a story of paradoxes, The morphogenesis of galaxies; 4 - The Universe, a homogeneous 'soup' that has turned into a hierarchical structure: The grand thermal history of the Universe, The cosmic web, The formation of the structures of the Universe: the interplay of models, Does the Universe have a shape? Is it finite, or infinite?; 5 - Odyssey across the dark side of the Universe: The puzzle of dark matter, Astrophysics and the observation of dark matter, The theory of dark matter, Could dark matter be generated some day at LHC? A Universe dominated by dark energy, Astrophysics and the observation of dark energy, Theories of dark energy, The matter-antimatter asymmetry of the Universe; 6 - Journey into the lights of the Universe: Microwave - ESA Planck Surveyor, Submillimeter and infrared - ArTeMis, Herschel Space Observatory, VLT-VISIR, Cassini-CIRS, Visible - SoHo-GOLF, X-ray - XMM-Newton, Gamma ray - INTEGRAL, Fermi Gamma-Ray Space Telescope, HESS, EDELWEISS

  7. VI School on Cosmic Rays and Astrophysics

    International Nuclear Information System (INIS)

    2017-01-01

    VI School on Cosmic Rays and Astrophysics 17-25 November 2015, Chiapas, Mexico The VI School on Cosmic Rays and Astrophysics was held at the MCTP, at the Autonomous University of Chiapas (UNACH), Tuxtla Gutiérrez, Chiapas, Mexico thanks to the Science for Development ICTP-UNACH-UNESCO Regional Seminar, 17-25 November 2015 (http://mctp.mx/e-VI-School-on-Cosmic-Rays-and-Astrophysics.html). The School series started in La Paz, Bolivia in 2004 and it has been, since then, hosted by several Latin American countires: 1.- La Paz, Bolivia (August, 2004), 2.- Puebla, Mexico (September, 2006), 3.- Arequipa, Peru (September, 2008), 4.- Santo André, Brazil (September, 2010), 5.- La Paz, Bolivia (August, 2012). It aims to promote Cosmic Ray (CR) Physics and Astrophysics in the Latin American community and to provide a general overview of theoretical and experimental issues on these topics. It is directed to undergraduates, postgraduates and active researchers in the field. The lectures introduce fundamental Cosmic Ray Physics and Astrophysics with a review of standards of the field. It is expected the school continues happening during the next years following a tradition. In this edition, the list of seminars included topics such as experimental techniques of CR detection, development of CR showers and hadronic interactions, composition and energy spectrum of primary CR, Gamma-Ray Bursts (GRBs), neutrino Astrophysics, spacecraft detectors, simulations, solar modulation, and the current state of development and results of several astroparticle physics experiments such as The Pierre Auger Observatory in Argentina, HAWC in Mexico, KASCADE and KASCADE Grande, HESS, IceCube, JEM-EUSO, Fermi-LAT, and others. This time the school has been complemented with the ICTP-UNACH-UNESCO Seminar of theory on Particle and Astroparticle Physics. The organization was done by MCTP, the Mesoamerican Centre for Theoretical Physics. The school had 46 participants, 30 students from Honduras, Brazil

  8. SPECTRAL ANALYSIS AND INTERPRETATION OF THE {gamma}-RAY EMISSION FROM THE STARBURST GALAXY NGC 253

    Energy Technology Data Exchange (ETDEWEB)

    Abramowski, A. [Institut fuer Experimentalphysik, Universitaet Hamburg, Luruper Chaussee 149, D-22761 Hamburg (Germany); Acero, F. [Laboratoire Univers et Particules de Montpellier, Universite Montpellier 2, CNRS/IN2P3, CC 72, Place Eugene Bataillon, F-34095 Montpellier Cedex 5 (France); Aharonian, F.; Bernloehr, K.; Bochow, A. [Max-Planck-Institut fuer Kernphysik, P.O. Box 103980, D-69029 Heidelberg (Germany); Akhperjanian, A. G. [National Academy of Sciences of the Republic of Armenia, Yerevan (Armenia); Anton, G.; Balzer, A.; Brucker, J. [Physikalisches Institut, Universitaet Erlangen-Nuernberg, Erwin-Rommel-Str. 1, D-91058 Erlangen (Germany); Barnacka, A. [Nicolaus Copernicus Astronomical Center, ul. Bartycka 18, 00-716 Warsaw (Poland); Becherini, Y. [APC, AstroParticule et Cosmologie, Universite Paris Diderot, CNRS/IN2P3, CEA/lrfu, Observatoire de Paris, Sorbonne Paris Cite, 10, rue Alice Domon et Leonie Duquet, F-75205 Paris Cedex 13 (France); Becker, J. [Institut fuer Theoretische Physik, Lehrstuhl IV: Weltraum und Astrophysik, Ruhr-Universitaet Bochum, D-44780 Bochum (Germany); Birsin, E. [Institut fuer Physik, Humboldt-Universitaet zu Berlin, Newtonstr. 15, D-12489 Berlin (Germany); Biteau, J.; Brun, F. [Laboratoire Leprince-Ringuet, Ecole Polytechnique, CNRS/IN2P3, F-91128 Palaiseau (France); Boisson, C. [LUTH, Observatoire de Paris, CNRS, Universite Paris Diderot, 5 Place Jules Janssen, F-92190 Meudon (France); Bolmont, J. [LPNHE, Universite Pierre et Marie Curie Paris 6, Universite Denis Diderot Paris 7, CNRS/IN2P3, 4 Place Jussieu, F-75252, Paris Cedex 5 (France); Bordas, P. [Institut fuer Astronomie und Astrophysik, Universitaet Tuebingen, Sand 1, D-72076 Tuebingen (Germany); Brun, P. [CEA Saclay, DSM/IRFU, F-91191 Gif-Sur-Yvette Cedex (France); Bulik, T., E-mail: stefan.ohm@le.ac.uk [Astronomical Observatory, The University of Warsaw, Al. Ujazdowskie 4, 00-478 Warsaw (Poland); Collaboration: H.E.S.S. Collaboration; and others

    2012-10-01

    Very high energy (VHE; E {>=} 100 GeV) and high-energy (HE; 100 MeV {<=} E {<=} 100 GeV) data from {gamma}-ray observations performed with the H.E.S.S. telescope array and the Fermi-LAT instrument, respectively, are analyzed in order to investigate the non-thermal processes in the starburst galaxy NGC 253. The VHE {gamma}-ray data can be described by a power law in energy with differential photon index {Gamma} = 2.14 {+-} 0.18{sub stat} {+-} 0.30{sub sys} and differential flux normalization at 1 TeV of F{sub 0} = (9.6 {+-} 1.5{sub stat}(+ 5.7, -2.9){sub sys}) Multiplication-Sign 10{sup -14} TeV{sup -1} cm{sup -2} s{sup -1}. A power-law fit to the differential HE {gamma}-ray spectrum reveals a photon index of {Gamma} 2.24 {+-} 0.14{sub stat} {+-} 0.03{sub sys} and an integral flux between 200 MeV and 200 GeV of F(0.2-200 GeV) = (4.9 {+-} 1.0{sub stat} {+-} 0.3{sub sys}) Multiplication-Sign 10{sup -9} cm{sup -2} s{sup -1}. No evidence for a spectral break or turnover is found over the dynamic range of both the LAT instrument and the H.E.S.S. experiment: a combined fit of a power law to the HE and VHE {gamma}-ray data results in a differential photon index {Gamma} = 2.34 {+-} 0.03 with a p-value of 30%. The {gamma}-ray observations indicate that at least about 20% of the energy of the cosmic rays (CRs) capable of producing hadronic interactions is channeled into pion production. The smooth alignment between the spectra in the HE and VHE {gamma}-ray domain suggests that the same transport processes dominate in the entire energy range. Advection is most likely responsible for charged particle removal from the starburst nucleus from GeV to multiple TeV energies. In a hadronic scenario for the {gamma}-ray production, the single overall power-law spectrum observed would therefore correspond to the mean energy spectrum produced by the ensemble of CR sources in the starburst region.

  9. The TeV {gamma}-ray binary PSR B1259-63. Observations with the high energy stereoscopic system in the years 2005-2007

    Energy Technology Data Exchange (ETDEWEB)

    Kerschhaggl, Matthias

    2010-04-06

    PSR B1259-63/SS2883 is a binary system where a 48 ms pulsar orbits a massive Be star with a period of 3.4 years. The system exhibits variable, non-thermal radiation around periastron on the highly eccentric orbit (e=0.87) visible from radio to very high energies (VHE; E>100 GeV). When being detected in TeV {gamma}-rays with the High Energy Stereoscopic System (H.E.S.S.) in 2004 it became known as the first variable galactic VHE source. This thesis presents VHE data from PSR B1259-63 as taken during the years 2005, 2006 and before as well as shortly after the 2007 periastron passage. These data extend the knowledge of the lightcurve of this object to all phases of the binary orbit. The lightcurve constrains physical mechanisms present in this TeV source. Observations of VHE {gamma}-rays with the H.E.S.S. telescope array using the Imaging Atmospheric Cherenkov Technique were performed. The H.E.S.S. instrument features an angular resolution of < 0.1 and an energy resolution of < 20%. Gamma-ray events in an energy range of 0.5-70 TeV were recorded. From these data, energy spectra and lightcurve with a monthly time sampling were extracted. VHE {gamma}-ray emission from PSRB1259-63 was detected with an overall significance of 9.5 standard deviations using 55 h of exposure, obtained from April to August 2007. The monthly flux of -rays during the observation period was measured, yielding VHE lightcurve data for the early pre-periastron phase of the system for the first time. No spectral variability was found on timescales of months. The spectrum is described by a power law with a photon index of {gamma}=2.8{+-}0.2{sub stat}{+-}0.2{sub sys} and flux normalisation {phi}{sub 0}=(1.1{+-}0.1{sub stat}{+-}0.2{sub sys}) x 10{sup -12} TeV{sup -1}cm{sup -2}s{sup -1}. PSR B1259-63 was also monitored in 2005 and 2006, far from periastron passage, comprising 8.9 h and 7.5 h of exposure, respectively. No significant excess of {gamma}-rays is seen in those observations. PSR B1259-63 has

  10. The TeV {gamma}-ray binary PSR B1259-63. Observations with the high energy stereoscopic system in the years 2005-2007

    Energy Technology Data Exchange (ETDEWEB)

    Kerschhaggl, Matthias

    2010-04-06

    PSR B1259-63/SS2883 is a binary system where a 48 ms pulsar orbits a massive Be star with a period of 3.4 years. The system exhibits variable, non-thermal radiation around periastron on the highly eccentric orbit (e=0.87) visible from radio to very high energies (VHE; E>100 GeV). When being detected in TeV {gamma}-rays with the High Energy Stereoscopic System (H.E.S.S.) in 2004 it became known as the first variable galactic VHE source. This thesis presents VHE data from PSR B1259-63 as taken during the years 2005, 2006 and before as well as shortly after the 2007 periastron passage. These data extend the knowledge of the lightcurve of this object to all phases of the binary orbit. The lightcurve constrains physical mechanisms present in this TeV source. Observations of VHE {gamma}-rays with the H.E.S.S. telescope array using the Imaging Atmospheric Cherenkov Technique were performed. The H.E.S.S. instrument features an angular resolution of < 0.1 and an energy resolution of < 20%. Gamma-ray events in an energy range of 0.5-70 TeV were recorded. From these data, energy spectra and lightcurve with a monthly time sampling were extracted. VHE {gamma}-ray emission from PSRB1259-63 was detected with an overall significance of 9.5 standard deviations using 55 h of exposure, obtained from April to August 2007. The monthly flux of -rays during the observation period was measured, yielding VHE lightcurve data for the early pre-periastron phase of the system for the first time. No spectral variability was found on timescales of months. The spectrum is described by a power law with a photon index of {gamma}=2.8{+-}0.2{sub stat}{+-}0.2{sub sys} and flux normalisation {phi}{sub 0}=(1.1{+-}0.1{sub stat}{+-}0.2{sub sys}) x 10{sup -12} TeV{sup -1}cm{sup -2}s{sup -1}. PSR B1259-63 was also monitored in 2005 and 2006, far from periastron passage, comprising 8.9 h and 7.5 h of exposure, respectively. No significant excess of {gamma}-rays is seen in those observations. PSR B1259-63 has

  11. Research in nuclear astrophysics

    International Nuclear Information System (INIS)

    Lattimer, J.M.; Yahil, A.

    1989-01-01

    The interaction between nuclear theory and some outstanding problems in astrophysics is examined. We are actively researching both the astrophysics of gravitational collapse, neutron star birth, and the emission of neutrinos from supernovae, on the one hand, and the nuclear physics of the equation of state of hot, dense matter on the other hand. There is close coupling between nuclear theory and the supernova phenomenon; in fact, nuclear matter properties, especially at supernuclear densities, might be best delineated by astrophysical considerations. Our research has also focused on the neutrinos emitted from supernovae, since they are the only available observables of the internal supernova mechanism. The recent observations of neutrinos from SN 1987A proved to be in remarkable agreement with models we pioneered in the one and one half years prior to its explosion in February 1987. We have also developed a novel hydrodynamical code in which shocks are treated via Riemann resolution rather than with artificial viscosity. We propose to modify it to use implicit differencing and to include multi-group neutrino diffusion and General Relativity. In parallel, we are extending calculations of the birth of a neutron star to include convection and mass accretion, by incorporating a hydrodynamic envelope onto a hydrostatic core. In view of the possible recent discovery of a pulsar in SN1987A, we are including the effects of rotation. We are undertaking a detailed comparison of current equations of state, focusing on disagreements regarding the nuclear incompressibly, symmetry energy and specific heat. Especially important is the symmetry energy, which below nuclear density controls free proton fractions and weak interaction rates and above this density critically influences the neutron star maximum mass and binding energy. 60 refs

  12. Experimental studies of nuclear astrophysics

    International Nuclear Information System (INIS)

    He Jianjun; Zhou Xiaohong; Zhang Yuhu

    2013-01-01

    Nuclear astrophysics is an interdisciplinary subject combining micro-scale nuclear physics and macro-scale astrophysics. Its main aims are to understand the origin and evolution of the elements in the universe, the time scale of stellar evolution, the stellar environment and sites, the energy generation of stars from thermonuclear processes and its impact on stellar evolution and the mechanisms driving astrophysical phenomena, and the structure and property of compact stars. This paper presents the significance and current research status of nuclear astrophysics; we introduce some fundamental concepts, the nuclear physics input parameters required by certain astrophysics models, and some widely-used experimental approaches in nuclear astrophysics research. The potential and feasibility of research in this field using China’s current and planned large-scale scientific facilities are analyzed briefly. Finally, the prospects of the establishing a deep underground science and engineering laboratory in China are envisaged. (authors)

  13. Astrophysics in 1999

    OpenAIRE

    Trimble, V; Aschwanden, MJ

    2000-01-01

    The year 1999 saw the arrival of a star with three planets, a universe with three parameters, and a solar corona that could be heated at least three ways. In addition, there were at least three papers on every question that has ever been asked in astrophysics, from "Will the Universe expand forever?" to "Does mantle convection occur in one or two layers?" The answers generally were, "Yes," "No," and "None of the above," to each of the questions. The authors have done their best to organize th...

  14. Investigating High Field Gravity using Astrophysical Techniques

    Energy Technology Data Exchange (ETDEWEB)

    Bloom, Elliott D.; /SLAC

    2008-02-01

    The purpose of these lectures is to introduce particle physicists to astrophysical techniques. These techniques can help us understand certain phenomena important to particle physics that are currently impossible to address using standard particle physics experimental techniques. As the subject matter is vast, compromises are necessary in order to convey the central ideas to the reader. Many general references are included for those who want to learn more. The paragraphs below elaborate on the structure of these lectures. I hope this discussion will clarify my motivation and make the lectures easier to follow. The lectures begin with a brief review of more theoretical ideas. First, elements of general relativity are reviewed, concentrating on those aspects that are needed to understand compact stellar objects (white dwarf stars, neutron stars, and black holes). I then review the equations of state of these objects, concentrating on the simplest standard models from astrophysics. After these mathematical preliminaries, Sec. 2(c) discusses 'The End State of Stars'. Most of this section also uses the simplest standard models. However, as these lectures are for particle physicists, I also discuss some of the more recent approaches to the equation of state of very dense compact objects. These particle-physics-motivated equations of state can dramatically change how we view the formation of black holes. Section 3 focuses on the properties of the objects that we want to characterize and measure. X-ray binary systems and Active Galactic Nuclei (AGN) are stressed because the lectures center on understanding very dense stellar objects, black hole candidates (BHCs), and their accompanying high gravitational fields. The use of x-ray timing and gamma-ray experiments is also introduced in this section. Sections 4 and 5 review information from x-ray and gamma-ray experiments. These sections also discuss the current state of the art in x-ray and gamma-ray satellite

  15. Investigating High Field Gravity using Astrophysical Techniques

    International Nuclear Information System (INIS)

    Bloom, Elliott D.

    2008-01-01

    The purpose of these lectures is to introduce particle physicists to astrophysical techniques. These techniques can help us understand certain phenomena important to particle physics that are currently impossible to address using standard particle physics experimental techniques. As the subject matter is vast, compromises are necessary in order to convey the central ideas to the reader. Many general references are included for those who want to learn more. The paragraphs below elaborate on the structure of these lectures. I hope this discussion will clarify my motivation and make the lectures easier to follow. The lectures begin with a brief review of more theoretical ideas. First, elements of general relativity are reviewed, concentrating on those aspects that are needed to understand compact stellar objects (white dwarf stars, neutron stars, and black holes). I then review the equations of state of these objects, concentrating on the simplest standard models from astrophysics. After these mathematical preliminaries, Sec. 2(c) discusses 'The End State of Stars'. Most of this section also uses the simplest standard models. However, as these lectures are for particle physicists, I also discuss some of the more recent approaches to the equation of state of very dense compact objects. These particle-physics-motivated equations of state can dramatically change how we view the formation of black holes. Section 3 focuses on the properties of the objects that we want to characterize and measure. X-ray binary systems and Active Galactic Nuclei (AGN) are stressed because the lectures center on understanding very dense stellar objects, black hole candidates (BHCs), and their accompanying high gravitational fields. The use of x-ray timing and gamma-ray experiments is also introduced in this section. Sections 4 and 5 review information from x-ray and gamma-ray experiments. These sections also discuss the current state of the art in x-ray and gamma-ray satellite experiments and

  16. Nuclear astrophysics: a new era

    Energy Technology Data Exchange (ETDEWEB)

    Wiescher, Michael; Aprahamian, Ani [Department of Physics, University of Notre Dame (United States); Regan, Paddy [Department of Physics, University of Surrey (United Kingdom)

    2002-02-01

    The latest generation of radioactive-ion-beam facilities promises to shed light on the complex nuclear processes that control the evolution of stars and stellar explosions. The most fundamental question in nature is where do we come from, or, put another way, what are we made of? The late Carl Sagan poetically said that we are all made of stardust, but the origin of the elements has fascinated scientists for thousands of years. Many of the greatest medieval and renaissance scientists dabbled in alchemy, trying to create the elements that make up the cosmos, but we had to wait until the early 20th century to recognize that elements are really defined by the number of protons in the nucleus. According to our current understanding, after the big bang most of the normal or baryonic material in the universe consisted of the lightest two elements, hydrogen and helium, with only trace amounts of lithium and beryllium. All the heavier elements that occur naturally on Earth were created from this original material via a series of nuclear reactions in the cores of stars or in stellar explosions. Over the last decade, ground-based telescopes and satellite-based Observatories have opened new windows on the stars across the electromagnetic spectrum, from infrared to gamma radiation. New technology now makes it possible to observe and analyse short-lived stellar explosions. Indeed, the distribution of elements in 'planetary nebula' and in the ejecta of supernovae and novae give a direct glimpse of individual nucleosynthesis processes. In the February issue of Physics World, Michael Wiescher, Paddy Regan and Ani Aprahamian describe how sate-of-the-art facilities are set to plug many of the gaps in our understanding of nuclear astrophysics. (U.K.)

  17. Searches for astrophysical neutrinos with IceCube

    International Nuclear Information System (INIS)

    Williams, D.

    2014-01-01

    Powerful astrophysical objects such as active galactic nuclei (AGN), core collapse supernovae and gamma ray bursts (GRBs) are potential sources of the highest energy cosmic rays. Many models of cosmic ray proton acceleration predict a corresponding flux of neutrinos in the TeV-PeV energy range. The detection of astrophysical neutrinos requires the largest neutrino detector ever built: IceCube, a cubic-kilometer array located near the geographic South Pole. IceCube has been collecting data throughout its construction, which was complete in December 2010. Data from the partial IceCube detector have already set interesting limits on astrophysical neutrino fluxes, including stringent limits on neutrino production in GRBs. (authors)

  18. Important plasma problems in astrophysics

    International Nuclear Information System (INIS)

    Kulsrud, R.M.

    1995-01-01

    In astrophysics, plasmas occur under very extreme conditions. For example, there are ultrastrong magnetic fields in neutron stars, relativistic plasmas around black holes and in jets, extremely energetic particles such as cosmic rays in the interstellar medium, extremely dense plasmas in accretion disks, and extremely large magnetic Reynolds numbers in the interstellar medium. These extreme limits for astrophysical plasmas make plasma phenomena much simpler to analyze in astrophysics than in the laboratory. An understanding of such phenomena often results in an interesting way, by simply taking the extreme limiting case of a known plasma theory. The author will describe one of the more exciting examples and will attempt to convey the excitement he felt when he was first exposed to it. However, not all plasma astrophysical phenomena are so simple. There are certain important plasma phenomena in astrophysics that have not been so easily resolved. In fact, a resolution of them is blocking significant progress in astrophysical research. They have not yet yielded to attacks by theoretical astrophysicists nor to extensive numerical simulation. The author will attempt to describe one of the more important of these plasma--astrophysical problems, and discuss why its resolution is so important to astrophysics. This significant example is fast, magnetic reconnection. Another significant example is the large-magnetic-Reynolds number magnetohydrodynamics (MHD) dynamos

  19. Computational Infrastructure for Nuclear Astrophysics

    International Nuclear Information System (INIS)

    Smith, Michael S.; Hix, W. Raphael; Bardayan, Daniel W.; Blackmon, Jeffery C.; Lingerfelt, Eric J.; Scott, Jason P.; Nesaraja, Caroline D.; Chae, Kyungyuk; Guidry, Michael W.; Koura, Hiroyuki; Meyer, Richard A.

    2006-01-01

    A Computational Infrastructure for Nuclear Astrophysics has been developed to streamline the inclusion of the latest nuclear physics data in astrophysics simulations. The infrastructure consists of a platform-independent suite of computer codes that is freely available online at nucastrodata.org. Features of, and future plans for, this software suite are given

  20. Cyberinfrastructure for Computational Relativistic Astrophysics

    OpenAIRE

    Ott, Christian

    2012-01-01

    Poster presented at the NSF Office of Cyberinfrastructure CyberBridges CAREER PI workshop. This poster discusses the computational challenges involved in the modeling of complex relativistic astrophysical systems. The Einstein Toolkit is introduced. It is an open-source community infrastructure for numerical relativity and computational astrophysics.

  1. Radiation processes in astrophysics

    CERN Document Server

    Tucker, Wallace H

    1975-01-01

    The purpose of this book is twofold: to provide a brief, simple introduction to the theory of radiation and its application in astrophysics and to serve as a reference manual for researchers. The first part of the book consists of a discussion of the basic formulas and concepts that underlie the classical and quantum descriptions of radiation processes. The rest of the book is concerned with applications. The spirit of the discussion is to present simple derivations that will provide some insight into the basic physics involved and then to state the exact results in a form useful for applications. The reader is referred to the original literature and to reviews for rigorous derivations.The wide range of topics covered is illustrated by the following table of contents: Basic Formulas for Classical Radiation Processes; Basic Formulas for Quantum Radiation Processes; Cyclotron and Synchrotron Radiation; Electron Scattering; Bremsstrahlung and Collision Losses; Radiative Recombination; The Photoelectric Effect; a...

  2. NASA's Astrophysics Data Archives

    Science.gov (United States)

    Hasan, H.; Hanisch, R.; Bredekamp, J.

    2000-09-01

    The NASA Office of Space Science has established a series of archival centers where science data acquired through its space science missions is deposited. The availability of high quality data to the general public through these open archives enables the maximization of science return of the flight missions. The Astrophysics Data Centers Coordinating Council, an informal collaboration of archival centers, coordinates data from five archival centers distiguished primarily by the wavelength range of the data deposited there. Data are available in FITS format. An overview of NASA's data centers and services is presented in this paper. A standard front-end modifyer called `Astrowbrowse' is described. Other catalog browsers and tools include WISARD and AMASE supported by the National Space Scince Data Center, as well as ISAIA, a follow on to Astrobrowse.

  3. Black-hole astrophysics

    Energy Technology Data Exchange (ETDEWEB)

    Bender, P. [Univ. of Colorado, Boulder, CO (United States); Bloom, E. [Stanford Linear Accelerator Center, Menlo Park, CA (United States); Cominsky, L. [Sonoma State Univ., Rohnert Park, CA (United States). Dept. of Physics and Astronomy] [and others

    1995-07-01

    Black-hole astrophysics is not just the investigation of yet another, even if extremely remarkable type of celestial body, but a test of the correctness of the understanding of the very properties of space and time in very strong gravitational fields. Physicists` excitement at this new prospect for testing theories of fundamental processes is matched by that of astronomers at the possibility to discover and study a new and dramatically different kind of astronomical object. Here the authors review the currently known ways that black holes can be identified by their effects on their neighborhood--since, of course, the hole itself does not yield any direct evidence of its existence or information about its properties. The two most important empirical considerations are determination of masses, or lower limits thereof, of unseen companions in binary star systems, and measurement of luminosity fluctuations on very short time scales.

  4. Astrophysics Faces the Millennium

    Science.gov (United States)

    Trimble, Virginia

    2001-03-01

    The Medieval synthesis of Aristotelian philosophy and church doctrine, due largely to Thomas Aquinas, insisted that the universe outside the earth's atmosphere must be immutable, single-centered, fully inventoried, immaculate or perfect, including perfectly spherical, and much else that sounds strange to modern ears. The beginnings of modern astronomy can be largely described as the overthrow of these various concepts by a combination of new technologies and new ways of thinking, and many current questions in astrophysics can be directly tied to developments of those same concepts. Indeed they probably all can be, but not over time, ending with questions like: Do other stars have spots? What does it mean when quasar jets look like they are moving faster than the speed of light? Is there anything special about our star, our galaxy, our planet, or our universe? How did these all form, and what is their long-term fate?

  5. Numerical relativity beyond astrophysics

    Science.gov (United States)

    Garfinkle, David

    2017-01-01

    Though the main applications of computer simulations in relativity are to astrophysical systems such as black holes and neutron stars, nonetheless there are important applications of numerical methods to the investigation of general relativity as a fundamental theory of the nature of space and time. This paper gives an overview of some of these applications. In particular we cover (i) investigations of the properties of spacetime singularities such as those that occur in the interior of black holes and in big bang cosmology. (ii) investigations of critical behavior at the threshold of black hole formation in gravitational collapse. (iii) investigations inspired by string theory, in particular analogs of black holes in more than 4 spacetime dimensions and gravitational collapse in spacetimes with a negative cosmological constant.

  6. Exotic nuclei and astrophysics

    Directory of Open Access Journals (Sweden)

    Penionzhkevich Yu.

    2012-12-01

    Full Text Available In recent years, nuclear physics investigations of the laws of the microscopic world contributed significantly to extension of our knowledge of phenomena occurring in the macroscopic world (Universe and made a formidable contribution to the development of astrophysical and cosmological theories. First of all, this concerns the expanding universe model, the evolution of stars, and the abundances of elements, as well as the properties of various stars and cosmic objects, including “cold” and neutron stars, black holes, and pulsars. Without claiming to give a full account of all cosmological problems, we will dwell upon those of them that, in my opinion, have much in common with nuclear-matter properties manifesting themselves in nuclear interactions.

  7. Numerical relativity beyond astrophysics.

    Science.gov (United States)

    Garfinkle, David

    2017-01-01

    Though the main applications of computer simulations in relativity are to astrophysical systems such as black holes and neutron stars, nonetheless there are important applications of numerical methods to the investigation of general relativity as a fundamental theory of the nature of space and time. This paper gives an overview of some of these applications. In particular we cover (i) investigations of the properties of spacetime singularities such as those that occur in the interior of black holes and in big bang cosmology. (ii) investigations of critical behavior at the threshold of black hole formation in gravitational collapse. (iii) investigations inspired by string theory, in particular analogs of black holes in more than 4 spacetime dimensions and gravitational collapse in spacetimes with a negative cosmological constant.

  8. Astrophysics days and MHD

    International Nuclear Information System (INIS)

    Falgarone, Edith; Rieutord, Michel; Richard, Denis; Zahn, Jean-Paul; Dauchot, Olivier; Daviaud, Francois; Dubrulle, Berengere; Laval, Jean-Philippe; Noullez, Alain; Bourgoin, Mickael; Odier, Philippe; Pinton, Jean-Francois; Leveque, Emmanuel; Chainais, Pierre; Abry, Patrice; Mordant, Nicolas; Michel, Olivier; Marie, Louis; Chiffaudel, Arnaud; Daviaud, Francois; Petrelis, Francois; Fauve, Stephan; Nore, C.; Brachet, M.-E.; Politano, H.; Pouquet, A.; Leorat, Jacques; Grapin, Roland; Brun, Sacha; Delour, Jean; Arneodo, Alain; Muzy, Jean-Francois; Magnaudet, Jacques; Braza, Marianna; Boree, Jacques; Maurel, S.; Ben, L.; Moreau, J.; Bazile, R.; Charnay, G.; Lewandowski, Roger; Laveder, Dimitri; Bouchet, Freddy; Sommeria, Joel; Le Gal, P.; Eloy, C.; Le Dizes, S.; Schneider, Kai; Farge, Marie; Bottausci, Frederic; Petitjeans, Philippe; Maurel, Agnes; Carlier, Johan; Anselmet, Fabien

    2001-05-01

    This publication gathers extended summaries of presentations proposed during two days on astrophysics and magnetohydrodynamics (MHD). The first session addressed astrophysics and MHD: The cold interstellar medium, a low ionized turbulent plasma; Turbulent convection in stars; Turbulence in differential rotation; Protoplanetary disks and washing machines; gravitational instability and large structures; MHD turbulence in the sodium von Karman flow; Numerical study of the dynamo effect in the Taylor-Green eddy geometry; Solar turbulent convection under the influence of rotation and of the magnetic field. The second session addressed the description of turbulence: Should we give up cascade models to describe the spatial complexity of the velocity field in a developed turbulence?; What do we learn with RDT about the turbulence at the vicinity of a plane surface?; Qualitative explanation of intermittency; Reduced model of Navier-Stokes equations: quickly extinguished energy cascade; Some mathematical properties of turbulent closure models. The third session addressed turbulence and coherent structures: Alfven wave filamentation and formation of coherent structures in dispersive MHD; Statistical mechanics for quasi-geo-strophic turbulence: applications to Jupiter's coherent structures; Elliptic instabilities; Physics and modelling of turbulent detached unsteady flows in aerodynamics and fluid-structure interaction; Intermittency and coherent structures in a washing machine: a wavelet analysis of joint pressure/velocity measurements; CVS filtering of 3D turbulent mixing layer using orthogonal wavelets. The last session addressed experimental methods: Lagrangian velocity measurements; Energy dissipation and instabilities within a locally stretched vortex; Study by laser imagery of the generation and breakage of a compressed eddy flow; Study of coherent structures of turbulent boundary layer at high Reynolds number

  9. MAX: Development of a Laue diffraction lens for nuclear astrophysics

    International Nuclear Information System (INIS)

    Barriere, N.; Ballmoos, P. von; Skinner, G.; Smither, B.; Bastie, P.; Hinglais, E.; Abrosimov, N.; Alvarez, J.M.; Andersen, K.; Courtois, P.; Halloin, H.; Harris, M.; Isern, J.; Jean, P.; Knoedlseder, J.; Ubertini, P.; Vedrenne, G.; Weidenspointner, G.; Wunderer, C.

    2006-01-01

    The next generation of instrumentation for nuclear astrophysics will have to achieve an improvement in sensitivity by a factor of 10-100 over present technologies. With the focusing gamma-ray telescope MAX we take up this challenge and propose to combine the required sensitivity with high spectral and angular resolution, and the capability to measure the polarization of the photons. MAX is a space-borne crystal diffraction telescope, featuring a broad-band Laue lens optimized for the observation of compact sources in two wide energy bands of high astrophysical relevance. Gamma rays will be focused from the large collecting area of a crystal diffraction lens onto a very small detector volume. As a consequence, the signal to background ratio is greatly enhanced, leading to unprecedented sensitivities

  10. Gamma-ray bursts

    CERN Document Server

    Wijers, Ralph A M J; Woosley, Stan

    2012-01-01

    Cosmic gamma ray bursts (GRBs) have fascinated scientists and the public alike since their discovery in the late 1960s. Their story is told here by some of the scientists who participated in their discovery and, after many decades of false starts, solved the problem of their origin. Fourteen chapters by active researchers in the field present a detailed history of the discovery, a comprehensive theoretical description of GRB central engine and emission models, a discussion of GRB host galaxies and a guide to how GRBs can be used as cosmological tools. Observations are grouped into three sets from the satellites CGRO, BeppoSAX and Swift, and followed by a discussion of multi-wavelength observations. This is the first edited volume on GRB astrophysics that presents a fully comprehensive review of the subject. Utilizing the latest research, Gamma-ray Bursts is an essential desktop companion for graduate students and researchers in astrophysics.

  11. Research in astrophysical processes

    Science.gov (United States)

    Ruderman, Malvin A.

    1994-01-01

    Work completed under this grant is summarized in the following areas:(1) radio pulsar turn on and evaporation of companions in very low mass x-ray binaries and in binary radio pulsar systems; (2) effects of magnetospheric pair production on the radiation from gamma-ray pulsars; (3) radiation transfer in the atmosphere of an illuminated companion star; (4) evaporation of millisecond pulsar companions;(5) formation of planets around pulsars; (6) gamma-ray bursts; (7) quasi-periodic oscillations in low mass x-ray binaries; (8) origin of high mass x-ray binaries, runaway OB stars, and the lower mass cutoff for core collapse supernovae; (9) dynamics of planetary atmospheres; (10) two point closure modeling of stationary, forced turbulence; (11) models for the general circulation of Saturn; and (12) compressible convection in stellar interiors.

  12. Theoretical nuclear structure and astrophysics. Progress report for 1996

    International Nuclear Information System (INIS)

    Guidry, M.W.; Nazarewicz, W.; Strayer, M.R.

    1996-01-01

    This research effort is directed toward theoretical support and guidance for the fields of radioactive ion beam physics, gamma ray spectroscopy, computational and nuclear astrophysics, and the interface between these disciplines. The authors report substantial progress in all those areas. One measure of progress is publications and invited material. The research described here has led to more than 43 papers that are published, accepted, or submitted to refereed journals, and to 15 invited presentations at conferences and workshops

  13. VI European Summer School on Experimental Nuclear Astrophysics

    Science.gov (United States)

    The European Summer School on Experimental Nuclear Astrophysics has reached the sixth edition, marking the tenth year's anniversary. The spirit of the school is to provide a very important occasion for a deep education of young researchers about the main topics of experimental nuclear astrophysics. Moreover, it should be regarded as a forum for the discussion of the last-decade research activity. Lectures are focused on various aspects of primordial and stellar nucleosynthesis, including novel experimental approaches and detectors, indirect methods and radioactive ion beams. Moreover, in order to give a wide educational offer, some lectures cover complementary subjects of nuclear astrophysics such as gamma ray astronomy, neutron-induced reactions, short-lived radionuclides, weak interaction and cutting-edge facilities used to investigate nuclear reactions of interest for astrophysics. Large room is also given to young researcher oral contributions. Traditionally, particular attention is devoted to the participation of students from less-favoured countries, especially from the southern coast of the Mediterranean Sea. The school is organised by the Catania Nuclear Astrophysics research group with the collaboration of Dipartimento di Fisica e Astromomia - Università di Catania and Laboratori Nazionali del Sud - Istituto Nazionale di Fisica Nucleare.

  14. Magnetic Reconnection in Extreme Astrophysical Environments

    Science.gov (United States)

    Uzdensky, Dmitri

    Magnetic reconnection is a fundamental plasma physics process of breaking ideal-MHD's frozen-in constraints on magnetic field connectivity and of dramatic rearranging of the magnetic topol-ogy, which often leads to a violent release of the free magnetic energy. Reconnection has long been acknowledged to be of great importance in laboratory plasma physics (magnetic fusion) and in space and solar physics (responsible for solar flares and magnetospheric substorms). In addition, its importance in Astrophysics has been increasingly recognized in recent years. However, due to a great diversity of astrophysical environments, the fundamental physics of astrophysical magnetic reconnection can be quite different from that of the traditional recon-nection encountered in the solar system. In particular, environments like the solar corona and the magnetosphere are characterized by relatively low energy densities, where the plasma is ad-equately described as a mixture of electrons and ions whose numbers are conserved and where the dissipated magnetic energy basically stays with the plasma. In contrast, in many high-energy astrophysical phenomena the energy density is so large that photons play as important a role as electrons and ions and, in particular, radiation pressure and radiative cooling become dominant. In this talk I focus on the most extreme case of high-energy-density astrophysical reconnec-tion — reconnection of magnetar-strength (1014 - 1015 Gauss) magnetic fields, important for giant flares in soft-gamma repeaters (SGRs), and for rapid magnetic energy release in either the central engines or in the relativistic jets of Gamma Ray Bursts (GRBs). I outline the key relevant physical processes and present a new theoretical picture of magnetic reconnection in these environments. The corresponding magnetic energy density is so enormous that, when suddenly released, it inevitably heats the plasma to relativistic temperatures, resulting in co-pious production of electron

  15. Astrophysical life extinctions what killed the dinosaurs?

    CERN Document Server

    Dar, Arnon

    1999-01-01

    Geological records indicate that the exponential diversification of marine and continental life on Earth in the past 500 My was interrupted by many life extinctions. They also indicate that the major mass extinctions were correlated in time with large meteoritic impacts, gigantic volcanic eruptions, sea regressions and drastic changes in global climate. Some of these catastrophes coincided in time. The astrophysical life extinction mechanisms which were proposed so far, in particular, meteoritic impacts, nearby supernova explosions, passage through molecular or dark matter clouds, and Galactic gamma/cosmic ray bursts cannot explain the time coincidences between these catastrophes. However, recent observations suggest that many planetary-mass objects may be present in the outer solar system between the Kuiper belt and the Oort cloud. Gravitational perturbations may occasionally bring them into the inner solar system. Their passage near Earth could have generated gigantic tidal waves, large volcanic eruptions, ...

  16. The high intensity {gamma}-ray source (HI{gamma}S) and recent results

    Energy Technology Data Exchange (ETDEWEB)

    Tonchev, A.P. [Duke University and TUNL, Triangle University Nuclear Laboratory, P.O. Box 90308, Durham, NC 27708 0308 (United States)]. E-mail: tonchev@tunl.duke.edu; Boswell, M. [University of North Carolina at Chapel Hill and TUNL, Chapel Hill, NC 27599 (United States); Howell, C.R. [Duke University and TUNL, Triangle University Nuclear Laboratory, P.O. Box 90308, Durham, NC 27708 0308 (United States); Karwowski, H.J. [University of North Carolina at Chapel Hill and TUNL, Chapel Hill, NC 27599 (United States); Kelley, J.H. [North Carolina State University and TUNL, Raleigh, NC 27695 (United States); Tornow, W. [Duke University and TUNL, Triangle University Nuclear Laboratory, P.O. Box 90308, Durham, NC 27708 0308 (United States); Wu, Y.K. [Duke University and Duke Free Electron Laser Laboratory, Durham, NC 27708-0319 (United States)

    2005-12-15

    The high intensity {gamma}-ray source (HI{gamma}S) utilizes intra-cavity backscattering of free electron laser photons from the Duke electron storage ring to produce a unique monoenergetic beam of high-flux {gamma}-rays with high polarization and selectable energy resolution. At present, {gamma}-ray beams with energies from 2 to 58 MeV are available with intensities as high as 10{sup 5}-5 x 10{sup 6} {gamma}/s, energy spreads of 3% or better, and nearly 100% linear polarization. The quality and intensity of the {gamma}-ray beams at HI{gamma}S are responsible for the unprecedented performance of this facility in a broad range of research programs in nuclear structure, nuclear astrophysics and nuclear applications. Recent results from excitation of isomeric states in ({gamma}, n) reactions and parity assignments of dipole states determined via the ({gamma}, {gamma}') reaction are presented.

  17. Nuclear astrophysics with radioactive beams

    International Nuclear Information System (INIS)

    Bertulani, C.A.; Gade, A.

    2010-01-01

    The quest to comprehend how nuclear processes influence astrophysical phenomena is driving experimental and theoretical research programs worldwide. One of the main goals in nuclear astrophysics is to understand how energy is generated in stars, how elements are synthesized in stellar events and what the nature of neutron stars is. New experimental capabilities, the availability of radioactive beams and increased computational power paired with new astronomical observations have advanced the present knowledge. This review summarizes the progress in the field of nuclear astrophysics with a focus on the role of indirect methods and reactions involving beams of rare isotopes.

  18. Nuclear Astrophysics Experiments at CIAE

    International Nuclear Information System (INIS)

    Liu Weiping; Li Zhihong; Bai Xixiang; Lian Gang; Guo Bing; Zeng, Sheng; Yan Shengquan; Wang Baoxiang; Shu Nengchuan; Wu Kaisu; Chen Yongshou

    2005-01-01

    This paper describes nuclear astrophysical studies using the unstable ion beam facility GIRAFFE. We measured the angular distributions for some low energy reactions, such as 7 Be(d, n) 8 B, 11 C(d, n) 12 N, 8 Li(d, n) 9 Be and 8 Li(d, p) 9 Li in inverse kinematics, and indirectly derived the astrophysical S-factors or reaction rates of 7 Be(p, γ) 8 B, 11 C(p, γ) 12 N, 8 Li(n, γ) 9 Li at astrophysically relevant energies

  19. Intermittent Astrophysical Radiation Sources and Terrestrial Life

    Science.gov (United States)

    Melott, Adrian

    2013-04-01

    Terrestrial life is exposed to a variety of radiation sources. Astrophysical observations suggest that strong excursions in cosmic ray flux and spectral hardness are expected. Gamma-ray bursts and supernovae are expected to irradiate the atmosphere with keV to GeV photons at irregular intervals. Supernovae will produce large cosmic ray excursions, with time development varying with distance from the event. Large fluxes of keV to MeV protons from the Sun pose a strong threat to electromagnetic technology. The terrestrial record shows cosmogenic isotope excursions which are consistent with major solar proton events, and there are observations of G-stars suggesting that the rate of such events may be much higher than previously assumed. In addition there are unknown and unexplained astronomical transients which may indicate new classes of events. The Sun, supernovae, and gamma-ray bursts are all capable of producing lethal fluences, and some are expected on intervals of 10^8 years or so. The history of life on Earth is filled with mass extinctions at a variety of levels of intensity. Most are not understood. Astrophysical radiation may play a role, particularly from large increases in muon irradiation on the ground, and changes in atmospheric chemistry which deplete ozone, admitting increased solar UVB. UVB is strongly absorbed by DNA and proteins, and breaks the chemical bonds---it is a known carcinogen. High muon fluxes will also be damaging to such molecules, but experiments are needed to pin down the rate. Solar proton events which are not directly dangerous for the biota may nevertheless pose a major threat to modern electromagnetic technology through direct impact on satellites and magnetic induction of large currents in power grids, disabling transformers. We will look at the kind of events that are expected on timescales from human to geological, and their likely consequences.

  20. Atoms in astrophysics

    CERN Document Server

    Eissner, W; Hummer, D; Percival, I

    1983-01-01

    It is hard to appreciate but nevertheless true that Michael John Seaton, known internationally for the enthusiasm and skill with which he pursues his research in atomic physics and astrophysics, will be sixty years old on the 16th of January 1983. To mark this occasion some of his colleagues and former students have prepared this volume. It contains articles that de­ scribe some of the topics that have attracted his attention since he first started his research work at University College London so many years ago. Seaton's association with University College London has now stretched over a period of some 37 years, first as an undergraduate student, then as a research student, and then, successively, as Assistant Lecturer, Lecturer, Reader, and Professor. Seaton arrived at University College London in 1946 to become an undergraduate in the Physics Department, having just left the Royal Air Force in which he had served as a navigator in the Pathfinder Force of Bomber Command. There are a number of stories of ho...

  1. Photonuclear reactions: astrophysical implications

    International Nuclear Information System (INIS)

    Nedorezov, V.G.

    2005-01-01

    Full text: Brief review on astrophysical aspects in photonuclear studies is presented. Main attention is paid on the two kind experiments. The first one was performed at ESRF by GRAAL collaboration using the back scattering laser photons technique to study light speed anisotropy with respect to the dipole of the Cosmic Microwave Background (CMB) radiation. This is a modern analog of the Michelson - Morley experiment. The results obtained are not only methologically different from those of the above mentioned experiments but also provide stronger constrains on the light speed anisotropy in CMB frame. Second subject is related to the electron scattering on exotic nuclei which can play significant role in explosive phenomena such as novae, supernovae and neutron stars. Such approach may be considered as the alternative to traditional low energy accelerator experiments. Exotic nuclei for these purposes can be obtained at CSI (ELISe project). The experiment is foreseen to be installed at the New Experimental Storage Ring (NESR) at RAIR where cooled secondary beams of radioactive ions will collide with an intense electron beam circulating in a small electron storage beam

  2. Astrophysical implications of periodicity

    International Nuclear Information System (INIS)

    Muller, R.A.

    1988-01-01

    Two remarkable discoveries of the last decade have profound implications for astrophysics and for geophysics. These are the discovery by Alvarez et al., that certain mass extinctions are caused by the impact on the earth of a large asteroid or comet, and the discovery by Raup and Sepkoski that such extinctions are periodic, with a cycle time of 26 to 30 million years. The validity of both of these discoveries is assumed and the implications are examined. Most of the phenomena described depend not on periodicity, but just on the weaker assumption that the impacts on the earth take place primarily in showers. Proposed explanations for the periodicity include galactic oscillations, the Planet X model, and the possibility of Nemesis, a solar companion star. These hypotheses are critically examined. Results of the search for the solar companion are reported. The Deccan flood basalts of India have been proposed as the impact site for the Cretaceous impact, but this hypotheisis is in contradiction with the conclusion of Courtillot et al., that the magma flow began during a period of normal magnetic field. A possible resolution of this contradiction is proposed

  3. A detailed study of the supernova remnant RCW 86 in TeV {gamma}-rays

    Energy Technology Data Exchange (ETDEWEB)

    Heinz, Sebastian

    2012-03-29

    A detailed study of the supernova remnant RCW 86 is presented. RCW 86 encountered a shell-like structure in radio, X-rays and optical, whereas in the discovery paper of RCW 86 in the very high energy regime the structure could not be confirmed. In this thesis for the first time the shell was resolved in the very high energy gamma rays. The shell width was determined to be 0.125 {+-}0.014 , the radius to be 0.194 {+-} 0.016 and the center to be -62.433 {+-}0.014 in declination and 220.734 {+-}0.016 in rectascension. The spectral analysis was performed for the whole SNR and for the south-east part, which is more pronounced in X-rays separately. But the results were comparable within errors. Additionally a power-law with an exponential cut off described the spectra best with the parameters: an spectral index of 1.50{+-}0.28, a cut-off energy of (2.69{+-}0.99 TeV) and an integral flux above 1 TeV of (6.51{+-}2.69) . 10{sup -12} cm{sup -2}s{sup -1}. The study of the correlation of the X-ray and VHE {gamma}-ray data of RCW 86 was hampered by the poor angular resolution of the VHE data. Therefore detailed studies of the Richardson-Lucy deconvolution algorithm have been performed. The outcome is, that deconvolution techniques are applicable to strong VHE {gamma}-ray sources and that fine structure well below the angular resolution can be studied. The application to RX J1713-3946, the brightest SNR in the VHE regime, has shown, that the correlation coefficient of the X-ray data and the VHE data of is stable down to 0.01 and has a value of 0.85. On the other side the significance of the data set is not sufficient in the case of RCW 86 to apply the deconvolution technique.

  4. An introduction to observational astrophysics

    CERN Document Server

    Gallaway, Mark

    2016-01-01

    Observational Astrophysics follows the general outline of an astrophysics undergraduate curriculum targeting practical observing information to what will be covered at the university level. This includes the basics of optics and coordinate systems to the technical details of CCD imaging, photometry, spectography and radio astronomy.  General enough to be used by students at a variety of institutions and advanced enough to be far more useful than observing guides targeted at amateurs, the author provides a comprehensive and up-to-date treatment of observational astrophysics at undergraduate level to be used with a university’s teaching telescope.  The practical approach takes the reader from basic first year techniques to those required for a final year project. Using this textbook as a resource, students can easily become conversant in the practical aspects of astrophysics in the field as opposed to the classroom.

  5. Recent progress on astrophysical opacity

    International Nuclear Information System (INIS)

    Rogers, F.J.; Iglesias, C.A.

    1992-08-01

    Improvements in the calculation of the opacity of astrophysical plasmas has helped to resolve several long-standing puzzles in the modeling of variable stars. The most significant opacity enhancements over the Los Alamos Astrophysical Library (LAOL) are due to improvements in the equation of state and atomic physics. Comparison with experiment has corroborated the predicted large opacity increases due to transitions in M-shell iron. We give a summary of recent developments

  6. An introduction to astrophysical hydrodynamics

    CERN Document Server

    Shore, Steven N

    1992-01-01

    This book is an introduction to astrophysical hydrodynamics for both astronomy and physics students. It provides a comprehensive and unified view of the general problems associated with fluids in a cosmic context, with a discussion of fluid dynamics and plasma physics. It is the only book on hydrodynamics that addresses the astrophysical context. Researchers and students will find this work to be an exceptional reference. Contents include chapters on irrotational and rotational flows, turbulence, magnetohydrodynamics, and instabilities.

  7. Gamma-Ray Astronomy Technology Needs

    Science.gov (United States)

    Gehrels, N.; Cannizzo, J. K.

    2012-01-01

    In recent decades gamma-ray observations have become a valuable tool for studying the universe. Progress made in diverse 8re1lS such as gamma-ray bursts (GRBs), nucleosynthesis, and active galactic nuclei (AGNs) has complimented and enriched our astrophysical understanding in many ways. We present an overview of current and future planned space y-ray missions and discussion technology needs for- the next generation of space gamma-ray instruments.

  8. Relativistic astrophysics and theory of gravity

    International Nuclear Information System (INIS)

    Zel'dovich, Ya.B.

    1982-01-01

    A brief historical review of the development of astrophysical science in the State Astrophysical Institute named after Shternberg (SAISh) has been given in a popular form. The main directions of the SAISh astrophysical investigations have been presented: relativistic theory of gravity, relativistic astrophysics of interplanetary medium and cosmology

  9. Gamma-Ray Instrument for Polarimetry, Spectroscopy and Imaging (GIPSI)

    National Research Council Canada - National Science Library

    Kroeger, R. A; Johnson, W. N; Kinzer, R. L; Kurfess, J. D; Inderhees, S. E; Phlips, B. F; Graham, B. L

    1996-01-01

    .... Gamma-ray polarimetry in the energy band around 60-300 keV is an interesting area of high energy astrophysics where observations have not been possible with the technologies employed in current and past space missions...

  10. FOREWORD: Nuclear Physics in Astrophysics V

    Science.gov (United States)

    Auerbach, Naftali; Hass, Michael; Paul, Michael

    2012-02-01

    of neutrinos, such as double-beta decay and neutrino mixing were well represented at the conference. One of the central problems in modern cosmology and astrophysics is the search for dark matter. Several talks dealt with this subject and with methods to detect dark matter. Another intriguing and rather novel subject that was discussed at the meeting was time variation of fundamental physical constants. Two speakers have examined the sensitivity of Big-Bang Nucleosynthesis to the variation of the values of the fundamental constants. The role of some specific nuclei (such as Ni 56) in cosmology was pointed out. Many of the presentations at the conference described experimental studies of reactions relevant to nucleosynthesis at various stages of cosmic evolution. As reflected in the conference, these activities are widespread, encompassing many laboratories. Rare Isotope Beam (RIB) facilities are in the forefront of these studies. To understand the various processes of nucleosynthesis one has to have a good theory of nuclei far from the stability line. A number of presentations dealt with the description of such exotic nuclei. It is clear from the presentations that the future of experimental nuclear astrophysics looks promising as existing experimental facilities are being upgraded and new facilities are being built. X-Ray and Gamma-Ray Bursts and cosmic explosions were the subject of several talks. A discussion of various experiments attempting to measure time-reversal violation was the subject of one lecture. The solution of the puzzle as to why the universe is asymmetric with respect to matter-antimatter requires knowledge of the limit of time-reversal conservation. The late John Bahcall was a great astrophysicist and a supporter of the conference series 'Nuclear physics in Astrophysics'. On the last day of the conference, following a talk by Neta Bahcall from Princeton University on dark matter in the Universe, a short commemoration for John was held. Detailed

  11. Study of the N=28 shell closure by one neutron transfer reaction: astrophysical application and {beta}-{gamma} spectroscopy of neutron rich nuclei around N=32/34 and N=40; Etude de la fermeture de couche N=28 autour du noyau {sub 18}{sup 46}Ar{sub 28} par reaction de transfert d'un neutron: application a l'astrophysique et Spectroscopie {beta}-{gamma} de noyaux riches en neutrons de N=32/34 et N=40

    Energy Technology Data Exchange (ETDEWEB)

    Gaudefroy, L

    2005-09-15

    The study of the N=28 shell closure has been presented as well as its astrophysical implications. Moreover the structure of neutron rich nuclei around N=32/34 and 40 was studied. The N=28 shell closure has been studied trough the one neutron transfer reaction on {sup 44,46}Ar nuclei. Excitation energies of states in {sup 45,47}Ar nuclei have been obtained, as well as their angular momenta and spectroscopic factors. These results were used to show that N=28 is still a good magic number in the argon isotopic chain. We interpreted the evolution of the spin-orbit partner gaps in terms of the tensor monopolar proton-neutron interaction. Thanks to this latter, we showed it is not necessary to summon up a reduction of the intensity of the spin-orbit force in order to explain this evolution in N=29 isotopes from calcium to argon chains. The neutron capture rates on {sup 44,46}Ar have been determined thanks to the results of the transfer reaction. Their influence on the nucleosynthesis of {sup 46,48}Ca was studied. We proposed stellar conditions to account for the abnormal isotopic ratio observed in the Allende meteorite concerning {sup 46,48}Ca isotopes. The beta decay and gamma spectroscopy of neutron rich nuclei in the scandium to cobalt region has been studied. We showed that beta decay process is dominated by the {nu}f{sub 5/2} {yields} {pi}f{sub 7/2} Gamow-Teller transition. Moreover, we demonstrated that the {nu}g{sub 9/2} hinders this process in the studied nuclei, and influences their structure, by implying the existence of isomers. Our results show that N=34 is not a magic number in the titanium chain and the superior ones. (author)

  12. When neutrinos attack - the impact of agressive neutrinos in astrophysics.

    Science.gov (United States)

    Kneller, James

    2004-11-01

    Of all the constituents within the standard model of particle physics our understanding of the neutrino has benefited the most from the interaction of astrophysics and `terraphysics'. Much has been learned about the properties of the neutrino from each: experiments here on Earth temper our appreciation of the role that neutrinos play in the cosmos while astrophysics can provide the densities and temperatures in which the neutrinos do more than simply flee. But their reluctance to interact means that it is not until we venture into the most extreme environments of astrophysics that we observe neutrinos pushing back' as hard as they are being pushed'. We review two sites where this occurs: the early Universe and the accretion disk, engines' of gamma ray bursts. Neutrinos play an important role in the evolution of the early Universe with a particular focus upon the electron neutrino in determining the primordial elemental composition via its participation in the most important reaction at that time. Within gamma ray burst accretion disks we again see the electron neutrinos at work in the nuclear reactions and through their function as the coolant' for the disk. Removal of the disk energy, and its deposition into the remnants of the massive star surrounding the disk, may lead to the formation of highly relativistic jets that will later be observed as the burst. We show what has been learned so far about the neutrino and its properties from the study of such environments and discuss where future research is heading.

  13. Astrophysics a very short introduction

    CERN Document Server

    Binney, James

    2016-01-01

    Astrophysics is the physics of the stars, and more widely the physics of the Universe. It enables us to understand the structure and evolution of planetary systems, stars, galaxies, interstellar gas, and the cosmos as a whole. In this Very Short Introduction, the leading astrophysicist James Binney shows how the field of astrophysics has expanded rapidly in the past century, with vast quantities of data gathered by telescopes exploiting all parts of the electromagnetic spectrum, combined with the rapid advance of computing power, which has allowed increasingly effective mathematical modelling. He illustrates how the application of fundamental principles of physics - the consideration of energy and mass, and momentum - and the two pillars of relativity and quantum mechanics, has provided insights into phenomena ranging from rapidly spinning millisecond pulsars to the collision of giant spiral galaxies. This is a clear, rigorous introduction to astrophysics for those keen to cut their teeth on a conceptual trea...

  14. Magnetohydrodynamic models of astrophysical jets

    International Nuclear Information System (INIS)

    Beskin, Vasily S

    2010-01-01

    In this review, analytical results obtained for a wide class of stationary axisymmetric flows in the vicinity of compact astrophysical objects are analyzed, with an emphasis on quantitative predictions for specific sources. Recent years have witnessed a great increase in understanding the formation and properties of astrophysical jets. This is due not only to new observations but also to advances in analytical theory which has produced fairly simple relations, and to what can undoubtedly be called a breakthrough in numerical simulation which has enabled confirmation of theoretical predictions. Of course, we are still very far from fully understanding the physical processes occurring in compact sources. Nevertheless, the progress made raises hopes for near-future test observations that can give insight into the physical processes occurring in active astrophysical objects. (reviews of topical problems)

  15. Future prospects for. gamma. -ray astronomy

    Energy Technology Data Exchange (ETDEWEB)

    Fichtel, C [National Aeronautics and Space Administration, Greenbelt, MD (USA). Goddard Space Flight Center

    1981-06-30

    As ..gamma..-ray astronomy moves from the discovery to the exploratory phase, the promise of ..gamma..-ray astrophysics noted by theorists in the late 1940s and 1950s is beginning to be realized. In the future, satellites should carry instruments that will have over an order of magnitude greater sensitivity than those flown thus far, and, for at least some portions of the ..gamma..-ray energy range, these detectors will also have substantially improved energy and angular resolution. The information to be obtained from these experiments should greatly enhance our knowledge of several astrophysical phenomena including the very energetic and nuclear processes associated with compact objects, astrophysical nucleosynthesis, solar particle acceleration, the chemical composition of the planets and other bodies of the Solar System, the structure of our Galaxy, the origin and dynamic pressure effects of the cosmic rays, high energy particles and energetic processes in other galaxies especially active ones, and the degree of matter-antimatter symmetry of the Universe. The ..gamma..-ray results of the forthcoming programs such as Gamma-I, the Gamma Ray Observatory, the ..gamma..-ray burst network, Solar Polar, and very high energy ..gamma..-ray telescopes on the ground will almost certainly provide justification for more sophisticated telescopes. These advanced instruments might be placed on the Space Platform currently under study by N.A.S.A.

  16. Advances in astronomy and astrophysics

    CERN Document Server

    Kopal, Zdenek

    1963-01-01

    Advances in Astronomy and Astrophysics, Volume 2 brings together numerous research works on different aspects of astronomy and astrophysics. This volume is composed of six chapters and begins with a summary of observational record on twilight extensions of the Venus cusps. The next chapter deals with the common and related properties of binary stars, with emphasis on the evaluation of their cataclysmic variables. Cataclysmic variables refer to an object in one of three classes: dwarf nova, nova, or supernova. These topics are followed by discussions on the eclipse phenomena and the eclipses i

  17. Advances in astronomy and astrophysics

    CERN Document Server

    Kopal, Zdenek

    1962-01-01

    Advances in Astronomy and Astrophysics, Volume 1 brings together numerous research works on different aspects of astronomy and astrophysics. This book is divided into five chapters and begins with an observational summary of the shock-wave theory of novae. The subsequent chapter provides the properties and problems of T tauri stars and related objects. These topics are followed by discussions on the structure and origin of meteorites and cosmic dust, as well as the models for evaluation of mass distribution in oblate stellar systems. The final chapter describes the methods of polarization mea

  18. Advances in astronomy and astrophysics

    CERN Document Server

    Kopal, Zdenek

    1966-01-01

    Advances in Astronomy and Astrophysics, Volume 4 brings together numerous research works on different aspects of astronomy and astrophysics. This volume is composed of five chapters, and starts with a description of objective prism and its application in space observations. The next chapter deals with the possibilities of deriving reliable models of the figure, density distribution, and gravity field of the Moon based on data obtained through Earth-bound telescopes. These topics are followed by a discussion on the ideal partially relativistic, partially degenerate gas in an exact manner. A ch

  19. Advanced LIGO: sources and astrophysics

    International Nuclear Information System (INIS)

    Creighton, Teviet

    2003-01-01

    Second-generation detectors in LIGO will take us from the discovery phase of gravitational-wave observations to the phase of true gravitational-wave astrophysics, with hundreds or thousands of potential sources. This paper surveys the most likely and interesting potential sources for Advanced LIGO, and the astrophysical processes that each one will probe. I conclude that binary inspiral signals are expected, while continuous signals from pulsars are plausible but not guaranteed. Other sources, such as core-collapse bursts, cosmic strings and primordial stochastic backgrounds, are speculative sources for Advanced LIGO, but also potentially the most interesting, since they push the limits of our theoretical knowledge

  20. Nuclear astrophysics away from stability

    International Nuclear Information System (INIS)

    Mathews, G.J.; Howard, W.M.; Takahashi, K.; Ward, R.A.

    1985-08-01

    Explosive astrophysical environments invariably lead to the production of nuclei away from stability. An understanding of the dynamics and nucleosynthesis in such environments is inextricably coupled to an understanding of the properties of the synthesized nuclei. In this talk a review is presented of the basic explosive nucleosynthesis mechanisms (s-process, r-process, n-process, p-process, and rp-process). Specific stellar model calculations are discussed and a summary of the pertinent nuclear data is presented. Possible experiments and nuclear-model calculations are suggested that could facilitate a better understanding of the astrophysical scenarios. 39 refs., 4 figs

  1. White Paper on Nuclear Astrophysics

    OpenAIRE

    Arcones, Almudena; Bardayan, Dan W.; Beers, Timothy C.; Berstein, Lee A.; Blackmon, Jeffrey C.; Messer, Bronson; Brown, B. Alex; Brown, Edward F.; Brune, Carl R.; Champagne, Art E.; Chieffi, Alessandro; Couture, Aaron J.; Danielewicz, Pawel; Diehl, Roland; El-Eid, Mounib

    2016-01-01

    This white paper informs the nuclear astrophysics community and funding agencies about the scientific directions and priorities of the field and provides input from this community for the 2015 Nuclear Science Long Range Plan. It summarizes the outcome of the nuclear astrophysics town meeting that was held on August 21-23, 2014 in College Station at the campus of Texas A&M University in preparation of the NSAC Nuclear Science Long Range Plan. It also reflects the outcome of an earlier town mee...

  2. Advances in astronomy and astrophysics

    CERN Document Server

    Kopal, Zdenek

    1968-01-01

    Advances in Astronomy and Astrophysics, Volume 6 brings together numerous research works on different aspects of astronomy and astrophysics. This volume is composed of five chapters, and starts with the description of improved methods for analyzing and classifying families of periodic orbits in a conservative dynamical system with two degrees of freedom. The next chapter describes the variation of fractional luminosity of distorted components of close binary systems in the course of their revolution, or the accompanying changes in radial velocity. This topic is followed by discussions on vari

  3. Nuclear astrophysics data at ORNL

    International Nuclear Information System (INIS)

    Smith, M.S.; Blackmon, J.C.

    1998-01-01

    There is a new program of evaluation and dissemination of nuclear data of critical importance for nuclear astrophysics within the Physics Division of Oak Ridge National Laboratory. Recent activities include determining the rates of the important 14 O(α,p) 17 F and 17 F(p,γ) 18 Ne reactions, disseminating the Caughlan and Fowler reaction rate compilation on the World Wide Web, and evaluating the 17 O(p,α) 14 N reaction rate. These projects, which are closely coupled to current ORNL nuclear astrophysics research, are briefly discussed along with future plans

  4. Laboratory Astrophysics Using High Energy Density Photon and Electron Beams

    CERN Document Server

    Bingham, Robert

    2005-01-01

    The development of intense laser and particle beams has opened up new opportunities to study high energy density astrophysical processes in the Laboratory. With even higher laser intensities possible in the near future vacuum polarization processes such as photon - photon scattering with or without large magnetic fields may also be experimentally observed. In this talk I will review the status of laboratory experiments using intense beans to investigate extreme astrophysical phenomena such as supernovae explosions, gamma x-ray bursts, ultra-high energy cosmic accelerators etc. Just as intense photon or electron beams can excite relativistic electron plasma waves or wakefields used in plasma acceleration, intense neutrino beams from type II supernovae can also excite wakefields or plasma waves. Other instabilities driven by intense beams relevant to perhaps x-ray bursts is the Weibel instability. Simulation results of extreme processes will also be presented.

  5. Nuclear astrophysics. Irfu - IN2P3 prospective of 2012

    International Nuclear Information System (INIS)

    Assie, M.; Hammache, F.; Khan, E.; Margueron, J.; Sereville, N. de; Bastin, B.; Oliveira Santos, F. de; Ploszajczak, M.; Sorlin, O.; Bernard, D.; Chieze, J.-P.; Decourchelle, A.; Ducret, J. E.; Foglizzo, T.; Gilles, D.; Schanne, S.; Turck-Chieze, S.; Coc, A.; Duprat, J.; Kiener, J.; Lefebvre-Schuhl, A.; Tatischeff, V.; Courtin, S.; Dufour, M.; Haas, F.; Gulminelli, F.; Gunsing, F.; Obertelli, A.; Maurin, D.; Renaud, M.; Smirnova, N.

    2011-01-01

    This document proposes a rather detailed overview of the different research works performed by nuclear astrophysicists belonging to the Irfu and to the IN2P3. It also presents the main results and envisaged researches. These issues are herein presented by distinguishing four main themes. The first one concerns the main issues of the field: cosmology and nuclear physics, hydrostatic nucleosynthesis and stellar evolution, explosive nucleosynthesis (supernovae, novae, X-bursts), neutron stars and protostars, galactic cosmic radiation and nuclear astrophysics, formation of the Solar System. The second theme concerns means of observation: astro-seismology, X astronomy, nuclear gamma astronomy, meteorites and micro-meteorites. The third theme concerns measurements in laboratory: steady beam accelerators, radioactive beam accelerators, neutron beams, production of radioactive targets, power lasers, isotopic analysis of extraterrestrial matter. The fourth theme concerns nuclear theories for astrophysics. Appendices propose summaries of objectives of current projects, and tables indicating involved staff and budgets

  6. Particle and astrophysics aspects of ultrahigh energy cosmic rays

    Energy Technology Data Exchange (ETDEWEB)

    Sigl, G [Institut d' Astrophysique de Paris, Paris (France)

    2001-11-15

    The origin of cosmic rays is one of the major unresolved astrophysical questions. In particular, the highest energy cosmic rays observed possess macroscopic energies and their origin is likely to be associated with the most energetic processes in the Universe. Their existence triggered a flurry of theoretical explanations ranging from conventional shock acceleration to particle physics beyond the Standard Model and processes taking place at the earliest moments of our Universe. Furthermore, many new experimental activities promise a strong increase of statistics at the highest energies and a combination with {gamma}-ray and neutrino astrophysics will put strong constraints on these theoretical models. Detailed Monte Carlo simulations indicate that charged ultra-high energy cosmic rays can also be used as probes of large scale magnetic fields whose origin may open another window into the very early Universe. We give an overview over this quickly evolving research field. (author)

  7. Double layers and circuits in astrophysics

    International Nuclear Information System (INIS)

    Alfven, H.

    1986-05-01

    As the rate of energy release in a double layer with voltage DeltaV is P corresponding to IDeltaV, a double layer must be treated part of a circuit which delivers the current I. As neither double layer nor circuit can be derived from magnetofluid models of a plasma, such models are useless for treating energy transfer by menas of double layers. They must be replaced by particle models and circuit theory. A simple circuit is suggested which is applied to the energizing of auroroal particles, to solar flares, and to intergalactic double radio sources. Application to the heliospheric current systems leads to the prediction of two double layers on the sun's axis which may give radiations detectable from earth. Double layers in space should be classified as a new type of celestial object (one example is the double radio sources). It is tentatively suggested in X-ray and gamma-ray bursts may be due to exploding double layers (although annihilation is an alternative energy source). A study of how a number of the most used textbooks in astrophysics treat important concepts like double layers, critical velocity, pinch effects and circuits is made. It is found that students using these textbooks remain essentially ignorant of even the existence of these, in spite of the fact that some of them have been well known for half a centry (e.g., double layers, Langmuir, 1929: pinch effect, Bennet, 1934). The conclusion is that astrophysics is too important to be left in the hands of the astrophysicist. Earth bound and space telescope data must be treated by scientists who are familiar with laboratory and magnetospheric physics and circuit theory, and of course with modern plasma theory. At least by volume the universe consists to more than 99 percent of plasma, and electromagnetic forces are 10/sup39/ time stronger than gravitation

  8. A SEARCH FOR VERY HIGH ENERGY GAMMA RAYS FROM THE MISSING LINK BINARY PULSAR J1023+0038 WITH VERITAS

    Energy Technology Data Exchange (ETDEWEB)

    Aliu, E. [Department of Physics and Astronomy, Barnard College, Columbia University, NY 10027 (United States); Archambault, S. [Physics Department, McGill University, Montreal, QC H3A 2T8 (Canada); Archer, A.; Buckley, J. H.; Bugaev, V. [Department of Physics, Washington University, St. Louis, MO 63130 (United States); Benbow, W.; Cerruti, M. [Fred Lawrence Whipple Observatory, Harvard-Smithsonian Center for Astrophysics, Amado, AZ 85645 (United States); Bird, R. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Biteau, J. [Santa Cruz Institute for Particle Physics and Department of Physics, University of California, Santa Cruz, CA 95064 (United States); Buchovecky, M. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Byrum, K. [Argonne National Laboratory, 9700 S. Cass Avenue, Argonne, IL 60439 (United States); Cardenzana, J. V; Dickinson, H. J.; Eisch, J. D. [Department of Physics and Astronomy, Iowa State University, Ames, IA 50011 (United States); Chen, X. [Institute of Physics and Astronomy, University of Potsdam, D-14476 Potsdam-Golm (Germany); Ciupik, L. [Astronomy Department, Adler Planetarium and Astronomy Museum, Chicago, IL 60605 (United States); Connolly, M. P. [School of Physics, National University of Ireland Galway, University Road, Galway (Ireland); Cui, W.; Feng, Q. [Department of Physics and Astronomy, Purdue University, West Lafayette, IN 47907 (United States); Falcone, A., E-mail: ester.aliu.fuste@gmail.com, E-mail: gtrichards@gatech.edu, E-mail: masha.chernyakova@dcu.ie, E-mail: malloryr@gmail.com [Department of Astronomy and Astrophysics, 525 Davey Lab, Pennsylvania State University, University Park, PA 16802 (United States); and others

    2016-11-10

    The binary millisecond radio pulsar PSR J1023+0038 exhibits many characteristics similar to the gamma-ray binary system PSR B1259–63/LS 2883, making it an ideal candidate for the study of high-energy nonthermal emission. It has been the subject of multiwavelength campaigns following the disappearance of the pulsed radio emission in 2013 June, which revealed the appearance of an accretion disk around the neutron star. We present the results of very high energy (VHE) gamma-ray observations carried out by the Very Energetic Radiation Imaging Telescope Array System before and after this change of state. Searches for steady and pulsed emission of both data sets yield no significant gamma-ray signal above 100 GeV, and upper limits are given for both a steady and pulsed gamma-ray flux. These upper limits are used to constrain the magnetic field strength in the shock region of the PSR J1023+0038 system. Assuming that VHE gamma rays are produced via an inverse Compton mechanism in the shock region, we constrain the shock magnetic field to be greater than ∼2 G before the disappearance of the radio pulsar and greater than ∼10 G afterward.

  9. Fermi LAT Observations of LS I +61 303: First Detection of an Orbital Modulation in GeV Gamma Rays

    Energy Technology Data Exchange (ETDEWEB)

    Abdo, A.A.; /Federal City Coll. /Naval Research Lab, Wash., D.C.; Ackermann, M.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Ajello, M.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Atwood, W.B.; /UC, Santa Cruz; Axelsson, M.; /Stockholm U., OKC /Stockholm U.; Baldini, L.; /INFN, Pisa; Ballet, J.; /DAPNIA, Saclay; Barbiellini, G.; /INFN, Trieste /Trieste U.; Bastieri, D.; /INFN, Padua /Padua U.; Baughman, B.M.; /Ohio State U.; Bechtol, K.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bellazzini, R.; /INFN, Pisa; Berenji, B.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Blandford, R.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bloom, E.D.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bonamente, E.; /INFN, Perugia /Perugia U.; Borgland, A.W.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bregeon, J.; /INFN, Pisa; Brez, A.; /INFN, Pisa; Brigida, M.; /Bari U. /INFN, Bari; Bruel, P.; /Ecole Polytechnique /Washington U., Seattle /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /IASF, Milan /Milan Polytechnic /DAPNIA, Saclay /ASDC, Frascati /INFN, Perugia /Perugia U. /NASA, Goddard /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /DAPNIA, Saclay /Naval Research Lab, Wash., D.C. /George Mason U. /NASA, Goddard /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /INFN, Perugia /Perugia U. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Montpellier U. /Sonoma State U. /Stockholm U., OKC /Royal Inst. Tech., Stockholm /Stockholm U. /DAPNIA, Saclay /NASA, Goddard /CSST, Baltimore /ASDC, Frascati /Naval Research Lab, Wash., D.C. /INFN, Trieste /Pavia U. /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /UC, Santa Cruz /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /SLAC /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Grenoble, CEN; /more authors..

    2012-04-02

    This Letter presents the first results from the observations of LS I +61{sup o}303 using Large Area Telescope data from the Fermi Gamma-Ray Space Telescope between 2008 August and 2009 March. Our results indicate variability that is consistent with the binary period, with the emission being modulated at 26.6 {+-} 0.5 days. This constitutes the first detection of orbital periodicity in high-energy gamma rays (20 MeV-100 GeV, HE). The light curve is characterized by a broad peak after periastron, as well as a smaller peak just before apastron. The spectrum is best represented by a power law with an exponential cutoff, yielding an overall flux above 100 MeV of 0.82 {+-} 0.03(stat) {+-} 0.07(syst) 10{sup -6} ph cm{sup -2} s{sup -1}, with a cutoff at 6.3 {+-} 1.1(stat) {+-} 0.4(syst) GeV and photon index {Gamma} = 2.21 {+-} 0.04(stat) {+-} 0.06(syst). There is no significant spectral change with orbital phase. The phase of maximum emission, close to periastron, hints at inverse Compton scattering as the main radiation mechanism. However, previous very high-energy gamma ray (>100 GeV, VHE) observations by MAGIC and VERITAS show peak emission close to apastron. This and the energy cutoff seen with Fermi suggest that the link between HE and VHE gamma rays is nontrivial.

  10. Journal of Astrophysics and Astronomy

    Indian Academy of Sciences (India)

    27

    Indian Institute of Astrophysics, Koramangala 2nd Block, Bangalore. 560034, India .... the hydrogen rich thermosphere so significantly that the internal energy of the gas becomes greater than the gravitational potential energy. This leads ... way greenhouse, water vapor would reach the stratosphere where it would.

  11. Journal of Astrophysics and Astronomy

    Indian Academy of Sciences (India)

    65

    Northern IMF as simulated by PIC code in parallel with MHD model-Journal of Astrophysics ... The global structure of the collisionless bow shock was inves- tigated by ..... international research community, access to modern space science simulations. ...... LaTeX Font Info: Redeclaring math alphabet \\mathbf on input line 29.

  12. An introduction to nuclear astrophysics

    International Nuclear Information System (INIS)

    Norman, E.B.

    1987-09-01

    The role of nuclear reactions in astrophysics is described. Stellar energy generation and heavy element nucleosynthesis is explained in terms of specific sequences of charged-particle and neutron induced reactions. The evolution and final states of stars are examined. 20 refs. 11 figs., 2 tabs

  13. Nuclear astrophysics of light nuclei

    DEFF Research Database (Denmark)

    Fynbo, Hans Otto Uldall

    2013-01-01

    A review of nuclear astrophysics of light nuclei using radioactive beams or techniques developed for radioactive beams is given. We discuss Big Bang nucleosynthesis, with special focus on the lithium problem, aspects of neutrino-physics, helium-burning and finally selected examples of studies...

  14. Astronomy & Astrophysics: an international journal

    Science.gov (United States)

    Bertout, C.

    2011-07-01

    After a brief historical introduction, we review the scope, editorial process, and production organization of A&A, one of the leading journals worldwide dedicated to publishing the results of astrophysical research. We then briefly discuss the economic model of the Journal and some current issues in scientific publishing.

  15. Compressed Baryonic Matter of Astrophysics

    OpenAIRE

    Guo, Yanjun; Xu, Renxin

    2013-01-01

    Baryonic matter in the core of a massive and evolved star is compressed significantly to form a supra-nuclear object, and compressed baryonic matter (CBM) is then produced after supernova. The state of cold matter at a few nuclear density is pedagogically reviewed, with significant attention paid to a possible quark-cluster state conjectured from an astrophysical point of view.

  16. Electric Currents along Astrophysical Jets

    Directory of Open Access Journals (Sweden)

    Ioannis Contopoulos

    2017-10-01

    Full Text Available Astrophysical black holes and their surrounding accretion disks are believed to be threaded by grand design helical magnetic fields. There is strong theoretical evidence that the main driver of their winds and jets is the Lorentz force generated by these fields and their associated electric currents. Several researchers have reported direct evidence for large scale electric currents along astrophysical jets. Quite unexpectedly, their directions are not random as would have been the case if the magnetic field were generated by a magnetohydrodynamic dynamo. Instead, in all kpc-scale detections, the inferred electric currents are found to flow away from the galactic nucleus. This unexpected break of symmetry suggests that a battery mechanism is operating around the central black hole. In the present article, we summarize observational evidence for the existence of large scale electric currents and their associated grand design helical magnetic fields in kpc-scale astrophysical jets. We also present recent results of general relativistic radiation magnetohydrodynamic simulations which show the action of the Cosmic Battery in the vicinity of astrophysical black holes.

  17. Indirect methods in nuclear astrophysics

    International Nuclear Information System (INIS)

    Bertulani, C.A.; Shubhchintak; Mukhamedzhanov, A.; Kadyrov, A. S.; Kruppa, A.; Pang, D. Y.

    2016-01-01

    We discuss recent developments in indirect methods used in nuclear astrophysics to determine the capture cross sections and subsequent rates of various stellar burning processes, when it is difficult to perform the corresponding direct measurements. We discuss in brief, the basic concepts of Asymptotic Normalization Coefficients, the Trojan Horse Method, the Coulomb Dissociation Method, (d,p), and charge-exchange reactions. (paper)

  18. Astrophysics on the Lab Bench

    Science.gov (United States)

    Hughes, Stephen W.

    2010-01-01

    In this article some basic laboratory bench experiments are described that are useful for teaching high school students some of the basic principles of stellar astrophysics. For example, in one experiment, students slam a plastic water-filled bottle down onto a bench, ejecting water towards the ceiling, illustrating the physics associated with a…

  19. Nuclear astrophysics: An application of nuclear physics

    International Nuclear Information System (INIS)

    Fueloep, Z.

    2005-01-01

    Nuclear astrophysics, a fruitful combination of nuclear physics and astrophysics can be viewed as a special application of nuclear physics where the study of nuclei and their reactions are motivated by astrophysical problems. Nuclear astrophysics is also a good example for the state of the art interdisciplinary research. The origin of elements studied by geologists is explored by astrophysicists using nuclear reaction rates provided by the nuclear physics community. Due to the high interest in the field two recent Nuclear Physics Divisional Conferences of the European Physical Society were devoted to nuclear astrophysics and a new conference series entitled 'Nuclear Physics in Astrophysics' has been established. Selected problems of nuclear astrophysics will be presented emphasizing the interplay between nuclear physics and astrophysics. As an example the role of 14 N(p,r) 15 O reaction rate in the determination of the age of globular clusters will be discussed in details

  20. International Olympiad on Astronomy and Astrophysics

    Science.gov (United States)

    Soonthornthum, B.; Kunjaya, C.

    2011-01-01

    The International Olympiad on Astronomy and Astrophysics, an annual astronomy and astrophysics competition for high school students, is described. Examples of problems and solutions from the competition are also given. (Contains 3 figures.)

  1. Broad Band Observations of Gravitationally Lensed Blazar during a Gamma-Ray Outburst

    Directory of Open Access Journals (Sweden)

    Julian Sitarek

    2016-09-01

    Full Text Available QSO B0218+357 is a gravitationally lensed blazar located at a cosmological redshift of 0.944. In July 2014 a GeV flare was observed by Fermi-LAT, triggering follow-up observations with the MAGIC telescopes at energies above 100 GeV. The MAGIC observations at the expected time of arrival of the trailing component resulted in the first detection of QSO B0218+357 in Very-High-Energy (VHE, >100 GeV gamma rays. We report here the observed multiwavelength emission during the 2014 flare.

  2. The Explorer program for astronomy and astrophysics

    International Nuclear Information System (INIS)

    Savage, B.D.; Becklin, E.E.; Cassinelli, J.P.; Dupree, A.K.; Elliot, J.L.; Hoffmann, W.F.; Hudson, H.S.; Jura, M.; Kurfess, J.; Murray, S.S.

    1986-01-01

    This report was prepared to provide NASA with a strategy for proceeding with Explorer-class programs for research in space astronomy and astrophysics. The role of Explorers in astronomy and astrophysics and their past accomplishments are discussed, as are current and future astronomy and astrophysics Explorers. Specific cost needs for an effective Explorer program are considered

  3. The importance of CNO isotopes in astrophysics

    International Nuclear Information System (INIS)

    Audoze, J.

    1977-01-01

    The research into CNO isotopes in astrophysics includes many different subfields of astrophysics such as meteoretical studies, experimental and theoretical nuclear astrophysics, optical astronomy, radio astronomy, etc. The purpose of this paper is to give some overview of the topic and guideline among these different subfields. (G.T.H.)

  4. Probing the very-high-energy gamma-ray spectral curvature in the blazar PG 1553+113 with the MAGIC telescopes

    CERN Document Server

    Aleksić, J.; Antonelli, L A; Antoranz, P; Babic, A; Bangale, P; Barrio, J A; González, J Becerra; Bednarek, W; Bernardini, E; Biasuzzi, B; Biland, A; Blanch, O; Bonnefoy, S; Bonnoli, G; Borracci, F; Bretz, T; Carmona, E; Carosi, A; Colin, P; Colombo, E; Contreras, J.L; Cortina, J; Covino, S; Da Vela, P; Dazzi, F; De Angelis, A; De Caneva, G; De Lotto, B; Wilhelmi, E de Oña; Mendez, C Delgado; Prester, D Dominis; Dorner, D; Doro, M; Einecke, S; Eisenacher, D; Elsaesser, D; Fidalgo, D; Fonseca, M.V; Font, L; Frantzen, K; Fruck, C; Galindo, D; López, R J García; Garczarczyk, M; Terrats, D Garrido; Gaug, M; Godinović, N; Muñoz, A González; Gozzini, S R; Hadasch, D; Hanabata, Y; Hayashida, M; Herrera, J; Hose, J; Hrupec, D; Idec, W; Kadenius, V; Kellermann, H; Knoetig, M L; Kodani, K; Konno, Y; Krause, J; Kubo, H; Kushida, J; La Barbera, A; Lelas, D; Lewandowska, N; Lindfors, E; Lombardi, S; Longo, F; López, M; López-Coto, R; López-Oramas, A; Lorenz, E; Lozano, I; Makariev, M; Mallot, K; Maneva, G; Mannheim, K; Maraschi, L; Marcote, B; Mariotti, M; Martínez, M; Mazin, D; Menzel, U; Miranda, J M; Mirzoyan, R; Moralejo, A; Munar-Adrover, P; Nakajima, D; Neustroev, V; Niedzwiecki, A; Nilsson, K; Nishijima, K; Noda, K; Orito, R; Overkemping, A; Paiano, S; Palatiello, M; Paneque, D; Paoletti, R; Paredes, J M; Paredes-Fortuny, X; Persic, M; Poutanen, J; Moroni, P G Prada; Prandini, E; Puljak, I; Reinthal, R; Rhode, W; Ribó, M; Rico, J; Garcia, J Rodriguez; Rügamer, S; Saito, T; Saito, K; Satalecka, K; Scalzotto, V; Scapin, V; Schultz, C; Schweizer, T; Sillanpää, A; Sitarek, J; Snidaric, I; Sobczynska, D; Spanier, F; Stamerra, A; Steinbring, T; Storz, J; Strzys, M; Takalo, L; Takami, H; Tavecchio, F; Temnikov, P; Terzić, T; Tescaro, D; Teshima, M; Thaele, J; Tibolla, O; Torres, D F; Toyama, T; Treves, A; Vogler, P; Will, M; Zanin, R; D'Ammando, F; Lähteenmäki, A; Tornikoski, M; Hovatta, T; Readhead, A C S; Max-Moerbeck, W; Richards, J.L

    2015-01-01

    PG 1553+113 is a very-high-energy (VHE, E>100 GeV) gamma-ray emitter classified as a BL Lac object. Its redshift is constrained by intergalactic absorption lines in the range 0.40.2). The observed curvature is compatible with the extragalactic background light (EBL) imprint predicted by the current generation of EBL models assuming a redshift z~0.4. New constraints on the redshift were derived from the VHE spectrum. These constraints are compatible with previous limits and suggest that the source is most likely located around the optical lower limit, z=0.4. Finally, we find that the synchrotron self-Compton (SSC) model gives a satisfactory description of the observed multi-wavelength spectral energy distribution during the flare.

  5. Monopole, astrophysics and cosmic ray observatory at Gran Sasso

    International Nuclear Information System (INIS)

    Demarzo, C.; Enriquez, O.; Giglietto, N.

    1985-01-01

    A new large area detector, MACRO was approved for installation at the Gran Sasso Laboratory in Italy. The detector will be dedicated to the study of naturally penetrating radiation deep underground. It is designed with the general philosophy of covering the largest possible area with a detector having both sufficient built-in redundancy and use of complementary techniques to study very rare phenomena. The detector capabilities will include monopole investigations significantly below the Parker bound; astrophysics studies of very high energy gamma ray and neutrino point sources; cosmic ray measurements of single and multimuons; and the general observation of rare new forms of matter in the cosmic rays

  6. Monopole, astrophysics and cosmic ray observatory at Gran Sasso

    Science.gov (United States)

    Demarzo, C.; Enriquez, O.; Giglietto, N.; Posa, F.; Attolini, M.; Baldetti, F.; Giacomelli, G.; Grianti, F.; Margiotta, A.; Serra, P.

    1985-01-01

    A new large area detector, MACRO was approved for installation at the Gran Sasso Laboratory in Italy. The detector will be dedicated to the study of naturally penetrating radiation deep underground. It is designed with the general philosophy of covering the largest possible area with a detector having both sufficient built-in redundancy and use of complementary techniques to study very rare phenomena. The detector capabilities will include monopole investigations significantly below the Parker bound; astrophysics studies of very high energy gamma ray and neutrino point sources; cosmic ray measurements of single and multimuons; and the general observation of rare new forms of matter in the cosmic rays.

  7. Very-high-energy gamma-ray observations of the Type Ia Supernova SN 2014J with the MAGIC telescopes

    Science.gov (United States)

    Ahnen, M. L.; Ansoldi, S.; Antonelli, L. A.; Antoranz, P.; Arcaro, C.; Babic, A.; Banerjee, B.; Bangale, P.; Barres de Almeida, U.; Barrio, J. A.; Becerra González, J.; Bednarek, W.; Bernardini, E.; Berti, A.; Biasuzzi, B.; Biland, A.; Blanch, O.; Bonnefoy, S.; Bonnoli, G.; Borracci, F.; Bretz, T.; Carosi, R.; Carosi, A.; Chatterjee, A.; Colin, P.; Colombo, E.; Contreras, J. L.; Cortina, J.; Covino, S.; Cumani, P.; Da Vela, P.; Dazzi, F.; De Angelis, A.; De Lotto, B.; de Oña Wilhelmi, E.; Di Pierro, F.; Doert, M.; Domínguez, A.; Dominis Prester, D.; Dorner, D.; Doro, M.; Einecke, S.; Eisenacher Glawion, D.; Elsaesser, D.; Engelkemeier, M.; Fallah Ramazani, V.; Fernández-Barral, A.; Fidalgo, D.; Fonseca, M. V.; Font, L.; Frantzen, K.; Fruck, C.; Galindo, D.; García López, R. J.; Garczarczyk, M.; Garrido Terrats, D.; Gaug, M.; Giammaria, P.; Godinović, N.; Gora, D.; Guberman, D.; Hadasch, D.; Hahn, A.; Hayashida, M.; Herrera, J.; Hose, J.; Hrupec, D.; Hughes, G.; Idec, W.; Kodani, K.; Konno, Y.; Kubo, H.; Kushida, J.; La Barbera, A.; Lelas, D.; Lindfors, E.; Lombardi, S.; Longo, F.; López, M.; López-Coto, R.; Majumdar, P.; Makariev, M.; Mallot, K.; Maneva, G.; Manganaro, M.; Mannheim, K.; Maraschi, L.; Marcote, B.; Mariotti, M.; Martínez, M.; Mazin, D.; Menzel, U.; Miranda, J. M.; Mirzoyan, R.; Moralejo, A.; Moretti, E.; Nakajima, D.; Neustroev, V.; Niedzwiecki, A.; Nievas Rosillo, M.; Nilsson, K.; Nishijima, K.; Noda, K.; Nogués, L.; Paiano, S.; Palacio, J.; Palatiello, M.; Paneque, D.; Paoletti, R.; Paredes, J. M.; Paredes-Fortuny, X.; Pedaletti, G.; Peresano, M.; Perri, L.; Persic, M.; Poutanen, J.; Prada Moroni, P. G.; Prandini, E.; Puljak, I.; Garcia, J. R.; Reichardt, I.; Rhode, W.; Ribó, M.; Rico, J.; Saito, T.; Satalecka, K.; Schroeder, S.; Schweizer, T.; Sillanpää, A.; Sitarek, J.; Snidaric, I.; Sobczynska, D.; Stamerra, A.; Strzys, M.; Surić, T.; Takalo, L.; Tavecchio, F.; Temnikov, P.; Terzić, T.; Tescaro, D.; Teshima, M.; Torres, D. F.; Toyama, T.; Treves, A.; Vanzo, G.; Vazquez Acosta, M.; Vovk, I.; Ward, J. E.; Will, M.; Wu, M. H.; Zanin, R.

    2017-06-01

    Context. In this work we present data from observations with the MAGIC telescopes of SN 2014J detected on January 21 2014, the closest Type Ia supernova since Imaging Air Cherenkov Telescopes started to operate. Aims: We aim to probe the possibility of very-high-energy (VHE; E ≥ 100 GeV) gamma rays produced in the early stages of Type Ia supernova explosions. Methods: We performed follow-up observations after this supernova (SN) explosion for five days, between January 27 and February 2 2014. We searched for gamma-ray signals in the energy range between 100 GeV and several TeV from the location of SN 2014J using data from a total of 5.5 h of observations. Prospects for observing gamma rays of hadronic origin from SN 2014J in the near future are also being addressed. Results: No significant excess was detected from the direction of SN 2014J. Upper limits at 95% confidence level on the integral flux, assuming a power-law spectrum, dF/dE ∝ E- Γ, with a spectral index of Γ = 2.6, for energies higher than 300 GeV and 700 GeV, are established at 1.3 × 10-12 and 4.1 × 10-13 photons cm-2 s-1, respectively. Conclusions: For the first time, upper limits on the VHE emission of a Type Ia supernova are established. The energy fraction isotropically emitted into TeV gamma rays during the first 10 days after the supernova explosion for energies greater than 300 GeV is limited to 10-6 of the total available energy budget ( 1051 erg). Within the assumed theoretical scenario, the MAGIC upper limits on the VHE emission suggest that SN 2014J will not be detectable in the future by any current or planned generation of Imaging Atmospheric Cherenkov Telescopes.

  8. Hydrodynamic Instability, Integrated Code, Laboratory Astrophysics, and Astrophysics

    Science.gov (United States)

    Takabe, Hideaki

    2016-10-01

    This is an article for the memorial lecture of Edward Teller Medal and is presented as memorial lecture at the IFSA03 conference held on September 12th, 2003, at Monterey, CA. The author focuses on his main contributions to fusion science and its extension to astrophysics in the field of theory and computation by picking up five topics. The first one is the anomalous resisitivity to hot electrons penetrating over-dense region through the ion wave turbulence driven by the return current compensating the current flow by the hot electrons. It is concluded that almost the same value of potential as the average kinetic energy of the hot electrons is realized to prevent the penetration of the hot electrons. The second is the ablative stabilization of Rayleigh-Taylor instability at ablation front and its dispersion relation so-called Takabe formula. This formula gave a principal guideline for stable target design. The author has developed an integrated code ILESTA (ID & 2D) for analyses and design of laser produced plasma including implosion dynamics. It is also applied to design high gain targets. The third is the development of the integrated code ILESTA. The forth is on Laboratory Astrophysics with intense lasers. This consists of two parts; one is review on its historical background and the other is on how we relate laser plasma to wide-ranging astrophysics and the purposes for promoting such research. In relation to one purpose, I gave a comment on anomalous transport of relativistic electrons in Fast Ignition laser fusion scheme. Finally, I briefly summarize recent activity in relation to application of the author's experience to the development of an integrated code for studying extreme phenomena in astrophysics.

  9. Gamma-rays from decaying dark matter

    Energy Technology Data Exchange (ETDEWEB)

    Bertone, G. [Paris-6 Univ., 75 (France). Inst. d' Astrophysique; Buchmueller, W.; Covi, L.; Ibarra, A. [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany)

    2007-10-15

    We study the prospects for detecting gamma-rays from decaying Dark Matter (DM), focusing in particular on gravitino DM in R-parity breaking vacua. Given the substantially different angular distribution of the predicted gamma-ray signal with respect to the case of annihilating DM, and the relatively poor (of order 0.1 ) angular resolution of gamma-ray detectors, the best strategy for detection is in this case to look for an exotic contribution to the gamma-ray flux at high galactic latitudes, where the decaying DM contribution would resemble an astrophysical extragalactic component, similar to the one inferred by EGRET observations. Upcoming experiments such as GLAST and AMS-02 may identify this exotic contribution and discriminate it from astrophysical sources, or place significant constraints on the mass and lifetime of DM particles. (orig.)

  10. Multifragmentation model for astrophysical strangelets

    International Nuclear Information System (INIS)

    Biswas, Sayan; De, J.N.; Joarder, Partha S.; Raha, Sibaji; Syam, Debapriyo

    2012-01-01

    A model for the possible size distribution of astrophysical strangelets, that fragment out of the warm strange quark matter ejected during the merger of binary strange stars in the Galaxy, is presented here by invoking the statistical multifragmentation model. A simplified assumption of zero quark mass has been considered to obtain such mass-spectrum for the strangelets. An approximate estimate for the intensity of such strangelets in the galactic cosmic rays is also attempted by using a diffusion approximation.

  11. Ongoing Space Physics - Astrophysics Connections

    OpenAIRE

    Eichler, David

    2005-01-01

    I review several ongoing connections between space physics and astrophysics: a) Measurements of energetic particle spectra have confirmed theoretical prediction of the highest energy to which shocks can accelerate particles, and this has direct bearing on the origin of the highest energy cosmic rays. b) Mass ejection in solar flares may help us understand photon ejection in the giant flares of magnetar outbursts. c) Measurements of electron heat fluxes in the solar wind can help us understand...

  12. The INTErnational Gamma Ray Astrophysics Laboratory: INTEGRAL Highlights

    Energy Technology Data Exchange (ETDEWEB)

    Ubertini, Pietro, E-mail: pietro.ubertini@iaps.inaf.it; Bazzano, Angela

    2014-04-01

    The INTEGRAL Space Observatory was selected as the second Medium size mission (M2) of the ESAs Horizon 2000 vision programme. INTEGRAL is the first high angular and spectral resolution hard X-ray and soft γ-ray observatory with a wide band spectral response ranging from 3 keV up to 10 MeV energy band. This capability is supplemented by an unprecedented sensitivity enhanced by the 3 days orbit allowing long and uninterrupted observations over very wide field of view (up to ∼1000 squared degrees to zero response) and sub-ms time resolution. Part of the observatory success is due to its capability to link the high energy sky with the lower energy band. The complementarity and synergy with pointing soft X-ray missions such as XMM-Newton and CHANDRA and more recently with NuSTAR is a strategic feature to link the “thermal” and the “non-thermal” Universe observed at higher energies by space missions such as Fermi and AGILE and ground based TeV observatories sensitive to extremely high energies. INTEGRAL was launched on 17 October 2002 from the Baikonur Cosmodrome (Kazakistan) aboard a Proton rocket as part of the Russian contribution to the mission, and has successfully spent almost 11 years in orbit. In view of its successful science outcome the ESA Space Programme Committee haw recently approved its scientific operation till the end of 2016. To date the spacecraft, ground segment and scientific payload are in excellent state-of-health, and INTEGRAL is continuing its scientific operations, originally planned for a 5-year technical design and scientific nominal operation plan. This paper summarizes the current INTEGRAL scientific achievements and future prospects, with particular regard to the high energy domain.

  13. Some perspectives in nuclear astrophysics on non-thermal phenomena

    International Nuclear Information System (INIS)

    Tatischeff, V.

    2012-01-01

    In this HDR (Accreditation to Supervise Researches) report, the author presents and comments his research activities on nuclear phenomena in stellar eruptions (solar eruptions, lithium nucleosynthesis in stellar eruptions), on particle acceleration in shock waves of stellar explosions (diffusive acceleration by shock wave, particle acceleration in symbiotic novae, particle acceleration in radio-detected supernovae), of research on low energy cosmic rays (galactic emission of nuclear gamma rays, non thermal soft X rays as new tracer of accelerated particles), and on the origin of short period radioactivities in the primitive solar system (extinguished radio-activities and formation of the solar system, origin of berylium-10 in the primitive solar system). The author concludes with some perspectives on non thermal phenomena in nuclear astrophysics, and on research and development for the future of medium-energy gamma astronomy [fr

  14. Rounding Up the Astrophysical Weeds

    Science.gov (United States)

    McMillan, James P.

    2016-09-01

    New instruments used for astronomy such as ALMA, Herschel, and SOFIA have greatly increased the quality of available astrophysical data. These improved data contain spectral lines and features which are not accounted for in the quantum mechanical (QM) catalogs. A class of molecules has been identified as being particularly problematic, the so-called "weeds". These molecules have numerous transitions, of non-trivial intensity, which are difficult to model due to highly perturbed low lying vibrational states. The inability to properly describe the complete contribution of these weeds to the astrophysical data has led directly to the misidentification of other target molecules. Ohio State's Microwave Laboratory has developed an alternative approach to this problem. Rather than relying on complex QM calculations, we have developed a temperature dependent approach to laboratory based terahertz spectroscopy. We have developed a set of simple packages, in addition to traditional line list catalogs, that enable astronomers to successfully remove the weed signals from their data. This dissertation will detail my laboratory work and analysis of three keys weeds: methanol, methyl formate and methyl cyanide. Also, discussed will be the analytical technique I used to apply these laboratory results to astrophysical data.

  15. GAMMA-RAY SIGNAL FROM THE PULSAR WIND IN THE BINARY PULSAR SYSTEM PSR B1259-63/LS 2883

    Energy Technology Data Exchange (ETDEWEB)

    Khangulyan, Dmitry [Institute of Space and Astronautical Science/JAXA, 3-1-1 Yoshinodai, Chuo-ku, Sagamihara, Kanagawa 252-5210 (Japan); Aharonian, Felix A. [Dublin Institute for Advanced Studies, 31 Fitzwilliam Place, Dublin 2 (Ireland); Bogovalov, Sergey V. [National Research Nuclear University-MEPHI, Kashirskoe Shosse 31, Moscow 115409 (Russian Federation); Ribo, Marc, E-mail: khangul@astro.isas.jaxa.jp, E-mail: felix.aharonian@dias.ie, E-mail: svbogovalov@mephi.ru, E-mail: mribo@am.ub.es [Departament d' Astronomia i Meteorologia, Institut de Ciences del Cosmos (ICC), Universitat de Barcelona (IEEC-UB), Marti i Franques 1, E-08028 Barcelona (Spain)

    2011-12-01

    Binary pulsar systems emit potentially detectable components of gamma-ray emission due to Comptonization of the optical radiation of the companion star by relativistic electrons of the pulsar wind, both before and after termination of the wind. The recent optical observations of binary pulsar system PSR B1259-63/LS 2883 revealed radiation properties of the companion star which differ significantly from previous measurements. In this paper, we study the implications of these observations for the interaction rate of the unshocked pulsar wind with the stellar photons and the related consequences for fluxes of high energy and very high energy (VHE) gamma rays. We show that the signal should be strong enough to be detected with Fermi close to the periastron passage, unless the pulsar wind is strongly anisotropic or the Lorentz factor of the wind is smaller than 10{sup 3} or larger than 10{sup 5}. The higher luminosity of the optical star also has two important implications: (1) attenuation of gamma rays due to photon-photon pair production and (2) Compton drag of the unshocked wind. While the first effect has an impact on the light curve of VHE gamma rays, the second effect may significantly decrease the energy available for particle acceleration after termination of the wind.

  16. FERMI LAT OBSERVATIONS OF LS I +610303: FIRST DETECTION OF AN ORBITAL MODULATION IN GeV GAMMA RAYS

    International Nuclear Information System (INIS)

    Abdo, A. A.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Blandford, R.; Bloom, E. D.; Borgland, A. W.; Atwood, W. B.; Axelsson, M.; Baldini, L.; Bellazzini, R.; Bregeon, J.; Brez, A.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Baughman, B. M.; Bonamente, E.; Brigida, M.

    2009-01-01

    This Letter presents the first results from the observations of LS I +61 0 303 using Large Area Telescope data from the Fermi Gamma-Ray Space Telescope between 2008 August and 2009 March. Our results indicate variability that is consistent with the binary period, with the emission being modulated at 26.6 ± 0.5 days. This constitutes the first detection of orbital periodicity in high-energy gamma rays (20 MeV-100 GeV, HE). The light curve is characterized by a broad peak after periastron, as well as a smaller peak just before apastron. The spectrum is best represented by a power law with an exponential cutoff, yielding an overall flux above 100 MeV of 0.82 ± 0.03(stat) ± 0.07(syst) 10 -6 ph cm -2 s -1 , with a cutoff at 6.3 ± 1.1(stat) ± 0.4(syst) GeV and photon index Γ = 2.21 ± 0.04(stat) ± 0.06(syst). There is no significant spectral change with orbital phase. The phase of maximum emission, close to periastron, hints at inverse Compton scattering as the main radiation mechanism. However, previous very high-energy gamma ray (>100 GeV, VHE) observations by MAGIC and VERITAS show peak emission close to apastron. This and the energy cutoff seen with Fermi suggest that the link between HE and VHE gamma rays is nontrivial.

  17. Very-high-energy gamma-ray observations of pulsar wind nebulae and cataclysmic variable stars with MAGIC and development of trigger systems for IACTs

    Science.gov (United States)

    Lopez-Coto, Ruben

    2015-07-01

    The history of astronomy is as ancient as the reach of our written records. All the human civilizations have been interested in the study and interpretation of the night sky and its objects and phenomena. These observations were performed with the naked eye until the beginning of the 17th century, when Galileo Galilei started to use an instrument recently developed called telescope. Since then, the range of accessible wavelengths has been increasing, with a burst in the 20th century with the developing of instruments to observe them: antennas (radio and submillimeter), telescopes (optical, IR) and satellites (UV, X-rays and soft gamma rays). The last wavelength range accessed was the Very-High-Energy (VHE) gamma rays. At this range fluxes are so low that it is not possible to use space-based instruments with typical collection areas of O(1) m2. We must resort to the imaging atmospheric Cherenkov technique, which is based on the detection of the flashes of Cherenkov light that VHE gamma rays produce when they interact with the Earth's atmosphere. The field is very young, with the first source discovered in 1989 by the pioneering Whipple telescope. It is very dynamic with more than 150 sources detected to date, most of them by MAGIC, HESS and VERITAS, that make up the current generation of instruments. Finally, the field is also very promising, with the preparation of a next generation of imaging atmospheric Cherenkov telescopes: CTA, that is expected to start full operation in 2020. The work presented in this thesis comprises my efforts to take the ground-based γ-ray astronomy one step forward. Part I of the thesis is an introduction to the non- thermal universe, the imaging atmospheric Cherenkov technique and the Imaging Atmospheric Cherenkov Telescopes (IACTs) MAGIC and CTA. Part II deals with several ways to reduce the trigger threshold of IACTs. This includes the simula- tion, characterization and test of an analog trigger especially designed to achieve the

  18. sup 4 sup 4 Ti atom counting for nuclear astrophysics

    CERN Document Server

    Hui, S K; Berkovits, D; Boaretto, E; Ghelberg, S; Hass, M; Hershkowitz, A; Navon, E

    2000-01-01

    The nuclide sup 4 sup 4 Ti (T sub 1 sub / sub 2 =59.2 yr) has recently become an important asset to nuclear astrophysics through the measurement of its cosmic radioactivity, yielding significant information on fresh sup 4 sup 4 Ti nucleosynthesis in supernovae. We propose to use AMS to determine the production rate of sup 4 sup 4 Ti by the main channel believed to be responsible for sup 4 sup 4 Ti astrophysical production, namely sup 4 sup 0 Ca(alpha,gamma). A preliminary experiment conducted at the Koffler 14UD Pelletron accelerator demonstrates a sensitivity of 1x10 sup - sup 1 sup 4 for the sup 4 sup 4 Ti/Ti ratio. The AMS detection was performed using sup 4 sup 4 Ti sup - ions sputtered from a TiO sub 2 sample, reducing considerably the sup 4 sup 4 Ca isobaric interference. The present limit corresponds effectively to sup 4 sup 4 Ti production with resonance strength in the range 10-100 meV for a one-day sup 4 sup 0 Ca(alpha,gamma) activation. Several such resonances are known to be responsible for sup 4 ...

  19. INTEGRAL and XMM-Newton observations of the weak gamma-ray burst GRB 030227

    DEFF Research Database (Denmark)

    Mereghetti, S.; Gotz, D.; Tiengo, A.

    2003-01-01

    We present International Gamma-Ray Astrophysical Laboratory ( INTEGRAL) and XMM-Newton observations of the prompt gamma-ray emission and the X-ray afterglow of GRB 030227, the first gamma-ray burst for which the quick localization obtained with the INTEGRAL Burst Alert System has led...

  20. Decay Spectroscopy for Nuclear Astrophysics: {beta}-delayed Proton Decay

    Energy Technology Data Exchange (ETDEWEB)

    Trache, L.; Simmons, E.; Spiridon, A.; McCleskey, M.; Roeder, B. T.; Tribble, R. E. [Texas A and M University, College Station, TX 77845 (United States); Saastamoinen, A.; Jokinen, A.; Aysto, J. [University of Jyvaskyla, Jyvaskyla (Finland); Davinson, T.; Woods, P. J. [University of Edinburgh, Edinburgh (United Kingdom); Pollacco, E.; Kebbiri, M. [CEA/IRFU Saclay (France); Pascovici, G. [IKP, Universitaet zu Koeln (Germany)

    2011-11-30

    Decay spectroscopy is one of the oldest indirect methods in nuclear astrophysics. We have developed at TAMU techniques to measure beta- and beta-delayed proton decay of sd-shell, proton-rich nuclei. The short-lived radioactive species are produced in-flight, separated, then slowed down (from about 40 MeV/u) and implanted in the middle of very thin Si detectors. These allowed us to measure protons with energies as low as 200 keV from nuclei with lifetimes of 100 ms or less. At the same time we measure gamma-rays up to 8 MeV with high resolution HPGe detectors. We have studied the decay of {sup 23}Al, {sup 27}P, {sup 31}Cl, all important for understanding explosive H-burning in novae. The technique has shown a remarkable selectivity to beta-delayed charged-particle emission and works even at radioactive beam rates of a few pps. The states populated are resonances for the radiative proton capture reactions {sup 22}Na(p,{gamma}){sup 23}Mg(crucial for the depletion of {sup 22}Na in novae), {sup 26m}Al(p,{gamma}){sup 27}Si and {sup 30}P(p,{gamma}){sup 31}S(bottleneck in novae and XRB burning), respectively. More recently we have radically improved the technique using a gas based detector we call AstroBox.

  1. Investigations of astrophysically interesting nuclear reactions by the use of gas target techniques

    Energy Technology Data Exchange (ETDEWEB)

    Hammer, J W [Inst. fuer Strahlenphysik, Univ. Stuttgart, Stuttgart (Germany)

    1998-06-01

    A brief review of the common properties of windowless and recirculating gas targets is presented. As example the Stuttgart gas target facility Rhinoceros in the extended and in the supersonic jet mode with its properties and techniques is explained, also with respect to gas purification techniques. Furthermore several typical experiments from the field of nuclear astrophysics with characteristic results are described (D({alpha},{gamma}){sup 6}Li, {sup 15}N({alpha},{gamma}){sup 19}F, {sup 16}O(p,{gamma}){sup 17}F, {sup 16}O({alpha},{gamma}){sup 20}Ne, {sup 20}Ne({alpha},{gamma}){sup 24}Mg, {sup 21}Ne({alpha},n){sup 24}Mg, {sup 18}O({alpha},n){sup 21}Ne, {sup 17}O({alpha},n){sup 20}Ne). In several cases the experimental sensitivity could be raised by up to a factor of 10{sup 6}. (orig.)

  2. Dark matter: the astrophysical case

    International Nuclear Information System (INIS)

    Silk, J.

    2012-01-01

    The identification of dark matter is one of the most urgent problems in cosmology. I describe the astrophysical case for dark matter, from both an observational and a theoretical perspective. This overview will therefore focus on the observational motivations rather than the particle physics aspects of dark matter constraints on specific dark matter candidates. First, however, I summarize the astronomical evidence for dark matter, then I highlight the weaknesses of the standard cold dark matter model (LCDM) to provide a robust explanation of some observations. The greatest weakness in the dark matter saga is that we have not yet identified the nature of dark matter itself

  3. Nuclear astrophysics with indirect methods

    International Nuclear Information System (INIS)

    Shubhchintak

    2016-01-01

    In the area of astrophysics, it is well known that several different type of nuclear reactions are involved in the production of elements and for energy generation in stars. The knowledge of rates and cross section of these reactions is necessary in order to understand the origin of elements in the universe. Particularly, interests are there in the processes like pp-chain, CNO cycle, r-process and s-process, which are responsible for the formation of majority of the nuclei via various reactions like (p, γ), (n, γ), (α, γ) etc

  4. A directional gamma-ray detector based on scintillator plates

    Energy Technology Data Exchange (ETDEWEB)

    Hanna, D., E-mail: hanna@physics.mcgill.ca; Sagnières, L.; Boyle, P.J.; MacLeod, A.M.L.

    2015-10-11

    A simple device for determining the azimuthal location of a source of gamma radiation, using ideas from astrophysical gamma-ray burst detection, is described. A compact and robust detector built from eight identical modules, each comprising a plate of CsI(Tl) scintillator coupled to a photomultiplier tube, can locate a point source of gamma rays with degree-scale precision by comparing the count rates in the different modules. Sensitivity to uniform environmental background is minimal.

  5. A new method for the reconstruction of very-high-energy gamma-ray spectra and application to galatic cosmic-ray accelerators

    Energy Technology Data Exchange (ETDEWEB)

    Fernandes, Milton Virgilio

    2014-09-15

    previously reported, but unidentified extended TeV γ-ray source HESSJ1614-518. Unpublished H.E.S.S. data and archival multi-wavelength (MWL) data (radio, X-ray, and He data) as well various astrophysical objects in the FoV were investigated in search of a counterpart. The energy-dependent TeV morphology (with at least two source regions) can hardly be reconciled with the MWL data. A SC-wind scenario appears unlikely and the FoV lacks plausible counterpart, but a relic pulsar wind nebula could explain the lack of prominent X-ray emission. The VHE γ-ray source remains unidentified. The analysis of unpublished H.E.S.S. data on the SFR the Gould Belt (GB) did not provide any firm evidence of VHE γ-ray emission, and upper limits on the flux and the cosmic-ray enhancement were derived. The analysis of current IACTs. Towards Orion A, a possible discovery of extended VHE γ rays with flux of 10.8 % of the Crab Nebula is found with TBS, but cannot be confirmed and could be an artifact od the analysis of this region. Observations with the H.E.S.S. telescope system motivate that SCs and SFRs can accelerate GCRs. However, further H.E.S.S. observations are needed for further morphological and spectral studies. Also, more X-ray observations (in the case of HESSJ1614-518) and further studies on the background-estimation methods and their systematics (in the case of the GB) are required.

  6. A new method for the reconstruction of very-high-energy gamma-ray spectra and application to galatic cosmic-ray accelerators

    International Nuclear Information System (INIS)

    Fernandes, Milton Virgilio

    2014-09-01

    previously reported, but unidentified extended TeV γ-ray source HESSJ1614-518. Unpublished H.E.S.S. data and archival multi-wavelength (MWL) data (radio, X-ray, and He data) as well various astrophysical objects in the FoV were investigated in search of a counterpart. The energy-dependent TeV morphology (with at least two source regions) can hardly be reconciled with the MWL data. A SC-wind scenario appears unlikely and the FoV lacks plausible counterpart, but a relic pulsar wind nebula could explain the lack of prominent X-ray emission. The VHE γ-ray source remains unidentified. The analysis of unpublished H.E.S.S. data on the SFR the Gould Belt (GB) did not provide any firm evidence of VHE γ-ray emission, and upper limits on the flux and the cosmic-ray enhancement were derived. The analysis of current IACTs. Towards Orion A, a possible discovery of extended VHE γ rays with flux of 10.8 % of the Crab Nebula is found with TBS, but cannot be confirmed and could be an artifact od the analysis of this region. Observations with the H.E.S.S. telescope system motivate that SCs and SFRs can accelerate GCRs. However, further H.E.S.S. observations are needed for further morphological and spectral studies. Also, more X-ray observations (in the case of HESSJ1614-518) and further studies on the background-estimation methods and their systematics (in the case of the GB) are required.

  7. Nuclear physics in astrophysics. Part 2. Abstracts

    International Nuclear Information System (INIS)

    Gyuerky, Gy.; Fueloep, Zs.

    2005-01-01

    The proceedings of the 20. International Nuclear Physics Divisional Conference of the European Physical Society covers a wide range of topics in nuclear astrophysics. The topics addressed are big bang nucleosynthesis, stellar nucleosynthesis, measurements and nuclear data for astrophysics, nuclear structure far from stability, neutrino physics, and rare-ion-beam facilities and experiments. The perspectives of nuclear physics and astrophysics are also overviewed. 77 items are indexed separately for the INIS database. (K.A.)

  8. High Energy Astrophysics Science Archive Research Center

    Data.gov (United States)

    National Aeronautics and Space Administration — The High Energy Astrophysics Science Archive Research Center (HEASARC) is the primary archive for NASA missions dealing with extremely energetic phenomena, from...

  9. Technology Development for AGIS (Advanced Gamma-ray Imaging System).

    Science.gov (United States)

    Krennrich, Frank

    2008-04-01

    Next-generation arrays of atmospheric Cherenkov telescopes are at the conceptual planning stage and each could consist of on the order of 100 telescopes. The two currently-discussed projects AGIS in the US and CTA in Europe, have the potential to achieve an order of magnitude better sensitivity for Very High Energy (VHE) gamma-ray observations over state-to-the-art observatories. These projects require a substantial increase in scale from existing 4-telescope arrays such as VERITAS and HESS. The optimization of a large array requires exploring cost reduction and research and development for the individual elements while maximizing their performance as an array. In this context, the technology development program for AGIS will be discussed. This includes developing new optical designs, evaluating new types of photodetectors, developing fast trigger systems, integrating fast digitizers into highly-pixilated cameras, and reliability engineering of the individual components.

  10. TEV GAMMA-RAY OBSERVATIONS OF THE GALACTIC CENTER RIDGE BY VERITAS

    Energy Technology Data Exchange (ETDEWEB)

    Archer, A.; Buckley, J. H.; Bugaev, V. [Department of Physics, Washington University, St. Louis, MO 63130 (United States); Benbow, W.; Cerruti, M. [Fred Lawrence Whipple Observatory, Harvard-Smithsonian Center for Astrophysics, Amado, AZ 85645 (United States); Bird, R.; Collins-Hughes, E. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Buchovecky, M. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Byrum, K. [Argonne National Laboratory, 9700 S. Cass Avenue, Argonne, IL 60439 (United States); Cardenzana, J. V; Eisch, J. D. [Department of Physics and Astronomy, Iowa State University, Ames, IA 50011 (United States); Chen, X. [Institute of Physics and Astronomy, University of Potsdam, D-14476 Potsdam-Golm (Germany); Ciupik, L. [Astronomy Department, Adler Planetarium and Astronomy Museum, Chicago, IL 60605 (United States); Connolly, M. P. [School of Physics, National University of Ireland Galway, University Road, Galway (Ireland); Falcone, A. [Department of Astronomy and Astrophysics, 525 Davey Lab, Pennsylvania State University, University Park, PA 16802 (United States); Feng, Q.; Finley, J. P. [Department of Physics and Astronomy, Purdue University, West Lafayette, IN 47907 (United States); Fleischhack, H. [DESY, Platanenallee 6, D-15738 Zeuthen (Germany); Flinders, A. [Department of Physics and Astronomy, University of Utah, Salt Lake City, UT 84112 (United States); Fortson, L., E-mail: asmith44@umd.edu [School of Physics and Astronomy, University of Minnesota, Minneapolis, MN 55455 (United States); and others

    2016-04-20

    The Galactic Center ridge has been observed extensively in the past by both GeV and TeV gamma-ray instruments revealing a wealth of structure, including a diffuse component and the point sources G0.9+0.1 (a composite supernova remnant) and Sgr A* (believed to be associated with the supermassive black hole located at the center of our Galaxy). Previous very high energy (VHE) gamma-ray observations with the H.E.S.S. experiment have also detected an extended TeV gamma-ray component along the Galactic plane in the >300 GeV gamma-ray regime. Here we report on observations of the Galactic Center ridge from 2010 to 2014 by the VERITAS telescope array in the >2 TeV energy range. From these observations we (1) provide improved measurements of the differential energy spectrum for Sgr A* in the >2 TeV gamma-ray regime, (2) provide a detection in the >2 TeV gamma-ray emission from the composite SNR G0.9+0.1 and an improved determination of its multi-TeV gamma-ray energy spectrum, and (3) report on the detection of VER J1746-289, a localized enhancement of >2 TeV gamma-ray emission along the Galactic plane.

  11. Recent astrophysical applications of the Trojan Horse Method to nuclear astrophysics

    International Nuclear Information System (INIS)

    Spitaleri, C.; Cherubini, S.; Crucilla, V.; Gulino, M.; La Cognata, M.; Lamia, L.; Pizzone, R. G.; Puglia, S. M. R.; Rapisarda, G. G.; Romano, S.; Sergi, M. L.; Tumino, A.; Fu, C.; Tribble, R.; Banu, A.; Al-Abdullah, T.; Goldberg, V.; Mukhamedzhanov, A.; Tabacaru, G.; Trache, L.

    2008-01-01

    The Trojan Horse Method (THM) is an unique indirect technique allowing to measure astrophysical rearrangement reactions down to astrophysical relevant energies. The basic principle and a review of the recent applications of the Trojan Horse Method are presented. The applications aiming to the extraction of the bare astrophysical S b (E) for some two-body processes are discussed

  12. Relation of astrophysical turbulence and magnetic reconnection

    Energy Technology Data Exchange (ETDEWEB)

    Lazarian, A. [Department of Astronomy, University of Wisconsin, 475 North Charter Street, Madison, Wisconsin 53706 (United States); Eyink, Gregory L. [Department of Applied Mathematics and Statistics, Johns Hopkins University, Baltimore, Maryland 21218 (United States); Vishniac, E. T. [Department of Physics and Astronomy, McMaster University, 1280 Main Street West, Hamilton, Ontario L8S 4M1 (Canada)

    2012-01-15

    Astrophysical fluids are generically turbulent and this must be taken into account for most transport processes. We discuss how the preexisting turbulence modifies magnetic reconnection and how magnetic reconnection affects the MHD turbulent cascade. We show the intrinsic interdependence and interrelation of magnetic turbulence and magnetic reconnection, in particular, that strong magnetic turbulence in 3D requires reconnection and 3D magnetic turbulence entails fast reconnection. We follow the approach in Eyink et al.[Astrophys. J. 743, 51 (2011)] to show that the expressions of fast magnetic reconnection in A. Lazarian and E. T. Vishniac [Astrophys. J. 517, 700 (1999)] can be recovered if Richardson diffusion of turbulent flows is used instead of ordinary Ohmic diffusion. This does not revive, however, the concept of magnetic turbulent diffusion which assumes that magnetic fields can be mixed up in a passive way down to a very small dissipation scales. On the contrary, we are dealing the reconnection of dynamically important magnetic field bundles which strongly resist bending and have well defined mean direction weakly perturbed by turbulence. We argue that in the presence of turbulence the very concept of flux-freezing requires modification. The diffusion that arises from magnetic turbulence can be called reconnection diffusion as it based on reconnection of magnetic field lines. The reconnection diffusion has important implications for the continuous transport processes in magnetized plasmas and for star formation. In addition, fast magnetic reconnection in turbulent media induces the First order Fermi acceleration of energetic particles, can explain solar flares and gamma ray bursts. However, the most dramatic consequence of these developments is the fact that the standard flux freezing concept must be radically modified in the presence of turbulence.

  13. Space astronomy and astrophysics program by NASA

    Science.gov (United States)

    Hertz, Paul L.

    2014-07-01

    The National Aeronautics and Space Administration recently released the NASA Strategic Plan 20141, and the NASA Science Mission Directorate released the NASA 2014 Science Plan3. These strategic documents establish NASA's astrophysics strategic objectives to be (i) to discover how the universe works, (ii) to explore how it began and evolved, and (iii) to search for life on planets around other stars. The multidisciplinary nature of astrophysics makes it imperative to strive for a balanced science and technology portfolio, both in terms of science goals addressed and in missions to address these goals. NASA uses the prioritized recommendations and decision rules of the National Research Council's 2010 decadal survey in astronomy and astrophysics2 to set the priorities for its investments. The NASA Astrophysics Division has laid out its strategy for advancing the priorities of the decadal survey in its Astrophysics 2012 Implementation Plan4. With substantial input from the astrophysics community, the NASA Advisory Council's Astrophysics Subcommittee has developed an astrophysics visionary roadmap, Enduring Quests, Daring Visions5, to examine possible longer-term futures. The successful development of the James Webb Space Telescope leading to a 2018 launch is an Agency priority. One important goal of the Astrophysics Division is to begin a strategic mission, subject to the availability of funds, which follows from the 2010 decadal survey and is launched after the James Webb Space Telescope. NASA is studying a Wide Field Infrared Survey Telescope as its next large astrophysics mission. NASA is also planning to partner with other space agencies on their missions as well as increase the cadence of smaller Principal Investigator led, competitively selected Astrophysics Explorers missions.

  14. Separation of gamma and hadron initiated air showers with energies between 20 and 500 TeV

    Energy Technology Data Exchange (ETDEWEB)

    Arqueros, F. [Universidad Complutense de Madrid (Spain). Facultad de Ciencias Fisicas; Karle, A. [Max-Planck-Institut fuer Physik, Muenchen (Germany); Lorenz, E. [Max-Planck-Institut fuer Physik, Muenchen (Germany); Martinez, S. [Universidad Complutense de Madrid (Spain). Facultad de Ciencias Fisicas; Plaga, R. [Max-Planck-Institut fuer Physik, Muenchen (Germany); Rozanska, M. [Institute of Nuclear Physics, Cracow (Poland)

    1994-04-24

    The discrimination between air showers initiated by {gamma} rays and by hadrons is one of the fundamental problems in experimental cosmic-ray physics. The physics of this `{gamma}/hadron separation` is discussed in this paper. We restrict ourselves to the energy range from about 20 to 500 TeV, and take only the information contained in the lateral Cerenkov light distribution and the number of electrons at the detector level into consideration. An understanding of the differences between air showers generated by {gamma} rays and those due to hadrons leads us to formulate suitable observables for the separation process. Angle integrating Cerenkov arrays (AICA) offer a promising new approach to ground-based {gamma}-ray astronomy in the energy region from about 20 to 500 TeV. In order to establish this technique, an efficient suppression of the overwhelming hadronic background radiation is required. As an example for our general discussion, we present one method for {gamma}/hadron separation in AICAs called ``LES``. It is based on the simultaneous determination of the shower size and some characteristic parameters of the lateral distribution of the Cerenkov light. The potential inherent within this technique is demonstrated in quantitative detail for the existing ``AIROBICC`` AICA. We also propose an objective measure of the intrinsic sensitivity of a detection scheme in ground-based {gamma}-ray astronomy, the ``reduced quality factor``. It is shown that AICAs may reach a sensitivity to {gamma}-ray point sources in the high VHE range similar to that of the Cerenkov-telescope imaging technique in the low VHE region. (orig.)

  15. Self-Organized Criticality in Astrophysics The Statistics of Nonlinear Processes in the Universe

    CERN Document Server

    Aschwanden, Markus

    2011-01-01

    The concept of ‘self-organized criticality’ (SOC) has been applied to a variety of problems, ranging from population growth and traffic jams to earthquakes, landslides and forest fires. The technique is now being applied to a wide range of phenomena in astrophysics, such as planetary magnetospheres, solar flares, cataclysmic variable stars, accretion disks, black holes and gamma-ray bursts, and also to phenomena in galactic physics and cosmology. Self-organized Criticality in Astrophysics introduces the concept of SOC and shows that, due to its universality and ubiquity, it is a law of nature. The theoretical framework and specific physical models are described, together with a range of applications in various aspects of astrophyics. The mathematical techniques, including the statistics of random processes, time series analysis, time scale and waiting time distributions, are presented and the results are applied to specific observations of astrophysical phenomena.

  16. Massive magnetic monopoles in cosmology and astrophysics

    International Nuclear Information System (INIS)

    Kolb, E.W.

    1984-01-01

    The astrophysical and cosmological consequences of magnetic monopoles are discussed. The production of monopoles during phase transition in the early universe is addressed, and proposals which have been made to alleviate the monopole problem are summarized. Astrophysical limits on galactic magnetic monopoles are discussed along with experimental efforts to detect monopoles. Finally, monopole-induced proton decay is addressed. 48 references

  17. Highlights of modern astrophysics: Concepts and controversies

    International Nuclear Information System (INIS)

    Shapiro, S.L.; Teukolsky, V.

    1986-01-01

    In this book, physicists and astronomers review issues in astrophysics. The book stresses accomplishments of observational and theoretical work, and demonstrates how to reveal information about stars and galaxies by applying the basic principles of physics. It pinpoints conflicting views and findings on important topics and indicates possibilities for future research in the field of modern astrophysics

  18. Astrophysics with small satellites in Scandinavia

    DEFF Research Database (Denmark)

    Lund, Niels

    2003-01-01

    The small-satellites activities in the Scandinavian countries are briefly surveyed with emphasis on astrophysics research. (C) 2002 COSPAR. Published by Elsevier Science Ltd. All rights reserved.......The small-satellites activities in the Scandinavian countries are briefly surveyed with emphasis on astrophysics research. (C) 2002 COSPAR. Published by Elsevier Science Ltd. All rights reserved....

  19. The Advanced Gamma-Ray Imaging System (AGIS)

    Science.gov (United States)

    Otte, Nepomuk

    The Advanced Gamma-ray Imaging System (AGIS) is a concept for the next generation of imag-ing atmospheric Cherenkov telescope arrays. It has the goal of providing an order of magnitude increase in sensitivity for Very High Energy Gamma-ray ( 100 GeV to 100 TeV) astronomy compared to currently operating arrays such as CANGAROO, HESS, MAGIC, and VERITAS. After an overview of the science such an array would enable, we discuss the development of the components of the telescope system that are required to achieve the sensitivity goal. AGIS stresses improvements in several areas of IACT technology including component reliability as well as exploring cost reduction possibilities in order to achieve its goal. We discuss alterna-tives for the telescopes and positioners: a novel Schwarzschild-Couder telescope offering a wide field of view with a relatively smaller plate scale, and possibilities for rapid slewing in order to address the search for and/or study of Gamma-ray Bursts in the VHE gamma-ray regime. We also discuss options for a high pixel count camera system providing the necessary finer solid angle per pixel and possibilities for a fast topological trigger that would offer improved realtime background rejection and lower energy thresholds.

  20. Demographics in Astronomy and Astrophysics

    Science.gov (United States)

    Ulvestad, James S.

    2011-05-01

    Astronomy has been undergoing a significant demographic shift over the last several decades, as shown by data presented in the 2000 National Research Council (NRC) report "Federal Funding of Astronomical Research," and the 2010 NRC report, "New Worlds, New Horizons in Astronomy and Astrophysics." For example, the number of advertised postdoctoral positions in astronomy has increased much more rapldly than the number of faculty positions, contributing to a holding pattern of early-career astronomers in multiple postdoctoral positions. This talk will summarize some of the current demographic trends in astronomy, including information about gender and ethnic diversity, and describe some of the possible implications for the future. I thank the members of the Astro2010 Demographics Study Group, as well as numerous white-paper contributors to Astro2010, for providing data and analyses.

  1. Silica aerogel and space astrophysics

    International Nuclear Information System (INIS)

    Koch-Miramond, L.

    1985-09-01

    Silica aerogels have been produced in large and transparent blocks for space astrophysics experiments since the beginning of the 1970's. They were used in cosmic ray experiments on board balloons by the Saclay group. A new space venture where aerogel Cerenkov radiators will play a decisive role is currently being prepared by a large collaboration of European and US Institutes. It will be part of the so-called International Solar Polar Mission (ISPM) which will explore the heliosphere over the full range of solar latitudes from the ecliptic (equatorial) plane to the magnetic poles of the sun. Comments on properties and long term behaviour of silica aerogel cerenkov radiators in space environment are given

  2. Axions in astrophysics and cosmology

    International Nuclear Information System (INIS)

    Sikivie, P.

    1984-07-01

    Axion models often have a spontaneously broken exact discrete symmetry. In that case, they have discretely degenerate vacua and hence domain walls. The properties of the domain walls, the cosmological catastrophe they produce and the ways in which this catastrophe may be avoided are explained. Cosmology and astrophysics provide arguments that imply the axion decay constant should lie in the range 10 8 GeV less than or equal to f/sub a/ less than or equal to 10 12 GeV. Reasons are given why axions are an excellent candidate to constitute the dark matter of galactic halos. Using the coupling of the axions to the electromagnetic field, detectors are described to look for axions floating about in the halo of our galaxy and for axions emitted by the sun

  3. The fundamentals of stellar astrophysics

    International Nuclear Information System (INIS)

    Collins, G.W. II.

    1989-01-01

    A broad overview of theoretical stellar astrophysics is presented in a textbook intended for graduate students. Chapters are devoted to fundamental principles, assumptions, theorems, and polytropes; energy sources and sinks; the flow of energy through the star and the construction of stellar models; the theory of stellar evolution; relativistic stellar structure; the structure of distorted stars; stellar pulsation and oscillation. Also discussed are the flow of radiation through the stellar atmosphere, the solution of the radiative-transfer equation, the environment of the radiation field, the construction of a stellar model atmosphere, the formation and shape of spectral lines, LTE breakdown, illuminated and extended stellar atmospheres, and the transfer of polarized radiation. Diagrams, graphs, and sample problems are provided. 164 refs

  4. Nuclear astrophysics of the sun

    International Nuclear Information System (INIS)

    Kocharov, G.E.

    1980-01-01

    In the first chapter we will discuss the problem of nuclear reactions in the interior of the sun and consider the modern aspects of the neutrino astrophysics of the Sun. The second chapter is devoted to the high energy interactions in the solar atmosphere during the flares. Among a great number of events during the solar flares we shall consider mainly the nuclear reactions. Special attention will be paid to the genetic connection between the different components of solar electromagnetic and corpuscular radiation. The idea of the unity of processes in different parts of the Sun, from hot and dense interior up to the rare plasma of the solar corona will be the main line of the book. (orig./WL) 891 WL/orig.- 892 HIS

  5. Large-Scale Astrophysical Visualization on Smartphones

    Science.gov (United States)

    Becciani, U.; Massimino, P.; Costa, A.; Gheller, C.; Grillo, A.; Krokos, M.; Petta, C.

    2011-07-01

    Nowadays digital sky surveys and long-duration, high-resolution numerical simulations using high performance computing and grid systems produce multidimensional astrophysical datasets in the order of several Petabytes. Sharing visualizations of such datasets within communities and collaborating research groups is of paramount importance for disseminating results and advancing astrophysical research. Moreover educational and public outreach programs can benefit greatly from novel ways of presenting these datasets by promoting understanding of complex astrophysical processes, e.g., formation of stars and galaxies. We have previously developed VisIVO Server, a grid-enabled platform for high-performance large-scale astrophysical visualization. This article reviews the latest developments on VisIVO Web, a custom designed web portal wrapped around VisIVO Server, then introduces VisIVO Smartphone, a gateway connecting VisIVO Web and data repositories for mobile astrophysical visualization. We discuss current work and summarize future developments.

  6. Exploring the cosmic frontier. Astrophysical instruments for the 21st century

    International Nuclear Information System (INIS)

    Lobanov, A.P.; Zensus, J.A.; Cesarsky, C.; Diamond, P.

    2007-01-01

    In the coming decades, astrophysical science will benefit enormously from the construction and operation of several major international ground- and space based facilities, such as ALMA, Herschel/Planck, and SKA in the far infrared to radio band, Extremely Large Telescopes, JWST and GAIA in the optical to near infrared regime, XEUS and Constellation-X in the X-ray, and GLAST in the Gamma-ray regime. These and other new instruments will have a major impact in a wide range of scientific topics including the cosmological epoch of reionization, galactic dynamics and nuclear activity, stellar astronomy, extra-solar planets, gamma-ray bursts, X-ray binaries, and many others. On May 18-21, 2004, the Max-Planck-Society's Harnack-Haus in Dahlem, Berlin hosted the international symposium ''Exploring the Cosmic Frontier: Astrophysical Instruments for the 21st Century''. The symposium in Berlin was dedicated to exploring the complementarity and synergies between different branches of astrophysical research, by presenting and discussing the fundamental scientific problems that will be addressed by major future astrophysical facilities in the next few decades. This book contains 70 papers from the meeting and is intended to give a lasting account of a snapshot of an evolving scientific discourse and interaction throughout our field of research. (orig.)

  7. Consequences of intense intermittent astrophysical radiation sources for terrestrial planets

    Science.gov (United States)

    Melott, Adrian

    2011-11-01

    Life on Earth has developed in the context of cosmic radiation backgrounds. This in turn can be a base for comparison with other potential life-bearing planets. Many kinds of strong radiation bursts are possible by astrophysical entities ranging from gamma-ray bursts at cosmological distances to the Sun itself. Many of these present potential hazards to the biosphere: on timescales long compared with human history, the probability of an event intense enough to disrupt life on the land surface or in the oceans becomes large. One of the mechanisms which comes into play even at moderate intensities is the ionization of the Earth's atmosphere, which leads through chemical changes (specifically, depletion of stratospheric ozone) to increased ultraviolet-B flux from the Sun reaching the surface. UVB is extremely hazardous to most life due to its strong absorption by the genetic material DNA and subsequent breaking of chemical bonds. We characterize intensities at the Earth and rates or upper limits on rates. We estimate how often a major extinction-level event is probable given the current state of knowledge. Moderate level events are dominated by the Sun, but the far more severe infrequent events are dominated by gamma-ray bursts and supernovae. So-called ``short-hard'' gamma-ray bursts are a substantial threat, comparable in magnitude to supernovae and greater than that of the higher-luminosity long bursts considered in most past work. Short bursts may come with little or no warning.

  8. A holistic view of unstable dark matter. Spectral and anisotropy signatures in astrophysical backgrounds

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Le

    2010-11-15

    The nature of dark matter is one of the key outstanding problems in both particle and astrophysics. If dark matter decays or annihilates into electrons and positrons, it can affect diffuse radiation backgrounds observed in astrophysics. In this thesis, we propose a new, more general analysis of constraints on dark matter models. For any decaying dark matter model, constraints on mass and lifetime can be obtained by folding the specific dark matter decay spectrum with a response function. We derive these response functions from full-sky radio surveys and Fermi-LAT gamma-ray observations as well as from the local positron fluxes measured by the PAMELA satellite experiment and apply them to place constraints on some specific dark matter decay models. We also discuss the influence of astrophysical uncertainties on the response function, such as the uncertainties from propagation models and from the spatial distribution of the dark matter. Moreover, an anisotropy analysis of full-sky emission gamma-ray and radio maps is performed to identify possible signatures of annihilating dark matter. We calculate angular power spectra of the cosmological background of synchrotron emission from dark matter annihilations into electron positron pairs. We compare the power spectra with the anisotropy of astrophysical and cosmological radio backgrounds, from normal galaxies, radio-galaxies, galaxy cluster accretion shocks, the cosmic microwave background and Galactic foregrounds. In addition, we develop a numerical tool to compute gamma-ray emission from such electrons and positrons diffusing in the smooth host halo and in substructure halos with masses down to 10{sup -6}M{sub s}un. We show that, unlike the total gamma-ray angular power spectrum observed by Fermi-LAT, the angular power spectrum from the inverse Compton scattering is exponentially suppressed below an angular scale determined by the diffusion length of electrons and positrons. (orig.)

  9. A holistic view of unstable dark matter. Spectral and anisotropy signatures in astrophysical backgrounds

    International Nuclear Information System (INIS)

    Zhang, Le

    2010-11-01

    The nature of dark matter is one of the key outstanding problems in both particle and astrophysics. If dark matter decays or annihilates into electrons and positrons, it can affect diffuse radiation backgrounds observed in astrophysics. In this thesis, we propose a new, more general analysis of constraints on dark matter models. For any decaying dark matter model, constraints on mass and lifetime can be obtained by folding the specific dark matter decay spectrum with a response function. We derive these response functions from full-sky radio surveys and Fermi-LAT gamma-ray observations as well as from the local positron fluxes measured by the PAMELA satellite experiment and apply them to place constraints on some specific dark matter decay models. We also discuss the influence of astrophysical uncertainties on the response function, such as the uncertainties from propagation models and from the spatial distribution of the dark matter. Moreover, an anisotropy analysis of full-sky emission gamma-ray and radio maps is performed to identify possible signatures of annihilating dark matter. We calculate angular power spectra of the cosmological background of synchrotron emission from dark matter annihilations into electron positron pairs. We compare the power spectra with the anisotropy of astrophysical and cosmological radio backgrounds, from normal galaxies, radio-galaxies, galaxy cluster accretion shocks, the cosmic microwave background and Galactic foregrounds. In addition, we develop a numerical tool to compute gamma-ray emission from such electrons and positrons diffusing in the smooth host halo and in substructure halos with masses down to 10 -6 M s un. We show that, unlike the total gamma-ray angular power spectrum observed by Fermi-LAT, the angular power spectrum from the inverse Compton scattering is exponentially suppressed below an angular scale determined by the diffusion length of electrons and positrons. (orig.)

  10. Space instrumentation for gamma-ray astronomy

    Energy Technology Data Exchange (ETDEWEB)

    Teegarden, B.J

    1999-02-11

    The decade of the 1990s has witnessed a renaissance in the field of gamma-ray astronomy. The seminal event was the launch of the Compton Gamma-Ray Observatory (CGRO) in April 1991. There have been a flood of major discoveries from CGRO including breakthroughs in gamma-ray bursts, annihilation radiation, and blazars. The Italian SAX satellite was launched in April 1996. Although not primarily a gamma-ray mission, it has added a new dimension to our understanding of gamma-ray bursts. Along with these new discoveries a firm groundwork has been laid for missions and new technology development that should maintain a healthy and vigorous field throughout most of the next decade. These include the ESA INTEGRAL mission (INTErnational Gamma-Ray Astrophysics Laboratory, to be launched in mid-2001) and the NASA GLAST mission (Gamma-Ray Large Area Space Telescope) with a likely launch in the middle of the next decade. These two missions will extend the observational capabilities well beyond those of CGRO. New technologies (to gamma-ray astronomy), such as cooled germanium detectors, silicon strip detectors, and CdTe detectors are planned for these new missions. Additional promising new technologies such as CdZnTe strip detectors, scintillator fibers, and a gamma-ray lens for future gamma-ray astronomy missions are under development in laboratories around the world.

  11. Space instrumentation for gamma-ray astronomy

    International Nuclear Information System (INIS)

    Teegarden, B.J.

    1999-01-01

    The decade of the 1990s has witnessed a renaissance in the field of gamma-ray astronomy. The seminal event was the launch of the Compton Gamma-Ray Observatory (CGRO) in April 1991. There have been a flood of major discoveries from CGRO including breakthroughs in gamma-ray bursts, annihilation radiation, and blazars. The Italian SAX satellite was launched in April 1996. Although not primarily a gamma-ray mission, it has added a new dimension to our understanding of gamma-ray bursts. Along with these new discoveries a firm groundwork has been laid for missions and new technology development that should maintain a healthy and vigorous field throughout most of the next decade. These include the ESA INTEGRAL mission (INTErnational Gamma-Ray Astrophysics Laboratory, to be launched in mid-2001) and the NASA GLAST mission (Gamma-Ray Large Area Space Telescope) with a likely launch in the middle of the next decade. These two missions will extend the observational capabilities well beyond those of CGRO. New technologies (to gamma-ray astronomy), such as cooled germanium detectors, silicon strip detectors, and CdTe detectors are planned for these new missions. Additional promising new technologies such as CdZnTe strip detectors, scintillator fibers, and a gamma-ray lens for future gamma-ray astronomy missions are under development in laboratories around the world

  12. Promising lines of investigations in the realms of laboratory astrophysics with the aid of powerful lasers

    International Nuclear Information System (INIS)

    Belyaev, V. S.; Batishchev, P. A.; Bolshakov, V. V.; Elkin, K. S.; Karabadzhak, G. F.; Kovkov, D. V.; Matafonov, A. P.; Raykunov, G. G.; Yakhin, R. A.; Pikuz, S. A.; Skobelev, I. Yu.; Faenov, A. Ya.; Fortov, V. E.; Krainov, V. P.; Rozanov, V. B.

    2013-01-01

    The results of work on choosing and substantiating promising lines of research in the realms of laboratory astrophysics with the aid of powerful lasers are presented. These lines of research are determined by the possibility of simulating, under laboratory conditions, problematic processes of presentday astrophysics, such as (i) the generation and evolution of electromagnetic fields in cosmic space and the role of magnetic fields there at various spatial scales; (ii) the mechanisms of formation and evolution of cosmic gamma-ray bursts and relativistic jets; (iii) plasma instabilities in cosmic space and astrophysical objects, plasma jets, and shock waves; (iv) supernova explosions and mechanisms of the explosion of supernovae featuring a collapsing core; (v) nuclear processes in astrophysical objects; (vi) cosmic rays and mechanisms of their production and acceleration to high energies; and (vii) astrophysical sources of x-ray radiation. It is shown that the use of existing powerful lasers characterized by an intensity in the range of 10 18 –10 22 W/cm 2 and a pulse duration of 0.1 to 1 ps and high-energy lasers characterized by an energy in excess of 1 kJ and a pulse duration of 1 to 10 ns makes it possible to perform investigations in laboratory astrophysics along all of the chosen promising lines. The results obtained by experimentally investigating laser plasma with the aid of the laser facility created at Central Research Institute of Machine Building (TsNIIMash) and characterized by a power level of 10 TW demonstrate the potential of such facilities for performing a number of experiments in the realms of laboratory astrophysics.

  13. Gamma Knife

    Science.gov (United States)

    ... News Physician Resources Professions Site Index A-Z Gamma Knife Gamma Knife® is a radiation therapy that uses computerized ... If you're scheduled for radiation therapy using Gamma Knife®, a treatment team consisting of a radiation ...

  14. Gravity-mediated (or Composite) Dark Matter Confronts Astrophysical Data

    CERN Document Server

    Lee, Hyun Min; Sanz, Veronica

    2014-01-01

    We consider the astrophysical bounds on a new form of dark matter, the so called Gravity-mediated Dark Matter. In this scenario, dark matter communicates with us through a mediator sector composed of gravitational resonances, namely a new scalar (radion) and a massive spin-two resonance (massive graviton). We consider specific models motivated by natural electroweak symmetry breaking or weak-scale dark matter in the context of models in warped extra-dimensions and their composite duals. The main Dark Matter annihilation mechanism is due to the interactions of KK gravitons to gauge bosons that propagate in bulk. We impose the bounds on monochromatic or continuum photons from Fermi-LAT and HESS. We also explore scenarios in which the Fermi gamma-ray line could be a manifestation of Gravity-mediated Dark Matter.

  15. Worrying about the LHC, a lesson from astrophysics?

    CERN Multimedia

    CERN. Geneva

    2008-01-01

    To worry about the LHC is a popular sport. I shall share my own worries, hopefully original, and do it via a parable (for this method, I can quote earlier authors). The parable concerns a topic in astrophysics (gamma-ray bursts) which happens to be a simple exercise --but quite an interesting one-- on elementary particle-physics and beam dynamics, topics not unrelated to the LHC. Though most of the talk will be dedicated to the physics and, in particular, to its recent developments, the allegory will allow me to detect what, I shall argue, may be dangerous 'viruses' invading science. I do not have the decisive antidotes, but I shall discuss some possible ones.

  16. FIRST LIGHT: MeV ASTROPHYSICS FROM THE MOON

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Richard S. [University of Alabama in Huntsville, 301 Sparkman Drive, Huntsville, AL 35899 (United States); Lawrence, David J., E-mail: richard.s.miller@uah.edu [Johns Hopkins University Applied Physics Laboratory, 11100 Johns Hopkins Road, Laurel, MD 20723 (United States)

    2016-06-01

    We report evidence of the first astrophysical source detected from the Moon at MeV energies. Our detection of Cygnus X-1 is a validation of a new investigative paradigm in which the lunar environment is intrinsic to the detection approach: the Lunar Occultation Technique (LOT). NASA’s Lunar Prospector mission served as a proxy for a dedicated LOT-based mission. The characteristic signature of temporal modulation, generated by repeated lunar occultations and encoded within acquired gamma-ray data (0.5–9 MeV), is consistent with an unambiguous detection of Cygnus X-1 at 5.4 σ significance. Source localization and long-term monitoring capabilities of the LOT are also demonstrated. This “first light” detection verifies the basic tenets of the LOT methodology, reinforces its feasibility as an alternative astronomical detection paradigm for nuclear astrophysics investigations, and is an illustration of the fundamental benefits of the Moon as a platform for science.

  17. Particle Astrophysics after COBE- Blois 92- Summary Talk

    Science.gov (United States)

    Primack, J. R.

    The IV Rencontres de Blois, on Particle Astrophysics, held at the Ch\\^ateau de Blois, June 15-20, 1992, was a meeting well-timed for a reconsideration of the issues in particle astrophysics in the light of the COBE discovery of the cosmic microwave background (CMB) fluctuations. This is a summary of what I thought were the most interesting things discussed at Blois: (1) The near-success of Cold Dark Matter (CDM) in predicting the COBE fluctuation amplitude, which favors the hypothesis that structure formed in the universe through gravitational collapse. (2) The indications that $\\Omega\\approx1$ and that the power spectrum has a little more power on supercluster and larger scales than CDM. These are suggested by the IRAS and CfA redshift surveys and POTENT galaxy peculiar velocity analysis, and also by the COBE data. (3) The consequent demise of CDM and the rise of hybrid schemes such as Cold+Hot Dark Matter (C+HDM). (4) The possible implications for neutrino masses and mixings, and for cosmology, of the recent results on solar neutrinos. (5) The first discovery of TeV $\\gamma$ rays from an extragalactic source, which was announced at Blois. I also summarize here a number of the exciting ongoing and planned experiments and observations discussed at Blois: CERN experiments on $\

  18. Astrophysics at RIA (ARIA) Working Group

    International Nuclear Information System (INIS)

    Smith, Michael S.; Schatz, Hendrik; Timmes, Frank X.; Wiescher, Michael; Greife, Uwe

    2006-01-01

    The Astrophysics at RIA (ARIA) Working Group has been established to develop and promote the nuclear astrophysics research anticipated at the Rare Isotope Accelerator (RIA). RIA is a proposed next-generation nuclear science facility in the U.S. that will enable significant progress in studies of core collapse supernovae, thermonuclear supernovae, X-ray bursts, novae, and other astrophysical sites. Many of the topics addressed by the Working Group are relevant for the RIKEN RI Beam Factory, the planned GSI-Fair facility, and other advanced radioactive beam facilities

  19. Parametric Model for Astrophysical Proton-Proton Interactions and Applications

    Energy Technology Data Exchange (ETDEWEB)

    Karlsson, Niklas [KTH Royal Institute of Technology, Stockholm (Sweden)

    2007-01-01

    Observations of gamma-rays have been made from celestial sources such as active galaxies, gamma-ray bursts and supernova remnants as well as the Galactic ridge. The study of gamma rays can provide information about production mechanisms and cosmic-ray acceleration. In the high-energy regime, one of the dominant mechanisms for gamma-ray production is the decay of neutral pions produced in interactions of ultra-relativistic cosmic-ray nuclei and interstellar matter. Presented here is a parametric model for calculations of inclusive cross sections and transverse momentum distributions for secondary particles--gamma rays, e±, ve, $\\bar{v}$e, vμ and $\\bar{μ}$e--produced in proton-proton interactions. This parametric model is derived on the proton-proton interaction model proposed by Kamae et al.; it includes the diffraction dissociation process, Feynman-scaling violation and the logarithmically rising inelastic proton-proton cross section. To improve fidelity to experimental data for lower energies, two baryon resonance excitation processes were added; one representing the Δ(1232) and the other multiple resonances with masses around 1600 MeV/c2. The model predicts the power-law spectral index for all secondary particle to be about 0.05 lower in absolute value than that of the incident proton and their inclusive cross sections to be larger than those predicted by previous models based on the Feynman-scaling hypothesis. The applications of the presented model in astrophysics are plentiful. It has been implemented into the Galprop code to calculate the contribution due to pion decays in the Galactic plane. The model has also been used to estimate the cosmic-ray flux in the Large Magellanic Cloud based on HI, CO and gamma-ray observations. The transverse momentum distributions enable calculations when the proton distribution is anisotropic. It is shown that the gamma-ray spectrum and flux due to a

  20. Local models of astrophysical discs

    Science.gov (United States)

    Latter, Henrik N.; Papaloizou, John

    2017-12-01

    Local models of gaseous accretion discs have been successfully employed for decades to describe an assortment of small-scale phenomena, from instabilities and turbulence, to dust dynamics and planet formation. For the most part, they have been derived in a physically motivated but essentially ad hoc fashion, with some of the mathematical assumptions never made explicit nor checked for consistency. This approach is susceptible to error, and it is easy to derive local models that support spurious instabilities or fail to conserve key quantities. In this paper we present rigorous derivations, based on an asympototic ordering, and formulate a hierarchy of local models (incompressible, Boussinesq and compressible), making clear which is best suited for a particular flow or phenomenon, while spelling out explicitly the assumptions and approximations of each. We also discuss the merits of the anelastic approximation, emphasizing that anelastic systems struggle to conserve energy unless strong restrictions are imposed on the flow. The problems encountered by the anelastic approximation are exacerbated by the disc's differential rotation, but also attend non-rotating systems such as stellar interiors. We conclude with a defence of local models and their continued utility in astrophysical research.

  1. Mass-23 nuclei in astrophysics

    International Nuclear Information System (INIS)

    Fraser, P R; Amos, K; Van der Kniff, D; Canton, L; Karataglidis, S; Svenne, J P

    2015-01-01

    The formation of mass-23 nuclei by radiative capture is of great interest in astrophysics. A topical problem associated with these isobars is the so-called 22 Na puzzle of ONe white dwarf novae, where the abundance of 22 Na observed is not as is predicted by current stellar models, indicating there is more to learn about how the distribution of elements in the universe occurred. Another concerns unexplained variations in elements abundance on the surface of aging red giant stars. One method for theoretically studying nuclear scattering is the Multi-Channel Algebraic Scattering (MCAS) formalism. Studies to date have used a simple collective-rotor prescription to model the target states which couple to projectile nucleons. While, in general, the target states considered all belong to the ground state rotor band, for some systems it is necessary to include coupling to states outside of this band. Herein we discuss an extension of MCAS to allow coupling of different strengths between such states and the ground state band. This consideration is essential when studying the scattering of neutrons from 22 Ne, a necessary step in studying the mass-23 nuclei mentioned above. (paper)

  2. Dissecting the Gamma-Ray Background in Search of Dark Matter

    Energy Technology Data Exchange (ETDEWEB)

    Cholis, Ilias; Hooper, Dan; McDermott, Samuel D.

    2014-02-01

    Several classes of astrophysical sources contribute to the approximately isotropic gamma-ray background measured by the Fermi Gamma-Ray Space Telescope. In this paper, we use Fermi's catalog of gamma-ray sources (along with corresponding source catalogs at infrared and radio wavelengths) to build and constrain a model for the contributions to the extragalactic gamma-ray background from astrophysical sources, including radio galaxies, star-forming galaxies, and blazars. We then combine our model with Fermi's measurement of the gamma-ray background to derive constraints on the dark matter annihilation cross section, including contributions from both extragalactic and galactic halos and subhalos. The resulting constraints are competitive with the strongest current constraints from the Galactic Center and dwarf spheroidal galaxies. As Fermi continues to measure the gamma-ray emission from a greater number of astrophysical sources, it will become possible to more tightly constrain the astrophysical contributions to the extragalactic gamma-ray background. We project that with 10 years of data, Fermi's measurement of this background combined with the improved constraints on the astrophysical source contributions will yield a sensitivity to dark matter annihilations that exceeds the strongest current constraints by a factor of ~ 5 - 10.

  3. DISCOVERY OF VERY HIGH ENERGY GAMMA RAYS FROM PKS 1424+240 AND MULTIWAVELENGTH CONSTRAINTS ON ITS REDSHIFT

    International Nuclear Information System (INIS)

    Acciari, V. A.; Benbow, W.; Aliu, E.; Boltuch, D.; Arlen, T.; Chow, Y. C.; Aune, T.; Bautista, M.; Cogan, P.; Beilicke, M.; Buckley, J. H.; Bugaev, V.; Boettcher, M.; Bradbury, S. M.; Byrum, K.; Cannon, A.; Cesarini, A.; Ciupik, L.; Cui, W.; Duke, C.

    2010-01-01

    We report the first detection of very high energy 83 Gamma-ray emission above 100 GeV. (VHE) gamma-ray emission above 140 GeV from PKS 1424+240, a BL Lac object with an unknown redshift. The photon spectrum above 140 GeV measured by VERITAS is well described by a power law with a photon index of 3.8 ± 0.5 stat ± 0.3 syst and a flux normalization at 200 GeV of (5.1 ± 0.9 stat ± 0.5 syst ) x 10 -11 TeV -1 cm -2 s -1 , where stat and syst denote the statistical and systematical uncertainties, respectively. The VHE flux is steady over the observation period between MJD 54881 and 55003 (from 2009 February 19 to June 21). Flux variability is also not observed in contemporaneous high-energy observations with the Fermi Large Area Telescope. Contemporaneous X-ray and optical data were also obtained from the Swift XRT and MDM observatory, respectively. The broadband spectral energy distribution is well described by a one-zone synchrotron self-Compton model favoring a redshift of less than 0.1. Using the photon index measured with Fermi in combination with recent extragalactic background light absorption models it can be concluded from the VERITAS data that the redshift of PKS 1424+240 is less than 0.66.

  4. Isometric embeddings in cosmology and astrophysics

    Indian Academy of Sciences (India)

    embedding theory, a given spacetime (or 'brane') is embedded in a higher- ..... If one recalls that the motivation (at least in part) for non-compact extra ... to successfully embed (apparently perfect fluid) astrophysical models, we typically need to.

  5. Transport processes in space physics and astrophysics

    CERN Document Server

    Zank, Gary P

    2014-01-01

    Transport Processes in Space Physics and Astrophysics' is aimed at graduate level students to provide the necessary mathematical and physics background to understand the transport of gases, charged particle gases, energetic charged particles, turbulence, and radiation in an astrophysical and space physics context. Subjects emphasized in the work include collisional and collisionless processes in gases (neutral or plasma), analogous processes in turbulence fields and radiation fields, and allows for a simplified treatment of the statistical description of the system. A systematic study that addresses the common tools at a graduate level allows students to progress to a point where they can begin their research in a variety of fields within space physics and astrophysics. This book is for graduate students who expect to complete their research in an area of plasma space physics or plasma astrophysics. By providing a broad synthesis in several areas of transport theory and modeling, the work also benefits resear...

  6. Advances in instrumentation for nuclear astrophysics

    Directory of Open Access Journals (Sweden)

    S. D. Pain

    2014-04-01

    Full Text Available The study of the nuclear physics properties which govern energy generation and nucleosynthesis in the astrophysical phenomena we observe in the universe is crucial to understanding how these objects behave and how the chemical history of the universe evolved to its present state. The low cross sections and short nuclear lifetimes involved in many of these reactions make their experimental determination challenging, requiring developments in beams and instrumentation. A selection of developments in nuclear astrophysics instrumentation is discussed, using as examples projects involving the nuclear astrophysics group at Oak Ridge National Laboratory. These developments will be key to the instrumentation necessary to fully exploit nuclear astrophysics opportunities at the Facility for Rare Isotope Beams which is currently under construction.

  7. About cosmic gamma ray lines

    Science.gov (United States)

    Diehl, Roland

    2017-06-01

    Gamma ray lines from cosmic sources convey the action of nuclear reactions in cosmic sites and their impacts on astrophysical objects. Gamma rays at characteristic energies result from nuclear transitions following radioactive decays or high-energy collisions with excitation of nuclei. The gamma-ray line from the annihilation of positrons at 511 keV falls into the same energy window, although of different origin. We present here the concepts of cosmic gamma ray spectrometry and the corresponding instruments and missions, followed by a discussion of recent results and the challenges and open issues for the future. Among the lessons learned are the diffuse radioactive afterglow of massive-star nucleosynthesis in 26Al and 60Fe gamma rays, which is now being exploited towards the cycle of matter driven by massive stars and their supernovae; large interstellar cavities and superbubbles have been recognised to be of key importance here. Also, constraints on the complex processes making stars explode as either thermonuclear or core-collapse supernovae are being illuminated by gamma-ray lines, in this case from shortlived radioactivities from 56Ni and 44Ti decays. In particular, the three-dimensionality and asphericities that have recently been recognised as important are enlightened in different ways through such gamma-ray line spectroscopy. Finally, the distribution of positron annihilation gamma ray emission with its puzzling bulge-dominated intensity disctribution is measured through spatially-resolved spectra, which indicate that annihilation conditions may differ in different parts of our Galaxy. But it is now understood that a variety of sources may feed positrons into the interstellar medium, and their characteristics largely get lost during slowing down and propagation of positrons before annihilation; a recent microquasar flare was caught as an opportunity to see positrons annihilate at a source.

  8. Nuclear astrophysics and nuclei far from stability

    International Nuclear Information System (INIS)

    Schatz, H.

    2003-01-01

    Unstable nuclei play a critical role in a number of astrophysical scenarios and are important for our understanding of the origin of the elements. Among the most important scenarios are the r-process (Supernovae), Novae, X-ray bursters, and Superbursters. For these astrophysical events I review the open questions, recent developments in astronomy, and how nuclear physics, in particular experiments with radioactive beams, needs to contribute to find the answers. (orig.)

  9. Cosmological and astrophysical neutrino mass measurements

    DEFF Research Database (Denmark)

    Abazajian, K.N.; Calabrese, E.; Cooray, A.

    2011-01-01

    Cosmological and astrophysical measurements provide powerful constraints on neutrino masses complementary to those from accelerators and reactors. Here we provide a guide to these different probes, for each explaining its physical basis, underlying assumptions, current and future reach.......Cosmological and astrophysical measurements provide powerful constraints on neutrino masses complementary to those from accelerators and reactors. Here we provide a guide to these different probes, for each explaining its physical basis, underlying assumptions, current and future reach....

  10. Technology Development for a Neutrino Astrophysical Observatory

    International Nuclear Information System (INIS)

    Chaloupka, V.; Cole, T.; Crawford, H.J.; He, Y.D.; Jackson, S.; Kleinfelder, S.; Lai, K.W.; Learned, J.; Ling, J.; Liu, D.; Lowder, D.; Moorhead, M.; Morookian, J.M.; Nygren, D.R.; Price, P.B.; Richards, A.; Shapiro, G.; Shen, B.; Smoot, George F.; Stokstad, R.G.; VanDalen, G.; Wilkes, J.; Wright, F.; Young, K.

    1996-01-01

    We propose a set of technology developments relevant to the design of an optimized Cerenkov detector for the study of neutrino interactions of astrophysical interest. Emphasis is placed on signal processing innovations that enhance significantly the quality of primary data. These technical advances, combined with field experience from a follow-on test deployment, are intended to provide a basis for the engineering design for a kilometer-scale Neutrino Astrophysical Observatory

  11. Astrophysics at nTOF facility

    International Nuclear Information System (INIS)

    Tagliente, G.; Colonna, N.; Maronne, S.; Terlizzi, R.; Abondanno, U.; Fujii, K.; Milazzo, P.M.; Moreau, C.; Belloni, F.; Aerts, G.; Berthoumieux, E.; Andriamonje, S.; Dridi, W.; Gunsing, F.; Pancin, J.; Perrot, L.; Alvarez, H.; Duran, I.; Paradela, C.; Alvarez-Velarde, F.; Cano-Ott, D.; Embid-Segura, M.; Guerrero, C.; Martinez, T.; Villamarin, D.; Vincente, M.C.; Gonzalez-Romero, E.; Andrzejewski, J.; Marganiec, J.; Assimakopoulos, P.; Karamanis, D.; Audouin, L.; Dillman, I.; Heil, M.; Kappeler, F.; Mosconi, M.; Plag, R.; Voss, F.; Walter, S.; Wissak, K.; Badurek, G.; Jericha, E.; Leeb, H.; Oberhummer, H.; Pigni, M.T.; Baumann, P.; David, S.; Kerveno, M.; Rudolf, G.; Lukic, S.; Becvar, F.; Krticka, M.; Bisterzo, S.; Ferrant, L.; Gallino, R.; Calvino, F.; Poch, A.; Pretel, C.; Calviani, M.; Gramegna, F.; Mastinu, P.; Capote, R.; Mengoni, A.; Capote, R.; Lozano, M.; Quesada, J.; Carrapico, C.; Salgado, J.; Santos, C.; Tavora, L.; Vaz, P.; Cennini, P.; Chiaveri, E.; Dahlfors, M.; Kadi, Y.; Sarchiapone, L.; Vlachoudis, V.; Wendler, H.; Chepel, V.; Ferreira-Marques, R.; Goncalves, I.; Lindote, A.; Lopes, I.; Neves, F.; Couture, A.; Cox, J.; O'Brien, S.; Wiescher, M.; Dominga-Pardo, C.; Tain, J.L.; Eleftheriadis, C.; Lamboudis, C.; Savvidis, I.; Stephan, C.; Tassan-Got, L.; Furman, W.; Haas, B.; Haight, R.; Reifarth, R.; Igashira, M.; Koehler, P.; Massimi, C.; Vannini, G.; Papadopoulos, C.; Pavlik, A.; Pavlopoulos, P.; Plomen, A.; Rullhusen, P.; Rauscher, T.; Rubbia, C.; Ventura, A.

    2009-01-01

    The neutron time of flight (n T OF) facility at CERN is a neutron spallation source, its white neutron energy spectrum ranges from thermal to several GeV, covering the full energy range of interest for nuclear astrophysics, in particular for measurements of the neutron capture cross-section required in s-process nucleosynthesis. This contribution gives an overview on the astrophysical program made at n T OF facility, the results and the implications will be considered.

  12. Hydrodynamic instabilities in astrophysics and ICF

    International Nuclear Information System (INIS)

    Paul Drake, R.

    2005-01-01

    Inertial fusion systems and astrophysical systems both involve hydrodynamic effects, including sources of pressure, shock waves, rarefactions, and plasma flows. In the evolution of such systems, hydrodynamic instabilities naturally evolve. As a result, a fundamental understanding of hydrodynamic instabilities is necessary to understand their behavior. In addition, high-energy-density facilities designed for ICF purposes can be used to provide and experimental basis for understanding astrophysical processes. In this talk. I will discuss the instabilities that appear in astrophysics and ICF from the common perspective of the basic mechanisms at work. Examples will be taken from experiments aimed at ICF, from astrophysical systems, and from experiments using ICF systems to address issues in astrophysics. The high-energy-density research facilities of today can accelerate small but macroscopic amounts of material to velocities above 100 km/s, can heat such material to temperature above 100 eV, can produce pressures far above a million atmospheres (10''12 dybes/cm''2 or 0.1 TPascal), and can do experiments under these conditions that address basic physics issues. This enables on to devise experiments aimed directly at important process such as the Rayleigh Taylor instability at an ablating surface or at an embedded interface that is accelerating, the Richtmeyer Meshkov evolution of shocked interfaces, and the Kelvin-Helmholtz instability of shear flows. The talk will include examples of such phenomena from the laboratory and from astrophysics, and will discuss experiments to study them. (Author)

  13. Discovery of a point-like very-high-energy gamma-ray source in Monoceros

    International Nuclear Information System (INIS)

    Aharonian, F.A.; Benbow, W.; Berge, D.; Bernlohr, K.; Bolz, O.; Braun, I.; Buhler, R.; Carrigan, S.; Costamante, L.; Domainko, W.; Egberts, K.; Forster, A.; Funk, S.; Hauser, D.; Hermann, G.; Hinton, J.A.; Hofmann, W.; Hoppe, S.; Khelifi, B.; Kosack, K.; Masterson, C.; Panter, M.; Rowell, G.; van Eldik, C.; Volk, H.J.; Akhperjanian, A.G.; Sahakian, V.; Bazer-Bachi, A.R.; Borrel, V.; Marcowith, A.; Olive, J.P.; Beilicke, M.; Cornils, R.; Heinzelmann, G.; Raue, M.; Ripken, J.; Bernlohr, K.; Funk, Seb.; Fussling, M.; Kerschhaggl, M.; Lohse, T.; Schlenker, S.; Schwanke, U.; Boisson, C.; Martin, J.M.; Sol, H.; Brion, E.; Glicenstein, J.F.; Goret, P.; Moulin, E.; Rolland, L.

    2007-01-01

    Aims. The complex Monoceros Loop SNR/Rosette Nebula region contains several potential sources of very-high-energy (VHE) γ-ray emission and two as yet unidentified high-energy EGRET sources. Sensitive VHE observations are required to probe acceleration processes in this region. Methods. The HESS telescope array has been used to search for very high-energy gamma-ray sources in this region. CO data from the NANTEN telescope were used to map the molecular clouds in the region, which could act as target material for γ-ray production via hadronic interactions. Results. We announce the discovery of a new γ-ray source, HESS J0632+057, located close to the rim of the Monoceros SNR. This source is unresolved by HESS and has no clear counterpart at other wavelengths but is possibly associated with the weak X-ray source 1RXS J063258.3+054857, the Be-star MWC148 and/or the lower energy γ-ray source 3EGJ0634+0521. No evidence for an associated molecular cloud was found in the CO data. (authors)

  14. A Search for bursts of TeV gamma rays with Milagro

    Science.gov (United States)

    Smith, A. J.; MILAGRO Collaboration

    2001-08-01

    The Very High Energy (VHE, E > 100 GeV) component of Gamma-Ray Bursts (GRBs) remains unmeasured, despite the fact that models predict that the spectrum of GRBs extends beyond 1 TeV. Satellite detectors capable of observing GRBs lack the sensitivity to detect γ-rays with energies greater than ≈ 30 GeV due to their small effective area. Air ˇCerenkov telescopes, capable of detecting TeV point sources with excellent sensitivity have limited sensitivity to GRBs due to their small fields of view and limited duty cycles. The detection of TeV emission from GRBs is further complicated by the attenuation of VHE photons by interaction with the intergalactic infrared radiation. This process limits the horizon for TeV observations of GRBs to z pond (4800 m2 ) instrumented with an array of photo-multiplier tubes. Milagro operates 24 hours a day and continuously observes the entire overhead sky (≈2 sr). Because of its wide field of view and high duty cycle Milagro is uniquely capable of searching for TeV emission from GRBs. An efficient algorithm has been developed to search the Milagro data for GRBs with durations from 250 microseconds to 40s. The search, while designed to search for the TeV component of GRBs, may also be sensitive to the evaporation of primordial black holes, or some other yet undiscovered phenomenon. The results of this search are presented.

  15. Distance Measurement Solves Astrophysical Mysteries

    Science.gov (United States)

    2003-08-01

    Location, location, and location. The old real-estate adage about what's really important proved applicable to astrophysics as astronomers used the sharp radio "vision" of the National Science Foundation's Very Long Baseline Array (VLBA) to pinpoint the distance to a pulsar. Their accurate distance measurement then resolved a dispute over the pulsar's birthplace, allowed the astronomers to determine the size of its neutron star and possibly solve a mystery about cosmic rays. "Getting an accurate distance to this pulsar gave us a real bonanza," said Walter Brisken, of the National Radio Astronomy Observatory (NRAO) in Socorro, NM. Monogem Ring The Monogem Ring, in X-Ray Image by ROSAT satellite CREDIT: Max-Planck Institute, American Astronomical Society (Click on Image for Larger Version) The pulsar, called PSR B0656+14, is in the constellation Gemini, and appears to be near the center of a circular supernova remnant that straddles Gemini and its neighboring constellation, Monoceros, and is thus called the Monogem Ring. Since pulsars are superdense, spinning neutron stars left over when a massive star explodes as a supernova, it was logical to assume that the Monogem Ring, the shell of debris from a supernova explosion, was the remnant of the blast that created the pulsar. However, astronomers using indirect methods of determining the distance to the pulsar had concluded that it was nearly 2500 light-years from Earth. On the other hand, the supernova remnant was determined to be only about 1000 light-years from Earth. It seemed unlikely that the two were related, but instead appeared nearby in the sky purely by a chance juxtaposition. Brisken and his colleagues used the VLBA to make precise measurements of the sky position of PSR B0656+14 from 2000 to 2002. They were able to detect the slight offset in the object's apparent position when viewed from opposite sides of Earth's orbit around the Sun. This effect, called parallax, provides a direct measurement of

  16. AGIS -- the Advanced Gamma-ray Imaging System

    Science.gov (United States)

    Krennrich, Frank

    2009-05-01

    The Advanced Gamma-ray Imaging System, AGIS, is envisioned to become the follow-up mission of the current generation of very high energy gamma-ray telescopes, namely, H.E.S.S., MAGIC and VERITAS. These instruments have provided a glimpse of the TeV gamma-ray sky, showing more than 70 sources while their detailed studies constrain a wealth of physics and astrophysics. The particle acceleration, emission and absorption processes in these sources permit the study of extreme physical conditions found in galactic and extragalactic TeV sources. AGIS will dramatically improve the sensitivity and angular resolution of TeV gamma-ray observations and therefore provide unique prospects for particle physics, astrophysics and cosmology. This talk will provide an overview of the science drivers, scientific capabilities and the novel technical approaches that are pursued to maximize the performance of the large array concept of AGIS.

  17. Gamma radiation from active galaxy nuclei detected at very high energies with H.E.S.S: Multi-wavelength study and simulation of radioactive processes

    International Nuclear Information System (INIS)

    Lenain, J.P.

    2009-01-01

    Active Galactic Nuclei (AGN) are among the most energetic sources in the Universe. A subgroup of AGN possesses relativistic jets, the emission of which is purely non-thermal. In the case where the jet is aligned to the line of sight, these objects, called 'blazars', have their emission amplified by the relativistic Doppler effect. Since the advent of very high energy (VHE; E > 100 GeV) γ-ray astrophysics, Cerenkov telescopes like H.E.S.S. have observed almost thirty AGN, mainly blazars, from the ground. Cerenkov radiation from particle showers created by the interaction of γ-rays in the terrestrial atmosphere is used to derive the properties of the incident photon and thus to study these extragalactic sources. We have studied the highly variable VHE γ-ray emission from the blazar PKS 2155-304, from which 2 major outbursts were detected in July 2006, within the framework of a dynamic Synchrotron self-Compton (SSC) model. This variable emission presents properties excluding the most standard emission scenarios for blazars. We have also developed an SSC emission model for misaligned relativistic jets, to interpret the recent discovery of VHE γ-ray emission from 2 radio galaxies, M87 and Cen-A, which established the emergence of a new family of cosmic TeV emitters. We conclude with a systematic study conducted on all the AGN currently known at TeV with a stationary SSC model. We present tools for predictions of flux densities in these objects, which can be confronted with future observations by the Cerenkov Telescope Array (CTA). (author)

  18. Cosmic matrix in the jubilee of relativistic astrophysics

    Energy Technology Data Exchange (ETDEWEB)

    Ruffini, R., E-mail: ruffini@icra.it [Dip. di Fisica, Sapienza University of Rome and ICRA Piazzale Aldo Moro 5, I–00185, Rome (Italy); ICRANet, Piazza della Repubblica 10, I–65122 Pescara (Italy); Université de Nice Sophie Antipolis, Nice, CEDEX 2, Grand Château Parc Valrose (France); ICRANet-Rio, Centro Brasileiro de Pesquisas Físicas, Rua Dr. Xavier Sigaud 150, Rio de Janeiro, RJ, 22290–180 (Brazil); Aimuratov, Y.; Enderli, M.; Kovacevic, M. [Dip. di Fisica, Sapienza University of Rome and ICRA Piazzale Aldo Moro 5, I–00185, Rome (Italy); Université de Nice Sophie Antipolis, Nice, CEDEX 2, Grand Château Parc Valrose (France); Belinski, V.; Bianco, C. L.; Izzo, L.; Moradi, R.; Muccino, M.; Rueda, J. A.; Vereshchagin, G. V.; Wang, Y.; Xue, S.-S. [Dip. di Fisica, Sapienza University of Rome and ICRA Piazzale Aldo Moro 5, I–00185, Rome (Italy); ICRANet, Piazza della Repubblica 10, I–65122 Pescara (Italy); Mathews, G. J. [ICRANet, Piazza della Repubblica 10, I–65122 Pescara (Italy); Center for Astrophysics, University of Notre Dame, US (United States); Penacchioni, A. V. [INPE - Av. dos Astronautas, 1758 - Sao Jose dos Campos - Sao Paulo – Brazil (Brazil); Pisani, G. B. [Dip. di Fisica, Sapienza University of Rome and ICRA Piazzale Aldo Moro 5, I–00185, Rome (Italy)

    2015-12-17

    Following the classical works on Neutron Stars, Black Holes and Cosmology, I outline some recent results obtained in the IRAP-PhD program of ICRANet on the “Cosmic Matrix”: a new astrophysical phenomenon recorded by the X- and Gamma-Ray satellites and by the largest ground based optical telescopes all over our planet. In 3 minutes it has been recorded the occurrence of a “Supernova”, the “Induced-Gravitational-Collapse” on a Neutron Star binary, the formation of a “Black Hole”, and the creation of a “Newly Born Neutron Star”. This presentation is based on a document describing activities of ICRANet and recent developments of the paradigm of the Cosmic Matrix in the comprehension of Gamma Ray Bursts (GRBs) presented on the occasion of the Fourteenth Marcel Grossmann Meeting on Recent Developments in Theoretical and Experimental General Relativity, Gravitation, and Relativistic Field Theory. A Portuguese version of this document can be downloaded at: http://www.icranet.org/documents/brochure{sub i}cranet{sub p}t.pdf.

  19. Cosmic matrix in the jubilee of relativistic astrophysics

    International Nuclear Information System (INIS)

    Ruffini, R.; Aimuratov, Y.; Enderli, M.; Kovacevic, M.; Belinski, V.; Bianco, C. L.; Izzo, L.; Moradi, R.; Muccino, M.; Rueda, J. A.; Vereshchagin, G. V.; Wang, Y.; Xue, S.-S.; Mathews, G. J.; Penacchioni, A. V.; Pisani, G. B.

    2015-01-01

    Following the classical works on Neutron Stars, Black Holes and Cosmology, I outline some recent results obtained in the IRAP-PhD program of ICRANet on the “Cosmic Matrix”: a new astrophysical phenomenon recorded by the X- and Gamma-Ray satellites and by the largest ground based optical telescopes all over our planet. In 3 minutes it has been recorded the occurrence of a “Supernova”, the “Induced-Gravitational-Collapse” on a Neutron Star binary, the formation of a “Black Hole”, and the creation of a “Newly Born Neutron Star”. This presentation is based on a document describing activities of ICRANet and recent developments of the paradigm of the Cosmic Matrix in the comprehension of Gamma Ray Bursts (GRBs) presented on the occasion of the Fourteenth Marcel Grossmann Meeting on Recent Developments in Theoretical and Experimental General Relativity, Gravitation, and Relativistic Field Theory. A Portuguese version of this document can be downloaded at: http://www.icranet.org/documents/brochure_icranet_pt.pdf

  20. Fermi-LAT Observations of the Gamma-Ray Burst GRB 130427A

    NARCIS (Netherlands)

    Ackermann, M.; et al., [Unknown; van der Horst, A.J.

    2014-01-01

    The observations of the exceptionally bright gamma-ray burst (GRB) 130427A by the Large Area Telescope aboard the Fermi Gamma-ray Space Telescope provide constraints on the nature of these unique astrophysical sources. GRB 130427A had the largest fluence, highest-energy photon (95 GeV), longest

  1. The Crab pulsar at VHE

    Directory of Open Access Journals (Sweden)

    Zanin Roberta

    2017-01-01

    Full Text Available The last six years have witnessed major revisions of our knowledge about the Crab Pulsar. The consensus scenario for the origin of the high-energy pulsed emission has been challenged with the discovery of a very-high-energy power law tail extending up to ~400 GeV, above the expected spectral cut off at a few GeV. Now, new measurements obtained by the MAGIC collaboration extend the energy spectrum of the Crab Pulsar even further, on the TeV regime. Above ~400 GeV the pulsed emission comes mainly from the interpulse, which becomes more prominent with energy due to a harder spectral index. These findings require γ -ray production via inverse Compton scattering close to or beyond the light cylinder radius by an underlying particle population with Lorentz factors greater than 5 × 106. We will present those new results and discuss the implications in our current knowledge concerning pulsar environments.

  2. Gamma-ray imaging. Applications in nuclear non-proliferation and homeland security

    International Nuclear Information System (INIS)

    Vetter, Kai; Mihailescu, Lucian

    2010-01-01

    This paper provides the motivation and describes implementations of gamma-ray imaging for homeland security applications and more general for national and international nuclear security. As in nuclear medicine and astrophysics, the goal of gamma-ray imaging is the detection and localization of nuclear materials, however, here in a terrestrial environment with distances between nuclear medicine and astrophysics, i.e. in the range of 1-100 meters. Due to the recently increased threat of nuclear terrorism, the detection of illicit nuclear materials and the prevention of nuclear proliferation through the development of advanced gamma-ray imaging concepts and technologies has become and active research field. (author)

  3. Exploring the Cosmic Frontier Astrophysical Instruments for the 21st Century

    CERN Document Server

    Lobanov, Andrei P; Cesarsky, Catherine; Diamond, Phillip J

    2007-01-01

    In the coming decades, astrophysical science will benefit enormously from the construction and operation of several major international ground- and space based facilities, such as ALMA, Herschel/Planck, and SKA in the far infrared to radio band, Extremely Large Telescopes, JWST and GAIA in the optical to near infrared regime, XEUS and Constellation-X in the X-ray, and GLAST in the Gamma-ray regime. These and other new instruments will have a major impact in a wide range of scientific topics including the cosmological epoch of reionization, galactic dynamics and nuclear activity, stellar astronomy, extra-solar planets, gamma-ray bursts, X-ray binaries, and many others. On May 18-21, 2004, the Max-Planck-Society’s Harnack-Haus in Dahlem, Berlin hosted the international symposium "Exploring the Cosmic Frontier: Astrophysical Instruments for the 21st Century". The symposium in Berlin was dedicated to exploring the complementarity and synergies between different branches of astrophysical research, by presenting ...

  4. Preface: Eighth European Summer School on Experimental Nuclear Astrophysics

    International Nuclear Information System (INIS)

    Claudio, Spitaleri; Livio, Lamia; Gianluca, Pizzone Rosario

    2016-01-01

    predict the existence of different stellar environments which could produce the observed isotopic abundances, and the nuclear processes which must occur in these stars. This is also valid for elements heavier than iron production, when fusion reactions are of negligible importance and the main nucleosynthetic path goes through p-process, r-process, and s-process. Many of the nuclides generated in the huge explosion triggered by the last burnings in the life of a massive star are unstable. Then in order to understand what is going on in Supernovae explosions, Gamma-ray bursts, Novae it was pointed out that the physics of radioactive beams should be explored. Many group of physicists have then taken the opportunities offered by the world-wide developments of radioactive ion beams facilities to start to investigate such environments. In this field also the weak interaction processes are important and in some cases, like type II Supernovae, dominant. Additional nucleosynthetic paths, such as the i-processes were also introduced in one specific lecture. In order to better understand our Universe, a precise knowledge of nuclear inputs for nuclear astrophysics is therefore needed. They influence sensitively the nucleosynthesis of the elements in the early stages of the universe and in all the objects formed thereafter and control the associate energy generation, neutrino luminosity and stellar evolution. Thus a good knowledge of reaction rates is essential to understand this broad picture. Studies at the energies typical of nuclear astrophysics for charged particle induced reactions (few keV - 1 MeV) are severely hampered by the low signal-to-noise ratio, essentially due to the tiny cross sections that have to be measured (as low as picobarn in some cases). The best experimental solutions to this main problem will be discussed in this book and presented in their details. The pilot project, LUNA, i.e. a 50 keV accelerator installed in the Laboratori Nazionali del Gran Sasso has

  5. GRIPS - Gamma-Ray Imaging, Polarimetry and Spectroscopy

    Czech Academy of Sciences Publication Activity Database

    Greiner, J.; Mannheim, K.; Hudec, René; Mészáros, A.

    2012-01-01

    Roč. 34, č. 2 (2012), s. 551-582 ISSN 0922-6435 Institutional research plan: CEZ:AV0Z10030501 Keywords : compton and pair creation telescope * gamma-ray bursts * nucleosynthesis Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 2.969, year: 2012

  6. Plasma Astrophysics, part II Reconnection and Flares

    CERN Document Server

    Somov, Boris V

    2007-01-01

    This well-illustrated monograph is devoted to classic fundamentals, current practice, and perspectives of modern plasma astrophysics. The first part is unique in covering all the basic principles and practical tools required for understanding and working in plasma astrophysics. The second part presents the physics of magnetic reconnection and flares of electromagnetic origin in space plasmas within the solar system; single and double stars, relativistic objects, accretion disks, and their coronae are also covered. This book is designed mainly for professional researchers in astrophysics. However, it will also be interesting and useful to graduate students in space sciences, geophysics, as well as advanced students in applied physics and mathematics seeking a unified view of plasma physics and fluid mechanics.

  7. Plasma Astrophysics, Part I Fundamentals and Practice

    CERN Document Server

    Somov, Boris V

    2006-01-01

    This well-illustrated monograph is devoted to classic fundamentals, current practice, and perspectives of modern plasma astrophysics. The first part is unique in covering all the basic principles and practical tools required for understanding and working in plasma astrophysics. The second part presents the physics of magnetic reconnection and flares of electromagnetic origin in space plasmas within the solar system; single and double stars, relativistic objects, accretion disks, and their coronae are also covered. This book is designed mainly for professional researchers in astrophysics. However, it will also be interesting and useful to graduate students in space sciences, geophysics, as well as advanced students in applied physics and mathematics seeking a unified view of plasma physics and fluid mechanics.

  8. Astrophysical disks Collective and Stochastic Phenomena

    CERN Document Server

    Fridman, Alexei M; Kovalenko, Ilya G

    2006-01-01

    The book deals with collective and stochastic processes in astrophysical discs involving theory, observations, and the results of modelling. Among others, it examines the spiral-vortex structure in galactic and accretion disks , stochastic and ordered structures in the developed turbulence. It also describes sources of turbulence in the accretion disks, internal structure of disk in the vicinity of a black hole, numerical modelling of Be envelopes in binaries, gaseous disks in spiral galaxies with shock waves formation, observation of accretion disks in a binary system and mass distribution of luminous matter in disk galaxies. The editors adaptly brought together collective and stochastic phenomena in the modern field of astrophysical discs, their formation, structure, and evolution involving the methodology to deal with, the results of observation and modelling, thereby advancing the study in this important branch of astrophysics and benefiting Professional Researchers, Lecturers, and Graduate Students.

  9. The Astrophysical Multimessenger Observatory Network (AMON)

    Science.gov (United States)

    Smith. M. W. E.; Fox, D. B.; Cowen, D. F.; Meszaros, P.; Tesic, G.; Fixelle, J.; Bartos, I.; Sommers, P.; Ashtekar, Abhay; Babu, G. Jogesh; hide

    2013-01-01

    We summarize the science opportunity, design elements, current and projected partner observatories, and anticipated science returns of the Astrophysical Multimessenger Observatory Network (AMON). AMON will link multiple current and future high-energy, multimessenger, and follow-up observatories together into a single network, enabling near real-time coincidence searches for multimessenger astrophysical transients and their electromagnetic counterparts. Candidate and high-confidence multimessenger transient events will be identified, characterized, and distributed as AMON alerts within the network and to interested external observers, leading to follow-up observations across the electromagnetic spectrum. In this way, AMON aims to evoke the discovery of multimessenger transients from within observatory subthreshold data streams and facilitate the exploitation of these transients for purposes of astronomy and fundamental physics. As a central hub of global multimessenger science, AMON will also enable cross-collaboration analyses of archival datasets in search of rare or exotic astrophysical phenomena.

  10. Astrophysical observations: lensing and eclipsing Einstein's theories.

    Science.gov (United States)

    Bennett, Charles L

    2005-02-11

    Albert Einstein postulated the equivalence of energy and mass, developed the theory of special relativity, explained the photoelectric effect, and described Brownian motion in five papers, all published in 1905, 100 years ago. With these papers, Einstein provided the framework for understanding modern astrophysical phenomena. Conversely, astrophysical observations provide one of the most effective means for testing Einstein's theories. Here, I review astrophysical advances precipitated by Einstein's insights, including gravitational redshifts, gravitational lensing, gravitational waves, the Lense-Thirring effect, and modern cosmology. A complete understanding of cosmology, from the earliest moments to the ultimate fate of the universe, will require developments in physics beyond Einstein, to a unified theory of gravity and quantum physics.

  11. Doppler tomography in fusion plasmas and astrophysics

    DEFF Research Database (Denmark)

    Salewski, Mirko; Geiger, B.; Heidbrink, W. W.

    2015-01-01

    Doppler tomography is a well-known method in astrophysics to image the accretion flow, often in the shape of thin discs, in compact binary stars. As accretion discs rotate, all emitted line radiation is Doppler-shifted. In fast-ion Dα (FIDA) spectroscopy measurements in magnetically confined plasma......, the Dα-photons are likewise Doppler-shifted ultimately due to gyration of the fast ions. In either case, spectra of Doppler-shifted line emission are sensitive to the velocity distribution of the emitters. Astrophysical Doppler tomography has lead to images of accretion discs of binaries revealing bright...... and limits, analogies and differences in astrophysical and fusion plasma Doppler tomography and what can be learned by comparison of these applications....

  12. Laboratory Astrophysics Division of The AAS (LAD)

    Science.gov (United States)

    Salama, Farid; Drake, R. P.; Federman, S. R.; Haxton, W. C.; Savin, D. W.

    2012-10-01

    The purpose of the Laboratory Astrophysics Division (LAD) is to advance our understanding of the Universe through the promotion of fundamental theoretical and experimental research into the underlying processes that drive the Cosmos. LAD represents all areas of astrophysics and planetary sciences. The first new AAS Division in more than 30 years, the LAD traces its history back to the recommendation from the scientific community via the White Paper from the 2006 NASA-sponsored Laboratory Astrophysics Workshop. This recommendation was endorsed by the Astronomy and Astrophysics Advisory Committee (AAAC), which advises the National Science Foundation (NSF), the National Aeronautics and Space Administration (NASA), and the U.S. Department of Energy (DOE) on selected issues within the fields of astronomy and astrophysics that are of mutual interest and concern to the agencies. In January 2007, at the 209th AAS meeting, the AAS Council set up a Steering Committee to formulate Bylaws for a Working Group on Laboratory Astrophysics (WGLA). The AAS Council formally established the WGLA with a five-year mandate in May 2007, at the 210th AAS meeting. From 2008 through 2012, the WGLA annually sponsored Meetings in-a-Meeting at the AAS Summer Meetings. In May 2011, at the 218th AAS meeting, the AAS Council voted to convert the WGLA, at the end of its mandate, into a Division of the AAS and requested draft Bylaws from the Steering Committee. In January 2012, at the 219th AAS Meeting, the AAS Council formally approved the Bylaws and the creation of the LAD. The inaugural gathering and the first business meeting of the LAD were held at the 220th AAS meeting in Anchorage in June 2012. You can learn more about LAD by visiting its website at http://lad.aas.org/ and by subscribing to its mailing list.

  13. Laboratory Astrophysics Division of the AAS (LAD)

    Science.gov (United States)

    Salama, Farid; Drake, R. P.; Federman, S. R.; Haxton, W. C.; Savin, D. W.

    2012-01-01

    The purpose of the Laboratory Astrophysics Division (LAD) is to advance our understanding of the Universe through the promotion of fundamental theoretical and experimental research into the underlying processes that drive the Cosmos. LAD represents all areas of astrophysics and planetary sciences. The first new AAS Division in more than 30 years, the LAD traces its history back to the recommendation from the scientific community via the White Paper from the 2006 NASA-sponsored Laboratory Astrophysics Workshop. This recommendation was endorsed by the Astronomy and Astrophysics Advisory Committee (AAAC), which advises the National Science Foundation (NSF), the National Aeronautics and Space Administration (NASA), and the U.S. Department of Energy (DOE) on selected issues within the fields of astronomy and astrophysics that are of mutual interest and concern to the agencies. In January 2007, at the 209th AAS meeting, the AAS Council set up a Steering Committee to formulate Bylaws for a Working Group on Laboratory Astrophysics (WGLA). The AAS Council formally established the WGLA with a five-year mandate in May 2007, at the 210th AAS meeting. From 2008 through 2012, the WGLA annually sponsored Meetings in-a-Meeting at the AAS Summer Meetings. In May 2011, at the 218th AAS meeting, the AAS Council voted to convert the WGLA, at the end of its mandate, into a Division of the AAS and requested draft Bylaws from the Steering Committee. In January 2012, at the 219th AAS Meeting, the AAS Council formally approved the Bylaws and the creation of the LAD. The inaugural gathering and the first business meeting of the LAD were held at the 220th AAS meeting in Anchorage in June 2012. You can learn more about LAD by visiting its website at http://lad.aas.org/ and by subscribing to its mailing list.

  14. Byurakan Astrophysical Observatory as Cultural Centre

    Science.gov (United States)

    Mickaelian, A. M.; Farmanyan, S. V.

    2017-07-01

    NAS RA V. Ambartsumian Byurakan Astrophysical Observatory is presented as a cultural centre for Armenia and the Armenian nation in general. Besides being scientific and educational centre, the Observatory is famous for its unique architectural ensemble, rich botanical garden and world of birds, as well as it is one of the most frequently visited sightseeing of Armenia. In recent years, the Observatory has also taken the initiative of the coordination of the Cultural Astronomy in Armenia and in this field, unites the astronomers, historians, archaeologists, ethnographers, culturologists, literary critics, linguists, art historians and other experts. Keywords: Byurakan Astrophysical Observatory, architecture, botanic garden, tourism, Cultural Astronomy.

  15. Theoretical nuclear structure and astrophysics at FAIR

    International Nuclear Information System (INIS)

    Rodríguez, Tomás R

    2014-01-01

    Next generation of radioactive ion beam facilities like FAIR will open a bright future for nuclear structure and nuclear astrophysics research. In particular, very exotic nuclei (mainly neutron rich) isotopes will be produced and a lot of new exciting experimental data will help to test and improve the current nuclear models. In addition, these data (masses, reaction cross sections, beta decay half-lives, etc.) combined with the development of better theoretical approaches will be used as the nuclear physics input for astrophysical simulations. In this presentation I will review some of the state-of-the-art nuclear structure methods and their applications.

  16. Sources and astrophysical effects of gravitational waves

    International Nuclear Information System (INIS)

    Rees, M.J.

    1974-01-01

    The probable sources of short intense gravitational wave emissions are discussed and it is concluded, on the basis of current astrophysical ideas, that the number of events detected by an apparatus such as Weber's would not be more than one pulse par century. Some proposed explanations of a higher event rate are examined briefly but it is suggested that the sensitivity would probably have to be improved by a factor 10 8 if a few events per year due to extragalactic supernovae are to be detectable. The article concludes by mentioning several other kinds of gravitational waves of potential interest in astrophysics

  17. Advances in astronomy and astrophysics 9

    CERN Document Server

    Kopal, Zdenek

    1972-01-01

    Advances in Astronomy and Astrophysics, Volume 9 covers reviews on the advances in astronomy and astrophysics. The book presents reviews on the Roche model and its applications to close binary systems. The text then describes the part played by lunar eclipses in the evolution of astronomy; the classical theory of lunar eclipses; deviations from geometrical theory; and the methods of photometric observations of eclipses. The problems of other phenomena related in one way or another to lunar eclipses are also considered. The book further tackles the infrared observation on the eclipsed moon, as

  18. Advances in astronomy and astrophysics 7

    CERN Document Server

    Kopal, Zdenek

    2013-01-01

    Advances in Astronomy and Astrophysics, Volume 7 covers reviews about the advances in astronomy and astrophysics. The book presents reviews on the scattering of electrons by diatomic molecules and on Babcock's theory of the 22-year solar cycle and the latitude drift of the sunspot zone. The text then describes reviews on the structures of the terrestrial planets (Earth, Venus, Mars, Mercury) and on type III solar radio bursts. The compact and dispersed cosmic matter is also considered with regard to the search for new cosmic objects and phenomena and on the nature of the ref shift from compact

  19. Astrophysical relevance of γ transition energies

    International Nuclear Information System (INIS)

    Rauscher, Thomas

    2008-01-01

    The relevant γ energy range is explicitly identified where additional γ strength must be located to have an impact on astrophysically relevant reactions. It is shown that folding the energy dependences of the transmission coefficients and the level density leads to maximal contributions for γ energies of 2≤E γ ≤4 unless quantum selection rules allow isolated states to contribute. Under this condition, electric dipole transitions dominate. These findings allow us to more accurately judge the relevance of modifications of the γ strength for astrophysics

  20. Spherical Panoramas for Astrophysical Data Visualization

    Science.gov (United States)

    Kent, Brian R.

    2017-05-01

    Data immersion has advantages in astrophysical visualization. Complex multi-dimensional data and phase spaces can be explored in a seamless and interactive viewing environment. Putting the user in the data is a first step toward immersive data analysis. We present a technique for creating 360° spherical panoramas with astrophysical data. The three-dimensional software package Blender and the Google Spatial Media module are used together to immerse users in data exploration. Several examples employing these methods exhibit how the technique works using different types of astronomical data.

  1. On the saturation of astrophysical dynamos

    DEFF Research Database (Denmark)

    Dorch, Bertil; Archontis, Vasilis

    2004-01-01

    In the context of astrophysical dynamos we illustrate that the no-cosines flow, with zero mean helicity, can drive fast dynamo action and we study the dynamo's mode of operation during both the linear and non-linear saturation regimes. It turns out that in addition to a high growth rate in the li......In the context of astrophysical dynamos we illustrate that the no-cosines flow, with zero mean helicity, can drive fast dynamo action and we study the dynamo's mode of operation during both the linear and non-linear saturation regimes. It turns out that in addition to a high growth rate...

  2. Bibliometric indicators of young authors in astrophysics

    DEFF Research Database (Denmark)

    Havemann, Frank; Larsen, Birger

    2015-01-01

    We test 16 bibliometric indicators with respect to their validity at the level of the individual researcher by estimating their power to predict later successful researchers. We compare the indicators of a sample of astrophysics researchers who later co-authored highly cited papers before...... their first landmark paper with the distributions of these indicators over a random control group of young authors in astronomy and astrophysics. We find that field and citation-window normalisation substantially improves the predicting power of citation indicators. The sum of citation numbers normalised...

  3. Magnetic processes in astrophysics theory, simulations, experiments

    CERN Document Server

    Rüdiger, Günther; Hollerbach, Rainer

    2013-01-01

    In this work the authors draw upon their expertise in geophysical and astrophysical MHD to explore the motion of electrically conducting fluids, the so-called dynamo effect, and describe the similarities and differences between different magnetized objects. They also explain why magnetic fields are crucial to the formation of the stars, and discuss promising experiments currently being designed to investigate some of the relevant physics in the laboratory. This interdisciplinary approach will appeal to a wide audience in physics, astrophysics and geophysics. This second edition covers such add

  4. White Paper on Nuclear Astrophysics and Low Energy Nuclear Physics - Part 1. Nuclear Astrophysics

    Energy Technology Data Exchange (ETDEWEB)

    Arcones, Almudena [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Escher, Jutta E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Others, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2016-04-04

    This white paper informs the nuclear astrophysics community and funding agencies about the scientific directions and priorities of the field and provides input from this community for the 2015 Nuclear Science Long Range Plan. It summarizes the outcome of the nuclear astrophysics town meeting that was held on August 21 - 23, 2014 in College Station at the campus of Texas A&M University in preparation of the NSAC Nuclear Science Long Range Plan. It also reflects the outcome of an earlier town meeting of the nuclear astrophysics community organized by the Joint Institute for Nuclear Astrophysics (JINA) on October 9 - 10, 2012 Detroit, Michigan, with the purpose of developing a vision for nuclear astrophysics in light of the recent NRC decadal surveys in nuclear physics (NP2010) and astronomy (ASTRO2010). The white paper is furthermore informed by the town meeting of the Association of Research at University Nuclear Accelerators (ARUNA) that took place at the University of Notre Dame on June 12 - 13, 2014. In summary we find that nuclear astrophysics is a modern and vibrant field addressing fundamental science questions at the intersection of nuclear physics and astrophysics. These questions relate to the origin of the elements, the nuclear engines that drive life and death of stars, and the properties of dense matter. A broad range of nuclear accelerator facilities, astronomical observatories, theory efforts, and computational capabilities are needed. With the developments outlined in this white paper, answers to long-standing key questions are well within reach in the coming decade.

  5. Some highlights of the 14th Texas symposium on relativistic astrophysics

    International Nuclear Information System (INIS)

    Shapiro, M.M.

    1989-01-01

    The new channels in astrophysics, complementing the ancient science of optical astronomy, have come into their own in the past half-century. To be sure, the first of these disciplines---cosmic radiation---was discovered about 75 years ago, but two or three decades passed before it was perceived as a significant astrophysical phenomenon. Even the nature of the incoming radiation was not established until the 1940s. Then, in successive decades, came radio astronomy, x-ray and gamma-ray astronomy, and neutrino astronomy. With the growing sensitivity of gravitational-wave detectors, the confirmation of signals arriving in this channel of astronomy may happen within the next decade. Thus, the effective history of contemporary astronomy spans hardly more than half a century---twice the lifetime of the Texas symposia. This paper reports on some of the topics covered at the 14th Texas symposium

  6. Gamma astronomy

    International Nuclear Information System (INIS)

    Cesarsky, C.; Cesarsky, J.P.

    1986-01-01

    This article overviews the gamma astronomy research. Sources already observed, and what causes to give to them; the galactic radiation and its interpretation; techniques already used and current projects [fr

  7. Gamma Spectroscopy

    NARCIS (Netherlands)

    Niemantsverdriet, J.W.; Butz, Tilman; Ertl, G.; Knözinger, H.; Schüth, F.

    2008-01-01

    No abstract. The sections in this article are 1 Introduction 2 Mössbauer Spectroscopy 3 Time-Differential Perturbed Angular Correlations (TDPAC) 4 Conclusions and Outlook Keywords: Mössbauer spectroscopy; gamma spectroscopy; perturbed angular correlation; TDPAC

  8. Evolution and seismic tools for stellar astrophysics

    CERN Document Server

    Monteiro, Mario JPFG

    2008-01-01

    A collection of articles published by the journal "Astrophysics and Space Science, Volume 316, Number 1-4", August 2008. This work covers 10 evolution codes and 9 oscillation codes. It is suitable for researchers and research students working on the modeling of stars and on the implementation of seismic test of stellar models.

  9. The Trojan Horse Method in nuclear astrophysics

    International Nuclear Information System (INIS)

    Spitaleri, C.; Cherubini, S.; Del Zoppo, A.; Di Pietrob, A.; Figuerab, P.; Gulino, M.; Lattuadab, M.; Miljanic, Dstroke; Musumarra, A.; Pellegriti, M.G.; Pizzone, R.G.; Rolfs, C.; Romano, S.; Tudisco, S.; Tumino, A.

    2003-01-01

    The basic features of the Trojan Horse Method are discussed together with a review of recent applications, aimed to extract the bare astrophysical S(E)-factor for several two-body processes. In this framework information on electron screening potential U e was obtained from the comparison with direct experiments

  10. Nuclear astrophysics and the Trojan Horse Method

    Energy Technology Data Exchange (ETDEWEB)

    Spitaleri, C. [University of Catania, Dipartimento di Fisica e Astronomia, Catania (Italy); Laboratori Nazionali del Sud - INFN, Catania (Italy); La Cognata, M.; Pizzone, R.G. [Laboratori Nazionali del Sud - INFN, Catania (Italy); Lamia, L. [University of Catania, Dipartimento di Fisica e Astronomia, Catania (Italy); Mukhamedzhanov, A.M. [Texas A and M University, Cyclotron Institute, College Station, TX (United States)

    2016-04-15

    In this review, we discuss the new recent results of the Trojan Horse Method that is used to determine reaction rates for nuclear processes in several astrophysical scenarios. The theory behind this technique is shortly presented. This is followed by an overview of some new experiments that have been carried out using this indirect approach. (orig.)

  11. Studying shocks in model astrophysical flows

    International Nuclear Information System (INIS)

    Chakrabarti, S.K.

    1989-01-01

    We briefly discuss some properties of the shocks in the existing models for quasi two-dimensional astrophysical flows. All of these models which allow the study of shock analytically have some unphysical characteristics due to inherent assumptions made. We propose a hybrid model for a thin flow which has fewer unpleasant features and is suitable for the study of shocks. (author). 5 refs

  12. Neutrino Masses and Mixings and Astrophysics

    Science.gov (United States)

    Fuller, George M.

    1998-10-01

    Here we discuss the implications of light neutrino masses and neutrino flavor/type mixing for dark matter, big bang nucleosynthesis, and models of heavy element nucleosynthesis in super novae. We will also argue the other way and discuss possible constraints on neutrino physics from these astrophysical considerations.

  13. Astronomical optical interferometry, II: Astrophysical results

    Directory of Open Access Journals (Sweden)

    Jankov S.

    2011-01-01

    Full Text Available Optical interferometry is entering a new age with several ground- based long-baseline observatories now making observations of unprecedented spatial resolution. Based on a great leap forward in the quality and quantity of interferometric data, the astrophysical applications are not limited anymore to classical subjects, such as determination of fundamental properties of stars; namely, their effective temperatures, radii, luminosities and masses, but the present rapid development in this field allowed to move to a situation where optical interferometry is a general tool in studies of many astrophysical phenomena. Particularly, the advent of long-baseline interferometers making use of very large pupils has opened the way to faint objects science and first results on extragalactic objects have made it a reality. The first decade of XXI century is also remarkable for aperture synthesis in the visual and near-infrared wavelength regimes, which provided image reconstructions from stellar surfaces to Active Galactic Nuclei. Here I review the numerous astrophysical results obtained up to date, except for binary and multiple stars milliarcsecond astrometry, which should be a subject of an independent detailed review, taking into account its importance and expected results at microarcsecond precision level. To the results obtained with currently available interferometers, I associate the adopted instrumental settings in order to provide a guide for potential users concerning the appropriate instruments which can be used to obtain the desired astrophysical information.

  14. Nuclear astrophysics experiments with Pohang neutron facility

    International Nuclear Information System (INIS)

    Kim, Yeong Duk; Yoo, Gwang Ho

    1998-01-01

    Nuclear astrophysics experiments for fundamental understanding of Big Bang nucleosynthesis was performed at Pohang Neutron Facility. Laboratory experiments, inhomogeneous Big Bang nucleosynthesis and S-process were used for nucleosynthesis. For future study, more study on S-process for the desired data and nuclear network calculation are necessary

  15. Astrophysics, cosmology and high energy physics

    International Nuclear Information System (INIS)

    Rees, M.J.

    1983-01-01

    A brief survey is given of some topics in astrophysics and cosmology, with special emphasis on the inter-relation between the properties of the early Universe and recent ideas in high energy physics, and on simple order-of-magnitude arguments showing how the scales and dimensions of cosmic phenomena are related to basic physical constants. (orig.)

  16. Particle physics-astrophysics working group

    International Nuclear Information System (INIS)

    Cronin, J.W.; Kolb, E.W.

    1989-01-01

    The working group met each afternoon and listened to mini-symposia on a broad range of subjects covering all aspects of particle physics---astrophysics both theoretical and experimental. This paper reports that as a result, a number of papers which follow were commissioned to reflect the present status and future prospects of the field

  17. Workshop on gravitational waves and relativistic astrophysics

    Indian Academy of Sciences (India)

    Discussions related to gravitational wave experiments viz. LIGO and LISA as well as to observations of supermassive black holes dominated the workshop sessions on gravitational waves and relativistic astrophysics in the ICGC-2004. A summary of seven papers that were presented in these workshop sessions has been ...

  18. Exotic nuclear beta transitions astrophysical examples

    CERN Document Server

    Takahashi, K

    1981-01-01

    A theoretical study of nuclear beta -transitions under various astrophysical circumstances is reviewed by illustrative examples: 1) continuum-state electron captures in a matter in the nuclear statistical equiplibrium, and ii) bound-state beta -decays in stars in connection with a cosmochronometer and with the s-process branchings. (45 refs).

  19. Challenges and opportunities in laboratory plasma astrophysics

    Science.gov (United States)

    Drake, R. Paul

    2017-06-01

    We are in a period of explosive success and opportunity in the laboratory study of plasma phenomena that are relevant to astrophysics. In this talk I will share with you several areas in which recent work, often foreshadowed 20 or 30 years ago, has produced dramatic initial success with prospects for much more. To begin, the talk will provide a brief look at the types of devices used and the regimes they access, showing how they span many orders of magnitude in parameters of interest. It will then illustrate the types of work one can do with laboratory plasmas that are relevant to astrophysics, which range from direct measurement of material properties to the production of scaled models of certain dynamics to the pursuit of complementary understanding. Examples will be drawn from the flow of energy and momentum in astrophysics, the formation and structure of astrophysical systems, and magnetization and its consequences. I hope to include some discussion of collisionless shocks, very dense plasmas, work relevant to the end of the Dark Ages, reconnection, and dynamos. The talk will conclude by highlighting some topics where it seems that we may be on the verge of exciting new progress.The originators of work discussed, and collaborators and funding sources when appropriate, will be included in the talk.

  20. Statistics and Informatics in Space Astrophysics

    Science.gov (United States)

    Feigelson, E.

    2017-12-01

    The interest in statistical and computational methodology has seen rapid growth in space-based astrophysics, parallel to the growth seen in Earth remote sensing. There is widespread agreement that scientific interpretation of the cosmic microwave background, discovery of exoplanets, and classifying multiwavelength surveys is too complex to be accomplished with traditional techniques. NASA operates several well-functioning Science Archive Research Centers providing 0.5 PBy datasets to the research community. These databases are integrated with full-text journal articles in the NASA Astrophysics Data System (200K pageviews/day). Data products use interoperable formats and protocols established by the International Virtual Observatory Alliance. NASA supercomputers also support complex astrophysical models of systems such as accretion disks and planet formation. Academic researcher interest in methodology has significantly grown in areas such as Bayesian inference and machine learning, and statistical research is underway to treat problems such as irregularly spaced time series and astrophysical model uncertainties. Several scholarly societies have created interest groups in astrostatistics and astroinformatics. Improvements are needed on several fronts. Community education in advanced methodology is not sufficiently rapid to meet the research needs. Statistical procedures within NASA science analysis software are sometimes not optimal, and pipeline development may not use modern software engineering techniques. NASA offers few grant opportunities supporting research in astroinformatics and astrostatistics.

  1. Balance in the NASA Astrophysics Program

    Science.gov (United States)

    Elvis, Martin

    2017-08-01

    The Decadal studies are usually instructed to come up with a “balanced program” for the coming decade of astrophysics initiatives, both on the ground and in space. The meaning of “balance” is left up to the Decadal panels. One meaning is that there should be a diversity of mission costs in the portfolio. Another that there should be a diversity of science questions addressed. A third is that there should be a diversity of signals (across electromagnetic wavebands, and of non-em carriers). It is timely for the astronomy community to debate the meaning of balance in the NASA astrophysics program as the “Statement of Task” (SoT) that defines the goals and process of the 2020 Astrophysics Decadal review are now being formulated.Here I propose some ways in which the Astro2020 SoT could be made more specific in order to make balance more evident and so avoid the tendency for a single science question, and a single mission to answer that question, to dominate the program. As an example of an alternative ambitious approach, I present a proof-of-principle program of 6, mostly “probe-class” missions, that would fit the nominal funding profile for the 2025-2035 NASA Astrophysics Program, while being more diverse in ambitious science goals and in wavelength coverage.

  2. Microphysics, cosmology, and high energy astrophysics

    International Nuclear Information System (INIS)

    Hoyle, F.

    1974-01-01

    The discussion of microphysics, cosmology, and high energy astrophysics includes particle motion in an electromagnetic field, conformal transformations, conformally invariant theory of gravitation, particle orbits, Friedman models with k = 0, +-1, the history and present status of steady-state cosmology, and the nature of mass. (U.S.)

  3. Pulsars as tools for fundamental physics & astrophysics

    NARCIS (Netherlands)

    Cordes, J.M.; Kramer, M.; Lazio, T.J.W.; Stappers, B.W.; Backer, D.C.; Johnston, S.

    2004-01-01

    The sheer number of pulsars discovered by the SKA, in combination with the exceptional timing precision it can provide, will revolutionize the field of pulsar astrophysics. The SKA will provide a complete census of pulsars in both the Galaxy and in Galactic globular clusters that can be used to

  4. Cosmological grand unification monopoles: astrophysical constraints

    International Nuclear Information System (INIS)

    Fry, J.N.

    1982-01-01

    I review the general arguments which suggest that relic GU magnetic monopoles should emerge from the early universe, and I discuss several astrophysical settings in which their effects could be, but are not, observed. This places limits on their possible flux, and their abundance bound to more ordinary material

  5. Astrophysical contributions of the International Ultraviolet Explorer

    International Nuclear Information System (INIS)

    Kondo, Y.; Boggess, A.; Maran, S.P.

    1989-01-01

    Findings that have been made by the IUE in a variety of astrophysical areas are reviewed. Results on stellar chromospheres and transition regions, evolutionary processes in interacting binaries, winds from early-type stars, the ISM, SN 1987A, active galactic nuclei, and solar system objects are addressed. 158 refs

  6. Minicourses in Astrophysics, Modular Approach, Vol. II.

    Science.gov (United States)

    Illinois Univ., Chicago.

    This is the second of a two-volume minicourse in astrophysics. It contains chapters on the following topics: stellar nuclear energy sources and nucleosynthesis; stellar evolution; stellar structure and its determination; and pulsars. Each chapter gives much technical discussion, mathematical treatment, diagrams, and examples. References are…

  7. Teaching Astrophysics to Upper Level Undergraduates

    Science.gov (United States)

    Van Dorn Bradt, Hale

    2010-03-01

    A Socratic peer-instruction method for teaching upper level undergraduates is presented. Basically, the instructor sits with the students and guides their presentations of the material. My two textbooks* (on display) as well as many others are amenable to this type of teaching. *Astronomy Methods - A Physical Approach to Astronomical Observations (CUP 2004) *Astrophysics Processes-The Physics of Astronomical Phenomena (CUP 2008)

  8. Astronomy and astrophysics in the new millennium: Panel reports

    National Research Council Canada - National Science Library

    Astronomy and Astrophysics Survey Committee, Board on Physics and Astronomy, Space Studies Board, National Research Council

    2001-01-01

    In preparing the report, Astronomy and Astrophysics in the New Millenium , the AASC made use of a series of panel reports that address various aspects of ground- and space-based astronomy and astrophysic...

  9. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Since 1977, papers in Astrophysics and Astronomy appeared as a special section in Pramana. ... The journal publishes original research papers on all aspects of astrophysics and ... Articles are also visible in Web of Science immediately.

  10. Discovery of Very High Energy Gamma Rays from PKS 1424+240 and Multiwavelength Constraints on its Redshift

    Energy Technology Data Exchange (ETDEWEB)

    Acciari, V.A.; /Harvard-Smithsonian Ctr. Astrophys.; Aliu, E.; /Delaware U., Bartol Inst.; Arlen, T.; /UCLA; Aune, T.; /UC, Santa Cruz; Bautista, M.; /McGill U.; Beilicke, M. /Washington U., St. Louis; Benbow, W.; /Harvard-Smithsonian Ctr. Astrophys.; Bottcher, M.; /Ohio U.; Boltuch, D.; /Delaware U., Bartol Inst.; Bradbury, S.M.; /Leeds U.; Buckley, J.H.; /Washington U., St. Louis; Bugaev, V.; /Washington U., St. Louis; Byrum, K.; /Argonne; Cannon, A.; /University Coll., Dublin; Cesarini, A.; /Natl. U. of Ireland, Galway; Chow, Y.C.; /UCLA; Ciupik, L.; /Roosevelt U., Chicago; Cogan, P.; /McGill U.; Cui, W.; /Purdue U.; Duke, C.; /Grinnell Coll.; Falcone, A.; /Penn State U. /Purdue U. /Utah U. /Roosevelt U., Chicago /Harvard-Smithsonian Ctr. Astrophys. /Purdue U. /Natl. U. of Ireland, Galway /Utah U. /University Coll., Dublin /McGill U. /Roosevelt U., Chicago /McGill U. /Delaware U., Bartol Inst. /Utah U. /Chicago U., EFI /Iowa State U. /Roosevelt U., Chicago /DePauw U. /Utah U. /Pittsburg State U. /Washington U., St. Louis /Iowa State U. /Natl. U. of Ireland, Galway /Utah U. /McGill U. /Washington U., St. Louis /McGill U. /McGill U. /Purdue U. /Anderson U. /Galway-Mayo Inst. of Tech. /Iowa State U. /UCLA; /more authors..

    2012-04-05

    We report the first detection of very-high-energy (VHE) gamma-ray emission above 140GeV from PKS 1424+240, a BL Lac object with an unknown redshift. The photon spectrum above 140GeV measured by VERITAS is well described by a power law with a photon index of 3.8 {+-}0.5{sub stat} {+-} 0.3{sub syst} and a flux normalization at 200 GeV of (5.1 {+-} 0.9{sub stat} {+-} 0.5{sub syst}) x 10{sup -11} TeV{sup -1} cm{sup -2} s{sup -1}, where stat and syst denote the statistical and systematical uncertainty, respectively. The VHE flux is steady over the observation period between MJD 54881 and 55003 (2009 February 19 to June 21). Flux variability is also not observed in contemporaneous high energy observations with the Fermi Large Area Telescope (LAT). Contemporaneous X-ray and optical data were also obtained from the Swift XRT and MDM observatory, respectively. The broadband spectral energy distribution (SED) is well described by a one-zone synchrotron self-Compton (SSC) model favoring a redshift of less than 0.1. Using the photon index measured with Fermi in combination with recent extragalactic background light (EBL) absorption models it can be concluded from the VERITAS data that the redshift of PKS 1424+240 is less than 0.66.

  11. Study of aluminum emission spectra in astrophysical plasmas

    International Nuclear Information System (INIS)

    Jin Zhan; Zhang Jie

    2001-01-01

    High temperature, high density and strong magnetic fields in plasmas produced by ultra-high intensity and ultrashort laser pulses are similar to the main characteristics of astrophysical plasmas. This makes it possible to simulate come astrophysical processes at laboratories. The author presents the theoretic simulation of aluminum emission spectra in astrophysical plasmas. It can be concluded that using laser produced plasmas, the authors can obtain rich information on astrophysical spectroscopy, which is unobservable for astronomer

  12. Gamma-Ray Imaging Spectrometer (GRIS): a new balloon-borne experiment for gamma-ray line astronomy

    International Nuclear Information System (INIS)

    Teegarden, B.J.; Cline, T.L.; Gehrels, N.; Porreca, G.; Tueller, J.; Leventhal, M.; Huters, A.F.; Maccallum, C.J.; Stang, P.D.; Sandia Labs., Albuquerque, NM)

    1985-01-01

    High resolution gamma-ray spectroscopy is a relatively new field that holds great promise for further understanding of high energy astrophysical processes. When the high resolution gamma-ray spectrometer (GRSE) was removed from the GRO payload, a balloon program was initiated to permit continued development and improvement of instrumentation in this field, as well as continued scientific observations. The Gamma-Ray Imaging Spectrometer (GRIS) is one of the experiments selected as part of this program. The instrument contains a number of new and innovative features that are expected to produce a significant improvement in source location accuracy and sensitivity over previous balloon and satellite experiments

  13. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy. Anjan A. Sen. Articles written in Journal of Astrophysics and Astronomy. Volume 37 Issue 4 December 2016 pp 33 Review. Cosmology and Astrophysics using the Post-Reionization HI · Tapomoy Guha Sarkar Anjan A. Sen · More Details Abstract Fulltext PDF.

  14. 3rd Session of the Sant Cugat Forum on Astrophysics

    CERN Document Server

    Gravitational wave astrophysics

    2015-01-01

    This book offers review chapters written by invited speakers of the 3rd Session of the Sant Cugat Forum on Astrophysics — Gravitational Waves Astrophysics. All chapters have been peer reviewed. The book goes beyond normal conference proceedings in that it provides a wide panorama of the astrophysics of gravitational waves and serves as a reference work for researchers in the field.

  15. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Indian Institute of Astrophysics, Koramangala, Bangalore 560 034, India. Kavli Institute for Astronomy & Astrophysics, Peking University, Beijing 100871, China. National Research Council of Canada, Herzberg Institute of Astrophysics, 5071 West Saanich Road, Victoria, British Columbia, Canada. Thirty Meter Project Office, ...

  16. 75 FR 2893 - NASA Advisory Council; Science Committee; Astrophysics Subcommittee; Meeting

    Science.gov (United States)

    2010-01-19

    ... Committee; Astrophysics Subcommittee; Meeting AGENCY: National Aeronautics and Space Administration. ACTION... of the Astrophysics Subcommittee of the NASA Advisory Council (NAC). This Subcommittee reports to the... following topics: --Astrophysics Division Update --Updates on Select Astrophysics Missions --Discussion of...

  17. 78 FR 2293 - NASA Advisory Council; Science Committee; Astrophysics Subcommittee; Meeting

    Science.gov (United States)

    2013-01-10

    ... Committee; Astrophysics Subcommittee; Meeting AGENCY: National Aeronautics and Space Administration. ACTION... amended, the National Aeronautics and Space Administration (NASA) announces a meeting of the Astrophysics... meeting includes the following topics: --Astrophysics Division Update --NASA Astrophysics Roadmapping It...

  18. 78 FR 66384 - NASA Advisory Council; Science Committee; Astrophysics Subcommittee; Meeting

    Science.gov (United States)

    2013-11-05

    ... Committee; Astrophysics Subcommittee; Meeting AGENCY: National Aeronautics and Space Administration. ACTION... amended, the National Aeronautics and Space Administration (NASA) announces a meeting of the Astrophysics...: --Astrophysics Division Update --Presentation of Astrophysics Roadmap --Reports from Program Analysis Groups...

  19. 75 FR 51116 - NASA Advisory Council; Science Committee; Astrophysics Subcommittee; Meeting

    Science.gov (United States)

    2010-08-18

    ... Committee; Astrophysics Subcommittee; Meeting AGENCY: National Aeronautics and Space Administration. ACTION... amended, the National Aeronautics and Space Administration (NASA) announces a meeting of the Astrophysics... topics: --Astrophysics Division Update --2010 Astronomy and Astrophysics Decadal Survey --Update on...

  20. Resonant elastic scattering, inelastic scattering and astrophysical reactions; Diffusion elastique resonante, diffusion inelastique et reactions astrophysiques

    Energy Technology Data Exchange (ETDEWEB)

    De Oliveira Santos, F. [Grand Accelerateur National d' Ions Lourds, UMR 6415, 14 - Caen (France)

    2007-07-01

    Nuclear reactions can occur at low kinetic energy. Low-energy reactions are characterized by a strong dependence on the structure of the compound nucleus. It turns out that it is possible to study the nuclear structure by measuring these reactions. In this course, three types of reactions are treated: Resonant Elastic Scattering (such as N{sup 14}(p,p)N{sup 14}), Inelastic Scattering (such as N{sup 14}(p,p')N{sup 14*}) and Astrophysical reactions (such as N{sup 14}(p,{gamma})O{sup 15}). (author)

  1. γ astrophysics above 10-30 GeV with the MAGIC telescope

    International Nuclear Information System (INIS)

    Mirzoyan, Razmick

    1999-01-01

    The project on the 17 m oe telescope, dubbed MAGIC (Major Atmospheric Gamma Imaging Cherenkov Telescope), is dedicated for γ astrophysics in the energy range from 10-30 GeV till 50-100 TeV. MAGIC will for the first time allow to explore with very high sensitivity the energy range 10-300 GeV and to bridge the existing energy gap between satellite and ground-based air Cherenkov measurements. We believe MAGIC will serve as a prototype for future multi-telescope γ ray observatories

  2. The opacity of the universe for high and very high energy {gamma}-rays

    Energy Technology Data Exchange (ETDEWEB)

    Meyer, Manuel

    2013-08-15

    The flux of high energy (HE, energy 100 MeVVHE, E>or similar 100 GeV) {gamma}-rays originating from cosmological sources is attenuated due to pair production in interactions with photons at ultraviolet to infrared wavelengths of the extragalactic background light (EBL). The main components contributing to the EBL photon density are the starlight integrated over cosmic time and the starlight reprocessed by dust in galaxies. Consequently, the EBL is an integral measure of the cosmic star formation history. Depending on the source distance, the Universe should be opaque to {gamma}-rays above a certain energy. Nevertheless, the number of detected {gamma}-ray sources has increased continuously in recent years. VHE emitting objects beyond redshifts of z>0.5 have been detected with imaging air Cherenkov telescopes (IACTs), while HE {gamma}-rays from active galactic nuclei (AGN) above redshifts z>or similar 3 have been observed with the Large Area Telescope (LAT) on board the Fermi satellite. In this work, a large sample of VHE {gamma}-ray spectra will be combined with data of the Fermi-LAT to derive upper limits on the EBL photon density at z = 0. Generic EBL realizations are used to correct AGN spectra for absorption, which are subsequently tested against model assumptions. The evolution of the EBL with redshift is accounted for, and a possible formation of electromagnetic cascades is considered. As a result, the EBL density is constrained over almost three orders of magnitude in wavelength, between 0.4 {mu}m and 100 {mu}m. At optical wavelengths, an EBL intensity above 24 nW m{sup -2}sr{sup -1} is ruled out, and between 8 {mu}m and 31 {mu}m it is limited to be below 5 nW m{sup -2}sr{sup -1}. In the infrared, the constraints are within a factor {proportional_to} 2 of lower limits derived from galaxy number counts. Additionally,the behavior of VHE spectra in the transition from the optical depth regimes {tau

  3. NASA Astrophysics Funds Strategic Technology Development

    Science.gov (United States)

    Seery, Bernard D.; Ganel, Opher; Pham, Bruce

    2016-01-01

    The COR and PCOS Program Offices (POs) reside at the NASA Goddard Space Flight Center (GSFC), serving as the NASA Astrophysics Division's implementation arm for matters relating to the two programs. One aspect of the PO's activities is managing the COR and PCOS Strategic Astrophysics Technology (SAT) program, helping mature technologies to enable and enhance future astrophysics missions. For example, the SAT program is expected to fund key technology developments needed to close gaps identified by Science and Technology Definition Teams (STDTs) planned to study several large mission concept studies in preparation for the 2020 Decadal Survey.The POs are guided by the National Research Council's "New Worlds, New Horizons in Astronomy and Astrophysics" Decadal Survey report, NASA's Astrophysics Implementation Plan, and the visionary Astrophysics Roadmap, "Enduring Quests, Daring Visions." Strategic goals include dark energy, gravitational waves, and X-ray observatories. Future missions pursuing these goals include, e.g., US participation in ESA's Euclid, Athena, and L3 missions; Inflation probe; and a large UV/Optical/IR (LUVOIR) telescope.To date, 65 COR and 71 PCOS SAT proposals have been received, of which 15 COR and 22 PCOS projects were funded. Notable successes include maturation of a new far-IR detector, later adopted by the SOFIA HAWC instrument; maturation of the H4RG near-IR detector, adopted by WFIRST; development of an antenna-coupled transition-edge superconducting bolometer, a technology deployed by BICEP2/BICEP3/Keck to measure polarization in the CMB signal; advanced UV reflective coatings implemented on the optics of GOLD and ICON, two heliophysics Explorers; and finally, the REXIS instrument on OSIRIS-REx is incorporating CCDs with directly deposited optical blocking filters developed by another SAT-funded project.We discuss our technology development process, with community input and strategic prioritization informing calls for SAT proposals and

  4. Observing with a space-borne gamma-ray telescope: selected results from INTEGRAL

    International Nuclear Information System (INIS)

    Schanne, Stephane

    2006-01-01

    The International Gamma-Ray Astrophysics Laboratory, i.e. the INTEGRAL satellite of ESA, in orbit since about 3 years, performs gamma-ray observations of the sky in the 15 keV to 8 MeV energy range. Thanks to its imager IBIS, and in particular the ISGRI detection plane based on 16384 CdTe pixels, it achieves an excellent angular resolution (12 arcmin) for point source studies with good continuum spectrum sensitivity. Thanks to its spectrometer SPI, based on 19 germanium detectors maintained at 85 K by a cryogenic system, located inside an active BGO veto shield, it achieves excellent spectral resolution of about 2 keV for 1 MeV photons, which permits astrophysical gamma-ray line studies with good narrow-line sensitivity. In this paper we review some goals of gamma-ray astronomy from space and present the INTEGRAL satellite, in particular its instruments ISGRI and SPI. Ground and in-flight calibration results from SPI are presented, before presenting some selected astrophysical results from INTEGRAL. In particular results on point source searches are presented, followed by results on nuclear astrophysics, exemplified by the study of the 1809 keV gamma-ray line from radioactive 26 Al nuclei produced by the ongoing stellar nucleosynthesis in the Galaxy. Finally a review on the study of the positron-electron annihilation in the Galactic center region, producing 511 keV gamma-rays, is presented

  5. White paper on nuclear astrophysics and low energy nuclear physics Part 1: Nuclear astrophysics

    International Nuclear Information System (INIS)

    Arcones, Almudena; Bardayan, Dan W.

    2016-01-01

    This white paper informs the nuclear astrophysics community and funding agencies about the scientific directions and priorities of the field and provides input from this community for the 2015 Nuclear Science Long Range Plan. It also summarizes the outcome of the nuclear astrophysics town meeting that was held on August 21–23, 2014 in College Station at the campus of Texas A&M University in preparation of the NSAC Nuclear Science Long Range Plan. It also reflects the outcome of an earlier town meeting of the nuclear astrophysics community organized by the Joint Institute for Nuclear Astrophysics (JINA) on October 9–10, 2012 Detroit, Michigan, with the purpose of developing a vision for nuclear astrophysics in light of the recent NRC decadal surveys in nuclear physics (NP2010) and astronomy (ASTRO2010). Our white paper is informed informed by the town meeting of the Association of Research at University Nuclear Accelerators (ARUNA) that took place at the University of Notre Dame on June 12–13, 2014. In summary we find that nuclear astrophysics is a modern and vibrant field addressing fundamental science questions at the intersection of nuclear physics and astrophysics. These questions relate to the origin of the elements, the nuclear engines that drive life and death of stars, and the properties of dense matter. A broad range of nuclear accelerator facilities, astronomical observatories, theory efforts, and computational capabilities are needed. Answers to long standing key questions are well within reach in the coming decade because of the developments outlined in this white paper.

  6. Gamma camera

    International Nuclear Information System (INIS)

    Berninger, W.H.

    1975-01-01

    The light pulse output of a scintillator, on which incident collimated gamma rays impinge, is detected by an array of photoelectric tubes each having a convexly curved photocathode disposed in close proximity to the scintillator. Electronic circuitry connected to outputs of the phototubes develops the scintillation event position coordinate electrical signals with good linearity and with substantial independence of the spacing between the scintillator and photocathodes so that the phototubes can be positioned as close to the scintillator as is possible to obtain less distortion in the field of view and improved spatial resolution as compared to conventional planar photocathode gamma cameras

  7. Applications for X-ray detectors in astrophysics

    International Nuclear Information System (INIS)

    Remillard, R.A.

    2003-01-01

    Full text: Position-sensitive X-Ray detectors continue to playa central role in high-energy astrophysics. The current science goals are reviewed with emphasis on requirements in terms of camera performance. Wide-field imaging techniques, including coded mask cameras, are an essential part of space programs because of the transient nature of high-priority targets, e.g. eruptions from black-hole binaries and cosmic explosions such as gamma ray bursts. Pointing X-ray telescopes are being planned with a wide range of photon energies and with collection designs that include both mirrors and coded masks. Requirements for high spectral resolution and high time resolution are driven by diverse types of X-ray sources such as msec pulsars, quasars with emission-line profiles shaped by general relativity, and X-ray binaries that exhibit quasi-periodic oscillations in the range of 40-1300 Hz. Many laboratories and universities are involved in space-qualification of new detector technologies, e.g. CZT cameras, X-ray calorimeters, new types of CCDs, and GEM detectors. Even X-ray interferometry is on the horizon of NASA's science roadmap. The difficulties in advancing new technologies for space science applications require careful coordinations between industry and science groups in order to solve science problems while minimizing risk

  8. Fullerenes, PAHs, Amino Acids and High Energy Astrophysics

    Directory of Open Access Journals (Sweden)

    Susana Iglesias-Groth

    2014-12-01

    Full Text Available We present theoretical, observational and laboratory work on the spectral properties of fullerenes and hydrogenated fullerenes. Fullerenes in its various forms (individual, endohedral, hydrogenated, etc. can contribute to the UV bump in the extinction curves measured in many lines of sight of the Galaxy. They can also produce a large number of absorption features in the optical and near infrared which could be associated with diffuse interstellar bands. We summarise recent laboratory work on the spectral characterisation of fullerenes and hydrogenated fullerenes (for a range of temperatures. The recent detection of mid-IR bands of fullerenes in various astrophysical environments (planetary nebulae, reflection nebulae provide additional evidence for a link between fullerene families and diffuse interstellar bands. We describe recent observational work on near IR bands of C60+ in a protoplanetary nebula which support fullerene formation during the post-AGB phase. We also report on the survival of fullerenes to irradiation by high energy particles and gamma photons and laboratory work to explore the chemical  reactions that take place when fullerenes are exposed to this radiations in the presence of water, ammonia and other molecules as a potential path to form amino acids.

  9. TeV Particle Astrophysics 2010, Booklet of abstracts

    International Nuclear Information System (INIS)

    None, C.; Davide Ferella, A.; Pato, M.; Catena, R.; Salucci, P.; Rielage, K.; Kobayashi, K.; Degunda, U.; Estrada, J.; Yue, Q.; Benbow, W.; Maestro, P.; Berghaus, P.; Benzvi, S.; Gallant, Y.; Coniglione, R.; Frey, R.; Besson, D.; Odrowski, S.; Ernenwein, J.P.; Dios Zornosa, J. de; Colnard, C.; Cavalcante de Souza, J.; Fraija, N.; Cerdeno, D.; Moroi, T.; Kumar, J.; Slatyer, T.; Yaguna, C.; Thomson, G.; Tameda, Y.; Taylor, A.; Giacinti, G.; Calvez, A.; Kotera, K.; Shinozaki, K.; Aharonian, F.; Essey, W.; Ahlers, M.; Fargion, D.; Canadas, B.; Boehm, C.; Palomares-Ruiz, S.; Panci, P.; Sanchez-Conde, M.A.; Hensley, B.; Vivier, M.; Hooper, D.; Finkbeiner, D.; Dobler, G.; Malyshev, D.; Mertsch, P.; Giannios, D.; Dalton, M.; Casandijan, J.M.; Mukherjee, R.; Morlino, G.; Ando, S.; Gilmore, R.; Medina, C.; Weitzel, Q.; Caprioli, D.; Vovk, I.; Vincent, S.; Delahaye, T.; Lavalle, J.; Galli, S.; Crocker, R.; Catena, R.; Cholis, I.; Sandick, P.; Rydberg, C.E.; Hulss, J.P.; Danninger, M.; Tran, D.; Spolyar, D.; Belanger, G.; Ronga, F.; Montanino, D.; Fornasa, M.; Regoes, E.; Caprioli, D.; Morlino, G.; Ostapchenko, S.; Kawanaka, N.; Kalli, S.; Whitehorn, N.; Boutayeb, B.; Casanellas, J.; Lopes, I.

    2012-01-01

    The aim of the conference is to bring together theorists and experimentalists working in the fields of Particle Physics, Astrophysics and Cosmology, with a shared interest in physical processes at the TeV energy scale. After decades of theoretical speculation, the exploration of the TeV energy frontier has now in fact begun, with the results provided by ground-based and space-born observatories of gamma-rays (Fermi, HESS, Magic, Veritas, Cangaroo, Milagro), anti-matter (PAMELA, ATIC, HESS and soon AMS-02) and neutrinos (IceCube, Antares), with a large number of ongoing direct Dark Matter search experiments exploiting different detection techniques, and with the TeV particle accelerators Tevatron and the Large Hadron Collider. The physics underlying these experiments involves many intertwined issues, such as the nature of Dark Matter, Physics beyond the Standard Model, the origin of Cosmic Rays and the distribution of Dark and visible matter in the Universe. This document gathers only the abstracts of the papers. (authors)

  10. DIAPHANE: A portable radiation transport library for astrophysical applications

    Science.gov (United States)

    Reed, Darren S.; Dykes, Tim; Cabezón, Rubén; Gheller, Claudio; Mayer, Lucio

    2018-05-01

    One of the most computationally demanding aspects of the hydrodynamical modelingof Astrophysical phenomena is the transport of energy by radiation or relativistic particles. Physical processes involving energy transport are ubiquitous and of capital importance in many scenarios ranging from planet formation to cosmic structure evolution, including explosive events like core collapse supernova or gamma-ray bursts. Moreover, the ability to model and hence understand these processes has often been limited by the approximations and incompleteness in the treatment of radiation and relativistic particles. The DIAPHANE project has focused on developing a portable and scalable library that handles the transport of radiation and particles (in particular neutrinos) independently of the underlying hydrodynamic code. In this work, we present the computational framework and the functionalities of the first version of the DIAPHANE library, which has been successfully ported to three different smoothed-particle hydrodynamic codes, GADGET2, GASOLINE and SPHYNX. We also present validation of different modules solving the equations of radiation and neutrino transport using different numerical schemes.

  11. Visualization needs and techniques for astrophysical simulations

    International Nuclear Information System (INIS)

    Kapferer, W; Riser, T

    2008-01-01

    Numerical simulations have evolved continuously towards being an important field in astrophysics, equivalent to theory and observation. Due to the enormous developments in computer sciences, both hardware- and software-architecture, state-of-the-art simulations produce huge amounts of raw data with increasing complexity. In this paper some aspects of problems in the field of visualization in numerical astrophysics in combination with possible solutions are given. Commonly used visualization packages along with a newly developed approach to real-time visualization, incorporating shader programming to uncover the computational power of modern graphics cards, are presented. With these techniques at hand, real-time visualizations help scientists to understand the coherences in the results of their numerical simulations. Furthermore a fundamental problem in data analysis, i.e. coverage of metadata on how a visualization was created, is highlighted.

  12. Critical ionisation velocity effects in astrophysical plasmas

    International Nuclear Information System (INIS)

    Raadu, M.A.

    1979-08-01

    Critical ionisation velocity effects are relevant to astrophysical situations where neutral gas moves through a magnetised plasma. The experimental significance of the critical velocity is well established and the physical basis is now becoming clear. The underlying mechanism depends on the combined effects of electron impact ionisation and electron energisation by collective plasma interactions. For low density plasmas a theory based on a circular process involving electron heating through a modified two stream instability has been developed. Several applications of critical velocity effects to astrophysical plasmas have been discussed in the literature. The importance of the effect in any particular case may be determined from a detailed consideration of energy and momentum balance, using appropriate atomic rate coefficients and taking full account of collective plasma processes. (Auth.)

  13. International Conference on Particle Physics and Astrophysics

    CERN Document Server

    2015-01-01

    The International Conference on Particle Physics and Astrophysics (ICPPA-2015) will be held in Moscow, Russia, from October 5 to 10, 2015. The conference is organized by Center of Basic Research and Particle Physics of National Research Nuclear University “MEPhI”. The aim of the Conference is to promote contacts between scientists and development of new ideas in fundamental research. Therefore we will bring together experts and young scientists working on experimental and theoretical aspects of nuclear, particle, astroparticle physics and cosmology. ICPPA-2015, aims to present the most recent results in astrophysics and collider physics and reports from the main experiments currently taking data. The working languages of the conference are English and Russian.

  14. Underground nuclear astrophysics at the Dresden Felsenkeller

    Energy Technology Data Exchange (ETDEWEB)

    Bemmerer, Daniel; Ilgner, Christoph; Junghans, Arnd R.; Mueller, Stefan; Rimarzig, Bernd; Schwengner, Ronald; Szuecs, Tamas; Wagner, Andreas [Helmholtz-Zentrum Dresden-Rossendorf (HZDR), Dresden (Germany); Cowan, Thomas E.; Gohl, Stefan; Grieger, Marcel; Reinicke, Stefan; Roeder, Marko; Schmidt, Konrad; Stoeckel, Klaus; Takacs, Marcell P.; Wagner, Louis [Helmholtz-Zentrum Dresden-Rossendorf (HZDR), Dresden (Germany); Technische Universitaet Dresden (Germany); Reinhardt, Tobias P.; Zuber, Kai [Technische Universitaet Dresden (Germany)

    2015-07-01

    Favored by the low background underground, accelerator-based experiments are an important tool to study nuclear astrophysics reactions involving stable charged particles. This technique has been used with great success at the 0.4 MV LUNA accelerator in the Gran Sasso laboratory in Italy. However, the nuclear reactions of helium and carbon burning and the neutron source reactions for the astrophysical s-process require higher beam energies, as well as the continuation of solar fusion studies. As a result, NuPECC strongly recommended the installation of one or more higher-energy underground accelerators. Such a project is underway in Dresden. A 5 MV Pelletron accelerator is currently being refurbished by installing an ion source on the high voltage terminal, enabling intensive helium beams. The preparation of the underground site is funded, and the civil engineering project is being updated. The science case, operational strategy and project status are reported.

  15. Numerical Methods for Radiation Magnetohydrodynamics in Astrophysics

    Energy Technology Data Exchange (ETDEWEB)

    Klein, R I; Stone, J M

    2007-11-20

    We describe numerical methods for solving the equations of radiation magnetohydrodynamics (MHD) for astrophysical fluid flow. Such methods are essential for the investigation of the time-dependent and multidimensional dynamics of a variety of astrophysical systems, although our particular interest is motivated by problems in star formation. Over the past few years, the authors have been members of two parallel code development efforts, and this review reflects that organization. In particular, we discuss numerical methods for MHD as implemented in the Athena code, and numerical methods for radiation hydrodynamics as implemented in the Orion code. We discuss the challenges introduced by the use of adaptive mesh refinement in both codes, as well as the most promising directions for future developments.

  16. Astrophysical data analysis with information field theory

    International Nuclear Information System (INIS)

    Enßlin, Torsten

    2014-01-01

    Non-parametric imaging and data analysis in astrophysics and cosmology can be addressed by information field theory (IFT), a means of Bayesian, data based inference on spatially distributed signal fields. IFT is a statistical field theory, which permits the construction of optimal signal recovery algorithms. It exploits spatial correlations of the signal fields even for nonlinear and non-Gaussian signal inference problems. The alleviation of a perception threshold for recovering signals of unknown correlation structure by using IFT will be discussed in particular as well as a novel improvement on instrumental self-calibration schemes. IFT can be applied to many areas. Here, applications in in cosmology (cosmic microwave background, large-scale structure) and astrophysics (galactic magnetism, radio interferometry) are presented

  17. Status reports of supercomputing astrophysics in Japan

    International Nuclear Information System (INIS)

    Nakamura, Takashi; Nagasawa, Mikio

    1990-01-01

    The Workshop on Supercomputing Astrophysics was held at National Laboratory for High Energy Physics (KEK, Tsukuba) from August 31 to September 2, 1989. More than 40 participants of physicists, astronomers were attendant and discussed many topics in the informal atmosphere. The main purpose of this workshop was focused on the theoretical activities in computational astrophysics in Japan. It was also aimed to promote effective collaboration between the numerical experimentists working on supercomputing technique. The various subjects of the presented papers of hydrodynamics, plasma physics, gravitating systems, radiative transfer and general relativity are all stimulating. In fact, these numerical calculations become possible now in Japan owing to the power of Japanese supercomputer such as HITAC S820, Fujitsu VP400E and NEC SX-2. (J.P.N.)

  18. Modern fluid dynamics for physics and astrophysics

    CERN Document Server

    Regev, Oded; Yecko, Philip A

    2016-01-01

    This book grew out of the need to provide students with a solid introduction to modern fluid dynamics. It offers a broad grounding in the underlying principles and techniques used, with some emphasis on applications in astrophysics and planetary science. The book comprehensively covers recent developments, methods and techniques, including, for example, new ideas on transitions to turbulence (via transiently growing stable linear modes), new approaches to turbulence (which remains the enigma of fluid dynamics), and the use of asymptotic approximation methods, which can give analytical or semi-analytical results and complement fully numerical treatments. The authors also briefly discuss some important considerations to be taken into account when developing a numerical code for computer simulation of fluid flows. Although the text is populated throughout with examples and problems from the field of astrophysics and planetary science, the text is eminently suitable as a general introduction to fluid dynamics. It...

  19. Neutrino particle astrophysics: status and outlook

    CERN Multimedia

    CERN. Geneva

    2016-01-01

    The discovery of astrophysical neutrinos at high energy by IceCube raises a host of questions: What are the sources? Is there a Galactic as well as an extragalactic component? How does the astrophysical spectrum continue to lower energy where the dominant signal is from atmospheric neutrinos? Is there a measureable flux of cosmogenic neutrinos at higher energy? What is the connection to cosmic rays? At what level and in what energy region should we expect to see evidence of the π0 decay photons that must accompany the neutrinos at production? Such questions are stimulating much theoretical activity and many multi-wavelength follow-up observations as well as driving plans for new detectors. My goal in this presentation will be to connect the neutrino data and their possible interpretations to ongoing multi-messenger observations and to the design of future detectors.

  20. Exploring Astrophysical Magnetohydrodynamics in the Laboratory

    Science.gov (United States)

    Manuel, Mario

    2014-10-01

    Plasma evolution in many astrophysical systems is dominated by magnetohydrodynamics. Specifically of interest to this talk are collimated outflows from accretion systems. Away from the central object, the Euler equations can represent the plasma dynamics well and may be scaled to a laboratory system. We have performed experiments to investigate the effects of a background magnetic field on an otherwise hydrodynamically collimated plasma. Laser-irradiated, cone targets produce hydrodynamically collimated plasma jets and a pulse-powered solenoid provides a constant background magnetic field. The application of this field is shown to completely disrupt the original flow and a new magnetically-collimated, hollow envelope is produced. Results from these experiments and potential implications for their astrophysical analogs will be discussed.

  1. Numerical Methods for Radiation Magnetohydrodynamics in Astrophysics

    International Nuclear Information System (INIS)

    Klein, R I; Stone, J M

    2007-01-01

    We describe numerical methods for solving the equations of radiation magnetohydrodynamics (MHD) for astrophysical fluid flow. Such methods are essential for the investigation of the time-dependent and multidimensional dynamics of a variety of astrophysical systems, although our particular interest is motivated by problems in star formation. Over the past few years, the authors have been members of two parallel code development efforts, and this review reflects that organization. In particular, we discuss numerical methods for MHD as implemented in the Athena code, and numerical methods for radiation hydrodynamics as implemented in the Orion code. We discuss the challenges introduced by the use of adaptive mesh refinement in both codes, as well as the most promising directions for future developments

  2. Global kinetic theory of astrophysical jets

    International Nuclear Information System (INIS)

    Chang, T.

    1989-01-01

    We suggest that an astrophysical plasma stream flowing outward from a central object aling an open magnetic field line with decreasing field strength generally will have anisotropic velocity distributions. I particular, the electron distribution function of this type of plasma streams will contain a 'thermally populated' region and a stretche out high energy tail (or 'jet-like') region collimated in the utward direction of the magnetic field line. Our argument is based on a global, collisional, kinetic theory. Because the 'kinetic jets' are always pointed aling the outward direction of the field lines, thy are automatically collimated and will assume whatever the peculiar geometries dictated by the magnetic field. This result should be useful in the understanding of the basic structures of such diverse astrophysical objects as the extragalactic radio jets, stellar winds, the solar wind, planetary polar winds, and galactic jets. (author). 8 refs.; 2 figs

  3. The Trojan horse method in nuclear astrophysics

    International Nuclear Information System (INIS)

    Aliotta, M.; Rolfs, C.; Lattuada, M.; Pellegriti, M.G.; Pizzone, R.G.; Spitaleri, C.; Miljanic, Dj.; Typel, S.; Wolter, H.H.

    2001-01-01

    Because of the Coulomb barrier, reaction cross sections in astrophysics cannot be accessed directly at the relevant Gamow energies, unless very favourable conditions are met (e.g. LUNA--underground experiments). Theoretical extrapolations of available data are then needed to derive the astrophysical S(0)-factor. Various indirect processes have been used in order to obtain additional information on the parameters entering these extrapolations. The Trojan Horse Method is an indirect method which might help to bypass some of the problems typically encountered in direct measurements, namely the presence of the Coulomb barrier and the effect of the electron screening. However, a comparison with direct data in an appropriate energy region (e.g. around the Coulomb barrier) is crucial before extending the method to the relevant Gamow energy. Additionally, experimental and theoretical tests are needed to validate the assumptions underlying the method. The application of the Trojan Horse Method to some cases of interest is discussed

  4. Astrophysical data analysis with information field theory

    Science.gov (United States)

    Enßlin, Torsten

    2014-12-01

    Non-parametric imaging and data analysis in astrophysics and cosmology can be addressed by information field theory (IFT), a means of Bayesian, data based inference on spatially distributed signal fields. IFT is a statistical field theory, which permits the construction of optimal signal recovery algorithms. It exploits spatial correlations of the signal fields even for nonlinear and non-Gaussian signal inference problems. The alleviation of a perception threshold for recovering signals of unknown correlation structure by using IFT will be discussed in particular as well as a novel improvement on instrumental self-calibration schemes. IFT can be applied to many areas. Here, applications in in cosmology (cosmic microwave background, large-scale structure) and astrophysics (galactic magnetism, radio interferometry) are presented.

  5. Astrophysical data analysis with information field theory

    Energy Technology Data Exchange (ETDEWEB)

    Enßlin, Torsten, E-mail: ensslin@mpa-garching.mpg.de [Max Planck Institut für Astrophysik, Karl-Schwarzschild-Straße 1, D-85748 Garching, Germany and Ludwig-Maximilians-Universität München, Geschwister-Scholl-Platz 1, D-80539 München (Germany)

    2014-12-05

    Non-parametric imaging and data analysis in astrophysics and cosmology can be addressed by information field theory (IFT), a means of Bayesian, data based inference on spatially distributed signal fields. IFT is a statistical field theory, which permits the construction of optimal signal recovery algorithms. It exploits spatial correlations of the signal fields even for nonlinear and non-Gaussian signal inference problems. The alleviation of a perception threshold for recovering signals of unknown correlation structure by using IFT will be discussed in particular as well as a novel improvement on instrumental self-calibration schemes. IFT can be applied to many areas. Here, applications in in cosmology (cosmic microwave background, large-scale structure) and astrophysics (galactic magnetism, radio interferometry) are presented.

  6. Neutrino masses in astrophysics and cosmology

    International Nuclear Information System (INIS)

    Raffelt, G.G.

    1996-01-01

    Astrophysical and cosmological arguments and observations give us the most restrictive constraints on neutrino masses, electromagnetic couplings, and other properties. Conversely, massive neutrinos would contribute to the cosmic dark-matter density and would play an important role for the formation of structure in the universe. Neutrino oscillations may well solve the solar neutrino problem, and can have a significant impact on supernova physics. (author) 14 figs., tabs., 33 refs

  7. An anelastic approximation arising in astrophysics

    Czech Academy of Sciences Publication Activity Database

    Donatelli, D.; Feireisl, Eduard

    2017-01-01

    Roč. 369, 3-4 (2017), s. 1573-1597 ISSN 0025-5831 EU Projects: European Commission(XE) 320078 - MATHEF Institutional support: RVO:67985840 Keywords : Navier-Stokes system * astrophysics Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 1.314, year: 2016 https://link.springer.com/article/10.1007%2Fs00208-016-1507-x

  8. Astrophysical and terrestrial neutrinos in Supernova detectors

    International Nuclear Information System (INIS)

    Lagage, P.O.

    1985-09-01

    Supernova (SN) explosions are the place of very fundamental phenomena, whose privileged messengers are neutrinos. But such events are very rare. Then, SN detection has to be combined with other purposes. The recent developments of SN detectors have been associated with developments of underground particle physics (proton decay, monopoles ...). But here, I will restrict myself to discuss the possibilities for a supernova detector to be sensitive to other sources of neutrinos, astrophysical or terrestrial

  9. Neutrino masses in astrophysics and cosmology

    Energy Technology Data Exchange (ETDEWEB)

    Raffelt, G G [Max-Planck-Institut fuer Physik, Muenchen (Germany)

    1996-11-01

    Astrophysical and cosmological arguments and observations give us the most restrictive constraints on neutrino masses, electromagnetic couplings, and other properties. Conversely, massive neutrinos would contribute to the cosmic dark-matter density and would play an important role for the formation of structure in the universe. Neutrino oscillations may well solve the solar neutrino problem, and can have a significant impact on supernova physics. (author) 14 figs., tabs., 33 refs.

  10. Carbon dioxide and climate: an astrophysical perspective

    Energy Technology Data Exchange (ETDEWEB)

    Kandel, R S

    1979-01-01

    In this survey the earth is viewed from the astrophysical perspective, i.e. using global mean values of environmental parameters. The role of carbon dioxide is described in the processes of energy transfer from the earth's surface to space, which determine global climate as measured by the mean surface temperature. Analogies and differences between the problems of the terrestrial atmosphere and those of the solar and stellar atmospheres are examined, both in the computation of model atmospheres and in remote sensing of atmospheric temperature and composition. Subsequently, the temporal astrophysical perspective, with a review of the evolution of CO/sub 2/ abundance and climate on astrophysical or geological time scales, on earth as an Venus (the runaway greenhouse) and on Mars is introduced. Variation of CO/sub 2/ may have been critical to the maintenance of an environment in which life could originate and evolve, and may itself have been affected by life. On human time scales, the recent and continuing increase in atmospheric CO/sub 2/ raises new problems, which are briefly surveyed. It is argued, that the differential greenhouse effect of increased CO/sub 2/ in the earth's atmosphere is essentially identifical to the blanketing effect of spectral lines on the temperature structure of stellar atmospheres. The methods used by astrophysicists in such studies are reviewed and compared with those used to evaluate the differential greenhouse effect of CO/sub 2/ in radiative-convective models of the earth's atmosphere. The latter methods remain relatively crude, but recent results by different authors are in reasonably good agreement; however, the astrophysical perspective, i.e. the use of one-dimensional global mean models, remains a gross simplification of the real complexity of the earth's climate system, which is also true in stellar atmospheres.

  11. Gamma Ray Bursts-Afterglows and Counterparts

    Science.gov (United States)

    Fishman, Gerald J

    1998-01-01

    Several breakthrough discoveries were made last year of x-ray, optical and radio afterglows and counterparts to gamma-ray bursts, and a redshift has been associated with at least one of these. These discoveries were made possible by the fast, accurate gamma-ray burst locations of the BeppoSAX satellite. It is now generally believed that the burst sources are at cosmological distances and that they represent the most powerful explosions in the Universe. These observations also open new possibilities for the study of early star formation, the physics of extreme conditions and perhaps even cosmology. This session will concentrate on recent x-ray, optical and radio afterglow observations of gamma-ray bursts, associated redshift measurements, and counterpart observations. Several review and theory talks will also be presented, along with a summary of the astrophysical implications of the observations. There will be additional poster contributions on observations of gamma-ray burst source locations at wavelengths other than gamma rays. Posters are also solicited that describe new observational capabilities for rapid follow-up observations of gamma-ray bursts.

  12. Texas symposium on relativistic astrophysics, 9th, Munich, West Germany, December 14-19, 1978, proceedings

    International Nuclear Information System (INIS)

    Ehlers, J.; Perry, J.J.; Walker, M.

    1980-01-01

    Papers are presented on recent developments in relativistic astrophysics in the fields of extragalactic sources, galaxy formation and cosmology, gamma-ray astronomy, gravitation theory and fundamental interactions, supernovae and gravitational collapse, neutron stars, pulsars and supernova remnants and X-ray astronomy. Specific topics include the properties of BL Lac objects, the emission-line spectra of active galactic nuclei and quasars, current knowledge of the cosmic microwave background, the limits to observational verification in cosmology, the gravitational instability theory of galaxy formation and clustering, COS-B observations of Galactic high-energy gamma rays, isolated systems in general relativity and quantum gravity. Attention is also given to the evolution and explosion of massive stars, neutrino astronomy, pulsar radiation mechanisms, evidence of gravitational radiation from measurements of the binary pulsar PSR 1913+13, the X-ray spectra of accreting degenerate stars, and theoretical aspects of X-ray binaries

  13. Scientific and technical progress in high-energy astrophysics at INPE

    International Nuclear Information System (INIS)

    Bui-Van, N.A.; Jayanthi, U.B.; Jardim, J.O.D.; Braga, J.; Santo, C.M.E.

    1984-01-01

    The recent advances in high-energy Astrophysics pertains to the study of compact objects in galactic nuclei, binary systems and pulsars. These aspects are best understood by the study of the emissions in X- and gamma rays of these objects through the temporal variation in flux and spectrum. The Southern Hemisphere offers some of the unique objects for investigations such as galactic center, the Vela pulsar etc. For high temporal and spectra resolution studies two telescopes 'GeLi' and 'Pulsar' were designed and constructed. To support these scientific activities, a program in balloon launching and data acquisition facilities has been developed since 1971. The 'Balloon Launching Center' of INPE has capacity to launch balloons of -850,000 m 3 with payloads weighting about 1,000 Kg. Taking advantage of these facilities, project 'Bantar', with the goal to measure the atmospheric gamma-ray radiation in the Antartic Region, is under progress. (Author) [pt

  14. Cosmology and particle astrophysics. 2. ed.

    International Nuclear Information System (INIS)

    Bergstroem, L.; Goobar, A.

    2006-01-01

    Beginning with some basic facts about the observable universe the authors consider in successive chapters the complete range of topics that make up a degree course in cosmology and particle astrophysics. The outstanding feature of this book is that it is self-contained, in that no specialised knowledge is required on the part of the reader, apart from basic undergraduate mathematics and physics. This paperback edition will again target students of physics, astrophysics and cosmology at the advanced undergraduate level or early graduate level. One of the book's biggest strong points is that the authors rapidly involve students in the most exciting of today's developments in the field in a simple and self-contained manner, relegating the more technical aspects to appendices. The worked examples throughout the book, and summaries at the end of each chapter, which were expanded in the second edition, have been very well received by students. This book offers advanced undergraduate level and beginning graduate level students a highly readable, yet comprehensive review of particle astrophysics. Competing books cover this topic at too advanced a level for this readership. (orig.)

  15. Heavy ion irradiation of astrophysical ice analogs

    International Nuclear Information System (INIS)

    Duarte, Eduardo Seperuelo; Domaracka, Alicja; Boduch, Philippe; Rothard, Hermann; Balanzat, Emmanuel; Dartois, Emmanuel; Pilling, Sergio; Farenzena, Lucio; Frota da Silveira, Enio

    2009-01-01

    Icy grain mantles consist of small molecules containing hydrogen, carbon, oxygen and nitrogen atoms (e.g. H 2 O, GO, CO 2 , NH 3 ). Such ices, present in different astrophysical environments (giant planets satellites, comets, dense clouds, and protoplanetary disks), are subjected to irradiation of different energetic particles: UV radiation, ion bombardment (solar and stellar wind as well as galactic cosmic rays), and secondary electrons due to cosmic ray ionization of H 2 . The interaction of these particles with astrophysical ice analogs has been the object of research over the last decades. However, there is a lack of information on the effects induced by the heavy ion component of cosmic rays in the electronic energy loss regime. The aim of the present work is to simulate of the astrophysical environment where ice mantles are exposed to the heavy ion cosmic ray irradiation. Sample ice films at 13 K were irradiated by nickel ions with energies in the 1-10 MeV/u range and analyzed by means of FTIR spectrometry. Nickel ions were used because their energy deposition is similar to that deposited by iron ions, which are particularly abundant cosmic rays amongst the heaviest ones. In this work the effects caused by nickel ions on condensed gases are studied (destruction and production of molecules as well as associated cross sections, sputtering yields) and compared with respective values for light ions and UV photons. (authors)

  16. Traversable braneworld wormholes supported by astrophysical observations

    Science.gov (United States)

    Wang, Deng; Meng, Xin-He

    2018-02-01

    In this study, we investigate the characteristics and properties of a traversable wormhole constrained by the current astrophysical observations in the framework of modified theories of gravity (MOG). As a concrete case, we study traversable wormhole space-time configurations in the Dvali-Gabadadze-Porrati (DGP) braneworld scenario, which are supported by the effects of the gravity leakage of extra dimensions. We find that the wormhole space-time structure will open in terms of the 2 σ confidence level when we utilize the joint constraints supernovae (SNe) Ia + observational Hubble parameter data (OHD) + Planck + gravitational wave (GW) and z based on various energy conditions; (ii) we can offer a strict restriction to the local wormhole space-time structure by using the current astrophysical observations; and (iii) we can clearly identify a physical gravitational resource for the wormholes supported by astrophysical observations, namely the dark energy components of the universe or equivalent space-time curvature effects from MOG. Moreover, we find that the strong energy condition is always violated at low redshifts.

  17. Gamma camera

    International Nuclear Information System (INIS)

    Tschunt, E.; Platz, W.; Baer, Ul; Heinz, L.

    1978-01-01

    A gamma camera has a plurality of exchangeable collimators, one of which is replaceably mounted in the ray inlet opening of the camera, while the others are placed on separate supports. Supports are swingably mounted upon a column one above the other

  18. Gamma camera

    International Nuclear Information System (INIS)

    Schlosser, P.A.; Steidley, J.W.

    1980-01-01

    The design of a collimation system for a gamma camera for use in nuclear medicine is described. When used with a 2-dimensional position sensitive radiation detector, the novel system can produce superior images than conventional cameras. The optimal thickness and positions of the collimators are derived mathematically. (U.K.)

  19. The Extragalactic Background Light and the Gamma-ray Opacity of the Universe

    Science.gov (United States)

    Dwek, Eli; Krennrich, Frank

    2012-01-01

    The extragalactic background light (EBL) is one of the fundamental observational quantities in cosmology. All energy releases from resolved and unresolved extragalactic sources, and the light from any truly diffuse background, excluding the cosmic microwave background (CMB), contribute to its intensity and spectral energy distribution. It therefore plays a crucial role in cosmological tests for the formation and evolution of stellar objects and galaxies, and for setting limits on exotic energy releases in the universe. The EBL also plays an important role in the propagation of very high energy gamma-rays which are attenuated en route to Earth by pair producing gamma-gamma interactions with the EBL and CMB. The EBL affects the spectrum of the sources, predominantly blazars, in the approx 10 GeV to 10 TeV energy regime. Knowledge of the EBL intensity and spectrum will allow the determination of the intrinsic blazar spectrum in a crucial energy regime that can be used to test particle acceleration mechanisms and VHE gamma-ray production models. Conversely, knowledge of the intrinsic gamma-ray spectrum and the detection of blazars at increasingly higher redshifts will set strong limits on the EBL and its evolution. This paper reviews the latest developments in the determination of the EBL and its impact on the current understanding of the origin and production mechanisms of gamma-rays in blazars, and on energy releases in the universe. The review concludes with a summary and future directions in Cherenkov Telescope Array techniques and in infrared ground-based and space observatories that will greatly improve our knowledge of the EBL and the origin and production of very high energy gamma-rays.

  20. Asymptotic normalization coefficients in nuclear astrophysics

    Czech Academy of Sciences Publication Activity Database

    Kroha, Václav; Azhari, A.; Bém, Pavel; Burjan, Václav; Gagliardi, C. A.; Mukhamedzhanov, A. M.; Novák, Jan; Piskoř, Štěpán; Šimečková, Eva; Tang, X.; Trache, L.; Tribble, R. E.; Vincour, Jiří

    2003-01-01

    Roč. 719, - (2003), s. 119C-122C ISSN 0375-9474 R&D Projects: GA ČR GA202/01/0709; GA AV ČR KSK1048102 Institutional research plan: CEZ:AV0Z1048901 Keywords : S-factor * C-13(p,gamma)N-14 * Be-9(p, gamma)B-10 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.761, year: 2003

  1. Workshop on the origin of the heavy elements: Astrophysical models and experimental challenges, Santa Fe, New Mexico, September 3-4, 1999

    International Nuclear Information System (INIS)

    Haight, Robert C.; Ullmann, John L.; Strottman, Daniel D.; Koehler, Paul E.; Kaeppeler, Franz

    2000-01-01

    This Workshop was held on September 3--4, 1999, following the 10th International Symposium on Capture Gamma-Ray Spectroscopy. Presentations were made by 14 speakers, 6 from the US and 8 from other countries on topics relevant to s-, r- and rp-process nucleosynthesis. Laboratory experiments, both present and planned, and astrophysical observations were represented as were astrophysical models. Approximately 50 scientists participated in this Workshop. These Proceedings consist of copies of vu-graphs presented at the Workshop. For further information, the interested readers are referred to the authors

  2. Gamma camera

    International Nuclear Information System (INIS)

    Reiss, K.H.; Kotschak, O.; Conrad, B.

    1976-01-01

    A gamma camera with a simplified setup as compared with the state of engineering is described permitting, apart from good localization, also energy discrimination. Behind the usual vacuum image amplifier a multiwire proportional chamber filled with trifluorine bromium methane is connected in series. Localizing of the signals is achieved by a delay line, energy determination by means of a pulse height discriminator. With the aid of drawings and circuit diagrams, the setup and mode of operation are explained. (ORU) [de

  3. Gamma irradiator

    International Nuclear Information System (INIS)

    Simonet, G.

    1986-09-01

    Fiability of devices set around reactors depends on material resistance under irradiation noticeably joints, insulators, which belongs to composition of technical, safety or physical incasurement devices. The irradiated fuel elements, during their desactivation in a pool, are an interesting gamma irradiation device to simulate damages created in a nuclear environment. The existing facility at Osiris allows to generate an homogeneous rate dose in an important volume. The control of the element distances to irradiation box allows to control this dose rate [fr

  4. Gamma teletopography

    International Nuclear Information System (INIS)

    Simonet, G.

    1987-06-01

    The mapping of gamma sources radiation emission in a nuclear plant is an important safety point. A remote gamma ray mapping process was developed in SPS/CEA/SACLAY. It uses the ''pinhole camera'' principle, precursor of photography. It mainly consists of a radiation proof box, with a small orifice, containing sensitive emulsions at the opposite. A first conventional photographic type emulsion photographs the area. A second photographic emulsion shows up the gamma radiations. The superim position of the two shots gives immediate informations of the precise location of each source of radiation in the observed area. To make easier the presentation and to improve the accuracy of the results for radiation levels mapping, the obtained films are digitally processed. The processing assigns a colours scale to the various levels of observed radiations. Taking account physical data and standard parameters, it gets possible to estimate the dose rate. The device is portable. Its compactness and fully independent nature make it suitable for use anywhere. It can be adapted to a remote automatic handling system, robot... so as to avoid all operator exposure when the local dose rate is too high [fr

  5. Modeling the astrophysical dynamical process with laser-plasmas

    International Nuclear Information System (INIS)

    Xia Jiangfan; Zhang Jun; Zhang Jie

    2001-01-01

    The use of the state-of-the-art laser facility makes it possible to create conditions of the same or similar to those in the astrophysical processes. The introduction of the astrophysics-relevant ideas in laser-plasma experiments is propitious to the understanding of the astrophysical phenomena. However, the great difference between the laser-produced plasmas and the astrophysical processes makes it awkward to model the latter by laser-plasma experiments. The author addresses the physical backgrounds for modeling the astrophysical plasmas by laser plasmas, connecting these two kinds of plasmas by scaling laws. Thus, allowing the creation of experimental test beds where observations and models can be quantitatively compared with laser-plasma data. Special attentions are paid on the possibilities of using home-made laser facilities to model astrophysical phenomena

  6. Stopping Power Measurements: Implications in Nuclear Astrophysics

    International Nuclear Information System (INIS)

    Carmen Angulo; Thierry Delbar; Jean-Sebastien Graulich; Pierre Leleux

    1999-01-01

    The stopping powers of C, CH 2 , Al, Ni, and polyvinylchloride (PVC) for several light ions ( 9 Be, 11 B, 12 C, 14 N, 16 O, 19 F, 20 Ne) with an incident energy of 1 MeV/amu have been measured at the Louvain-la-Neuve cyclotron facility. Stopping powers are given relative to the one for 5.5 MeV 4 He ions with an uncertainty of less than 1%. We compare our results with two widely used semiempirical models and we discuss some implications in nuclear astrophysics studies

  7. Relativistic Astrophysics and Cosmology: A Primer

    International Nuclear Information System (INIS)

    Abramowicz, Marek A

    2007-01-01

    'Relativistic Astrophysics and Cosmology: A Primer' by Peter Hoyng, was published last year by Springer. The book is based on lectures given by the author at University of Utrecht to advanced undergraduates. This is a short and scholarly book. In about 300 pages, the author has covered the most interesting and important applications of Albert Einstein's general relativity in present-day astrophysics and cosmology: black holes, neutron stars, gravitational waves, and the cosmic microwave background. The book stresses theory, but also discusses several experimental and observational topics, such as the Gravity Probe B mission, interferometer detectors of gravitational waves and the power spectrum of the cosmic microwave background. The coverage is not uniform. Some topics are discussed in depth, others are only briefly mentioned. The book obviously reflects the author's own research interests and his preferences for specific mathematical methods, and the choice of the original artwork that illustrates the book (and appears on its cover) is a very personal one. I consider this personal touch an advantage, even if I do not always agree with the author's choices. For example, I employ Killing vectors as a very useful mathematical tool not only in my research on black holes, but also in my classes. I find that my students prefer it when discussions of particle, photon and fluid motion in the Schwarzschild and Kerr spacetimes are based explicitly and directly on the Killing vectors rather than on coordinate calculations. The latter approach is, of course, the traditional one, and is used in Peter Hoyng's book. Reading the book is a stimulating experience, because the reader can almost feel the author's presence. The author's opinions, his mathematical taste, his research pleasures, and his pedagogical passion are apparent everywhere. Lecturers contemplating a new course on relativistic astrophysics could adopt Hoyng's book as the text. Their students will be in the author

  8. Astrophysical constraints on scalar field models

    International Nuclear Information System (INIS)

    Bertolami, O.; Paramos, J.

    2005-01-01

    We use stellar structure dynamics arguments to extract bounds on the relevant parameters of two scalar field models: the putative scalar field mediator of a fifth force with a Yukawa potential and the new variable mass particle models. We also analyze the impact of a constant solar inbound acceleration, such as the one reported by the Pioneer anomaly, on stellar astrophysics. We consider the polytropic gas model to estimate the effect of these models on the hydrostatic equilibrium equation and fundamental quantities such as the central temperature. The current bound on the solar luminosity is used to constrain the relevant parameters of each model

  9. Physics, Astrophysics and Cosmology with Gravitational Waves

    Directory of Open Access Journals (Sweden)

    Sathyaprakash B. S.

    2009-03-01

    Full Text Available Gravitational wave detectors are already operating at interesting sensitivity levels, and they have an upgrade path that should result in secure detections by 2014. We review the physics of gravitational waves, how they interact with detectors (bars and interferometers, and how these detectors operate. We study the most likely sources of gravitational waves and review the data analysis methods that are used to extract their signals from detector noise. Then we consider the consequences of gravitational wave detections and observations for physics, astrophysics, and cosmology.

  10. Dimensional analysis and group theory in astrophysics

    CERN Document Server

    Kurth, Rudolf

    2013-01-01

    Dimensional Analysis and Group Theory in Astrophysics describes how dimensional analysis, refined by mathematical regularity hypotheses, can be applied to purely qualitative physical assumptions. The book focuses on the continuous spectral of the stars and the mass-luminosity relationship. The text discusses the technique of dimensional analysis, covering both relativistic phenomena and the stellar systems. The book also explains the fundamental conclusion of dimensional analysis, wherein the unknown functions shall be given certain specified forms. The Wien and Stefan-Boltzmann Laws can be si

  11. Nonlinear evolution of astrophysical Alfven waves

    Science.gov (United States)

    Spangler, S. R.

    1984-01-01

    Nonlinear Alfven waves were studied using the derivative nonlinear Schrodinger equation as a model. The evolution of initial conditions, such as envelope solitons, amplitude-modulated waves, and band-limited noise was investigated. The last two furnish models for naturally occurring Alfven waves in an astrophysical plasma. A collapse instability in which a wave packet becomes more intense and of smaller spatial extent was analyzed. It is argued that this instability leads to enhanced plasma heating. In studies in which the waves are amplified by an electron beam, the instability tends to modestly inhibit wave growth.

  12. Nuclear Data on Unstable Nuclei for Astrophysics

    International Nuclear Information System (INIS)

    Smith, Michael Scott; Meyer, Richard A; Lingerfelt, Eric; Scott, J.P.; Hix, William Raphael; Ma, Zhanwen; Bardayan, Daniel W.; Blackmon, Jeff C.; Guidry, Mike W.; KOZUB, RAYMOND L.; Chae, Kyung YuK.

    2004-01-01

    Recent measurements with radioactive beams at ORNL's Holifield Radioactive Ion Beam Facility (HRIBF) have prompted the evaluation of a number of reactions involving unstable nuclei needed for stellar explosion studies. We discuss these evaluations, as well as the development of a new computational infrastructure to enable the rapid incorporation of the latest nuclear physics results in astrophysics models. This infrastructure includes programs that simplify the generation of reaction rates, manage rate databases, and visualize reaction rates, all hosted at a new website http://www.nucastrodata.org

  13. Precision Astrophysics Experiments with the Kepler Satellite

    Science.gov (United States)

    Jackiewicz, Jason

    2012-10-01

    Long photometric observations from space of tens of thousands of stars, such as those provided by Kepler, offer unique opportunities to carry out ensemble astrophysics as well as detailed studies of individual objects. One of the primary tools at our disposal for understanding pulsating stars is asteroseismology, which uses observed stellar oscillation frequencies to determine interior properties. This can provide very strict constraints on theories of stellar evolution, structure, and the population characteristics of stars in the Milky Way galaxy. This talk will focus on several of the exciting insights Kepler has enabled through asteroseismology of stars across the H-R diagram.

  14. Physics, Astrophysics and Cosmology with Gravitational Waves.

    Science.gov (United States)

    Sathyaprakash, B S; Schutz, Bernard F

    2009-01-01

    Gravitational wave detectors are already operating at interesting sensitivity levels, and they have an upgrade path that should result in secure detections by 2014. We review the physics of gravitational waves, how they interact with detectors (bars and interferometers), and how these detectors operate. We study the most likely sources of gravitational waves and review the data analysis methods that are used to extract their signals from detector noise. Then we consider the consequences of gravitational wave detections and observations for physics, astrophysics, and cosmology.

  15. Showing Complex Astrophysical Settings Through Virtual Reality

    Science.gov (United States)

    Green, Joel; Smith, Denise; Smith, Louis Chad; Lawton, Brandon; Lockwood, Alexandra; Jirdeh, Hussein

    2018-01-01

    The James Webb Space Telescope (JWST), NASA’s next great observatory launching in spring 2019, will routinely showcase astrophysical concepts that will challenge the public's understanding. Emerging technologies such as virtual reality bring the viewer into the data and the concept in previously unimaginable immersive detail. For example, we imagine a spacefarer inside a protoplanetary disk, seeing the accretion process directly. STScI is pioneering some tools related to JWST for showcasing at AAS, and in local events, which I highlight here. If we develop materials properly tailored to this medium, we can reach more diverse audiences than ever before.

  16. NASA's Long-Term Astrophysics Data Archives

    OpenAIRE

    Rebull, L. M.; Desai, V.; Teplitz, H.; Groom, S.; Akeson, R.; Berriman, G. B.; Helou, G.; Imel, D.; Mazzarella, J. M.; Accomazzi, A.; McGlynn, T.; Smale, A.; White, R.

    2017-01-01

    NASA regards data handling and archiving as an integral part of space missions, and has a strong track record of serving astrophysics data to the public, beginning with the the IRAS satellite in 1983. Archives enable a major science return on the significant investment required to develop a space mission. In fact, the presence and accessibility of an archive can more than double the number of papers resulting from the data. In order for the community to be able to use the data, they have to b...

  17. Alpha resonant scattering for astrophysical reaction studies

    Energy Technology Data Exchange (ETDEWEB)

    Yamaguchi, H.; Kahl, D.; Nakao, T. [Center for Nuclear Study (CNS), University of Tokyo, RIKEN campus, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Wakabayashi, Y.; Kubano, S. [The Institute of Physical and Chemical Research (RIKEN), 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Hashimoto, T. [Research Center for Nuclear Physics (RCNP), Osaka University, 10-1 Mihogaoka, Ibaraki, Osaka 567-0047 (Japan); Hayakawa, S. [Istituto Nazionale Fisica Nucleare - Laboratori Nazionali del Sud (INFN-LNS), Via S. Sofia 62, 95125 Catania (Italy); Kawabata, T. [Department of Physics, Kyoto University, Kita-Shirakawa, Kyoto 606-8502 (Japan); Iwasa, N. [Department of Physics, Tohoku University, Aoba, Sendai, Miyagi 980-8578 (Japan); Teranishi, T. [Department of Physics, Kyushu University, 6-10-1 Hakozaki, Fukuoka 812-8581 (Japan); Kwon, Y. K. [Institute for Basic Science, 70, Yuseong-daero 1689-gil, Yuseong-gu, Daejeon 305-811 (Korea, Republic of); Binh, D. N. [30 MeV Cyclotron Center, Tran Hung Dao Hospital, Hoan Kiem District, Hanoi (Viet Nam); Khiem, L. H.; Duy, N. G. [Institute of Physics, Vietnam Academy of Science and Technology, 18 Hong Quoc Viet, Nghia do, Hanoi (Viet Nam)

    2014-05-02

    Several alpha-induced astrophysical reactions have been studied at CRIB (CNS Radioactive Ion Beam separator), which is a low-energy RI beam separator at Center for Nuclear Study (CNS) of the University of Tokyo. One of the methods to study them is the α resonant scattering using the thick-target method in inverse kinematics. Among the recent studies at CRIB, the measurement of {sup 7}Be+α resonant scattering is discussed. Based on the result of the experiment, we evaluated the contributions of high-lying resonances for the {sup 7}Be(α,γ) reaction, and proposed a new cluster band in {sup 11}C.

  18. Alpha resonant scattering for astrophysical reaction studies

    International Nuclear Information System (INIS)

    Yamaguchi, H.; Kahl, D.; Nakao, T.; Wakabayashi, Y.; Kubano, S.; Hashimoto, T.; Hayakawa, S.; Kawabata, T.; Iwasa, N.; Teranishi, T.; Kwon, Y. K.; Binh, D. N.; Khiem, L. H.; Duy, N. G.

    2014-01-01

    Several alpha-induced astrophysical reactions have been studied at CRIB (CNS Radioactive Ion Beam separator), which is a low-energy RI beam separator at Center for Nuclear Study (CNS) of the University of Tokyo. One of the methods to study them is the α resonant scattering using the thick-target method in inverse kinematics. Among the recent studies at CRIB, the measurement of 7 Be+α resonant scattering is discussed. Based on the result of the experiment, we evaluated the contributions of high-lying resonances for the 7 Be(α,γ) reaction, and proposed a new cluster band in 11 C

  19. Old and New from Multifrequency Astrophysics

    Directory of Open Access Journals (Sweden)

    Franco Giovannelli

    2014-12-01

    Full Text Available In this short review paper we comment on some the most important steps that have been made in the past decades for a better understanding of the physics governing our Universe. The results we discuss come from the many groundand-space-based experiments developed for measuring astrophysical sources in various energy bands. These experimental results are discussed within the framework of current theoretical models. Because of the limited length of this paper, we have selected only a few topics that, in our opinion, have been crucial for the progress of our understanding of the physics of cosmic sources.

  20. Introduction to stellar astrophysics. V. 1

    International Nuclear Information System (INIS)

    Boehm-Vitense, E.

    1989-01-01

    This textbook introduces basic elements of fundamental astronomy and astrophysics which serve as a foundation for understanding the structure, evolution, and observed properties of stars. The first half of the book explains how stellar motions, distances, luminosities, colours, radii, masses and temperatures are measured or derived. The author then shows how data of these sorts can be arranged to classify stars through their spectra. Stellar rotation and stellar magnetic fields are introduced. Stars with peculiar spectra and pulsating stars also merit special attention. The endpoints of stellar evolutions are briefly described. There is a separate chapter on the Sun and a final one on interstellar absorption. (author)

  1. Germination test for identification of gamma-irradiated bean seeds

    International Nuclear Information System (INIS)

    Wesolowska, B.; Ignatowicz, S.

    1993-01-01

    The feasibility of germination test for the practical detection of irradiated beans has not been investigated. The objective of this study was to determine if the relationship between the root growth rate and radiation dose could be used to produce a rapid analytical method for identification of irradiated beans. Such detection method could be potentially used for both (a) identification of irradiated food, and (b) for quarantine inspection (to certify that the agricultural product has been irradiated, and the pests present in it do not pose a quarantine risk). Results presented in this paper indicate that the germination test is not always capable of discriminating satisfactorily between irradiated and unirradiated samples of bean seeds, because the sensitivity of the test is often higher than the low doses which are suggested for disinfestation purposes. However, using the germination test, an unexperienced person can easily discriminate untreated bean seeds from those irradiated with 0.3-1.5 kGy doses of gamma radiation. (orig./vhe)

  2. GRASP. Development of an event reconstruction method using a gamma ray air shower parameterisation and applications to γ-ray sources with H.E.S.S

    Energy Technology Data Exchange (ETDEWEB)

    Hillert, Andreas

    2014-07-24

    The H.E.S.S. experiment, with its high sensitivity and large field-of-view, is an ideal instrument to survey the Milky Way in VHE γ-rays. An accurate reconstruction of the γ-ray direction as well as a strong reduction of the hadronic background is essential for the analysis of the data. In this work a reconstruction algorithm is developed that applies a fit of pixel amplitudes to an expected image obtained from a Gamma Ray Air Shower Parameterisation (GRASP). This parameterisation was obtained using Monte Carlo air shower simulations by parameterising the angular Cherenkov photon distribution with suitable analytical functions. Furthermore, it provides new classifying variables to differentiate γ-ray induced air showers from hadronic ones. The reconstruction of air shower parameters is achieved by a maximum likelihood fit and improves the angular resolution by 20-30% with respect to traditional image moment analysis methods. In combination with a MVA-based background rejection method using these new classifying variables the sensitivity can be improved by about 70%. An analysis of the Pulsar Wind Nebula MSH 15-5-2 and investigation of its morphology and spectral properties show an indication of energy dependent morphology in VHE γ-rays.

  3. SPACE PHYSICS: Developing resources for astrophysics at A-level: the TRUMP Astrophysics project

    Science.gov (United States)

    Swinbank, Elizabeth

    1997-01-01

    After outlining the astrophysical options now available in A-level physics syllabuses, this paper notes some of the particular challenges facing A-level teachers and students who chose these options and describes a project designed to support them. The paper highlights some key features of the project that could readily be incorporated into other areas of physics curriculum development.

  4. Solar, Stellar and Galactic Connections between Particle Physics and Astrophysics

    CERN Document Server

    Carraminana, Alberto

    2007-01-01

    This book collects extended and specialized reviews on topics linking astrophysics and particle physics at a level intermediate between a graduate student and a young researcher. The book includes also three reviews on observational techniques used in forefront astrophysics and short articles on research performed in Latin America. The reviews, updated and written by specialized researchers, describe the state of the art in the related research topics. This book is a valuable complement not only for research but also for lecturers in specialized course of high energy astrophysics, cosmic ray astrophysics and particle physics.

  5. New Worlds, New Horizons in Astronomy and Astrophysics

    National Research Council Canada - National Science Library

    2010-01-01

    .... Based on a broad and comprehensive survey of scientific opportunities, infrastructure, and organization in a national and international context, New Worlds, New Horizons in Astronomy and Astrophysic...

  6. Nuclear Data for Astrophysics Research: A New Online Paradigm

    International Nuclear Information System (INIS)

    Smith, Michael Scott

    2011-01-01

    Our knowledge of a wide range of astrophysical processes depends crucially on nuclear physics data. While new nuclear information is being generated at an ever-increasing rate, the methods to process this information into astrophysical simulations have changed little over the decades and cannot keep pace. Working online, 'cloud computing', may be the methodology breakthrough needed to ensure that the latest nuclear data quickly gets into astrophysics codes. The successes of the first utilization of cloud computing for nuclear astrophysics will be described. The advantages of cloud computing for the broader nuclear data community are also discussed.

  7. Demonstration of Submillimeter Astrophysics Technology at Caltech Submillimeter Observatory

    Data.gov (United States)

    National Aeronautics and Space Administration — Detector technology developments will determine the science product of future astrophysics missions and projects, and this is especially true at submillimeter...

  8. Studies of weak capture-gamma-ray resonances via coincidence techniques

    CERN Document Server

    Rowland, C; Champagne, A E; Dummer, A K; Fitzgerald, R; Harley, E C T; Mosher, J; Runkle, R

    2002-01-01

    A method for measuring weak capture-gamma-ray resonances via gamma gamma-coincidence counting techniques is described. The coincidence apparatus consisted of a large-volume germanium detector and an annular NaI(Tl) crystal. The setup was tested by measuring the weak E sub R =227 keV resonance in sup 2 sup 6 Mg(p,gamma) sup 2 sup 7 Al. Absolute germanium and NaI(Tl) counting efficiencies for a range of gamma-ray energies and for different detector-target geometries are presented. Studies of the gamma-ray background in our spectra are described. Compared to previous work, our method improves the detection sensitivity for weak capture-gamma-ray resonances by a factor of approx 100. The usefulness of the present technique for investigations of interest to nuclear astrophysics is discussed.

  9. ZAPP: The Z Astrophysical Plasma Properties collaboration

    International Nuclear Information System (INIS)

    Rochau, G. A.; Bailey, J. E.; Falcon, R. E.; Loisel, G. P.; Nagayama, T.; Mancini, R. C.; Hall, I.; Winget, D. E.; Montgomery, M. H.; Liedahl, D. A.

    2014-01-01

    The Z Facility at Sandia National Laboratories [Matzen et al., Phys. Plasmas 12, 055503 (2005)] provides MJ-class x-ray sources that can emit powers >0.3 PW. This capability enables benchmark experiments of fundamental material properties in radiation-heated matter at conditions previously unattainable in the laboratory. Experiments on Z can produce uniform, long-lived, and large plasmas with volumes up to 20 cc, temperatures from 1–200 eV, and electron densities from 10 17–23  cc −1 . These unique characteristics and the ability to radiatively heat multiple experiments in a single shot have led to a new effort called the Z Astrophysical Plasma Properties (ZAPP) collaboration. The focus of the ZAPP collaboration is to reproduce the radiation and material characteristics of astrophysical plasmas as closely as possible in the laboratory and use detailed spectral measurements to strengthen models for atoms in plasmas. Specific issues under investigation include the LTE opacity of iron at stellar-interior conditions, photoionization around active galactic nuclei, the efficiency of resonant Auger destruction in black-hole accretion disks, and H-Balmer line shapes in white dwarf photospheres

  10. Ultraviolet and Visible Emission Mechanisms in Astrophysics

    Science.gov (United States)

    Stancil, Phillip C.; Schultz, David R.

    2003-01-01

    The project involved the study of ultraviolet (UV) and visible emission mechanisms in astrophysical and atmospheric environments. In many situations, the emission is a direct consequence of a charge transferring collision of an ion with a neutral with capture of an electron to an excited state of the product ion. The process is also important in establishing the ionization and thermal balance of an astrophysical plasma. As little of the necessary collision data are available, the main thrust of the project was the calculation of total and state-selective charge transfer cross sections and rate coefficients for a very large number of collision systems. The data was computed using modern explicit techniques including the molecular-orbital close-coupling (MOCC), classical trajectory Monte Carlo (CTMC), and continuum distorted wave (CDW) methods. Estimates were also made in some instances using the multichannel Landau-Zener (MCLZ) and classical over-the-barrier (COB) models. Much of the data which has been computed has been formatted for inclusion in a charge transfer database on the World Wide Web (cfadc.phy.ornl.gov/astro/ps/data/). A considerable amount of data has been generated during the lifetime of the grant. Some of it has not been analyzed, but it will be as soon as possible, the data placed on our website, and papers ultimately written.

  11. Summary of sessions on nuclear astrophysics

    Science.gov (United States)

    Rolfs, C.

    In the minds of some there exists the patronizing belief that nuclear physics is a mature science. The same is not believed about nuclear astrophysics, which has been an active branch of astrophysics for over fifty years, but is now in the midst of an exciting revival in experimental and theoretical research around the world. The ultimate goal is to understand how nuclear processes generate the energy of stars over their lifetimes and, in doing so, synthesize heavier elements from the primordial hydrogen and helium produced in the Big Bang, which led to the expanding universe. Impressive progress has been made in this goal and this was rewarded. However, there are major puzzles, such as the solar neutrino problem to name just one, which challenge the fundaments of the field. To solve these problems, new nuclear physics data are needed employing novel experimental techniques such as radioactive ion beams and underground accelerator facilities. Without such new data, much of the work done so far will - in an optimistic view - be incomplete and - in a pessimistic view - be possibly wrong. Thus, new data do not represent a fine structure information or a cleaning-up job, but they represent the major next step in this exciting field&

  12. Time-symmetric integration in astrophysics

    Science.gov (United States)

    Hernandez, David M.; Bertschinger, Edmund

    2018-04-01

    Calculating the long-term solution of ordinary differential equations, such as those of the N-body problem, is central to understanding a wide range of dynamics in astrophysics, from galaxy formation to planetary chaos. Because generally no analytic solution exists to these equations, researchers rely on numerical methods that are prone to various errors. In an effort to mitigate these errors, powerful symplectic integrators have been employed. But symplectic integrators can be severely limited because they are not compatible with adaptive stepping and thus they have difficulty in accommodating changing time and length scales. A promising alternative is time-reversible integration, which can handle adaptive time-stepping, but the errors due to time-reversible integration in astrophysics are less understood. The goal of this work is to study analytically and numerically the errors caused by time-reversible integration, with and without adaptive stepping. We derive the modified differential equations of these integrators to perform the error analysis. As an example, we consider the trapezoidal rule, a reversible non-symplectic integrator, and show that it gives secular energy error increase for a pendulum problem and for a Hénon-Heiles orbit. We conclude that using reversible integration does not guarantee good energy conservation and that, when possible, use of symplectic integrators is favoured. We also show that time-symmetry and time-reversibility are properties that are distinct for an integrator.

  13. Communicating the Science from NASA's Astrophysics Missions

    Science.gov (United States)

    Hasan, Hashima; Smith, Denise A.

    2015-01-01

    Communicating science from NASA's Astrophysics missions has multiple objectives, which leads to a multi-faceted approach. While a timely dissemination of knowledge to the scientific community follows the time-honored process of publication in peer reviewed journals, NASA delivers newsworthy research result to the public through news releases, its websites and social media. Knowledge in greater depth is infused into the educational system by the creation of educational material and teacher workshops that engage students and educators in cutting-edge NASA Astrophysics discoveries. Yet another avenue for the general public to learn about the science and technology through NASA missions is through exhibits at museums, science centers, libraries and other public venues. Examples of the variety of ways NASA conveys the excitement of its scientific discoveries to students, educators and the general public will be discussed in this talk. A brief overview of NASA's participation in the International Year of Light will also be given, as well as of the celebration of the twenty-fifth year of the launch of the Hubble Space Telescope.

  14. Fundamental symmetries and astrophysics with radioactive beams

    International Nuclear Information System (INIS)

    Vogt, E.

    1996-04-01

    A major new initiative at TRIUMF pertains to the use of radioactive beams for astrophysics and for fundamental symmetry experiments. Some recent work is described in which the β-decay-followed by alpha particle emission of 16 N was used to find the resonance parameters dominating the alpha particle capture in 12 C and thus to find the astrophysical S-factor of this reaction which is of crucial importance for alpha-particle burning and the subsequent collapse of stars. In some work underway trapped neural atoms of radioactive potassium atoms will be used to study fundamental symmetries of the weak interactions. Trapping has been achieved and soon 38m K decay will be used to search for evidence of scalar interactions and 37 K decay to search for right-handed gauge-bosom interactions. Future experiments are planned to look for parity non-conservation in trapped francium atoms. This program is part of a revitalization for the TRIUMF laboratory accompanied by the construction of the radioactive beam facility (ISAC). (author)

  15. Astrophysical Model Selection in Gravitational Wave Astronomy

    Science.gov (United States)

    Adams, Matthew R.; Cornish, Neil J.; Littenberg, Tyson B.

    2012-01-01

    Theoretical studies in gravitational wave astronomy have mostly focused on the information that can be extracted from individual detections, such as the mass of a binary system and its location in space. Here we consider how the information from multiple detections can be used to constrain astrophysical population models. This seemingly simple problem is made challenging by the high dimensionality and high degree of correlation in the parameter spaces that describe the signals, and by the complexity of the astrophysical models, which can also depend on a large number of parameters, some of which might not be directly constrained by the observations. We present a method for constraining population models using a hierarchical Bayesian modeling approach which simultaneously infers the source parameters and population model and provides the joint probability distributions for both. We illustrate this approach by considering the constraints that can be placed on population models for galactic white dwarf binaries using a future space-based gravitational wave detector. We find that a mission that is able to resolve approximately 5000 of the shortest period binaries will be able to constrain the population model parameters, including the chirp mass distribution and a characteristic galaxy disk radius to within a few percent. This compares favorably to existing bounds, where electromagnetic observations of stars in the galaxy constrain disk radii to within 20%.

  16. Highlights of the NASA particle astrophysics program

    Energy Technology Data Exchange (ETDEWEB)

    Jones, William Vernon, E-mail: w.vernon.jones@nasa.gov [Astrophysics Division DH000, Science Mission Directorate, NASA Headquarters, Washington DC (United States)

    2014-07-01

    The NASA Particle Astrophysics Program covers Origin of the Elements, Nearest Sources of Cosmic Rays, How Cosmic Particle Accelerators Work, The Nature of Dark Matter, and Neutrino Astrophysics. Progress in each of these topics has come from sophisticated instrumentation flown on long duration balloon (LDB) flights around Antarctica over the past two decades. New opportunities including Super Pressure Balloons (SPB) and International Space Station (ISS) platforms are emerging for the next major step. Stable altitudes and long durations enabled by SPB flights ensure ultra-long duration balloon (ULDB) missions that can open doors to new science opportunities. The Alpha Magnetic Spectrometer (AMS) has been operating on the ISS since May 2011. The CALorimetric Electron Telescope (CALET) and Cosmic Ray Energetics And Mass (CREAM) experiments are being developed for launch to the Japanese Experiment Module Exposed Facility (JEM-EF) in 2015. And, the Extreme Universe Space Observatory (EUSO) is planned for launch to the ISS JEM-EF after 2017. Collectively, these four complementary ISS missions covering a large portion of the cosmic ray energy spectrum serve as a cosmic ray observatory. (author)

  17. ‘Firewall’ phenomenology with astrophysical neutrinos

    Science.gov (United States)

    Afshordi, Niayesh; Yazdi, Yasaman K.

    2016-12-01

    One of the most fundamental features of a black hole in general relativity is its event horizon: a boundary from which nothing can escape. There has been a recent surge of interest in the nature of these event horizons and their local neighbourhoods. In an attempt to resolve black hole information paradox(es), and more generally, to better understand the path towards quantum gravity, ‘firewalls’ have been proposed as an alternative to black hole event horizons. In this paper, we explore the phenomenological implications of black holes possessing a surface or ‘firewall’, and predict a potentially detectable signature of these firewalls in the form of a high energy astrophysical neutrino flux. We compute the spectrum of this neutrino flux in different models and show that it is a possible candidate for the source of the PeV neutrinos recently detected by IceCube. This opens up a new area of research, bridging the non-perturbative physics of quantum gravity with the observational black hole and high energy astrophysics.

  18. ‘Firewall’ phenomenology with astrophysical neutrinos

    International Nuclear Information System (INIS)

    Afshordi, Niayesh; Yazdi, Yasaman K

    2016-01-01

    One of the most fundamental features of a black hole in general relativity is its event horizon: a boundary from which nothing can escape. There has been a recent surge of interest in the nature of these event horizons and their local neighbourhoods. In an attempt to resolve black hole information paradox(es), and more generally, to better understand the path towards quantum gravity, ‘firewalls’ have been proposed as an alternative to black hole event horizons. In this paper, we explore the phenomenological implications of black holes possessing a surface or ‘firewall’, and predict a potentially detectable signature of these firewalls in the form of a high energy astrophysical neutrino flux. We compute the spectrum of this neutrino flux in different models and show that it is a possible candidate for the source of the PeV neutrinos recently detected by IceCube. This opens up a new area of research, bridging the non-perturbative physics of quantum gravity with the observational black hole and high energy astrophysics. (paper)

  19. Art as a Vehicle for Nuclear Astrophysics

    Science.gov (United States)

    Kilburn, Micha

    2013-04-01

    One aim of the The Joint Institute for Nuclear Astrophysics (JINA) is to teach K-12 students concepts and ideas related to nuclear astrophysics. For students who have not yet seen the periodic table, this can be daunting, and we often begin with astronomy concepts. The field of astronomy naturally lends itself to an art connection through its beautiful images. Our Art 2 Science programming adopts a hands-on approach by teaching astronomy through student created art projects. This approach engages the students, through tactile means, visually and spatially. For younger students, we also include physics based craft projects that facilitate the assimilation of problem solving skills. The arts can be useful for aural and kinetic learners as well. Our program also includes singing and dancing to songs with lyrics that teach physics and astronomy concepts. The Art 2 Science programming has been successfully used in after-school programs at schools, community centers, and art studios. We have even expanded the program into a popular week long summer camp. I will discuss our methods, projects, specific goals, and survey results for JINA's Art 2 Science programs.

  20. The CATS Service: An Astrophysical Research Tool

    Directory of Open Access Journals (Sweden)

    O V Verkhodanov

    2009-03-01

    Full Text Available We describe the current status of CATS (astrophysical CATalogs Support system, a publicly accessible tool maintained at Special Astrophysical Observatory of the Russian Academy of Sciences (SAO RAS (http://cats.sao.ru allowing one to search hundreds of catalogs of astronomical objects discovered all along the electromagnetic spectrum. Our emphasis is mainly on catalogs of radio continuum sources observed from 10 MHz to 245 GHz, and secondly on catalogs of objects such as radio and active stars, X-ray binaries, planetary nebulae, HII regions, supernova remnants, pulsars, nearby and radio galaxies, AGN and quasars. CATS also includes the catalogs from the largest extragalactic surveys with non-radio waves. In 2008 CATS comprised a total of about 109 records from over 400 catalogs in the radio, IR, optical and X-ray windows, including most source catalogs deriving from observations with the Russian radio telescope RATAN-600. CATS offers several search tools through different ways of access, e.g. via Web-interface and e-mail. Since its creation in 1997 CATS has managed about 105requests. Currently CATS is used by external users about 1500 times per day and since its opening to the public in 1997 has received about 4000 requests for its selection and matching tasks.

  1. Highlights of the NASA particle astrophysics program

    International Nuclear Information System (INIS)

    Jones, William Vernon

    2014-01-01

    The NASA Particle Astrophysics Program covers Origin of the Elements, Nearest Sources of Cosmic Rays, How Cosmic Particle Accelerators Work, The Nature of Dark Matter, and Neutrino Astrophysics. Progress in each of these topics has come from sophisticated instrumentation flown on long duration balloon (LDB) flights around Antarctica over the past two decades. New opportunities including Super Pressure Balloons (SPB) and International Space Station (ISS) platforms are emerging for the next major step. Stable altitudes and long durations enabled by SPB flights ensure ultra-long duration balloon (ULDB) missions that can open doors to new science opportunities. The Alpha Magnetic Spectrometer (AMS) has been operating on the ISS since May 2011. The CALorimetric Electron Telescope (CALET) and Cosmic Ray Energetics And Mass (CREAM) experiments are being developed for launch to the Japanese Experiment Module Exposed Facility (JEM-EF) in 2015. And, the Extreme Universe Space Observatory (EUSO) is planned for launch to the ISS JEM-EF after 2017. Collectively, these four complementary ISS missions covering a large portion of the cosmic ray energy spectrum serve as a cosmic ray observatory. (author)

  2. Advancing Astrophysics with the Square Kilometre Array

    CERN Document Server

    Fender, Rob; Govoni, Federica; Green, Jimi; Hoare, Melvin; Jarvis, Matt; Johnston-Hollitt, Melanie; Keane, Evan; Koopmans, Leon; Kramer, Michael; Maartens, Roy; Macquart, Jean-Pierre; Mellema, Garrelt; Oosterloo, Tom; Prandoni, Isabella; Pritchard, Jonathan; Santos, Mario; Seymour, Nick; Stappers, Ben; Staveley-Smith, Lister; Tian, Wen Wu; Umana, Grazia; Wagg, Jeff; Bourke, Tyler L; AASKA14

    2015-01-01

    In 2014 it was 10 years since the publication of the comprehensive ‘Science with the Square Kilometre Array’ book and 15 years since the first such volume appeared in 1999. In that time numerous and unexpected advances have been made in the fields of astronomy and physics relevant to the capabilities of the Square Kilometre Array (SKA). The SKA itself progressed from an idea to a developing reality with a baselined Phase 1 design (SKA1) and construction planned from 2017. To facilitate the publication of a new, updated science book, which will be relevant to the current astrophysical context, the meeting "Advancing Astrophysics with the Square Kilometre Array" was held in Giardina Naxos, Sicily. Articles were solicited from the community for that meeting to document the scientific advances enabled by the first phase of the SKA and those pertaining to future SKA deployments, with expected gains of 5 times the Phase 1 sensitivity below 350 MHz, about 10 times the Phase 1 sensitivity above 350 MHz and with f...

  3. Black Hole Astrophysics The Engine Paradigm

    CERN Document Server

    Meier, David L

    2012-01-01

    As a result of significant research over the past 20 years, black holes are now linked to some of the most spectacular and exciting phenomena in the Universe, ranging in size from those that have the same mass as stars to the super-massive objects that lie at the heart of most galaxies, including our own Milky Way. This book first introduces the properties of simple isolated holes, then adds in complications like rotation, accretion, radiation, and magnetic fields, finally arriving at a basic understanding of how these immense engines work. Black Hole Astrophysics • reviews our current knowledge of cosmic black holes and how they generate the most powerful observed pheonomena in the Universe; • highlights the latest, most up-to-date theories and discoveries in this very active area of astrophysical research; • demonstrates why we believe that black holes are responsible for important phenomena such as quasars, microquasars and gammaray bursts; • explains to the reader the nature of the violent and spe...

  4. Two families of astrophysical diverging lens models

    Science.gov (United States)

    Er, Xinzhong; Rogers, Adam

    2018-03-01

    In the standard gravitational lensing scenario, rays from a background source are bent in the direction of a foreground lensing mass distribution. Diverging lens behaviour produces deflections in the opposite sense to gravitational lensing, and is also of astrophysical interest. In fact, diverging lensing due to compact distributions of plasma has been proposed as an explanation for the extreme scattering events that produce frequency-dependent dimming of extragalactic radio sources, and may also be related to the refractive radio wave phenomena observed to affect the flux density of pulsars. In this work we study the behaviour of two families of astrophysical diverging lenses in the geometric optics limit, the power law, and the exponential plasma lenses. Generally, the members of these model families show distinct behaviour in terms of image formation and magnification, however the inclusion of a finite core for certain power-law lenses can produce a caustic and critical curve morphology that is similar to the well-studied Gaussian plasma lens. Both model families can produce dual radial critical curves, a novel distinction from the tangential distortion usually produced by gravitational (converging) lenses. The deflection angle and magnification of a plasma lens vary with the observational frequency, producing wavelength-dependent magnifications that alter the amplitudes and the shape of the light curves. Thus, multiwavelength observations can be used to physically constrain the distribution of the electron density in such lenses.

  5. Gamma teletopography

    International Nuclear Information System (INIS)

    Simonet, G.

    1986-09-01

    To set the gamma activity cartography is an important element of safety in numerous cases: intervention in hot cell, search of a radioactive source, examination of radioactive waste circuit followed by a reprocessing definition of decontamination and decommissioning processes and for all other accidents. The device presented here is like a ''black box'' with an aperture and an emulsion photosensitive to the opposite; a classical film takes photography of the place; a X-ray type emulsion gives a spot more or less contrasted and extensive corresponding to each source. Images can be processed with a microprocessor [fr

  6. Nuclear astrophysics at ISAC with DRAGON: Initial studies

    International Nuclear Information System (INIS)

    Olin, Art; Bishop, Shawn; D'Auria, John M.; Lamey, Michael; Liu, Wenjie; Wrede, Chris; Buchmann, Lothar; Chen, Alan; Hunter, Don; Laird, Alison M.; Ottewell, Dave; Rogers, Joel; Chatterjee, Mohan L.; Engel, Sabine; Strieder, Frank; Gigliotti, Dario; Hussein, Ahmed; Greife, Uwe; Jewett, Cybele; Hutcheon, Dave

    2002-01-01

    The new DRAGON recoil separator facility, designed and built to measure directly the rates of radiative proton and alpha capture reactions important for nuclear astrophysics, is now in operation at the TRIUMF-ISAC radioactive beams facility in Vancouver, Canada. Experiments have been conducted for the first time on the 21Na(p,γ)22Mg reaction. The evolution of nova explosions, and particularly their 22Na abundance, depends sensitively on this reaction rate. The radioactive 21Na beam with an intensity of up to 5 x 108 /s was directed onto a windowless hydrogen gas target (3.8 x 1018 H atoms/cm2). Prompt reaction gamma rays were detected using a BGO array and separated reaction products detected using a silicon strip detector at the end of the 20.8 m recoil mass separator. Yield measurements recording simultaneously singles and coincident signals were performed by scanning in energy over the known resonance reported previously in 22Mg at Ecm = 212 keV, and in addition, over a strong resonance observed at Ecm ≅822 keV. Known resonances in the 21Ne(p,γ)22Na, 20Ne(p,γ)21Na, and 24Mg(p,γ)25Al reactions have been used to calibrate the DRAGON. Studies are in progress to further define the performance of the DRAGON facility. Status of the data analysis and results from system performance studies will be presented along with a brief description of the new ISAC and DRAGON facilities

  7. Development of a Laue lens for nuclear astrophysics

    International Nuclear Information System (INIS)

    Rousselle, Julien

    2011-01-01

    In this work, a new type of gamma-ray telescope is presented. It features a crystal diffraction lens that concentrates photons from a large photon collecting area onto a small detector. In such a Laue lens, a large number of crystals are disposed on concentric rings; each crystal can be considered as a little mirror which deviates gamma-rays through Bragg diffraction from the incident beam onto a common focal spot. The principle of the Laue lens for astrophysics was demonstrated with the balloon mission CLAIRE. The objective of this work was to develop the Laue Lens concept into a sensitive, space qualified optics for a future satellite mission. This contribution consisted of two main facets: a) finding appropriate crystal materials and improving the performance of the diffracting crystals, and b) develop a prototype segment for a space qualified lens. Exploring new diffracting media and improving the performance of individual crystals implied the development of numerical simulations of the diffraction process for various types of mosaic and CDP (Curved Diffraction Plane) crystals. These simulations were used to select suitable crystals to be grown and to be tested. Two different X-ray facilities were used to probe the crystalline quality of candidate materials: the European Synchrotron Radiation Facility (ESRF, France) and the high neutron flux reactor at ILL (France). During 10 beam-runs (and a total of 3 months of measurement), a large number of samples were tested, including Ag, Ir, Pt, Au, Pb, Rh, AsGa, SiGe, and Cu crystals. Outstanding performances were established for gold and silver crystals (>500 keV), Cu and Ge (300-500 keV) crystals and SiGe CDP (<300 keV) crystal. The second facet of this work consisted of designing, manufacturing and characterizing a prototype lens segment. This R and D program was completed in collaboration with the CNES and Thales Alenia Space. For a representative sample of metal and semiconductor crystals that were mounted on the

  8. Gamma-Ray Bursts The Brightest Explosions in the Universe

    CERN Document Server

    Vedrenne, Gilbert

    2009-01-01

    Since their discovery was first announced in 1973, gamma-ray bursts (GRBs) have been among the most fascination objects in the universe. While the initial mystery has gone, the fascination continues, sustained by the close connection linking GRBs with some of the most fundamental topics in modern astrophysics and cosmology. Both authors have been active in GRB observations for over two decades and have produced an outstanding account on both the history and the perspectives of GRB research.

  9. Gamma-ray-line astronomy: the case of 26Al

    International Nuclear Information System (INIS)

    Prantzos, N.

    1986-07-01

    The recent detection of the 1.8 MeV line in the galactic plane, attributed to the decay of ∼ 3 Solar mass of radioactive 26 Al, brought closer together the disciplines of gamma-ray Astronomy and Nuclear Astrophysics. A review is presented here of the possible production mechanisms and sites of 26 Al in the Galaxy, with an emphasis on the role of massive, mass losing stars

  10. The Fermi Gamma-Ray Space Telescope, Exploding Stars, Neutron Stars, and Black Holes

    Science.gov (United States)

    Thompson, David J.

    2010-01-01

    Since August, 2008, the Fermi Gamma-ray Space Telescope has been scanning the sky, producing a full-sky image every three hours. These cosmic gamma-rays come from extreme astrophysical phenomena, many related to exploding stars (supernovae) or what these explosions leave behind: supernova remnants, neutron stars, and black holes. This talk uses sample Fermi results, plus simple demonstrations, to illustrate the exotic properties of these endpoints of stellar evolution.

  11. Detection techniques for the H.E.S.S. II telescope, data modeling of gravitational lensing and emission of blazars in HE-VHE astronomy

    International Nuclear Information System (INIS)

    Barnacka, Anna

    2013-01-01

    This thesis presents the study of four aspects of high energy astronomy. The first part of my thesis is dedicated to an aspect of instrument development for imaging atmospheric Cherenkov telescopes, namely the Level 2 trigger system of the High Energy Stereoscopic System (H.E.S.S.). My work on the project focused on the algorithm development and the Monte Carlo simulations of the trigger system and overall instrument. The hardware implementation of the system is described and its expected performances are then evaluated. The H.E.S.S. array has been used to observe the blazar PKS 1510-089. The second part of my thesis deals with the data analysis and modeling of broad-band emission of this particular blazar. In part II of my thesis, I am presenting the analysis of the H.E.S.S. data: the light curve and spectrum of PKS 1510-089, together with the FERMI data and a collection of multi-wavelength data obtained with various instruments. I am presenting the model of PKS 1510-089 observations carried out during a flare recorded by H.E.S.S.. The model is based on a single zone internal shock scenario. The third part of my thesis deals with blazars observed by the FERMI-LAT, but from the point of view of other phenomena: a strong gravitational lensing. This part of my thesis shows the first evidence for gravitational lensing phenomena in high energy gamma-rays. This evidence comes from the observation of a gravitational lens system induced echo in the light curve of the distant blazar PKS 1830-211. Traditional methods for the estimation of time delays in gravitational lensing systems rely on the cross-correlation of the light curves from individual images. In my thesis, I used 300 MeV-30 GeV photons detected by the Fermi-LAT instrument. The FERMI-LAT instrument cannot separate the images of known lenses. The observed light curve is thus the superposition of individual image light curves. The FERMI-LAT instrument has the advantage of providing long, evenly spaced, time series

  12. Advanced Telescope for High Energy Nuclear Astrophysics (ATHENA)

    National Research Council Canada - National Science Library

    Johnson, W. N; Dermer, C; Kroeger, R. A; Kurfess, J. D; Gehrels, N; Grindlay, J; Leising, M. D; Prince, T; Purcell, W; Ryan, J; Tumer, T

    1995-01-01

    We present a space mission concept for a low energy gamma-ray telescope, ATHENA, which is under investigation as the next major advance in gamma-ray spectroscopy following the current COMPTON Gamma...

  13. Seroprevalence for hepatitis E virus (HEV infection among volunteer blood donors of the Regional Blood Bank of Londrina, State of Paraná , Brazil Soroprevalência da infecção pelo virus da hepatite E (VHE em candidatos a doadores de sangue voluntários do Hemocentro Regional de Londrina, Londrina, Estado do Paraná, Brasil

    Directory of Open Access Journals (Sweden)

    André Luiz Bortoliero

    2006-04-01

    Full Text Available A cross-sectional study was carried out among 996 volunteer blood donors enrolled from May 1999 to December 1999 to determine the seroprevalence of hepatitis E virus (HEV infection among volunteer blood donors of the Regional Blood Bank of Londrina, State of Paraná, Brazil, and to evaluate whether the rate of seroprevalence of IgG anti-HEV antibodies is associated with sociodemographic variables and with seropositivity for hepatitis A virus (HAV infection. All participants answered the questionnaire regarding the sociodemographic characterisitcs. Serum samples were tested for IgG antibodies to HEV (anti-HEV by an enzyme linked immunoassay (ELISA. All serum samples positive for anti-HEV IgG and 237 serum samples negative for anti-HEV were also assayed for IgG anti-HAV antibodies by ELISA. Anti-HEV IgG was confirmed in 23/996 samples, resulting in a seroprevalence of 2.3% for HEV infection, similar to previous results obtained in developed countries. No significant association was found between the presence of anti-HEV IgG antibodies and the sociodemographic variables including gender, age, educational level, rural or urban areas, source of water, and sewer system (p > 0.05. Also, no association with seropositivity for anti-HAV IgG antibodies was observed (p > 0.05. Although this study revealed a low seroprevalence of HEV infection in the population evaluated, the results showed that this virus is circulating among the population from Londrina, South Brazil, and point out the need of further studies to define the clinical and epidemiological importance of HEV infection and to identify additional risk factors involved in the epidemiology and pathogenesis of this infection in this population.Os objetivos do estudo foram determinar a soroprevalência da infecção pelo vírus da hepatite E (VHE em candidatos a doadores de sangue voluntários do Hemocentro Regional de Londrina, Paraná, e avaliar se essa soroprevalência está associada com vari

  14. Gamma knife

    International Nuclear Information System (INIS)

    Kawamoto, Shunsuke; Takakura, Kintomo

    1991-01-01

    As to the gamma knife which is the radiation surgery device developed in Sweden a quarter century ago, its principle, structure, treatment techniques, already established clinical effect and the problems being left for hereafter are described. This treatment means supplements the operation under microscopes, and at present it takes the important position in neurosurgery, but hereafter, by the interdisciplinary cooperation of neurosurgery and clinical radiobiology, the more development can be expected. The method of irradiating the radiation of high dose selectively to a target region and breaking its tissue is called radiosurgery, and the device developed for this purpose is the gamma knife. First, it was applied to functional diseases, but good results were obtained by its application to auditory nerve and brain blood vessels, and it establishes the position as the safe treatment method of the morbid state in the deep part of brains, which is difficult to reach by operation. Accompanying the recent progress of the operation of skull base part, attention is paid to its application to various tumors in skull base. On the other hand, the radiosurgery combining a cyclotron or a linear accelerator with stereotaxic brain surgery is actively tried mainly to the deformation of brain blood vessels. (K.I.)

  15. Statistical learning in high energy and astrophysics

    Energy Technology Data Exchange (ETDEWEB)

    Zimmermann, J.

    2005-06-16

    This thesis studies the performance of statistical learning methods in high energy and astrophysics where they have become a standard tool in physics analysis. They are used to perform complex classification or regression by intelligent pattern recognition. This kind of artificial intelligence is achieved by the principle ''learning from examples'': The examples describe the relationship between detector events and their classification. The application of statistical learning methods is either motivated by the lack of knowledge about this relationship or by tight time restrictions. In the first case learning from examples is the only possibility since no theory is available which would allow to build an algorithm in the classical way. In the second case a classical algorithm exists but is too slow to cope with the time restrictions. It is therefore replaced by a pattern recognition machine which implements a fast statistical learning method. But even in applications where some kind of classical algorithm had done a good job, statistical learning methods convinced by their remarkable performance. This thesis gives an introduction to statistical learning methods and how they are applied correctly in physics analysis. Their flexibility and high performance will be discussed by showing intriguing results from high energy and astrophysics. These include the development of highly efficient triggers, powerful purification of event samples and exact reconstruction of hidden event parameters. The presented studies also show typical problems in the application of statistical learning methods. They should be only second choice in all cases where an algorithm based on prior knowledge exists. Some examples in physics analyses are found where these methods are not used in the right way leading either to wrong predictions or bad performance. Physicists also often hesitate to profit from these methods because they fear that statistical learning methods cannot

  16. Statistical learning in high energy and astrophysics

    International Nuclear Information System (INIS)

    Zimmermann, J.

    2005-01-01

    This thesis studies the performance of statistical learning methods in high energy and astrophysics where they have become a standard tool in physics analysis. They are used to perform complex classification or regression by intelligent pattern recognition. This kind of artificial intelligence is achieved by the principle ''learning from examples'': The examples describe the relationship between detector events and their classification. The application of statistical learning methods is either motivated by the lack of knowledge about this relationship or by tight time restrictions. In the first case learning from examples is the only possibility since no theory is available which would allow to build an algorithm in the classical way. In the second case a classical algorithm exists but is too slow to cope with the time restrictions. It is therefore replaced by a pattern recognition machine which implements a fast statistical learning method. But even in applications where some kind of classical algorithm had done a good job, statistical learning methods convinced by their remarkable performance. This thesis gives an introduction to statistical learning methods and how they are applied correctly in physics analysis. Their flexibility and high performance will be discussed by showing intriguing results from high energy and astrophysics. These include the development of highly efficient triggers, powerful purification of event samples and exact reconstruction of hidden event parameters. The presented studies also show typical problems in the application of statistical learning methods. They should be only second choice in all cases where an algorithm based on prior knowledge exists. Some examples in physics analyses are found where these methods are not used in the right way leading either to wrong predictions or bad performance. Physicists also often hesitate to profit from these methods because they fear that statistical learning methods cannot be controlled in a

  17. Novel laboratory simulations of astrophysical jets

    Science.gov (United States)

    Brady, Parrish Clawson

    This thesis was motivated by the promise that some physical aspects of astrophysical jets and collimation processes can be scaled to laboratory parameters through hydrodynamic scaling laws. The simulation of astrophysical jet phenomena with laser-produced plasmas was attractive because the laser- target interaction can inject energetic, repeatable plasma into an external environment. Novel laboratory simulations of astrophysical jets involved constructing and using the YOGA laser, giving a 1064 nm, 8 ns pulse laser with energies up to 3.7 + 0.2 J . Laser-produced plasmas were characterized using Schlieren, interferometry and ICCD photography for their use in simulating jet and magnetosphere physics. The evolution of the laser-produced plasma in various conditions was compared with self-similar solutions and HYADES computer simulations. Millimeter-scale magnetized collimated outflows were produced by a centimeter scale cylindrically symmetric electrode configuration triggered by a laser-produced plasma. A cavity with a flared nozzle surrounded the center electrode and the electrode ablation created supersonic uncollimated flows. This flow became collimated when the center electrode changed from an anodeto a cathode. The plasma jets were in axially directed permanent magnetic fields with strengths up to 5000 Gauss. The collimated magnetized jets were 0.1-0. 3 cm wide, up to 2.0 cm long, and had velocities of ~4.0 × 10 6 cm/s. The dynamics of the evolution of the jet were compared qualitatively and quantitatively with fluxtube simulations from Bellan's formulation [6] giving a calculated estimate of ~2.6 × 10 6 cm/s for jet evolution velocity and evidence for jet rotation. The density measured with interferometry was 1.9 ± 0.2 × 10 17 cm -3 compared with 2.1 × 10 16 cm -3 calculated with Bellan's pressure balance formulation. Kinks in the jet column were produced consistent with the Kruskal-Shafranov condition which allowed stable and symmetric jets to form with

  18. BOOK REVIEW: Astrophysics (Advanced Physics Readers)

    Science.gov (United States)

    Kibble, Bob

    2000-07-01

    Here is a handy and attractive reader to support students on post-16 courses. It covers the astrophysics, astronomy and cosmology that are demanded at A-level and offers anyone interested in these fields an interesting and engaging reference book. The author and the production team deserve credit for producing such an attractive book. The content, in ten chapters, covers what one would expect at this level but it is how it is presented that struck me as the book's most powerful asset. Each chapter ends with a summary of key ideas. Line drawings are clear and convey enough information to make them more than illustrations - they are as valuable as the text in conveying information. Full colour is used throughout to enhance illustrations and tables and to lift key sections of the text. A number of colour photographs complement the material and serve to maintain interest and remind readers that astrophysics is about real observable phenomena. Included towards the end is a set of tables offering information on physical and astronomical data, mathematical techniques and constellation names and abbreviations. This last table puzzled me as to its value. There is a helpful bibliography which includes society contacts and a website related to the text. Perhaps my one regret is that there is no section where students are encouraged to actually do some real astronomy. Astrophysics is in danger of becoming an armchair and calculator interest. There are practical projects that students could undertake either for school assessment or for personal interest. Simple astrophotography to capture star trails, observe star colours and estimate apparent magnitudes is an example, as is a simple double-star search. There are dozens more. However, the author's style is friendly and collaborative. He befriends the reader as they journey together through the ideas. There are progress questions at the end of each chapter. Their style tends to be rather closed and they emphasize factual recall

  19. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy. SANTABRATA DAS. Articles written in Journal of Astrophysics and Astronomy. Volume 23 Issue 1-2 March-June 2002 pp 143-147. Standing Shocks around Black Holes and Estimation of Outflow Rates · Santabrata Das Sandip K. Chakrabarti · More Details Abstract ...

  20. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... Home; Journals; Journal of Astrophysics and Astronomy. H. M. Antia. Articles written in Journal of Astrophysics and Astronomy. Volume 21 Issue 3-4 September-December 2000 pp 353-356 Session VIII – Helioseismology. Temporal Variation of Large Scale Flows in the Solar Interior · Sarbani Basu H. M. ...