WorldWideScience

Sample records for vhe gamma astrophysics

  1. Early warning for VHE gamma-ray flares with the ARGO-YBJ detector

    Energy Technology Data Exchange (ETDEWEB)

    Bartoli, B. [Dipartimento di Fisica dell' Universita di Napoli ' Federico II' , Complesso Universitario di Monte Sant' Angelo, via Cinthia, 80126 Napoli (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Napoli, Complesso Universitario di Monte Sant' Angelo, via Cinthia, 80126 Napoli (Italy); Bernardini, P. [Dipartimento di Fisica dell' Universita del Salento, via per Arnesano, 73100 Lecce (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Lecce, via per Arnesano, 73100 Lecce (Italy); Bi, X.J. [Key Laboratory of Particle Astrophysics, Institute of High Energy Physics, Chinese Academy of Sciences, P.O. Box 918, 100049 Beijing (China); Bleve, C. [Dipartimento di Fisica dell' Universita del Salento, via per Arnesano, 73100 Lecce (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Lecce, via per Arnesano, 73100 Lecce (Italy); Bolognino, I. [Dipartimento di Fisica Nucleare e Teorica dell' Universita di Pavia, via Bassi 6, 27100 Pavia (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Pavia, via Bassi 6, 27100 Pavia (Italy); Branchini, P.; Budano, A. [Istituto Nazionale di Fisica Nucleare, Sezione di Roma Tre, via della Vasca Navale 84, 00146 Roma (Italy); Calabrese Melcarne, A.K. [Istituto Nazionale di Fisica Nucleare - CNAF, Viale Berti-Pichat 6/2, 40127 Bologna (Italy); Camarri, P. [Dipartimento di Fisica dell' Universita di Roma ' Tor Vergata' , via della Ricerca Scientifica 1, 00133 Roma (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Roma Tor Vergata, via della Ricerca Scientifica 1, 00133 Roma (Italy); Cao, Z. [Key Laboratory of Particle Astrophysics, Institute of High Energy Physics, Chinese Academy of Sciences, P.O. Box 918, 100049 Beijing (China); and others

    2011-12-11

    Detecting and monitoring emissions from flaring gamma-ray sources in the very-high-energy (VHE, > 100 GeV) band is a very important topic in gamma-ray astronomy. The ARGO-YBJ detector is characterized by a high duty cycle and a wide field of view. Therefore, it is particularly capable of detecting flares from extragalactic objects. Based on fast reconstruction and analysis, real-time monitoring of 33 selected VHE extragalactic sources is implemented. Flares exceeding a specific threshold are reported timely, hence enabling the follow-up observation of these objects using more sensitive detectors, such as Cherenkov telescopes.

  2. VHE and UHE gamma ray astronomy: transients and sources

    International Nuclear Information System (INIS)

    Fegan, D.J.

    1987-01-01

    The transient and sporadic nature of a number of Cosmic gamma ray sources is examined in relation to VHE (10 11 to 10 14 eV) observations of pulsars and X-ray binary systems. Transients are not all that common but when they occur they generally produce emission of sufficient intensity and duration to obtain statistically significant effects which are gradually helping to establish a source catalog. A brief review is also made of the staus of UHE (>10 14 eV) gamma ray astronomy

  3. Very high energy gamma ray astrophysics. Progress report, August 1, 1980-July 31, 1981

    International Nuclear Information System (INIS)

    Lamb, R.C.

    1981-04-01

    Very high energy (VHE) gamma ray astronomy gives insight into fundamental questions regarding the origins of cosmic rays and the types of particle acceleration mechanisms which operate in nature. VHE photons are detected by means of the Cerenkov light their secondaries produce in the atmosphere. During June - September 1981 the solar collectors at Edwards Air Force Base will be used to detect the Cerenkov light from the photons from Cygnus X-3 thus extending its observation into a previously unexplored region. The time of each detector event will be recorded to the nearest 0.5 ms. If Cygnus X-3 is the neutron star remnant of a recent (unseen) supernova, then the VHE gamma rays may be pulsed at its rotation rate, and the data obtained will allow a sensitive test of this possibility. The equipment for the summer observations is nearly ready and will be tested in May prior to any early run in June

  4. Detection of VHE gamma-ray emission from the vicinity of PSR B1706-44 with H.E.S.S.

    Energy Technology Data Exchange (ETDEWEB)

    Chaves, Ryan C.G.; Ona Wilhelmi, Emma de [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Terrier, Regis [APC, CNRS, Univ. Paris-7 (France); Stegmann, Christian [Universitaet Erlangen-Nuernberg, Erlangen (Germany). Physikalisches Institut; Khelifi, Bruno [LLR, Ecole Polytechnique, CNRS/IN2P3, Palaiseau (France); Jager, Okkie C. de [Unit for Space Physics, North-West Univ., Potchefstroom (South Africa)

    2010-07-01

    The gamma-ray pulsar PSR B1706-44 and the adjacent supernova remnant (SNR) candidate G343.1-2.3 were observed by H.E.S.S. during a dedicated observational campaign in 2007. A new source of very-high-energy (VHE;E>100 GeV) gamma-ray emission, HESS J1708-443, was discovered with its centroid at RA(J2000.0)=17 h 8 m 10 s and Dec (J2000.0)=-44 d 21{sup '} ({+-}3{sup '} statistical error on each axis). The VHE gamma-ray source is significantly more extended than the H.E.S.S. point-spread function and has an intrinsic Gaussian width of 0.29 {+-}0.04 . Its energy spectrum can be described by a power law with a photon index=2.0{+-}0.1 (stat){+-}0.2 (syst). The integral flux measured between 1 and 10 TeV is {proportional_to}17% of the Crab Nebula flux in the same energy range. The possible associations with the energetic PSR B1706-44, also recently detected in the GeV domain with Fermi/LAT and AGILE, and SNR G343.1-2.3 are discussed.

  5. Relevance of axionlike particles for very-high-energy astrophysics

    International Nuclear Information System (INIS)

    De Angelis, Alessandro; Galanti, Giorgio; Roncadelli, Marco

    2011-01-01

    Several extensions of the standard model and, in particular, superstring theories suggest the existence of axionlike particles (ALPs), which are very light spin-zero bosons with a two-photon coupling. As a consequence, photon-ALP oscillations occur in the presence of an external magnetic field, and ALPs can lead to observable effects on the measured photon spectrum of astrophysical sources. An intriguing situation arises when blazars are observed in the very-high-energy (VHE) band--namely, above 100 GeV--as it is the case with the presently operating Imaging Atmospheric Cherenkov Telescopes H.E.S.S, Major Atmospheric Gamma Imaging Cherenkov telescope, Collaboration of Australia and Nippon for a Gamma Ray Observatory in the Outback III, and VERITAS. The extragalactic background light produced by galaxies during cosmic evolution gives rise to a source dimming which becomes important in the VHE band and increases with energy, since hard photons from a blazar scatter off soft extragalactic background light photons thereby disappearing into e + e - pairs. This dimming can be considerably reduced by photon-ALP oscillations, and since they are energy independent the resulting blazar spectra become harder than expected. We consider throughout a scenario first proposed by De Angelis, Roncadelli, and Mansutti in which the above strategy is implemented with photon-ALP oscillations triggered by large-scale magnetic fields, and we systematically investigate its implications for VHE blazars. We find that for ALPs lighter than 5·10 -10 eV the photon survival probability is larger than predicted by conventional physics above a few hundred GeV. Specifically, a boost factor of 10 can easily occur for sources at large distance and large energy, e.g. at 8 TeV for the blazar 1ES 0347-121 at redshift z=0.188. This is a clear-cut prediction which can be tested with the planned Cherenkov Telescope Array and the High Altitude Water Cherenkov Experiment (HAWC) water Cherenkov

  6. Gamma-ray bursts: astrophysical puzzle of the century

    International Nuclear Information System (INIS)

    Hudec, R.

    1998-01-01

    An overview is given of the problems of gamma-ray bursts /GRB/. As GRB became one of the greatest mysteries in modern astrophysics, this field of astrophysics is a subject of intensive research. The article covers some topical aspects of experiments related to the indentification of gamma-ray bursts. The preparation and results of experiments in the Astronomical Institute of the Academy of Sciences of the Czech Republic are described. (Z.J.)

  7. PKS 2005-489 at VHE: four years of monitoring with HESS and simultaneous multi-wavelength observations

    Science.gov (United States)

    H.E.S.S. Collaboration; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Barres de Almeida, U.; Bazer-Bachi, A. R.; Becherini, Y.; Behera, B.; Benbow, W.; Bernlöhr, K.; Bochow, A.; Boisson, C.; Bolmont, J.; Borrel, V.; Brucker, J.; Brun, F.; Brun, P.; Bühler, R.; Bulik, T.; Büsching, I.; Boutelier, T.; Chadwick, P. M.; Charbonnier, A.; Chaves, R. C. G.; Cheesebrough, A.; Chounet, L.-M.; Clapson, A. C.; Coignet, G.; Costamante, L.; Dalton, M.; Daniel, M. K.; Davids, I. D.; Degrange, B.; Deil, C.; Dickinson, H. J.; Djannati-Ataï, A.; Domainko, W.; O'C. Drury, L.; Dubois, F.; Dubus, G.; Dyks, J.; Dyrda, M.; Egberts, K.; Eger, P.; Espigat, P.; Fallon, L.; Farnier, C.; Fegan, S.; Feinstein, F.; Fiasson, A.; Förster, A.; Fontaine, G.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Gérard, L.; Gerbig, D.; Giebels, B.; Glicenstein, J. F.; Glück, B.; Goret, P.; Göring, D.; Hauser, M.; Heinz, S.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hoffmann, A.; Hofmann, W.; Hofverberg, P.; Holleran, M.; Hoppe, S.; Horns, D.; Jacholkowska, A.; de Jager, O. C.; Jahn, C.; Jung, I.; Katarzyński, K.; Katz, U.; Kaufmann, S.; Kerschhaggl, M.; Khangulyan, D.; Khélifi, B.; Keogh, D.; Klochkov, D.; Kluźniak, W.; Kneiske, T.; Komin, Nu.; Kosack, K.; Kossakowski, R.; Lamanna, G.; Lenain, J.-P.; Lohse, T.; Marandon, V.; Martineau-Huynh, O.; Marcowith, A.; Masbou, J.; Maurin, D.; McComb, T. J. L.; Medina, M. C.; Méhault, J.; Moderski, R.; Moulin, E.; Naumann-Godo, M.; de Naurois, M.; Nedbal, D.; Nekrassov, D.; Nicholas, B.; Niemiec, J.; Nolan, S. J.; Ohm, S.; Olive, J.-F.; de Oña Wilhelmi, E.; Orford, K. J.; Ostrowski, M.; Panter, M.; Paz Arribas, M.; Pedaletti, G.; Pelletier, G.; Petrucci, P.-O.; Pita, S.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raubenheimer, B. C.; Raue, M.; Rayner, S. M.; Renaud, M.; Rieger, F.; Ripken, J.; Rob, L.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Ruppel, J.; Sahakian, V.; Santangelo, A.; Schlickeiser, R.; Schöck, F. M.; Schwanke, U.; Schwarzburg, S.; Schwemmer, S.; Shalchi, A.; Sikora, M.; Skilton, J. L.; Sol, H.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Superina, G.; Szostek, A.; Tam, P. H.; Tavernet, J.-P.; Terrier, R.; Tibolla, O.; Tluczykont, M.; van Eldik, C.; Vasileiadis, G.; Venter, C.; Venter, L.; Vialle, J. P.; Vincent, P.; Vivier, M.; Völk, H. J.; Volpe, F.; Wagner, S. J.; Ward, M.; Zdziarski, A. A.; Zech, A.

    2010-02-01

    Aims: Our aim is to study the very high energy (VHE; E>100 GeV) γ-ray emission from BL Lac objects and the evolution in time of their broad-band spectral energy distribution (SED). Methods: VHE observations of the high-frequency peaked BL Lac object PKS 2005-489 were made with the High Energy Stereoscopic System (HESS) from 2004 through 2007. Three simultaneous multi-wavelength campaigns at lower energies were performed during the HESS data taking, consisting of several individual pointings with the XMM-Newton and RXTE satellites. Results: A strong VHE signal, ~17σ total, from PKS 2005-489 was detected during the four years of HESS observations (90.3 h live time). The integral flux above the average analysis threshold of 400 GeV is ~3% of the flux observed from the Crab Nebula and varies weakly on time scales from days to years. The average VHE spectrum measured from ~300 GeV to ~5 TeV is characterized by a power law with a photon index, Γ = 3.20± 0.16_stat± 0.10_syst. At X-ray energies the flux is observed to vary by more than an order of magnitude between 2004 and 2005. Strong changes in the X-ray spectrum (ΔΓX ≈ 0.7) are also observed, which appear to be mirrored in the VHE band. Conclusions: The SED of PKS 2005-489, constructed for the first time with contemporaneous data on both humps, shows significant evolution. The large flux variations in the X-ray band, coupled with weak or no variations in the VHE band and a similar spectral behavior, suggest the emergence of a new, separate, harder emission component in September 2005. Supported by CAPES Foundation, Ministry of Education of Brazil.Now at Harvard-Smithsonian Center for Astrophysics, Cambridge, USA.Now at W.W. Hansen Experimental Physics Laboratory & Kavli Institute for Particle Astrophysics and Cosmology, Stanford University, Stanford, USA.

  8. Very high-energy gamma rays from gamma-ray bursts.

    Science.gov (United States)

    Chadwick, Paula M

    2007-05-15

    Very high-energy (VHE) gamma-ray astronomy has undergone a transformation in the last few years, with telescopes of unprecedented sensitivity having greatly expanded the source catalogue. Such progress makes the detection of a gamma-ray burst at the highest energies much more likely than previously. This paper describes the facilities currently operating and their chances for detecting gamma-ray bursts, and reviews predictions for VHE gamma-ray emission from gamma-ray bursts. Results to date are summarized.

  9. Magnetic absorption of VHE photons in the magnetosphere of the Crab pulsar

    Science.gov (United States)

    Bogovalov, S. V.; Contopoulos, I.; Prosekin, A.; Tronin, I.; Aharonian, F. A.

    2018-05-01

    The detection of the pulsed ˜1 TeV gamma-ray emission from the Crab pulsar reported by MAGIC and VERITAS collaborations demands a substantial revision of existing models of particle acceleration in the pulsar magnetosphere. In this regard model independent restrictions on the possible production site of the very high energy (VHE) photons become an important issue. In this paper, we consider limitations imposed by the process of conversion of VHE gamma-rays into e± pairs in the magnetic field of the pulsar magnetosphere. Photons with energies exceeding 1 TeV are effectively absorbed even at large distances from the surface of the neutron star. Our calculations of magnetic absorption in the force-free magnetosphere show that the twisting of the magnetic field due to the pulsar rotation makes the magnetosphere more transparent compared to the dipole magnetosphere. The gamma-ray absorption appears stronger for photons emitted in the direction of rotation than in the opposite direction. There is a small angular cone inside which the magnetosphere is relatively transparent and photons with energy 1.5 TeV can escape from distances beyond 0.1 light cylinder radius (Rlc). The emission surface from where photons can be emitted in the observer's direction further restricts the sites of VHE gamma-ray production. For the observation angle 57° relative to the Crab pulsar axis of rotation and the orthogonal rotation, the emission surface in the open field line region is located as close as 0.4 Rlc from the stellar surface for a dipole magnetic field, and 0.1 Rlc for a force-free magnetic field.

  10. Dicty_cDB: VHE138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE138 (Link to dictyBase) - - - Contig-U15767-1 VHE138P (Link... to Original site) VHE138F 569 VHE138Z 621 VHE138P 1170 - - Show VHE138 Library VH (Link to library) Clone ID VHE138 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...FVDNQAGDSXSAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQGF NDVSYP--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICT...rsi*i**fkllpn*rtrf q*ckls--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTPVDCG ANDEDKCKTWSCDPTKGG

  11. The Future of Gamma Ray Astrophysics

    CERN Multimedia

    CERN. Geneva

    2016-01-01

    Over the past decade, gamma ray astrophysics has entered the astrophysical mainstream. Extremely successful space-borne (GeV) and ground-based (TeV) detectors, combined with a multitude of partner telescopes, have revealed a fascinating “astroscape" of active galactic nuclei, pulsars, gamma ray bursts, supernova remnants, binary stars, star-forming galaxies, novae much more, exhibiting major pathways along which large energy releases can flow. From  a basic physics perspective, exquisitely sensitive measurements have constrained the nature of dark matter, the cosmological origin of magnetic field and the properties of black holes. These advances have motivated the development of new facilities, including HAWC, DAMPE, CTA and SVOM, which will further our understanding of the high energy universe. Topics that will receive special attention include merging neutron star binaries, clusters of galaxies, galactic cosmic rays and putative, TeV dark matter.

  12. The goals of gamma-ray spectroscopy in high energy astrophysics

    Science.gov (United States)

    Lingenfelter, Richard E.; Higdon, James C.; Leventhal, Marvin; Ramaty, Reuven; Woosley, Stanford E.

    1990-01-01

    The use of high resolution gamma-ray spectroscopy in astrophysics is discussed with specific attention given to the application of the Nuclear Astrophysics Explorer (NAE). The gamma-ray lines from nuclear transitions in radionucleic decay and positron annihilation permits the study of current sites, rates and models of nucleosynthesis, and galactic structure. Diffuse galactic emission is discussed, and the high-resolution observations of gamma-ray lines from discrete sites are also described. Interstellar mixing and elemental abundances can also be inferred from high-resolution gamma-ray spectroscopy of nucleosynthetic products. Compact objects can also be examined by means of gamma-ray emissions, allowing better understanding of neutron stars and the accreting black hole near the galactic center. Solar physics can also be investigated by examining such features as solar-flare particle acceleration and atmospheric abundances.

  13. Physics and astrophysics with gamma-ray telescopes

    Energy Technology Data Exchange (ETDEWEB)

    Vandenbroucke, J. [Kavli Institute for Particle Astrophysics and Cosmology, Department of Physics and SLAC National Accelerator Laboratory, Stanford University, Stanford, CA 94305 (United States)

    2012-08-15

    In the past few years gamma-ray astronomy has entered a golden age. A modern suite of telescopes is now scanning the sky over both hemispheres and over six orders of magnitude in energy. At {approx}TeV energies, only a handful of sources were known a decade ago, but the current generation of ground-based imaging atmospheric Cherenkov telescopes (H.E.S.S., MAGIC, and VERITAS) has increased this number to nearly one hundred. With a large field of view and duty cycle, the Tibet and Milagro air shower detectors have demonstrated the promise of the direct particle detection technique for TeV gamma rays. At {approx}GeV energies, the Fermi Gamma-ray Space Telescope has increased the number of known sources by nearly an order of magnitude in its first year of operation. New classes of sources that were previously theorized to be gamma-ray emitters have now been confirmed observationally. Moreover, there have been surprise discoveries of GeV gamma-ray emission from source classes for which no theory predicted it was possible. In addition to elucidating the processes of high-energy astrophysics, gamma-ray telescopes are making essential contributions to fundamental physics topics including quantum gravity, gravitational waves, and dark matter. I summarize the current census of astrophysical gamma-ray sources, highlight some recent discoveries relevant to fundamental physics, and describe the synergetic connections between gamma-ray and neutrino astronomy. This is a brief overview intended in particular for particle physicists and neutrino astronomers, based on a presentation at the Neutrino 2010 conference in Athens, Greece. I focus in particular on results from Fermi (which was launched soon after Neutrino 2008), and conclude with a description of the next generation of instruments, namely HAWC and the Cherenkov Telescope Array.

  14. Exploring the extreme gamma-ray sky with HESS

    International Nuclear Information System (INIS)

    Sol, Helene

    2006-01-01

    The international HESS experiment. High Energy Stereoscopic System, fully operational since January 2004, is opening a new era for extreme gamma-ray astronomy. Located in Namibia, it is now the most sensitive detector for cosmic sources of very high energy (VHE) gamma-rays, in the tera-electron-volt (TeV) range. In July 2005, it had already more than double the number of sources detected at such energies, with the discovery of several active galactic nuclei (AGN), supernova remnants and plerions, a binary pulsar system, a microquasar candidate, and a sample of yet unidentified sources. HESS has also provide for the first time gamma-ray images of extended sources with the first astrophysical jet resolved in gamma-rays, and the first mapping of a shell supernova remnant, which proves the efficiency of in situ acceleration of particles up to 100 TeV and beyond

  15. Science with the Advanced Gamma Ray Imaging System (AGIS)

    Science.gov (United States)

    Coppi, Paolo

    2009-05-01

    We present the scientific drivers for the Advanced Gamma Ray Imaging System (AGIS), a concept for the next-generation ground- based gamma-ray experiment, comprised of an array of ˜100 imaging atmospheric Cherenkov telescopes. Design requirements for AGIS include achieving a sensitivity an order of magnitude better than the current generation of space or ground-based instruments in the energy range of 40 GeV to ˜100 TeV. We present here an overview of the scientific goals of AGIS, including the prospects for understanding VHE phenomena in the vicinity of accreting black holes, particle acceleration in a variety of astrophysical environments, indirect detection of dark matter, study of cosmological background radiation fields, and particle physics beyond the standard model.

  16. Dicty_cDB: VHE867 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE867 (Link to dictyBase) - G02701 DDB0204977 Contig-U14789-1... - (Link to Original site) VHE867F 383 - - - - - - Show VHE867 Library VH (Link to library) Clone ID VHE867 (Link to dict...yBase) Atlas ID - NBRP ID G02701 dictyBase ID DDB0204977 Link to Contig Contig-U14789-1 Original site URL http://dict...one) Salmo salar clone ssal-rgb2-599-16... 116 2e-25 DQ363469_1( DQ363469 |pid:none) Ict...m_ : 1.00 40.0 %: cytoplasmic 36.0 %: nuclear 12.0 %: cytoskeletal 8.0 %: mitochondrial 4.0 %: peroxisomal >> predict

  17. Astrophysical applications of Delbrück scattering: Dust scattered gamma radiation from gamma ray bursts

    International Nuclear Information System (INIS)

    Kunwar, B.; Bhadra, A.; Gupta, S.K. Sen

    2014-01-01

    A preliminary, and perhaps the first, study of astrophysical applications of Delbrück scattering in a gamma-ray emitting celestial object like a gamma-ray burst (GRB) has been made. At energies≥100 MeV the elastic scattering of gamma-ray photons off the molecular dust surrounding the GRB site is dominated by Delbrück scattering. Expressions for Delbrück-scattered gamma-ray flux as a function of time has been obtained for a few selected energies by assuming a simple model of GRB. These are compared with Compton-scattered flux. At certain situations, interestingly, the former is found to exceed the latter for the first few milliseconds of the burst. The issue of detectability of Delbrück-scattered gamma-ray echo from the cloud of a GRB is discussed. Although it is observed that the detection of such an echo is not within the capability of the presently operating gamma-ray missions such as Fermi LAT, a rough estimate shows that one can be optimistic that future generation gamma-ray telescopes might be able to see such photons' contribution to the total flux. - Highlights: ► Astrophysical application of Delbrück scattering in a GRB has been made. ► Initially, the Delbrück scattering may dominate the scattering of GeV γ-rays. ► The issue of detectability of such radiations is discussed

  18. Computational Astrophysics Consortium 3 - Supernovae, Gamma-Ray Bursts and Nucleosynthesis

    Energy Technology Data Exchange (ETDEWEB)

    Woosley, Stan [Univ. of California, Santa Cruz, CA (United States)

    2014-08-29

    Final project report for UCSC's participation in the Computational Astrophysics Consortium - Supernovae, Gamma-Ray Bursts and Nucleosynthesis. As an appendix, the report of the entire Consortium is also appended.

  19. High energy astrophysics with ground-based gamma ray detectors

    International Nuclear Information System (INIS)

    Aharonian, F; Buckley, J; Kifune, T; Sinnis, G

    2008-01-01

    Recent advances in ground-based gamma ray astronomy have led to the discovery of more than 70 sources of very high energy (E γ ≥ 100 GeV) gamma rays, falling into a number of source populations including pulsar wind nebulae, shell type supernova remnants, Wolf-Rayet stars, giant molecular clouds, binary systems, the Galactic Center, active galactic nuclei and 'dark' (yet unidentified) galactic objects. We summarize the history of TeV gamma ray astronomy up to the current status of the field including a description of experimental techniques and highlight recent astrophysical results. We also discuss the potential of ground-based gamma ray astronomy for future discoveries and describe possible directions for future instrumental developments

  20. VHE Gamma-ray Supernova Remnants

    Energy Technology Data Exchange (ETDEWEB)

    Funk, Stefan; /KIPAC, Menlo Park

    2007-01-22

    Increasing observational evidence gathered especially in X-rays and {gamma}-rays during the course of the last few years support the notion that Supernova remnants (SNRs) are Galactic particle accelerators up to energies close to the ''knee'' in the energy spectrum of Cosmic rays. This review summarizes the current status of {gamma}-ray observations of SNRs. Shell-type as well as plerionic type SNRs are addressed and prospect for observations of these two source classes with the upcoming GLAST satellite in the energy regime above 100 MeV are given.

  1. Search for VHE γ-ray emission from the direction of the two millisecond pulsars PSR J0437-4715 and PSR J1824-2452 and the composite supernova remnant Kes 75 with H.E.S.S

    International Nuclear Information System (INIS)

    Fuessling, Matthias

    2012-01-01

    This work reports on the search for pulsed and steady very-high energy (VHE) gamma-ray emission in the energy range extending from 100 GeV up to 100 TeV from the direction of three pulsars with the High Energy Stereoscopic System (H.E.S.S.). Pulsed gamma-ray radiation from pulsars with energies beyond 100 GeV was found thus far only for the young and energetic Crab pulsar. A special class of pulsar wind nebulae (PWNe) is associated with composite supernova remnants (SNRs) where the PWN is centered in an expanding SNR shell. In the first part of this thesis, the results on the search for pulsed and steady VHE gamma-ray emission from the two millisecond pulsars, PSR J0437-4715 and PSR J1824-2452, are presented. Parts of the observations were conducted in a special trigger setup (the topological trigger with convergent pointing) to reduce the energy threshold of the instrument. No signal of pulsed or steady emission is found and upper limits on the pulsed and steady gamma-ray flux are derived. The upper limits on the pulsed gamma-ray flux are compared to existing model predictions and, in the case of PSR J1824-2452, allow the range of possible viewing geometries in some models to be constrained. In the second part of this work, results on the search for pulsed and steady VHE gamma-ray emission from the direction of the composite SNR Kes 75 are presented. The PWN in the center of Kes 75 is powered by a very young and powerful pulsar, PSR J1846-0258, that has an exceptionally high magnetic field. While no hint for pulsed emission is found, steady VHE gamma-ray emission is detected with a statistical significance of 10 sigma from a point-like source. The VHE gamma-ray emission is spatially coincident with the PWN and the SNR shell. Both are discussed as a possible origin for the observed emission. The pulsar of Kes 75 would be the youngest pulsar known to date to power a VHE PWN.

  2. Very high energy gamma ray astronomy from Hanle

    International Nuclear Information System (INIS)

    Chitnis, Varsha R.

    2015-01-01

    Over a past decade very high energy (VHE) gamma ray astronomy has emerged as a major astronomical discipline. In India, we have a long tradition of experiments in this field. Few years ago, multi-institutional Himalayan Gamma Ray Observatory (HiGRO) collaboration was formed to set up VHE gamma rays experiments at Hanle, a high altitude location in Himalayas. HAGAR, the first phase of this collaboration is operational since 2008. HAGAR has successfully detected VHE gamma ray emission from some of the extragalactic objects like Mrk 421, Mrk 501 as well as galactic sources including Crab nebula/pulsar. Details of HAGAR telescope system and results obtained will be discussed. HiGRO is now gearing up for the next phase, i.e. 21 m diameter MACE telescope, which is being installed at Hanle at present. Details of MACE telescope system and future plans will be discussed. (author)

  3. THE 2010 VERY HIGH ENERGY {gamma}-RAY FLARE AND 10 YEARS OF MULTI-WAVELENGTH OBSERVATIONS OF M 87

    Energy Technology Data Exchange (ETDEWEB)

    Abramowski, A. [Institut fuer Experimentalphysik, Universitaet Hamburg, Luruper Chaussee 149, D 22761 Hamburg (Germany); Acero, F. [Laboratoire Univers et Particules de Montpellier, Universite Montpellier 2, CNRS/IN2P3, CC 72, Place Eugene Bataillon, F-34095 Montpellier Cedex 5 (France); Aharonian, F.; Bernloehr, K.; Bochow, A. [Max-Planck-Institut fuer Kernphysik, P.O. Box 103980, D 69029 Heidelberg (Germany); Akhperjanian, A. G. [National Academy of Sciences of the Republic of Armenia, 24 Marshall Baghramian Avenue, 0019 Yerevan (Armenia); Anton, G.; Balzer, A. [Physikalisches Institut, Universitaet Erlangen-Nuernberg, Erwin-Rommel-Str. 1, D 91058 Erlangen (Germany); Barnacka, A. [Nicolaus Copernicus Astronomical Center, ul. Bartycka 18, 00-716 Warsaw (Poland); Barres de Almeida, U. [Department of Physics, University of Durham, South Road, Durham DH1 3LE (United Kingdom); Becherini, Y. [Astroparticule et Cosmologie (APC), CNRS, Universite Paris 7 Denis Diderot, 10, rue Alice Domon et Leonie Duquet, F-75205 Paris Cedex 13 (France); Becker, J. [Institut fuer Theoretische Physik, Lehrstuhl IV: Weltraum und Astrophysik, Ruhr-Universitaet Bochum, D 44780 Bochum (Germany); Behera, B. [Landessternwarte, Universitaet Heidelberg, Koenigstuhl, D 69117 Heidelberg (Germany); Birsin, E. [Institut fuer Physik, Humboldt-Universitaet zu Berlin, Newtonstr. 15, D 12489 Berlin (Germany); Biteau, J. [Laboratoire Leprince-Ringuet, Ecole Polytechnique, CNRS/IN2P3, F-91128 Palaiseau (France); Boisson, C. [LUTH, Observatoire de Paris, CNRS, Universite Paris Diderot, 5 Place Jules Janssen, 92190 Meudon (France); Bolmont, J. [LPNHE, Universite Pierre et Marie Curie Paris 6, Universite Denis Diderot Paris 7, CNRS/IN2P3, 4 Place Jussieu, F-75252, Paris Cedex 5 (France); Bordas, P., E-mail: martin.raue@desy.de [Institut fuer Astronomie und Astrophysik, Universitaet Tuebingen, Sand 1, D 72076 Tuebingen (Germany); Collaboration: H.E.S.S. Collaboration; MAGIC Collaboration; VERITAS Collaboration; and others

    2012-02-20

    The giant radio galaxy M 87 with its proximity (16 Mpc), famous jet, and very massive black hole ((3 - 6) Multiplication-Sign 10{sup 9} M{sub Sun }) provides a unique opportunity to investigate the origin of very high energy (VHE; E > 100 GeV) {gamma}-ray emission generated in relativistic outflows and the surroundings of supermassive black holes. M 87 has been established as a VHE {gamma}-ray emitter since 2006. The VHE {gamma}-ray emission displays strong variability on timescales as short as a day. In this paper, results from a joint VHE monitoring campaign on M 87 by the MAGIC and VERITAS instruments in 2010 are reported. During the campaign, a flare at VHE was detected triggering further observations at VHE (H.E.S.S.), X-rays (Chandra), and radio (43 GHz Very Long Baseline Array, VLBA). The excellent sampling of the VHE {gamma}-ray light curve enables one to derive a precise temporal characterization of the flare: the single, isolated flare is well described by a two-sided exponential function with significantly different flux rise and decay times of {tau}{sup rise}{sub d} = (1.69 {+-} 0.30) days and {tau}{sup decay}{sub d} = (0.611 {+-} 0.080) days, respectively. While the overall variability pattern of the 2010 flare appears somewhat different from that of previous VHE flares in 2005 and 2008, they share very similar timescales ({approx}day), peak fluxes ({Phi}{sub >0.35TeV} {approx_equal} (1-3) Multiplication-Sign 10{sup -11} photons cm{sup -2} s{sup -1}), and VHE spectra. VLBA radio observations of 43 GHz of the inner jet regions indicate no enhanced flux in 2010 in contrast to observations in 2008, where an increase of the radio flux of the innermost core regions coincided with a VHE flare. On the other hand, Chandra X-ray observations taken {approx}3 days after the peak of the VHE {gamma}-ray emission reveal an enhanced flux from the core (flux increased by factor {approx}2; variability timescale <2 days). The long-term (2001-2010) multi-wavelength (MWL

  4. THE 2010 VERY HIGH ENERGY gamma-RAY FLARE AND 10 YEARS OF MULTI-WAVELENGTH OBSERVATIONS OF M 87

    OpenAIRE

    Abramowski, A.; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Balzer, A.; Barnacka, A.; de Almeida, U. Barres; Becherini, Y.; Becker, J.; Behera, B.; Bernloehr, K.; Birsin, E.; Biteau, J.; Bochow, A.

    2012-01-01

    The giant radio galaxy M 87 with its proximity (16 Mpc), famous jet, and very massive black hole ((3-6) x 10(9) M-circle dot) provides a unique opportunity to investigate the origin of very high energy (VHE; E > 100 GeV) gamma-ray emission generated in relativistic outflows and the surroundings of supermassive black holes. M 87 has been established as a VHE gamma-ray emitter since 2006. The VHE gamma-ray emission displays strong variability on timescales as short as a day. In this paper, resu...

  5. Astrophysical hints of axion-like particles

    Science.gov (United States)

    Roncadelli, M.; Galanti, G.; Tavecchio, F.; Bonnoli, G.

    2015-01-01

    After reviewing three astrophysical hints of the existence of axion-like particles (ALPs), we describe in more detail a new similar hint involving flat spectrum radio quasars (FSRQs). Detection of FSRQs above about 20GeV pose a challenge to very-high-energy (VHE) astrophysics, because at those energies the ultraviolet emission from their broad line region should prevent photons produced by the central engine to leave the source. Although a few astrophysical explanations have been put forward, they are totally ad hoc. We show that a natural explanation instead arises within the conventional models of FSRQs provided that photon-ALP oscillations occur inside the source. Our analysis takes the FSRQ PKR 1222+206 as an example, and it looks tantalizing that basically the same choice of the free model parameters adopted in this case is consistent with those that provide the other three hints of the existence of ALPs.

  6. SEARCH FOR A CORRELATION BETWEEN VERY-HIGH-ENERGY GAMMA RAYS AND GIANT RADIO PULSES IN THE CRAB PULSAR

    Energy Technology Data Exchange (ETDEWEB)

    Aliu, E. [Department of Physics and Astronomy, Barnard College, Columbia University, NY 10027 (United States); Archambault, S. [Physics Department, McGill University, Montreal, QC H3A 2T8 (Canada); Arlen, T. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Aune, T.; Bouvier, A. [Santa Cruz Institute for Particle Physics and Department of Physics, University of California, Santa Cruz, CA 95064 (United States); Beilicke, M.; Buckley, J. H.; Bugaev, V.; Dickherber, R. [Department of Physics, Washington University, St. Louis, MO 63130 (United States); Benbow, W. [Fred Lawrence Whipple Observatory, Harvard-Smithsonian Center for Astrophysics, Amado, AZ 85645 (United States); Byrum, K. [Argonne National Laboratory, 9700 S. Cass Avenue, Argonne, IL 60439 (United States); Cesarini, A.; Connolly, M. P. [School of Physics, National University of Ireland Galway, University Road, Galway (Ireland); Ciupik, L. [Astronomy Department, Adler Planetarium and Astronomy Museum, Chicago, IL 60605 (United States); Collins-Hughes, E. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Cui, W. [Department of Physics, Purdue University, West Lafayette, IN 47907 (United States); Duke, C. [Department of Physics, Grinnell College, Grinnell, IA 50112-1690 (United States); Dumm, J. [School of Physics and Astronomy, University of Minnesota, Minneapolis, MN 55455 (United States); Falcone, A. [Department of Astronomy and Astrophysics, 525 Davey Lab, Pennsylvania State University, University Park, PA 16802 (United States); Federici, S., E-mail: schroedter@veritas.sao.arizona.edu, E-mail: mccann@kicp.uchicago.edu, E-mail: nepomuk.otte@gmail.com [DESY, Platanenallee 6, 15738 Zeuthen (Germany); and others

    2012-12-01

    We present the results of a joint observational campaign between the Green Bank radio telescope and the VERITAS gamma-ray telescope, which searched for a correlation between the emission of very-high-energy (VHE) gamma rays (E {sub {gamma}} > 150 GeV) and giant radio pulses (GRPs) from the Crab pulsar at 8.9 GHz. A total of 15,366 GRPs were recorded during 11.6 hr of simultaneous observations, which were made across four nights in 2008 December and in 2009 November and December. We searched for an enhancement of the pulsed gamma-ray emission within time windows placed around the arrival time of the GRP events. In total, eight different time windows with durations ranging from 0.033 ms to 72 s were positioned at three different locations relative to the GRP to search for enhanced gamma-ray emission which lagged, led, or was concurrent with, the GRP event. Furthermore, we performed separate searches on main pulse GRPs and interpulse GRPs and on the most energetic GRPs in our data sample. No significant enhancement of pulsed VHE emission was found in any of the preformed searches. We set upper limits of 5-10 times the average VHE flux of the Crab pulsar on the flux simultaneous with interpulse GRPs on single-rotation-period timescales. On {approx}8 s timescales around interpulse GRPs, we set an upper limit of 2-3 times the average VHE flux. Within the framework of recent models for pulsed VHE emission from the Crab pulsar, the expected VHE-GRP emission correlations are below the derived limits.

  7. Search for a Correlation Between Very-High-Energy Gamma Rays and Giant Radio Pulses in the Crab Pulsar

    Science.gov (United States)

    Aliu, E.; Archambault, S.; Arlen, T.; Aune, T.; Beilicke, M.; Benbow, W.; Bouvier, A.; Buckley, J. H.; Bugaev, V.; Byrum, K.; hide

    2012-01-01

    We present the results of a joint observational campaign between the Green Bank radio telescope and the VERITAS gamma-ray telescope, which searched for a correlation between the emission of very-high-energy (VHE) gamma rays ( E(sub Gamma) > 150 GeV) and giant radio pulses (GRPs) from the Crab pulsar at 8.9 GHz. A total of 15,366 GRPs were recorded during 11.6 hr of simultaneous observations, which were made across four nights in 2008 December and in 2009 November and December. We searched for an enhancement of the pulsed gamma-ray emission within time windows placed around the arrival time of the GRP events. In total, eight different time windows with durations ranging from 0.033 ms to 72 s were positioned at three different locations relative to the GRP to search for enhanced gamma-ray emission which lagged, led, or was concurrent with, the GRP event. Furthermore, we performed separate searches on main pulse GRPs and interpulse GRPs and on the most energetic GRPs in our data sample. No significant enhancement of pulsed VHE emission was found in any of the preformed searches. We set upper limits of 5-10 times the average VHE flux of the Crab pulsar on the flux simultaneous with interpulse GRPs on single-rotation-period timescales. On approx. 8 s timescales around interpulse GRPs, we set an upper limit of 2-3 times the average VHE flux. Within the framework of recent models for pulsed VHE emission from the Crab pulsar, the expected VHE-GRP emission correlations are below the derived limits.

  8. A Very High Energy Gamma-Ray Spectrum of 1ES 2344+514

    OpenAIRE

    Schroedter, M.; Badran, H. M.; Buckley, J. H.; Gordo, J. Bussons; Carter-Lewis, D. A.; Duke, C.; Fegan, D. J.; Fegan, S. F.; Finley, J. P.; Gillanders, G. H.; Grube, J.; Horan, D.; Kenny, G. E.; Kertzman, M.; Kosack, K.

    2005-01-01

    The BL Lacertae (BL Lac) object 1ES 2344+514 (1ES 2344), at a redshift of 0.044, was discovered as a source of very high energy (VHE) gamma rays by the Whipple Collaboration in 1995 \\citep{2344Catanese98}. This detection was recently confirmed by the HEGRA Collaboration \\citep{2344Hegra03}. As is typical for high-frequency peaked blazars, the VHE gamma-ray emission is highly variable. On the night of 20 December, 1995, a gamma-ray flare of 5.3-sigma significance was detected, the brightest ou...

  9. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... The field of Very High Energy (VHE) gamma ray astronomy using the Atmospheric Cerenkov Technique has entered an interesting phase with detection of various galactic and extragalactic sources. Among galactic sources, only the Crab nebula has been established as a standard candle.

  10. Discovery of TeV gamma-ray emission from the pulsar wind nebula 3C 58 by MAGIC

    Directory of Open Access Journals (Sweden)

    López-Coto Rubén

    2016-01-01

    Full Text Available The pulsar wind nebula (PWN 3C 58 is one of the historical very-high-energy (VHE; E>100 GeV gamma-ray source candidates. It has been compared to the Crab Nebula due to their morphological similarities. This object was detected by Fermi-LAT with a spectrum extending beyond 100 GeV. We analyzed 81 hours of 3C 58 data taken with the MAGIC telescopes and we detected VHE gamma-ray emission for the first time at TeV energies with a significance of 5.7 sigma and an integral flux of 0.65% C.U. above 1 TeV. According to our results 3C 58 is the least luminous PWN ever detected at VHE and the one with the lowest flux at VHE to date. We compare our results with the expectations of time-dependent models in which electrons up-scatter photon fields. The best representation favors a distance to the PWN of 2 kpc and Far Infrared (FIR comparable to CMB photon fields. Hadronic contribution from the hosting supernova remnant (SNR requires unrealistic energy budget given the density of the medium, disfavoring cosmic ray acceleration in the SNR as origin of the VHE gamma-ray emission.

  11. VERITAS OBSERVATIONS OF GAMMA-RAY BURSTS DETECTED BY SWIFT

    International Nuclear Information System (INIS)

    Acciari, V. A.; Benbow, W.; Aliu, E.; Errando, M.; Arlen, T.; Aune, T.; Beilicke, M.; Buckley, J. H.; Bugaev, V.; Bradbury, S. M.; Byrum, K.; Cannon, A.; Collins-Hughes, E.; Cesarini, A.; Connolly, M. P.; Christiansen, J. L.; Ciupik, L.; Cui, W.; Duke, C.; Falcone, A.

    2011-01-01

    We present the results of 16 Swift-triggered Gamma-ray burst (GRB) follow-up observations taken with the Very Energetic Radiation Imaging Telescope Array System (VERITAS) telescope array from 2007 January to 2009 June. The median energy threshold and response time of these observations were 260 GeV and 320 s, respectively. Observations had an average duration of 90 minutes. Each burst is analyzed independently in two modes: over the whole duration of the observations and again over a shorter timescale determined by the maximum VERITAS sensitivity to a burst with a t –1.5 time profile. This temporal model is characteristic of GRB afterglows with high-energy, long-lived emission that have been detected by the Large Area Telescope on board the Fermi satellite. No significant very high energy (VHE) gamma-ray emission was detected and upper limits above the VERITAS threshold energy are calculated. The VERITAS upper limits are corrected for gamma-ray extinction by the extragalactic background light and interpreted in the context of the keV emission detected by Swift. For some bursts the VHE emission must have less power than the keV emission, placing constraints on inverse Compton models of VHE emission.

  12. Simulated gamma-ray pulse profile of the Crab pulsar with the Cherenkov Telescope Array

    Science.gov (United States)

    Burtovoi, A.; Zampieri, L.

    2016-07-01

    We present simulations of the very high energy (VHE) gamma-ray light curve of the Crab pulsar as observed by the Cherenkov Telescope Array (CTA). The CTA pulse profile of the Crab pulsar is simulated with the specific goal of determining the accuracy of the position of the interpulse. We fit the pulse shape obtained by the Major Atmospheric Gamma-Ray Imaging Cherenkov (MAGIC) telescope with a three-Gaussian template and rescale it to account for the different CTA instrumental and observational configurations. Simulations are performed for different configurations of CTA and for the ASTRI (Astrofisica con Specchi a Tecnologia Replicante Italiana) mini-array. The northern CTA configuration will provide an improvement of a factor of ˜3 in accuracy with an observing time comparable to that of MAGIC (73 h). Unless the VHE spectrum above 1 TeV behaves differently from what we presently know, unreasonably long observing times are required for a significant detection of the pulsations of the Crab pulsar with the high-energy-range sub-arrays. We also found that an independent VHE timing analysis is feasible with Large Size Telescopes. CTA will provide a significant improvement in determining the VHE pulse shape parameters necessary to constrain theoretical models of the gamma-ray emission of the Crab pulsar. One of such parameters is the shift in phase between peaks in the pulse profile at VHE and in other energy bands that, if detected, may point to different locations of the emission regions.

  13. Event-sequence time series analysis in ground-based gamma-ray astronomy

    International Nuclear Information System (INIS)

    Barres de Almeida, U.; Chadwick, P.; Daniel, M.; Nolan, S.; McComb, L.

    2008-01-01

    The recent, extreme episodes of variability detected from Blazars by the leading atmospheric Cerenkov experiments motivate the development and application of specialized statistical techniques that enable the study of this rich data set to its furthest extent. The identification of the shortest variability timescales supported by the data and the actual variability structure observed in the light curves of these sources are some of the fundamental aspects being studied, that answers can bring new developments on the understanding of the physics of these objects and on the mechanisms of production of VHE gamma-rays in the Universe. Some of our efforts in studying the time variability of VHE sources involve the application of dynamic programming algorithms to the problem of detecting change-points in a Poisson sequence. In this particular paper we concentrate on the more primary issue of the applicability of counting statistics to the analysis of time-series on VHE gamma-ray astronomy.

  14. High energy astrophysics

    International Nuclear Information System (INIS)

    Engel, A.R.

    1979-01-01

    High energy astrophysical research carried out at the Blackett Laboratory, Imperial College, London is reviewed. Work considered includes cosmic ray particle detection, x-ray astronomy, gamma-ray astronomy, gamma and x-ray bursts. (U.K.)

  15. Status of the GILDA project for the 30 MeV-100 GeV high energy gamma ray astrophysics

    Energy Technology Data Exchange (ETDEWEB)

    Casolino, M.; Sparvoli, R.; Morselli, A.; Picozza, P. [Rome Univ. `Tor Vergata` (Italy)]|[INFN, Rome (Italy); Barbiellini, G. [Trieste Univ. (Italy)]|[INFN, Trieste (Italy); Fuglesang, C. [ESA-EAC, Cologne (Germany); Ozerov, Yu.V.; Zemskov, V.M.; Zverev, V.G.; Galper, A.M. [Moscow Engineering Physics Institute, Moscow (Russian Federation)

    1995-09-01

    High energy gamma-ray astrophysics has greatly developed in the last few years because of the results of EGRET, on the Compton gamma ray observatory. The satellite observations have shown the importance of continuing the investigation of high energy gamma radiation but the emerging of new astrophysical and cosmological problems require for future experiments the realization of telescopes with parameters significatively improved with respect to the previous missions. In a traditional point of view, this is achieved with the increase of the length L of the device and, consequently, the mass of the telescope and satellite (growing as L{sup 3}). Such kinds of experiments are becoming rather expensive and are approaching the maximum value in cost, satellite mass and consuming resources. The telescope project GILDA presented in this paper is based on the use of silicon strip detectors. The silicon technique consents to obtain a much wider solid angle aperture; in this way there is more sensitivity without a growing in the size of the

  16. Status of the GILDA project for the 30 MeV-100 GeV high energy gamma ray astrophysics

    International Nuclear Information System (INIS)

    Casolino, M.; Sparvoli, R.; Morselli, A.; Picozza, P.; Barbiellini, G.; Fuglesang, C.; Ozerov, Yu.V.; Zemskov, V.M.; Zverev, V.G.; Galper, A.M.

    1995-01-01

    High energy gamma-ray astrophysics has greatly developed in the last few years because of the results of EGRET, on the Compton gamma ray observatory. The satellite observations have shown the importance of continuing the investigation of high energy gamma radiation but the emerging of new astrophysical and cosmological problems require for future experiments the realization of telescopes with parameters significatively improved with respect to the previous missions. In a traditional point of view, this is achieved with the increase of the length L of the device and, consequently, the mass of the telescope and satellite (growing as L 3 ). Such kinds of experiments are becoming rather expensive and are approaching the maximum value in cost, satellite mass and consuming resources. The telescope project GILDA presented in this paper is based on the use of silicon strip detectors. The silicon technique consents to obtain a much wider solid angle aperture; in this way there is more sensitivity without a growing in the size of the

  17. SPECTRAL ANALYSIS AND INTERPRETATION OF THE {gamma}-RAY EMISSION FROM THE STARBURST GALAXY NGC 253

    Energy Technology Data Exchange (ETDEWEB)

    Abramowski, A. [Institut fuer Experimentalphysik, Universitaet Hamburg, Luruper Chaussee 149, D-22761 Hamburg (Germany); Acero, F. [Laboratoire Univers et Particules de Montpellier, Universite Montpellier 2, CNRS/IN2P3, CC 72, Place Eugene Bataillon, F-34095 Montpellier Cedex 5 (France); Aharonian, F.; Bernloehr, K.; Bochow, A. [Max-Planck-Institut fuer Kernphysik, P.O. Box 103980, D-69029 Heidelberg (Germany); Akhperjanian, A. G. [National Academy of Sciences of the Republic of Armenia, Yerevan (Armenia); Anton, G.; Balzer, A.; Brucker, J. [Physikalisches Institut, Universitaet Erlangen-Nuernberg, Erwin-Rommel-Str. 1, D-91058 Erlangen (Germany); Barnacka, A. [Nicolaus Copernicus Astronomical Center, ul. Bartycka 18, 00-716 Warsaw (Poland); Becherini, Y. [APC, AstroParticule et Cosmologie, Universite Paris Diderot, CNRS/IN2P3, CEA/lrfu, Observatoire de Paris, Sorbonne Paris Cite, 10, rue Alice Domon et Leonie Duquet, F-75205 Paris Cedex 13 (France); Becker, J. [Institut fuer Theoretische Physik, Lehrstuhl IV: Weltraum und Astrophysik, Ruhr-Universitaet Bochum, D-44780 Bochum (Germany); Birsin, E. [Institut fuer Physik, Humboldt-Universitaet zu Berlin, Newtonstr. 15, D-12489 Berlin (Germany); Biteau, J.; Brun, F. [Laboratoire Leprince-Ringuet, Ecole Polytechnique, CNRS/IN2P3, F-91128 Palaiseau (France); Boisson, C. [LUTH, Observatoire de Paris, CNRS, Universite Paris Diderot, 5 Place Jules Janssen, F-92190 Meudon (France); Bolmont, J. [LPNHE, Universite Pierre et Marie Curie Paris 6, Universite Denis Diderot Paris 7, CNRS/IN2P3, 4 Place Jussieu, F-75252, Paris Cedex 5 (France); Bordas, P. [Institut fuer Astronomie und Astrophysik, Universitaet Tuebingen, Sand 1, D-72076 Tuebingen (Germany); Brun, P. [CEA Saclay, DSM/IRFU, F-91191 Gif-Sur-Yvette Cedex (France); Bulik, T., E-mail: stefan.ohm@le.ac.uk [Astronomical Observatory, The University of Warsaw, Al. Ujazdowskie 4, 00-478 Warsaw (Poland); Collaboration: H.E.S.S. Collaboration; and others

    2012-10-01

    Very high energy (VHE; E {>=} 100 GeV) and high-energy (HE; 100 MeV {<=} E {<=} 100 GeV) data from {gamma}-ray observations performed with the H.E.S.S. telescope array and the Fermi-LAT instrument, respectively, are analyzed in order to investigate the non-thermal processes in the starburst galaxy NGC 253. The VHE {gamma}-ray data can be described by a power law in energy with differential photon index {Gamma} = 2.14 {+-} 0.18{sub stat} {+-} 0.30{sub sys} and differential flux normalization at 1 TeV of F{sub 0} = (9.6 {+-} 1.5{sub stat}(+ 5.7, -2.9){sub sys}) Multiplication-Sign 10{sup -14} TeV{sup -1} cm{sup -2} s{sup -1}. A power-law fit to the differential HE {gamma}-ray spectrum reveals a photon index of {Gamma} 2.24 {+-} 0.14{sub stat} {+-} 0.03{sub sys} and an integral flux between 200 MeV and 200 GeV of F(0.2-200 GeV) = (4.9 {+-} 1.0{sub stat} {+-} 0.3{sub sys}) Multiplication-Sign 10{sup -9} cm{sup -2} s{sup -1}. No evidence for a spectral break or turnover is found over the dynamic range of both the LAT instrument and the H.E.S.S. experiment: a combined fit of a power law to the HE and VHE {gamma}-ray data results in a differential photon index {Gamma} = 2.34 {+-} 0.03 with a p-value of 30%. The {gamma}-ray observations indicate that at least about 20% of the energy of the cosmic rays (CRs) capable of producing hadronic interactions is channeled into pion production. The smooth alignment between the spectra in the HE and VHE {gamma}-ray domain suggests that the same transport processes dominate in the entire energy range. Advection is most likely responsible for charged particle removal from the starburst nucleus from GeV to multiple TeV energies. In a hadronic scenario for the {gamma}-ray production, the single overall power-law spectrum observed would therefore correspond to the mean energy spectrum produced by the ensemble of CR sources in the starburst region.

  18. Systematic search for very-high-energy gamma-ray emission from bow shocks of runaway stars

    Science.gov (United States)

    H.E.S.S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Akhperjanian, A. G.; Andersson, T.; Angüner, E. O.; Arakawa, M.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Büchele, M.; Bulik, T.; Capasso, M.; Carr, J.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chalme-Calvet, R.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Chrétien, M.; Coffaro, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Cui, Y.; Davids, I. D.; Decock, J.; Degrange, B.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dutson, K.; Dyks, J.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gajdus, M.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hervet, O.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holler, M.; Horns, D.; Ivascenko, A.; Iwasaki, H.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jogler, T.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katsuragawa, M.; Katz, U.; Kerszberg, D.; Khangulyan, D.; Khélifi, B.; Kieffer, M.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Nakashima, S.; de Naurois, M.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Öttl, S.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Richter, S.; Rieger, F.; Romoli, C.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Saito, S.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seglar-Arroyo, M.; Settimo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stycz, K.; Sushch, I.; Takahashi, T.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tsuji, N.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zabalza, V.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Żywucka, N.

    2018-04-01

    Context. Runaway stars form bow shocks by ploughing through the interstellar medium at supersonic speeds and are promising sources of non-thermal emission of photons. One of these objects has been found to emit non-thermal radiation in the radio band. This triggered the development of theoretical models predicting non-thermal photons from radio up to very-high-energy (VHE, E ≥ 0.1 TeV) gamma rays. Subsequently, one bow shock was also detected in X-ray observations. However, the data did not allow discrimination between a hot thermal and a non-thermal origin. Further observations of different candidates at X-ray energies showed no evidence for emission at the position of the bow shocks either. A systematic search in the Fermi-LAT energy regime resulted in flux upper limits for 27 candidates listed in the E-BOSS catalogue. Aim. Here we perform the first systematic search for VHE gamma-ray emission from bow shocks of runaway stars. Methods: Using all available archival H.E.S.S. data we search for very-high-energy gamma-ray emission at the positions of bow shock candidates listed in the second E-BOSS catalogue release. Out of the 73 bow shock candidates in this catalogue, 32 have been observed with H.E.S.S. Results: None of the observed 32 bow shock candidates in this population study show significant emission in the H.E.S.S. energy range. Therefore, flux upper limits are calculated in five energy bins and the fraction of the kinetic wind power that is converted into VHE gamma rays is constrained. Conclusions: Emission from stellar bow shocks is not detected in the energy range between 0.14 and 18 TeV.The resulting upper limits constrain the level of VHE gamma-ray emission from these objects down to 0.1-1% of the kinetic wind energy.

  19. The TeV {gamma}-ray binary PSR B1259-63. Observations with the high energy stereoscopic system in the years 2005-2007

    Energy Technology Data Exchange (ETDEWEB)

    Kerschhaggl, Matthias

    2010-04-06

    PSR B1259-63/SS2883 is a binary system where a 48 ms pulsar orbits a massive Be star with a period of 3.4 years. The system exhibits variable, non-thermal radiation around periastron on the highly eccentric orbit (e=0.87) visible from radio to very high energies (VHE; E>100 GeV). When being detected in TeV {gamma}-rays with the High Energy Stereoscopic System (H.E.S.S.) in 2004 it became known as the first variable galactic VHE source. This thesis presents VHE data from PSR B1259-63 as taken during the years 2005, 2006 and before as well as shortly after the 2007 periastron passage. These data extend the knowledge of the lightcurve of this object to all phases of the binary orbit. The lightcurve constrains physical mechanisms present in this TeV source. Observations of VHE {gamma}-rays with the H.E.S.S. telescope array using the Imaging Atmospheric Cherenkov Technique were performed. The H.E.S.S. instrument features an angular resolution of < 0.1 and an energy resolution of < 20%. Gamma-ray events in an energy range of 0.5-70 TeV were recorded. From these data, energy spectra and lightcurve with a monthly time sampling were extracted. VHE {gamma}-ray emission from PSRB1259-63 was detected with an overall significance of 9.5 standard deviations using 55 h of exposure, obtained from April to August 2007. The monthly flux of -rays during the observation period was measured, yielding VHE lightcurve data for the early pre-periastron phase of the system for the first time. No spectral variability was found on timescales of months. The spectrum is described by a power law with a photon index of {gamma}=2.8{+-}0.2{sub stat}{+-}0.2{sub sys} and flux normalisation {phi}{sub 0}=(1.1{+-}0.1{sub stat}{+-}0.2{sub sys}) x 10{sup -12} TeV{sup -1}cm{sup -2}s{sup -1}. PSR B1259-63 was also monitored in 2005 and 2006, far from periastron passage, comprising 8.9 h and 7.5 h of exposure, respectively. No significant excess of {gamma}-rays is seen in those observations. PSR B1259-63 has

  20. The TeV {gamma}-ray binary PSR B1259-63. Observations with the high energy stereoscopic system in the years 2005-2007

    Energy Technology Data Exchange (ETDEWEB)

    Kerschhaggl, Matthias

    2010-04-06

    PSR B1259-63/SS2883 is a binary system where a 48 ms pulsar orbits a massive Be star with a period of 3.4 years. The system exhibits variable, non-thermal radiation around periastron on the highly eccentric orbit (e=0.87) visible from radio to very high energies (VHE; E>100 GeV). When being detected in TeV {gamma}-rays with the High Energy Stereoscopic System (H.E.S.S.) in 2004 it became known as the first variable galactic VHE source. This thesis presents VHE data from PSR B1259-63 as taken during the years 2005, 2006 and before as well as shortly after the 2007 periastron passage. These data extend the knowledge of the lightcurve of this object to all phases of the binary orbit. The lightcurve constrains physical mechanisms present in this TeV source. Observations of VHE {gamma}-rays with the H.E.S.S. telescope array using the Imaging Atmospheric Cherenkov Technique were performed. The H.E.S.S. instrument features an angular resolution of < 0.1 and an energy resolution of < 20%. Gamma-ray events in an energy range of 0.5-70 TeV were recorded. From these data, energy spectra and lightcurve with a monthly time sampling were extracted. VHE {gamma}-ray emission from PSRB1259-63 was detected with an overall significance of 9.5 standard deviations using 55 h of exposure, obtained from April to August 2007. The monthly flux of -rays during the observation period was measured, yielding VHE lightcurve data for the early pre-periastron phase of the system for the first time. No spectral variability was found on timescales of months. The spectrum is described by a power law with a photon index of {gamma}=2.8{+-}0.2{sub stat}{+-}0.2{sub sys} and flux normalisation {phi}{sub 0}=(1.1{+-}0.1{sub stat}{+-}0.2{sub sys}) x 10{sup -12} TeV{sup -1}cm{sup -2}s{sup -1}. PSR B1259-63 was also monitored in 2005 and 2006, far from periastron passage, comprising 8.9 h and 7.5 h of exposure, respectively. No significant excess of {gamma}-rays is seen in those observations. PSR B1259-63 has

  1. Astrophysics at very high energies

    International Nuclear Information System (INIS)

    Aharonian, Felix; Bergstroem, Lars; Dermer, Charles

    2013-01-01

    Presents three complementary lectures on very-high-energy astrophysics given by worldwide leaders in the field. Reviews the recent advances in and prospects of gamma-ray astrophysics and of multi-messenger astronomy. Prepares readers for using space and ground-based gamma-ray observatories, as well as neutrino and other multi-messenger detectors. With the success of Cherenkov Astronomy and more recently with the launch of NASA's Fermi mission, very-high-energy astrophysics has undergone a revolution in the last years. This book provides three comprehensive and up-to-date reviews of the recent advances in gamma-ray astrophysics and of multi-messenger astronomy. Felix Aharonian and Charles Dermer address our current knowledge on the sources of GeV and TeV photons, gleaned from the precise measurements made by the new instrumentation. Lars Bergstroem presents the challenges and prospects of astro-particle physics with a particular emphasis on the detection of dark matter candidates. The topics covered by the 40th Saas-Fee Course present the capabilities of current instrumentation and the physics at play in sources of very-high-energy radiation to students and researchers alike. This book will encourage and prepare readers for using space and ground-based gamma-ray observatories, as well as neutrino and other multi-messenger detectors.

  2. VLBI OBSERVATIONS OF THE JET IN M 87 DURING THE VERY HIGH ENERGY {gamma}-RAY FLARE IN 2010 APRIL

    Energy Technology Data Exchange (ETDEWEB)

    Hada, Kazuhiro; Giroletti, Marcello; Giovannini, Gabriele [INAF Istituto di Radioastronomia, via Gobetti 101, I-40129 Bologna (Italy); Kino, Motoki; Nagai, Hiroshi [National Astronomical Observatory of Japan, Osawa, Mitaka, Tokyo 181-8588 (Japan); Doi, Akihiro [Institute of Space and Astronautical Science, Japan Aerospace Exploration Agency, 3-1-1 Yoshinodai, Chuo, Sagamihara 252-5210 (Japan); Hagiwara, Yoshiaki; Honma, Mareki; Kawaguchi, Noriyuki [Department of Astronomical Science, Graduate University for Advanced Studies (SOKENDAI), 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan)

    2012-11-20

    We report on the detailed radio status of the M 87 jet during the very high energy (VHE) {gamma}-ray flaring event in 2010 April, obtained from high-resolution, multi-frequency, phase-referencing Very Long Baseline Array observations. We especially focus on the properties of the jet base (the radio core) and the peculiar knot HST-1, which are currently favored as the {gamma}-ray emitting sites. During the VHE flaring event, the HST-1 region remains stable in terms of its structure and flux density in the optically thin regime above 2 GHz, being consistent with no signs of enhanced activities reported at X-ray for this feature. The radio core shows an inverted spectrum at least up to 43 GHz during this event. Astrometry of the core position, which is specified as {approx}20 R {sub s} from the central engine in our previous study, shows that the core position is stable on a level of 4 R {sub s}. The core at 43 and 22 GHz tends to show slightly ({approx}10%) higher flux level near the date of the VHE flux peak compared with the epochs before/after the event. The size of the 43 GHz core is estimated to be {approx}17 R {sub s}, which is close to the size of the emitting region suggested from the observed timescale of rapid variability at VHE. These results tend to favor the scenario that the VHE {gamma}-ray flare in 2010 April is associated with the radio core.

  3. Minicourses in Astrophysics, Modular Approach, Vol. I.

    Science.gov (United States)

    Illinois Univ., Chicago.

    This is the first volume of a two-volume minicourse in astrophysics. It contains chapters on the following topics: planetary atmospheres; X-ray astronomy; radio astrophysics; molecular astrophysics; and gamma-ray astrophysics. Each chapter gives much technical discussion, mathematical treatment, diagrams, and examples. References are included with…

  4. Very high energy gamma ray astrophysics: Progress report, May 1, 1987-February 1, 1988

    International Nuclear Information System (INIS)

    Lamb, R.G.; Lewis, D.A.

    1988-02-01

    The Whipple observatory Gamma Ray Collaboration has continued to make steady progress in its development of a highly sensitive stereoscopic imaging gamma-ray telescope (known as the HERCULES project). The milestones in this year's development include: the demonstration of the success of the imaging concept with a single camera by the detection of a very weak flux of gamma rays from the Crab Nebula at a high level of statistical significance (7 sigma), the confirmation of our detection of an anomalous pulsed flux from Hercules X-1 in the summer of 1986 by two other groups; this result has serious implications for the mechanism for gamma-ray emission in this binary source. The construction and installation of the new high resolution camera on the 10 m reflector; the realistic simulation of the sensitivity of this camera as well as that of the full HERCULES system was also undertaken. These, and other highlights of this year's program at the Iowa State University and the Smithsonian Astrophysical Observatory, are discussed in this paper. 6 figs

  5. Extragalactic Gamma-Ray Astrophysics

    CERN Multimedia

    CERN. Geneva

    2016-01-01

    During the last decades, various classes of radio-loud active galactic nuclei have been established as sources of high-energy radiation extending over a very broad range from soft gamma-rays (photon energies E~MeV) up to very-high-energy gamma-rays (E>100 GeV). These include blazars of different types, as well as young and evolved radio galaxies. The observed gamma-ray emission from such implies efficient particle acceleration processes taking place in highly magnetized and relativistic jets produced by supermassive black holes, processes that have yet to be identified and properly understood. In addition, nearby starforming and starburst galaxies, some of which host radio-quiet Seyfert-type nuclei, have been detected in the gamma-ray range as well. In their cases, the observed gamma-ray emission is due to non-thermal activity in the interstellar medium, possibly including also a contribution from accretion disks and nuclear outflows. Finally, the high-energy emission from clusters of galaxies remains elusive...

  6. Topics in Astrophysical X-Ray and Gamma Ray Spectroscopy. Ph.D. Thesis - Maryland Univ.

    Science.gov (United States)

    Bussard, R. W.

    1978-01-01

    A number of topics relating to astrophysical observations that have already been made or are currently planned of spectral features, mostly emission lines, in the X-ray and gamma ray region of the electromagnetic spectrum are investigated. These topics include: the production of characteristic X-ray and gamma ray lines by nonthermal ions, spectral features induced by processes occurring in strong magnetic fields, and the positron annihilation line at 0.5 MeV. The rate of X-ray production at 6.8 keV by the 2p to 1s transition in fast hydrogen- and helium-like iron ions, following both electron capture to excited levels and collisional excitation is calculated. The cross section for electron-ion Coulomb collisions in strong fields is also calculated.

  7. A detailed study of the supernova remnant RCW 86 in TeV {gamma}-rays

    Energy Technology Data Exchange (ETDEWEB)

    Heinz, Sebastian

    2012-03-29

    A detailed study of the supernova remnant RCW 86 is presented. RCW 86 encountered a shell-like structure in radio, X-rays and optical, whereas in the discovery paper of RCW 86 in the very high energy regime the structure could not be confirmed. In this thesis for the first time the shell was resolved in the very high energy gamma rays. The shell width was determined to be 0.125 {+-}0.014 , the radius to be 0.194 {+-} 0.016 and the center to be -62.433 {+-}0.014 in declination and 220.734 {+-}0.016 in rectascension. The spectral analysis was performed for the whole SNR and for the south-east part, which is more pronounced in X-rays separately. But the results were comparable within errors. Additionally a power-law with an exponential cut off described the spectra best with the parameters: an spectral index of 1.50{+-}0.28, a cut-off energy of (2.69{+-}0.99 TeV) and an integral flux above 1 TeV of (6.51{+-}2.69) . 10{sup -12} cm{sup -2}s{sup -1}. The study of the correlation of the X-ray and VHE {gamma}-ray data of RCW 86 was hampered by the poor angular resolution of the VHE data. Therefore detailed studies of the Richardson-Lucy deconvolution algorithm have been performed. The outcome is, that deconvolution techniques are applicable to strong VHE {gamma}-ray sources and that fine structure well below the angular resolution can be studied. The application to RX J1713-3946, the brightest SNR in the VHE regime, has shown, that the correlation coefficient of the X-ray data and the VHE data of is stable down to 0.01 and has a value of 0.85. On the other side the significance of the data set is not sufficient in the case of RCW 86 to apply the deconvolution technique.

  8. Search for very high-energy gamma-ray emission from the microquasar Cygnus X-1 with the MAGIC telescopes

    Science.gov (United States)

    Ahnen, M. L.; Ansoldi, S.; Antonelli, L. A.; Arcaro, C.; Babić, A.; Banerjee, B.; Bangale, P.; Barres de Almeida, U.; Barrio, J. A.; Becerra González, J.; Bednarek, W.; Bernardini, E.; Berti, A.; Bhattacharyya, W.; Biasuzzi, B.; Biland, A.; Blanch, O.; Bonnefoy, S.; Bonnoli, G.; Carosi, R.; Carosi, A.; Chatterjee, A.; Colin, P.; Colombo, E.; Contreras, J. L.; Cortina, J.; Covino, S.; Cumani, P.; da Vela, P.; Dazzi, F.; de Angelis, A.; de Lotto, B.; de Oña Wilhelmi, E.; di Pierro, F.; Doert, M.; Domínguez, A.; Dominis Prester, D.; Dorner, D.; Doro, M.; Einecke, S.; Eisenacher Glawion, D.; Elsaesser, D.; Engelkemeier, M.; Fallah Ramazani, V.; Fernández-Barral, A.; Fidalgo, D.; Fonseca, M. V.; Font, L.; Fruck, C.; Galindo, D.; García López, R. J.; Garczarczyk, M.; Gaug, M.; Giammaria, P.; Godinović, N.; Gora, D.; Guberman, D.; Hadasch, D.; Hahn, A.; Hassan, T.; Hayashida, M.; Herrera, J.; Hose, J.; Hrupec, D.; Ishio, K.; Konno, Y.; Kubo, H.; Kushida, J.; Kuveždić, D.; Lelas, D.; Lindfors, E.; Lombardi, S.; Longo, F.; López, M.; Maggio, C.; Majumdar, P.; Makariev, M.; Maneva, G.; Manganaro, M.; Mannheim, K.; Maraschi, L.; Mariotti, M.; Martínez, M.; Mazin, D.; Menzel, U.; Minev, M.; Mirzoyan, R.; Moralejo, A.; Moreno, V.; Moretti, E.; Neustroev, V.; Niedzwiecki, A.; Nievas Rosillo, M.; Nilsson, K.; Ninci, D.; Nishijima, K.; Noda, K.; Nogués, L.; Paiano, S.; Palacio, J.; Paneque, D.; Paoletti, R.; Paredes, J. M.; Paredes-Fortuny, X.; Pedaletti, G.; Peresano, M.; Perri, L.; Persic, M.; Prada Moroni, P. G.; Prandini, E.; Puljak, I.; Garcia, J. R.; Reichardt, I.; Rhode, W.; Ribó, M.; Rico, J.; Righi, C.; Saito, T.; Satalecka, K.; Schroeder, S.; Schweizer, T.; Sitarek, J.; Šnidarić, I.; Sobczynska, D.; Stamerra, A.; Strzys, M.; Surić, T.; Takalo, L.; Tavecchio, F.; Temnikov, P.; Terzić, T.; Tescaro, D.; Teshima, M.; Torres, D. F.; Torres-Albà, N.; Treves, A.; Vanzo, G.; Vazquez Acosta, M.; Vovk, I.; Ward, J. E.; Will, M.; Zarić, D.; MAGIC Collaboration; Bosch-Ramon, V.; Pooley, G. G.; Trushkin, S. A.; Zanin, R.

    2017-12-01

    The microquasar Cygnus X-1 displays the two typical soft and hard X-ray states of a black hole transient. During the latter, Cygnus X-1 shows a one-sided relativistic radio-jet. Recent detection of the system in the high energy (HE; E ≳ 60 MeV) gamma-ray range with Fermi-LAT associates this emission with the outflow. Former MAGIC observations revealed a hint of flaring activity in the very high-energy (VHE; E ≳ 100 GeV) regime during this X-ray state. We analyse ∼97 h of Cygnus X-1 data taken with the MAGIC telescopes between July 2007 and October 2014. To shed light on the correlation between hard X-ray and VHE gamma rays as previously suggested, we study each main X-ray state separately. We perform an orbital phase-folded analysis to look for variability in the VHE band. Additionally, to place this variability behaviour in a multiwavelength context, we compare our results with Fermi-LAT, AGILE, Swift-BAT, MAXI, RXTE-ASM, AMI and RATAN-600 data. We do not detect Cygnus X-1 in the VHE regime. We establish upper limits for each X-ray state, assuming a power-law distribution with photon index Γ = 3.2. For steady emission in the hard and soft X-ray states, we set integral upper limits at 95 per cent confidence level for energies above 200 GeV at 2.6 × 10-12 photons cm-2 s-1 and 1.0 × 10-11 photons cm-2 s-1, respectively. We rule out steady VHE gamma-ray emission above this energy range, at the level of the MAGIC sensitivity, originating in the interaction between the relativistic jet and the surrounding medium, while the emission above this flux level produced inside the binary still remains a valid possibility.

  9. The Astrophysics Science Division Annual Report 2008

    Science.gov (United States)

    Oegerle, William; Reddy, Francis; Tyler, Pat

    2009-01-01

    The Astrophysics Science Division (ASD) at Goddard Space Flight Center (GSFC) is one of the largest and most diverse astrophysical organizations in the world, with activities spanning a broad range of topics in theory, observation, and mission and technology development. Scientific research is carried out over the entire electromagnetic spectrum from gamma rays to radio wavelengths as well as particle physics and gravitational radiation. Members of ASD also provide the scientific operations for three orbiting astrophysics missions WMAP, RXTE, and Swift, as well as the Science Support Center for the Fermi Gamma-ray Space Telescope. A number of key technologies for future missions are also under development in the Division, including X-ray mirrors, and new detectors operating at gamma-ray, X-ray, ultraviolet, infrared, and radio wavelengths. This report includes the Division's activities during 2008.

  10. Searching for gamma-ray counterparts to gravitational waves from merging binary neutron stars with the Cherenkov Telescope Array

    Science.gov (United States)

    Patricelli, B.; Stamerra, A.; Razzano, M.; Pian, E.; Cella, G.

    2018-05-01

    The merger of binary neutron star (BNS) systems are predicted to be progenitors of short gamma-ray bursts (GRBs); the definitive probe of this association came with the recent detection of gravitational waves (GWs) from a BNS merger by Advanced LIGO and Advanced Virgo (GW170817), in coincidence with the short GRB 170817A observed by Fermi-GBM and INTEGRAL. Short GRBs are also expected to emit very-high energy (VHE, > 10S0 GeV) photons and VHE electromagnetic (EM) upper limits have been set with observations performed by ground-based gamma-ray detectors and during the intense EM follow-up campaign associated with GW170817/GRB 170817A. In the next years, the searches for VHE EM counterparts will become more effective thanks to the Cherenkov Telescope Array (CTA): this instrument will be fundamental for the EM follow-up of transient GW events at VHE, owing to its unprecedented sensitivity, rapid response (few tens of seconds) and capability to monitor large sky areas via survey-mode operation. We present a comprehensive study on the prospects for joint GW and VHE EM observations of merging BNSs with Advanced LIGO, Advanced Virgo and CTA, based on detailed simulations of the multi-messenger emission and detection. We propose a new observational strategy optimized on the prior assumptions about the EM emission. The method can be further generalized to include other electromagnetic emission models. According to this study CTA will cover most of the region of the GW skymap for the intermediate and most energetic on-axis GRBs associated to the GW event. We estimate the expected joint GW and VHE EM detection rates and we found this rate goes from 0.08 up to 0.5 events per year for the most energetic EM sources.

  11. Nuclear astrophysics lessons from INTEGRAL.

    Science.gov (United States)

    Diehl, Roland

    2013-02-01

    Measurements of high-energy photons from cosmic sources of nuclear radiation through ESA's INTEGRAL mission have advanced our knowledge: new data with high spectral resolution showed that characteristic gamma-ray lines from radioactive decays occur throughout the Galaxy in its interstellar medium. Although the number of detected sources and often the significance of the astrophysical results remain modest, conclusions derived from this unique astronomical window of radiation originating from nuclear processes are important, complementing the widely-employed atomic-line based spectroscopy. We review the results and insights obtained in the past decade from gamma-ray line measurements of cosmic sources in the context of their astrophysical questions.

  12. Focusing Telescopes in Nuclear Astrophysics

    CERN Document Server

    Ballmoos, Peter von

    2007-01-01

    This volume is the first of its kind on focusing gamma-ray telescopes. Forty-eight refereed papers provide a comprehensive overview of the scientific potential and technical challenges of this nascent tool for nuclear astrophysics. The book features articles dealing with pivotal technologies such as grazing incident mirrors, multilayer coatings, Laue- and Fresnel-lenses - and even an optic using the curvature of space-time. The volume also presents an overview of detectors matching the ambitious objectives of gamma ray optics, and facilities for operating such systems on the ground and in space. The extraordinary scientific potential of focusing gamma-ray telescopes for the study of the most powerful sources and the most violent events in the Universe is emphasized in a series of introductory articles. Practicing professionals, and students interested in experimental high-energy astrophysics, will find this book a useful reference

  13. Multi-TeV gamma ray and cosmic ray astrophysics with TAIGA

    Energy Technology Data Exchange (ETDEWEB)

    Tluczykont, Martin [Hamburg Univ. (Germany). Institut fuer Experimentalphysik; Collaboration: TAIGA Kollaboration

    2016-07-01

    The very high energy gamma-ray regime is the key to several questions in high energy astrophysics, the most prominent being the search for the origin of cosmic rays. Observations of gamma rays up to several 100 TeV are particularly important to spectrally resolve the cutoff regime of the long-sought Pevatrons, the accelerators of PeV cosmic rays. TAIGA is an international collaboration that has, in the past 3 years, installed the air Cherenkov timing array HiSCORE on an area of 0.25 square-km, and are currently installing a first 4m diameter imaging air Cherenkov telescope (IACT), to be operated in parallel with the timing array. Our aim is to combine the timing and imaging techniques on a large scale in order to optimize the air Cherenkov detection technique for energies above 10 TeV and up to several 100 TeV. Simulations show a clear potential of the planned hybrid event reconstruction, especially in the energy regime from 10 TeV to 100 TeV. The TAIGA experiment will be complemented by scintillator based particle detectors for a measurement of the muon content of the air shower at higher energies. The status of our experiment and the planned 1 square-km stage of TAIGA are discussed.

  14. Recent results in nuclear astrophysics

    Energy Technology Data Exchange (ETDEWEB)

    Coc, Alain; Kiener, Juergen [CNRS/IN2P3 et Universite Paris Sud 11, UMR 8609, Centre de Sciences Nucleaires et de Sciences de la Matiere (CSNSM), Orsay Campus (France); Hammache, Fairouz [CNRS/IN2P3 et Universite Paris Sud 11, UMR 8608, Institut de Physique Nucleaire d' Orsay (IPNO), Orsay Campus (France)

    2015-03-01

    In this review, we emphasize the interplay between astrophysical observations, modeling, and nuclear physics laboratory experiments. Several important nuclear cross sections for astrophysics have long been identified, e.g., {sup 12}C(α, γ){sup 16}O for stellar evolution, or {sup 13}C(α, n){sup 16}O and {sup 22}Ne(α, n){sup 25}Mg as neutron sources for the s-process. More recently, observations of lithium abundances in the oldest stars, or of nuclear gamma-ray lines from space, have required new laboratory experiments. New evaluation of thermonuclear reaction rates now includes the associated rate uncertainties that are used in astrophysical models to i) estimate final uncertainties on nucleosynthesis yields and ii) identify those reactions that require further experimental investigation. Sometimes direct cross section measurements are possible, but more generally the use of indirect methods is compulsory in view of the very low cross sections. Non-thermal processes are often overlooked but are also important for nuclear astrophysics, e.g., in gamma-ray emission from solar flares or in the interaction of cosmic rays with matter, and also motivate laboratory experiments. Finally, we show that beyond the historical motivations of nuclear astrophysics, understanding i) the energy sources that drive stellar evolution and ii) the origin of the elements can also be used to give new insights into physics beyond the standard model. (orig.)

  15. Recent results in nuclear astrophysics

    International Nuclear Information System (INIS)

    Coc, Alain; Kiener, Juergen; Hammache, Fairouz

    2015-01-01

    In this review, we emphasize the interplay between astrophysical observations, modeling, and nuclear physics laboratory experiments. Several important nuclear cross sections for astrophysics have long been identified, e.g., 12 C(α, γ) 16 O for stellar evolution, or 13 C(α, n) 16 O and 22 Ne(α, n) 25 Mg as neutron sources for the s-process. More recently, observations of lithium abundances in the oldest stars, or of nuclear gamma-ray lines from space, have required new laboratory experiments. New evaluation of thermonuclear reaction rates now includes the associated rate uncertainties that are used in astrophysical models to i) estimate final uncertainties on nucleosynthesis yields and ii) identify those reactions that require further experimental investigation. Sometimes direct cross section measurements are possible, but more generally the use of indirect methods is compulsory in view of the very low cross sections. Non-thermal processes are often overlooked but are also important for nuclear astrophysics, e.g., in gamma-ray emission from solar flares or in the interaction of cosmic rays with matter, and also motivate laboratory experiments. Finally, we show that beyond the historical motivations of nuclear astrophysics, understanding i) the energy sources that drive stellar evolution and ii) the origin of the elements can also be used to give new insights into physics beyond the standard model. (orig.)

  16. Gamma-Ray Bursts

    Science.gov (United States)

    Pellizza, L. J.

    Gamma-ray bursts are the brightest transient sources in the gamma-ray sky. Since their discovery in the late 1960s, the investigation of the astrophysical sys- tems in which these phenomena take place, and the physical mechanisms that drive them, has become a vast and prolific area of modern astrophysics. In this work I will briefly describe the most relevant observations of these sources, and the models that describe their nature, emphasizing on the in- vestigations about the progenitor astrophysical systems. FULL TEXT IN SPANISH

  17. Development of a low-level setup for gamma spectroscopy: Application for nuclear astrophysics using reverse kinematics

    International Nuclear Information System (INIS)

    Genard, G.; Nuttens, V.E.; Bouchat, V.; Terwagne, G.

    2010-01-01

    It is more and more necessary to improve the sensitivity of gamma-ray spectroscopy systems, especially in nuclear astrophysics. In the case of radiative proton capture reactions, one means is to avoid the reactions on the target impurities by using reverse kinematics. This technique is possible with the LARN accelerator and can provide very clean cross-section measurements. For that purpose, a hydrogen standard has been carried out by means of ion implantation in silicon. In addition, a low-level setup has been put in place on a new beam line of the accelerator. A high efficiency and high resolution germanium detector is used conjointly with a double shielding. A passive lead castle shielding system is used to reduce the natural radioactivity and an active shielding consisting of an anti-cosmic veto is provided by an anticoincidence between the plastic scintillator and the gamma-ray detector. The setup allows a reduction of 70% of the background interference and provides an approximately 200 fold sensitivity gain of between 600 and 3000 keV. Some other developments have also been carried out to optimize the setup. The entire setup and the reverse kinematics have been validated by measuring the cross-section of the 13 C(p,γ) 14 N and 15 N(p,γ) 16 O reactions that present some astrophysical interest.

  18. Extended VHE γ-ray emission towards SGR1806-20, LBV 1806-20, and stellar cluster Cl* 1806-20

    Science.gov (United States)

    H.E.S.S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Akhperjanian, A. G.; Angüner, E. O.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Birsin, E.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Bulik, T.; Capasso, M.; Carr, J.; Casanova, S.; Chakraborty, N.; Chalme-Calvet, R.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Chrétien, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Couturier, C.; Cui, Y.; Davids, I. D.; Degrange, B.; Deil, C.; deWilt, P.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dubus, G.; Dutson, K.; Dyks, J.; Dyrda, M.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gajdus, M.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Grudzińska, M.; Hadasch, D.; Hahn, J.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hervet, O.; Hillert, A.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holler, M.; Horns, D.; Ivascenko, A.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jogler, T.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katz, U.; Kerszberg, D.; Khélifi, B.; Kieffer, M.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krayzel, F.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; Lypova, I.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Menzler, U.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Morå, K.; Moulin, E.; Murach, T.; de Naurois, M.; Niederwanger, F.; Niemiec, J.; Oakes, L.; Odaka, H.; Öttl, S.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Paz Arribas, M.; Pekeur, N. W.; Pelletier, G.; Petrucci, P.-O.; Peyaud, B.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Reimer, A.; Reimer, O.; Renaud, M.; de Reyes, R.; Rieger, F.; Romoli, C.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Stycz, K.; Sushch, I.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tluczykont, M.; Trichard, C.; Tuffs, R.; van der Walt, J.; van Eldik, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zabalza, V.; Zaborov, D.; Zacharias, M.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Żywucka, N.

    2018-04-01

    Using the High Energy Spectroscopic System (H.E.S.S.) telescopes we have discovered a steady and extended very high-energy (VHE) γ-ray source towards the luminous blue variable candidate LBV 1806-20, massive stellar cluster Cl* 1806-20, and magnetar SGR 1806-20. The new VHE source, HESS J1808-204, was detected at a statistical significance of >6σ (post-trial) with a photon flux normalisation (2.9 ± 0.4stat ± 0.5sys) × 10-13 ph cm-2 s-1 TeV-1 at 1 TeV and a power-law photon index of 2.3 ± 0.2stat ± 0.3sys. The luminosity of this source (0.2 to 10 TeV; scaled to distance d = 8.7 kpc) is LVHE 1.6 × 1034(d/8.7 kpc)2 erg s-1. The VHE γ-ray emission is extended and is well fit by a single Gaussian with statistical standard deviation of 0.095° ± 0.015°. This extension is similar to that of the synchrotron radio nebula G10.0-0.3, which is thought to be powered by LBV 1806-20. The VHE γ-ray luminosity could be provided by the stellar wind luminosity of LBV 1806-20 by itself and/or the massive star members of Cl* 1806-20. Alternatively, magnetic dissipation (e.g. via reconnection) from SGR 1806-20 can potentially account for the VHE luminosity. The origin and hadronic and/or leptonic nature of the accelerated particles responsible for HESS J1808-204 is not yet clear. If associated with SGR 1806-20, the potentially young age of the magnetar (650 yr) can be used to infer the transport limits of these particles to match the VHE source size. This discovery provides new interest in the potential for high-energy particle acceleration from magnetars, massive stars, and/or stellar clusters.

  19. Goddard's Astrophysics Science Division Annual Report 2013

    Science.gov (United States)

    Weaver, Kimberly A. (Editor); Reddy, Francis J. (Editor); Tyler, Patricia A. (Editor)

    2014-01-01

    The Astrophysics Science Division (ASD) at Goddard Space Flight Center (GSFC) is one of the largest and most diverse astrophysical organizations in the world, with activities spanning a broad range of topics in theory, observation, and mission and technology development. Scientific research is carried out over the entire electromagnetic spectrum from gamma rays to radio wavelengths as well as particle physics and gravitational radiation. Members of ASD also provide the scientific operations for two orbiting astrophysics missions Fermi Gamma-ray Space Telescope and Swift as well as the Science Support Center for Fermi. A number of key technologies for future missions are also under development in the Division, including X-ray mirrors, space-based interferometry, high contrast imaging techniques to search for exoplanets, and new detectors operating at gamma-ray, X-ray, ultraviolet, infrared, and radio wavelengths. The overriding goals of ASD are to carry out cutting-edge scientific research, provide Project Scientist support for spaceflight missions, implement the goals of the NASA Strategic Plan, serve and support the astronomical community, and enable future missions by conceiving new concepts and inventing new technologies.

  20. Nuclear transfer reaction measurements at the ESR-for the investigation of the astrophysical O-15(alpha,gamma)Ne-19 reaction

    NARCIS (Netherlands)

    Doherty, D. T.; Woods, P. J.; Litvinov, Yu A.; Najafi, M. Ali; Bagchi, S.; Bishop, S.; Bo, M.; Brandau, C.; Davinson, T.; Dillmann, I.; Estrade, A.; Egelhof, P.; Evdokimov, A.; Gumberidze, A.; Heil, M.; Lederer, C.; Litvinov, S. A.; Lotay, G.; Kalantar-Nayestanaki, N.; Kiselev, O.; Kozhuharov, C.; Kroell, T.; Mahjour-Shafei, M.; Mutterer, M.; Nolden, F.; Petridis, N.; Popp, U.; Reifarth, R.; Rigollet, C.; Roy, S.; Steck, M.; Stoehlker, Th; Streicher, B.; Trotsenko, S.; von Schmid, M.; Yan, X. L.; Zamora, J. C.

    2015-01-01

    Astrophysical x-ray bursts are thought to be a result of thermonuclear explosions on the atmosphere of an accreting neutron star. Between these bursts, energy is thought to be generated by the hot CNO cycles. The O-15(alpha,gamma)Ne-19 reaction is one reaction that allows breakout from these CNO

  1. Nuclear transfer reaction measurements at the ESR-for the investigation of the astrophysical O-15(alpha,gamma)Ne-19 reaction

    NARCIS (Netherlands)

    Doherty, D. T.; Woods, P. J.; Litvinov, Yu A.; Najafi, M. Ali; Bagchi, S.; Bishop, S.; Bo, M.; Brandau, C.; Davinson, T.; Dillmann, I.; Estrade, A.; Egelhof, P.; Evdokimov, A.; Gumberidze, A.; Heil, M.; Lederer, C.; Litvinov, S. A.; Lotay, G.; Kalantar-Nayestanaki, N.; Kiselev, O.; Kozhuharov, C.; Kroell, T.; Mahjour-Shafei, M.; Mutterer, M.; Nolden, F.; Petridis, N.; Popp, U.; Reifarth, R.; Rigollet, C.; Roy, S.; Steck, M.; Stoehlker, Th; Streicher, B.; Trotsenko, S.; von Schmid, M.; Yan, X. L.; Zamora, J. C.

    Astrophysical x-ray bursts are thought to be a result of thermonuclear explosions on the atmosphere of an accreting neutron star. Between these bursts, energy is thought to be generated by the hot CNO cycles. The O-15(alpha,gamma)Ne-19 reaction is one reaction that allows breakout from these CNO

  2. First Accurate Normalization of the $\\beta$-delayed $\\alpha$ Decay of $^{16}$N and Implications for the $^{12}$C$(\\alpha,\\gamma)^{16}$O Astrophysical Reaction Rate arXiv

    CERN Document Server

    Kirsebom, O.S.; Lica, R.; Munch, M.; Riisager, K.; Fynbo, H.O.U.; Borge, M.J.G.; Madurga, M.; Marroquin, I.; Andreyev, A.N.; Berry, T.A.; Christensen, E.R.; Fernández, P. Díaz; Doherty, D.T.; Van Duppen, P.; Fraile, L.M.; Gallardo, M.C.; Greenlees, P.T.; Harkness-Brennan, L.J.; Hubbard, N.; Huyse, M.; Jensen, J.H.; Johansson, H.; Jonson, B.; Judson, D.S.; Konki, J.; Lazarus, I.; Lund, M.V.; Marginean, N.; Marginean, R.; Perea, A.; Mihai, C.; Negret, A.; Page, R.D.; Pucknell, V.; Rahkila, P.; Sorlin, O.; Sotty, C.; Swartz, J.A.; Sørensen, H.B.; Törnqvist, H.; Vedia, V.; Warr, N.; De Witte, H.

    The $^{12}$C$(\\alpha,\\gamma)^{16}$O reaction plays a central role in astrophysics, but its cross section at energies relevant for astrophysical applications is only poorly constrained by laboratory data. The reduced $\\alpha$ width, $\\gamma_{11}$, of the bound $1^-$ level in $^{16}$O is particularly important to determine the cross section. The magnitude of $\\gamma_{11}$ is determined via sub-Coulomb $\\alpha$-transfer reactions or the $\\beta$-delayed $\\alpha$ decay of $^{16}$N, but the latter approach is presently hampered by the lack of sufficiently precise data on the $\\beta$-decay branching ratios. Here we report improved branching ratios for the bound $1^-$ level and for $\\beta$-delayed $\\alpha$ emission. In the case of the $\\beta$-delayed $\\alpha$ branch, we find a $5\\sigma$ deviation from the literature value. With our new branching ratios, the constraints imposed on $\\gamma_{11}$ by the $\\beta\\alpha$-decay and $\\alpha$-transfer data are of similar precision and, for the first time, in good agreement. Th...

  3. High-Energy Spectroscopic Astrophysics Swiss Society for Astrophysics and Astronomy

    CERN Document Server

    Kahn, Steven M; von Ballmoos, Peter

    2005-01-01

    After three decades of intense research in X-ray and gamma-ray astronomy, the time was ripe to summarize basic knowledge on X-ray and gamma-ray spectroscopy for interested students and researchers ready to become involved in new high-energy missions. This volume exposes both the scientific basics and modern methods of high-energy spectroscopic astrophysics. The emphasis is on physical principles and observing methods rather than a discussion of particular classes of high-energy objects, but many examples and new results are included in the three chapters as well.

  4. A SEARCH FOR VERY HIGH ENERGY GAMMA RAYS FROM THE MISSING LINK BINARY PULSAR J1023+0038 WITH VERITAS

    Energy Technology Data Exchange (ETDEWEB)

    Aliu, E. [Department of Physics and Astronomy, Barnard College, Columbia University, NY 10027 (United States); Archambault, S. [Physics Department, McGill University, Montreal, QC H3A 2T8 (Canada); Archer, A.; Buckley, J. H.; Bugaev, V. [Department of Physics, Washington University, St. Louis, MO 63130 (United States); Benbow, W.; Cerruti, M. [Fred Lawrence Whipple Observatory, Harvard-Smithsonian Center for Astrophysics, Amado, AZ 85645 (United States); Bird, R. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Biteau, J. [Santa Cruz Institute for Particle Physics and Department of Physics, University of California, Santa Cruz, CA 95064 (United States); Buchovecky, M. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Byrum, K. [Argonne National Laboratory, 9700 S. Cass Avenue, Argonne, IL 60439 (United States); Cardenzana, J. V; Dickinson, H. J.; Eisch, J. D. [Department of Physics and Astronomy, Iowa State University, Ames, IA 50011 (United States); Chen, X. [Institute of Physics and Astronomy, University of Potsdam, D-14476 Potsdam-Golm (Germany); Ciupik, L. [Astronomy Department, Adler Planetarium and Astronomy Museum, Chicago, IL 60605 (United States); Connolly, M. P. [School of Physics, National University of Ireland Galway, University Road, Galway (Ireland); Cui, W.; Feng, Q. [Department of Physics and Astronomy, Purdue University, West Lafayette, IN 47907 (United States); Falcone, A., E-mail: ester.aliu.fuste@gmail.com, E-mail: gtrichards@gatech.edu, E-mail: masha.chernyakova@dcu.ie, E-mail: malloryr@gmail.com [Department of Astronomy and Astrophysics, 525 Davey Lab, Pennsylvania State University, University Park, PA 16802 (United States); and others

    2016-11-10

    The binary millisecond radio pulsar PSR J1023+0038 exhibits many characteristics similar to the gamma-ray binary system PSR B1259–63/LS 2883, making it an ideal candidate for the study of high-energy nonthermal emission. It has been the subject of multiwavelength campaigns following the disappearance of the pulsed radio emission in 2013 June, which revealed the appearance of an accretion disk around the neutron star. We present the results of very high energy (VHE) gamma-ray observations carried out by the Very Energetic Radiation Imaging Telescope Array System before and after this change of state. Searches for steady and pulsed emission of both data sets yield no significant gamma-ray signal above 100 GeV, and upper limits are given for both a steady and pulsed gamma-ray flux. These upper limits are used to constrain the magnetic field strength in the shock region of the PSR J1023+0038 system. Assuming that VHE gamma rays are produced via an inverse Compton mechanism in the shock region, we constrain the shock magnetic field to be greater than ∼2 G before the disappearance of the radio pulsar and greater than ∼10 G afterward.

  5. The new astrophysics

    International Nuclear Information System (INIS)

    Longair, M.

    1989-01-01

    The author offers a review of advances in astrophysics since 1945 when astronomers started to explore the universe beyond the bounds of the optical wavelength of the electromagnetic spectrum, especially in the fields of radio, x ray and gamma ray, cosmic ray, ultraviolet and infrared astronomies, as well as neutral hydrogen and molecular line studies. Theoretical and technological advances have also kept pace. An overview of the new astrophysics is offered focusing on the large-scale distribution of matter and the background microwave radiation, galaxies, stellar evolution and the interstellar media (dust, gas and high energy particles). Nucleosynthesis in stars is mentioned in a broader discussion of stellar evolution, and dead stars including supernovae. Active galaxies and quasars are discussed. After considering what should be included in astrophysical cosmology, the author looks to the future of the science. (U.K.)

  6. The High-Energy Astrophysics Learning Center, Version 1. [CD-ROM].

    Science.gov (United States)

    Whitlock, Laura A.; Allen, Jesse S.; Lochner, James C.

    The High-Energy Astrophysics (HEA) Learning Center gives students, teachers, and the general public a window into the world of high-energy astrophysics. The universe is revealed through x-rays and gamma rays where matter exists under extreme conditions. Information is available on astrophysics at a variety of reading levels, and is illustrated…

  7. The Astrophysics Science Division Annual Report 2009

    Science.gov (United States)

    Oegerle, William (Editor); Reddy, Francis (Editor); Tyler, Pat (Editor)

    2010-01-01

    The Astrophysics Science Division (ASD) at Goddard Space Flight Center (GSFC) is one of the largest and most diverse astrophysical organizations in the world, with activities spanning a broad range of topics in theory, observation, and mission and technology development. Scientific research is carried out over the entire electromagnetic spectrum - from gamma rays to radio wavelengths - as well as particle physics and gravitational radiation. Members of ASD also provide the scientific operations for three orbiting astrophysics missions - WMAP, RXTE, and Swift, as well as the Science Support Center for the Fermi Gamma-ray Space Telescope. A number of key technologies for future missions are also under development in the Division, including X-ray mirrors, space-based interferometry, high contrast imaging techniques to search for exoplanets, and new detectors operating at gamma-ray, X-ray, ultraviolet, infrared, and radio wavelengths. The overriding goals of ASD are to carry out cutting-edge scientific research, provide Project Scientist support for spaceflight missions, implement the goals of the NASA Strategic Plan, serve and support the astronomical community, and enable future missions by conceiving new concepts and inventing new technologies.

  8. Goddard's Astrophysics Science Division Annual Report 2011

    Science.gov (United States)

    Centrella, Joan; Reddy, Francis; Tyler, Pat

    2012-01-01

    The Astrophysics Science Division(ASD) at Goddard Space Flight Center(GSFC)is one of the largest and most diverse astrophysical organizations in the world, with activities spanning a broad range of topics in theory, observation, and mission and technology development. Scientific research is carried out over the entire electromagnetic spectrum from gamma rays to radiowavelengths as well as particle physics and gravitational radiation. Members of ASD also provide the scientific operations for three orbiting astrophysics missions WMAP, RXTE, and Swift, as well as the Science Support Center for the Fermi Gamma-ray Space Telescope. A number of key technologies for future missions are also under development in the Division, including X-ray mirrors, space-based interferometry, high contract imaging techniques to serch for exoplanets, and new detectors operating at gamma-ray, X-ray, ultraviolet, infrared, and radio wavelengths. The overriding goals of ASD are to carry out cutting-edge scientific research, and provide Project Scientist support for spaceflight missions, implement the goals of the NASA Strategic Plan, serve and suppport the astronomical community, and enable future missions by conceiving new conepts and inventing new technologies.

  9. Detection of variable VHE γ-ray emission from the extra-galactic γ-ray binary LMC P3

    Science.gov (United States)

    HESS Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Angüner, E. O.; Arakawa, M.; Armand, C.; Arrieta, M.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bonnefoy, S.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Büchele, M.; Bulik, T.; Capasso, M.; Caroff, S.; Carosi, A.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Colafrancesco, S.; Condon, B.; Conrad, J.; Davids, I. D.; Decock, J.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Donath, A.; Drury, L. O.'C.; Dyks, J.; Edwards, T.; Egberts, K.; Emery, G.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Funk, S.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Garrigoux, T.; Gaté, F.; Giavitto, G.; Glawion, D.; Glicenstein, J. F.; Gottschall, D.; Grondin, M.-H.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holch, T. L.; Holler, M.; Horns, D.; Ivascenko, A.; Iwasaki, H.; Jacholkowska, A.; Jamrozy, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katsuragawa, M.; Katz, U.; Kerszberg, D.; Khangulyan, D.; Khélifi, B.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lefaucheur, J.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Malyshev, D.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Nakashima, S.; de Naurois, M.; Ndiyavala, H.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poireau, V.; Prokhorov, D. A.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Rauth, R.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Rieger, F.; Rinchiuso, L.; Romoli, C.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Saito, S.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seglar-Arroyo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Shiningayamwe, K.; Simoni, R.; Sol, H.; Spanier, F.; Spir-Jacob, M.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Steppa, C.; Sushch, I.; Takahashi, T.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tsirou, M.; Tsuji, N.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Zorn, J.; Żywucka, N.

    2018-03-01

    Context. Recently, the high-energy (HE, 0.1-100 GeV) γ-ray emission from the object LMC P3 in the Large Magellanic Cloud (LMC) has been discovered to be modulated with a 10.3-day period, making it the first extra-galactic γ-ray binary. Aim. This work aims at the detection of very-high-energy (VHE, >100 GeV) γ-ray emission and the search for modulation of the VHE signal with the orbital period of the binary system. Methods: LMC P3 has been observed with the High Energy Stereoscopic System (H.E.S.S.); the acceptance-corrected exposure time is 100 h. The data set has been folded with the known orbital period of the system in order to test for variability of the emission. Results: VHE γ-ray emission is detected with a statistical significance of 6.4 σ. The data clearly show variability which is phase-locked to the orbital period of the system. Periodicity cannot be deduced from the H.E.S.S. data set alone. The orbit-averaged luminosity in the 1-10 TeV energy range is (1.4 ± 0.2) × 1035 erg s-1. A luminosity of (5 ± 1) × 1035 erg s-1 is reached during 20% of the orbit. HE and VHE γ-ray emissions are anti-correlated. LMC P3 is the most luminous γ-ray binary known so far.

  10. The Cherenkov Telescope Array For Very High-Energy Astrophysics

    Science.gov (United States)

    Kaaret, Philip

    2015-08-01

    The field of very high energy (VHE) astrophysics had been revolutionized by the results from ground-based gamma-ray telescopes, including the current imaging atmospheric Cherenkov telescope (IACT) arrays: HESS, MAGIC and VERITAS. A worldwide consortium of scientists from 29 countries has formed to propose the Cherenkov Telescope Array (CTA) that will capitalize on the power of this technique to greatly expand the scientific reach of ground-based gamma-ray telescopes. CTA science will include key topics such as the origin of cosmic rays and cosmic particle acceleration, understanding extreme environments in regions close to neutron stars and black holes, and exploring physics frontiers through, e.g., the search for WIMP dark matter, axion-like particles and Lorentz invariance violation. CTA is envisioned to consist of two large arrays of Cherenkov telescopes, one in the southern hemisphere and one in the north. Each array will contain telescopes of different sizes to provide a balance between cost and array performance over an energy range from below 100 GeV to above 100 TeV. Compared to the existing IACT arrays, CTA will have substantially better angular resolution and energy resolution, will cover a much wider energy range, and will have up to an order of magnitude better sensitivity. CTA will also be operated as an open observatory and high-level CTA data will be placed into the public domain; these aspects will enable broad participation in CTA science from the worldwide scientific community to fully capitalize on CTA's potential. This talk will: 1) review the scientific motivation and capabilities of CTA, 2) provide an overview of the technical design and the status of prototype development, and 3) summarize the current status of the project in terms of its proposed organization and timeline. The plans for access to CTA data and opportunities to propose for CTA observing time will be highlighed.Presented on behalf of the CTA Consortium.

  11. Developing a Laue Lens for Nuclear Astrophysics: The Challenge of Focusing Soft Gamma-rays

    Science.gov (United States)

    Barriere, Nicolas

    Soft gamma rays provide a unique window on the high-energy Universe, especially for studying nuclear astrophysics through nuclear line emission. However, the sensitivity of state-of-the-art gamma-ray telescopes is severely limited by the intense instrumental background when flown in space. A solution is to decouple the photon collection area from the photon detection area. Focusing source photons from a large collection area onto a small detector volume would dramatically improve the signal-to-noise ratio, and hence provide the long awaited sensitivity leap in this challenging energy band. Laue crystal diffraction can be utilized to focus soft gamma rays when configured in a Laue lens. While this technology has been demonstrated on balloon flights, the type of crystals used and the process of assembling many crystals into a lens have not been optimized yet. We propose to address all the technical aspects of the construction of a scientifically exploitable Laue lens in order to bring this technology to TRL-6. To this end, two small prototypes representative of the diversity of Laue lenses will be built and tested in relevant environments, leveraging the work accomplished under a previous APRA grant. This project will establish the real performances, the cost, and the construction duration of a full-scale lens, allowing us to propose a Laue lens telescope for suborbital or satellite missions.

  12. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy. Pantea Davoudifar. Articles written in Journal of Astrophysics and Astronomy. Volume 32 Issue 3 September 2011 pp 359-370. Extragalactic Gamma Ray Excess from Coma Supercluster Direction · Pantea Davoudifar S. Jalil Fatemi · More Details Abstract Fulltext ...

  13. 14th International School of Cosmic Ray Astrophysics

    CERN Document Server

    Stanev, Todor; Wefel, John P; Neutrinos and explosive events in the universe

    2005-01-01

    This volume contains the Lectures and selected participant contributions to the 14th Course of the International School of Cosmic Rays Astrophysics, a NATO Advanced Study Institute. Well known astrophysicists and astronomers discuss different aspects of the generation of high energy signals in powerful astrophysical objects concentrating on the production of neutrinos and gamma rays from high energy particle interactions. Recent results from new experiments and observatories are presented. Topics cover a wide range including the Spitzer infrared observatory, TeV gamma ray observations, dark matter, and neutrino telescopes. The combination of basic knowledge about the production of high energy signals with information about the data analysis of ongoing observations places the book between the usual levels of a textbook and a conference proceedings. It will give the reader a good introduction to the current field of astroparticle physics, and some of the fascinating astrophysics being addressed.

  14. Very-high-energy gamma-ray observations of the Type Ia Supernova SN 2014J with the MAGIC telescopes

    Science.gov (United States)

    Ahnen, M. L.; Ansoldi, S.; Antonelli, L. A.; Antoranz, P.; Arcaro, C.; Babic, A.; Banerjee, B.; Bangale, P.; Barres de Almeida, U.; Barrio, J. A.; Becerra González, J.; Bednarek, W.; Bernardini, E.; Berti, A.; Biasuzzi, B.; Biland, A.; Blanch, O.; Bonnefoy, S.; Bonnoli, G.; Borracci, F.; Bretz, T.; Carosi, R.; Carosi, A.; Chatterjee, A.; Colin, P.; Colombo, E.; Contreras, J. L.; Cortina, J.; Covino, S.; Cumani, P.; Da Vela, P.; Dazzi, F.; De Angelis, A.; De Lotto, B.; de Oña Wilhelmi, E.; Di Pierro, F.; Doert, M.; Domínguez, A.; Dominis Prester, D.; Dorner, D.; Doro, M.; Einecke, S.; Eisenacher Glawion, D.; Elsaesser, D.; Engelkemeier, M.; Fallah Ramazani, V.; Fernández-Barral, A.; Fidalgo, D.; Fonseca, M. V.; Font, L.; Frantzen, K.; Fruck, C.; Galindo, D.; García López, R. J.; Garczarczyk, M.; Garrido Terrats, D.; Gaug, M.; Giammaria, P.; Godinović, N.; Gora, D.; Guberman, D.; Hadasch, D.; Hahn, A.; Hayashida, M.; Herrera, J.; Hose, J.; Hrupec, D.; Hughes, G.; Idec, W.; Kodani, K.; Konno, Y.; Kubo, H.; Kushida, J.; La Barbera, A.; Lelas, D.; Lindfors, E.; Lombardi, S.; Longo, F.; López, M.; López-Coto, R.; Majumdar, P.; Makariev, M.; Mallot, K.; Maneva, G.; Manganaro, M.; Mannheim, K.; Maraschi, L.; Marcote, B.; Mariotti, M.; Martínez, M.; Mazin, D.; Menzel, U.; Miranda, J. M.; Mirzoyan, R.; Moralejo, A.; Moretti, E.; Nakajima, D.; Neustroev, V.; Niedzwiecki, A.; Nievas Rosillo, M.; Nilsson, K.; Nishijima, K.; Noda, K.; Nogués, L.; Paiano, S.; Palacio, J.; Palatiello, M.; Paneque, D.; Paoletti, R.; Paredes, J. M.; Paredes-Fortuny, X.; Pedaletti, G.; Peresano, M.; Perri, L.; Persic, M.; Poutanen, J.; Prada Moroni, P. G.; Prandini, E.; Puljak, I.; Garcia, J. R.; Reichardt, I.; Rhode, W.; Ribó, M.; Rico, J.; Saito, T.; Satalecka, K.; Schroeder, S.; Schweizer, T.; Sillanpää, A.; Sitarek, J.; Snidaric, I.; Sobczynska, D.; Stamerra, A.; Strzys, M.; Surić, T.; Takalo, L.; Tavecchio, F.; Temnikov, P.; Terzić, T.; Tescaro, D.; Teshima, M.; Torres, D. F.; Toyama, T.; Treves, A.; Vanzo, G.; Vazquez Acosta, M.; Vovk, I.; Ward, J. E.; Will, M.; Wu, M. H.; Zanin, R.

    2017-06-01

    Context. In this work we present data from observations with the MAGIC telescopes of SN 2014J detected on January 21 2014, the closest Type Ia supernova since Imaging Air Cherenkov Telescopes started to operate. Aims: We aim to probe the possibility of very-high-energy (VHE; E ≥ 100 GeV) gamma rays produced in the early stages of Type Ia supernova explosions. Methods: We performed follow-up observations after this supernova (SN) explosion for five days, between January 27 and February 2 2014. We searched for gamma-ray signals in the energy range between 100 GeV and several TeV from the location of SN 2014J using data from a total of 5.5 h of observations. Prospects for observing gamma rays of hadronic origin from SN 2014J in the near future are also being addressed. Results: No significant excess was detected from the direction of SN 2014J. Upper limits at 95% confidence level on the integral flux, assuming a power-law spectrum, dF/dE ∝ E- Γ, with a spectral index of Γ = 2.6, for energies higher than 300 GeV and 700 GeV, are established at 1.3 × 10-12 and 4.1 × 10-13 photons cm-2 s-1, respectively. Conclusions: For the first time, upper limits on the VHE emission of a Type Ia supernova are established. The energy fraction isotropically emitted into TeV gamma rays during the first 10 days after the supernova explosion for energies greater than 300 GeV is limited to 10-6 of the total available energy budget ( 1051 erg). Within the assumed theoretical scenario, the MAGIC upper limits on the VHE emission suggest that SN 2014J will not be detectable in the future by any current or planned generation of Imaging Atmospheric Cherenkov Telescopes.

  15. Separation of gamma and hadron initiated air showers with energies between 20 and 500 TeV

    Energy Technology Data Exchange (ETDEWEB)

    Arqueros, F. [Universidad Complutense de Madrid (Spain). Facultad de Ciencias Fisicas; Karle, A. [Max-Planck-Institut fuer Physik, Muenchen (Germany); Lorenz, E. [Max-Planck-Institut fuer Physik, Muenchen (Germany); Martinez, S. [Universidad Complutense de Madrid (Spain). Facultad de Ciencias Fisicas; Plaga, R. [Max-Planck-Institut fuer Physik, Muenchen (Germany); Rozanska, M. [Institute of Nuclear Physics, Cracow (Poland)

    1994-04-24

    The discrimination between air showers initiated by {gamma} rays and by hadrons is one of the fundamental problems in experimental cosmic-ray physics. The physics of this `{gamma}/hadron separation` is discussed in this paper. We restrict ourselves to the energy range from about 20 to 500 TeV, and take only the information contained in the lateral Cerenkov light distribution and the number of electrons at the detector level into consideration. An understanding of the differences between air showers generated by {gamma} rays and those due to hadrons leads us to formulate suitable observables for the separation process. Angle integrating Cerenkov arrays (AICA) offer a promising new approach to ground-based {gamma}-ray astronomy in the energy region from about 20 to 500 TeV. In order to establish this technique, an efficient suppression of the overwhelming hadronic background radiation is required. As an example for our general discussion, we present one method for {gamma}/hadron separation in AICAs called ``LES``. It is based on the simultaneous determination of the shower size and some characteristic parameters of the lateral distribution of the Cerenkov light. The potential inherent within this technique is demonstrated in quantitative detail for the existing ``AIROBICC`` AICA. We also propose an objective measure of the intrinsic sensitivity of a detection scheme in ground-based {gamma}-ray astronomy, the ``reduced quality factor``. It is shown that AICAs may reach a sensitivity to {gamma}-ray point sources in the high VHE range similar to that of the Cerenkov-telescope imaging technique in the low VHE region. (orig.)

  16. A search for gamma-ray imprints of annihilating dark matter in the galaxy, and the astrophysical implications of ultra-light fundamental vector bosons

    Energy Technology Data Exchange (ETDEWEB)

    Zechlin, Hannes-Sebastian

    2013-12-15

    Standard Model extensions imply new elementary particles that can lead to specific astrophysical signatures. In particular, weakly interacting massive particles (WIMPs) can constitute the unknown non-luminous cold dark matter, which contributes approximately 84% to the matter content of the Universe. Annihilation or decay of WIMPs may lead to high-energy gamma-rays. In this thesis, new methods of searching for gamma-ray signals from annihilating dark matter are developed and applied. Moreover, astrophysical imprints of new ultra-light hidden U(1) gauge bosons in radio data are investigated. Hierarchical structure formation predicts a variety of smaller bound dark matter sub-halos in Milky-Way-like galactic hosts. It is shown that the Fermi-LAT is sufficiently sensitive for detecting up to a few nearby dark matter subhalos in terms of faint gamma-ray sources with a moderate angular extent. Searches in the first and second Fermi-LAT source catalogs reveal about ten candidate sources each. To discriminate the source candidates from conventional astrophysical objects, an analysis for spectral, spatial, positional, and temporal gamma-ray properties using 3.5 years of Fermi-LAT data is carried out. In addition, a multi-wavelength analysis of archival data or follow-up observations in the radio, infrared, optical, UV, X-ray, high-energy, and very-high energy gamma-ray bands is carried out. The broad-band spectra of all promising candidates are compatible with AGN, in particular high-energy peaked BL-Lac type objects (HBLs). Dark matter annihilation can contribute to the small-scale angular anisotropy spectrum of the diffuse gamma-ray background (DGB). The detection capabilities of currently operating imaging atmospheric Cherenkov telescopes and the planned Cherenkov Telescope Array (CTA) are studied. With CTA, a relative gamma-ray contribution from annihilating dark matter of 10% to the extragalactic DGB can be resolved via angular anisotropies. In terms of the dark

  17. A search for gamma-ray imprints of annihilating dark matter in the galaxy, and the astrophysical implications of ultra-light fundamental vector bosons

    International Nuclear Information System (INIS)

    Zechlin, Hannes-Sebastian

    2013-12-01

    Standard Model extensions imply new elementary particles that can lead to specific astrophysical signatures. In particular, weakly interacting massive particles (WIMPs) can constitute the unknown non-luminous cold dark matter, which contributes approximately 84% to the matter content of the Universe. Annihilation or decay of WIMPs may lead to high-energy gamma-rays. In this thesis, new methods of searching for gamma-ray signals from annihilating dark matter are developed and applied. Moreover, astrophysical imprints of new ultra-light hidden U(1) gauge bosons in radio data are investigated. Hierarchical structure formation predicts a variety of smaller bound dark matter sub-halos in Milky-Way-like galactic hosts. It is shown that the Fermi-LAT is sufficiently sensitive for detecting up to a few nearby dark matter subhalos in terms of faint gamma-ray sources with a moderate angular extent. Searches in the first and second Fermi-LAT source catalogs reveal about ten candidate sources each. To discriminate the source candidates from conventional astrophysical objects, an analysis for spectral, spatial, positional, and temporal gamma-ray properties using 3.5 years of Fermi-LAT data is carried out. In addition, a multi-wavelength analysis of archival data or follow-up observations in the radio, infrared, optical, UV, X-ray, high-energy, and very-high energy gamma-ray bands is carried out. The broad-band spectra of all promising candidates are compatible with AGN, in particular high-energy peaked BL-Lac type objects (HBLs). Dark matter annihilation can contribute to the small-scale angular anisotropy spectrum of the diffuse gamma-ray background (DGB). The detection capabilities of currently operating imaging atmospheric Cherenkov telescopes and the planned Cherenkov Telescope Array (CTA) are studied. With CTA, a relative gamma-ray contribution from annihilating dark matter of 10% to the extragalactic DGB can be resolved via angular anisotropies. In terms of the dark

  18. GAMMA-RAY SIGNAL FROM THE PULSAR WIND IN THE BINARY PULSAR SYSTEM PSR B1259-63/LS 2883

    Energy Technology Data Exchange (ETDEWEB)

    Khangulyan, Dmitry [Institute of Space and Astronautical Science/JAXA, 3-1-1 Yoshinodai, Chuo-ku, Sagamihara, Kanagawa 252-5210 (Japan); Aharonian, Felix A. [Dublin Institute for Advanced Studies, 31 Fitzwilliam Place, Dublin 2 (Ireland); Bogovalov, Sergey V. [National Research Nuclear University-MEPHI, Kashirskoe Shosse 31, Moscow 115409 (Russian Federation); Ribo, Marc, E-mail: khangul@astro.isas.jaxa.jp, E-mail: felix.aharonian@dias.ie, E-mail: svbogovalov@mephi.ru, E-mail: mribo@am.ub.es [Departament d' Astronomia i Meteorologia, Institut de Ciences del Cosmos (ICC), Universitat de Barcelona (IEEC-UB), Marti i Franques 1, E-08028 Barcelona (Spain)

    2011-12-01

    Binary pulsar systems emit potentially detectable components of gamma-ray emission due to Comptonization of the optical radiation of the companion star by relativistic electrons of the pulsar wind, both before and after termination of the wind. The recent optical observations of binary pulsar system PSR B1259-63/LS 2883 revealed radiation properties of the companion star which differ significantly from previous measurements. In this paper, we study the implications of these observations for the interaction rate of the unshocked pulsar wind with the stellar photons and the related consequences for fluxes of high energy and very high energy (VHE) gamma rays. We show that the signal should be strong enough to be detected with Fermi close to the periastron passage, unless the pulsar wind is strongly anisotropic or the Lorentz factor of the wind is smaller than 10{sup 3} or larger than 10{sup 5}. The higher luminosity of the optical star also has two important implications: (1) attenuation of gamma rays due to photon-photon pair production and (2) Compton drag of the unshocked wind. While the first effect has an impact on the light curve of VHE gamma rays, the second effect may significantly decrease the energy available for particle acceleration after termination of the wind.

  19. 12th Italian-Korean Symposium on Relativistic Astrophysics

    International Nuclear Information System (INIS)

    Won Lee, Hyung; Remo Riffini; Vereshchagin

    2013-01-01

    This series of biannual symposia, since 1987, has been boosting exchange of information and collaborations between Italian and Korean astrophysicists on new and hot issues in the field of Relativistic Astrophysics. These symposia cover relativistic field theories, astrophysics and cosmology, topics such as gamma-ray bursts and compact stars, high energy cosmic rays, dark energy and dark matter, general relativity, black holes, and new physics related to cosmology. The organizers are confident that this symposium could deepen the understanding of not only astrophysics and cosmology but also Eastern and Western cultures.

  20. Dissecting the Gamma-Ray Background in Search of Dark Matter

    Energy Technology Data Exchange (ETDEWEB)

    Cholis, Ilias; Hooper, Dan; McDermott, Samuel D.

    2014-02-01

    Several classes of astrophysical sources contribute to the approximately isotropic gamma-ray background measured by the Fermi Gamma-Ray Space Telescope. In this paper, we use Fermi's catalog of gamma-ray sources (along with corresponding source catalogs at infrared and radio wavelengths) to build and constrain a model for the contributions to the extragalactic gamma-ray background from astrophysical sources, including radio galaxies, star-forming galaxies, and blazars. We then combine our model with Fermi's measurement of the gamma-ray background to derive constraints on the dark matter annihilation cross section, including contributions from both extragalactic and galactic halos and subhalos. The resulting constraints are competitive with the strongest current constraints from the Galactic Center and dwarf spheroidal galaxies. As Fermi continues to measure the gamma-ray emission from a greater number of astrophysical sources, it will become possible to more tightly constrain the astrophysical contributions to the extragalactic gamma-ray background. We project that with 10 years of data, Fermi's measurement of this background combined with the improved constraints on the astrophysical source contributions will yield a sensitivity to dark matter annihilations that exceeds the strongest current constraints by a factor of ~ 5 - 10.

  1. Summary for astrophysics and non-accelerator physics

    International Nuclear Information System (INIS)

    Kahana, S.H.

    1988-01-01

    This paper summarizes the presentations at the astrophysics and non-accelerator physics conference. Discussed in this paper are: supernovae, neutrinos, x-rays, gamma rays, cosmic rays, monopoles and primordial nucleosynthesis. 15 refs

  2. High Energy Density Laboratory Astrophysics

    CERN Document Server

    Lebedev, Sergey V

    2007-01-01

    During the past decade, research teams around the world have developed astrophysics-relevant research utilizing high energy-density facilities such as intense lasers and z-pinches. Every two years, at the International conference on High Energy Density Laboratory Astrophysics, scientists interested in this emerging field discuss the progress in topics covering: - Stellar evolution, stellar envelopes, opacities, radiation transport - Planetary Interiors, high-pressure EOS, dense plasma atomic physics - Supernovae, gamma-ray bursts, exploding systems, strong shocks, turbulent mixing - Supernova remnants, shock processing, radiative shocks - Astrophysical jets, high-Mach-number flows, magnetized radiative jets, magnetic reconnection - Compact object accretion disks, x-ray photoionized plasmas - Ultrastrong fields, particle acceleration, collisionless shocks. These proceedings cover many of the invited and contributed papers presented at the 6th International Conference on High Energy Density Laboratory Astrophys...

  3. Attenuation of VHE Gamma Rays by the Milky Way Interstellar Radiation Field

    Energy Technology Data Exchange (ETDEWEB)

    Moskalenko, Igor V.; /Stanford U., HEPL; Porter, Troy A.; /Louisiana State U.; Strong, Andrew W.; /Garching, Max Planck Inst., MPE

    2006-04-19

    The attenuation of very high energy gamma rays by pair production on the Galactic interstellar radiation field has long been thought of as negligible. However, a new calculation of the interstellar radiation field consistent with multi-wavelength observations by DIRBE and FIRAS indicates that the energy density of the Galactic interstellar radiation field is higher, particularly in the Galactic center, than previously thought. We have made a calculation of the attenuation of very high energy gamma rays in the Galaxy using this new interstellar radiation field which takes into account its nonuniform spatial and angular distributions. We find that the maximum attenuation occurs around 100 TeV at the level of about 25% for sources located at the Galactic center, and is important for both Galactic and extragalactic sources.

  4. Fermi LAT Observations of LS I +61 303: First Detection of an Orbital Modulation in GeV Gamma Rays

    Energy Technology Data Exchange (ETDEWEB)

    Abdo, A.A.; /Federal City Coll. /Naval Research Lab, Wash., D.C.; Ackermann, M.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Ajello, M.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Atwood, W.B.; /UC, Santa Cruz; Axelsson, M.; /Stockholm U., OKC /Stockholm U.; Baldini, L.; /INFN, Pisa; Ballet, J.; /DAPNIA, Saclay; Barbiellini, G.; /INFN, Trieste /Trieste U.; Bastieri, D.; /INFN, Padua /Padua U.; Baughman, B.M.; /Ohio State U.; Bechtol, K.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bellazzini, R.; /INFN, Pisa; Berenji, B.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Blandford, R.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bloom, E.D.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bonamente, E.; /INFN, Perugia /Perugia U.; Borgland, A.W.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bregeon, J.; /INFN, Pisa; Brez, A.; /INFN, Pisa; Brigida, M.; /Bari U. /INFN, Bari; Bruel, P.; /Ecole Polytechnique /Washington U., Seattle /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /IASF, Milan /Milan Polytechnic /DAPNIA, Saclay /ASDC, Frascati /INFN, Perugia /Perugia U. /NASA, Goddard /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /DAPNIA, Saclay /Naval Research Lab, Wash., D.C. /George Mason U. /NASA, Goddard /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /INFN, Perugia /Perugia U. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Montpellier U. /Sonoma State U. /Stockholm U., OKC /Royal Inst. Tech., Stockholm /Stockholm U. /DAPNIA, Saclay /NASA, Goddard /CSST, Baltimore /ASDC, Frascati /Naval Research Lab, Wash., D.C. /INFN, Trieste /Pavia U. /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /UC, Santa Cruz /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /SLAC /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Grenoble, CEN; /more authors..

    2012-04-02

    This Letter presents the first results from the observations of LS I +61{sup o}303 using Large Area Telescope data from the Fermi Gamma-Ray Space Telescope between 2008 August and 2009 March. Our results indicate variability that is consistent with the binary period, with the emission being modulated at 26.6 {+-} 0.5 days. This constitutes the first detection of orbital periodicity in high-energy gamma rays (20 MeV-100 GeV, HE). The light curve is characterized by a broad peak after periastron, as well as a smaller peak just before apastron. The spectrum is best represented by a power law with an exponential cutoff, yielding an overall flux above 100 MeV of 0.82 {+-} 0.03(stat) {+-} 0.07(syst) 10{sup -6} ph cm{sup -2} s{sup -1}, with a cutoff at 6.3 {+-} 1.1(stat) {+-} 0.4(syst) GeV and photon index {Gamma} = 2.21 {+-} 0.04(stat) {+-} 0.06(syst). There is no significant spectral change with orbital phase. The phase of maximum emission, close to periastron, hints at inverse Compton scattering as the main radiation mechanism. However, previous very high-energy gamma ray (>100 GeV, VHE) observations by MAGIC and VERITAS show peak emission close to apastron. This and the energy cutoff seen with Fermi suggest that the link between HE and VHE gamma rays is nontrivial.

  5. Searches for astrophysical neutrinos with IceCube

    International Nuclear Information System (INIS)

    Williams, D.

    2014-01-01

    Powerful astrophysical objects such as active galactic nuclei (AGN), core collapse supernovae and gamma ray bursts (GRBs) are potential sources of the highest energy cosmic rays. Many models of cosmic ray proton acceleration predict a corresponding flux of neutrinos in the TeV-PeV energy range. The detection of astrophysical neutrinos requires the largest neutrino detector ever built: IceCube, a cubic-kilometer array located near the geographic South Pole. IceCube has been collecting data throughout its construction, which was complete in December 2010. Data from the partial IceCube detector have already set interesting limits on astrophysical neutrino fluxes, including stringent limits on neutrino production in GRBs. (authors)

  6. Observational astrophysics

    CERN Document Server

    Smith, Robert C

    1995-01-01

    Combining a critical account of observational methods (telescopes and instrumentation) with a lucid description of the Universe, including stars, galaxies and cosmology, Smith provides a comprehensive introduction to the whole of modern astrophysics beyond the solar system. The first half describes the techniques used by astronomers to observe the Universe: optical telescopes and instruments are discussed in detail, but observations at all wavelengths are covered, from radio to gamma-rays. After a short interlude describing the appearance of the sky at all wavelengths, the role of positional astronomy is highlighted. In the second half, a clear description is given of the contents of the Universe, including accounts of stellar evolution and cosmological models. Fully illustrated throughout, with exercises given in each chapter, this textbook provides a thorough introduction to astrophysics for all physics undergraduates, and a valuable background for physics graduates turning to research in astronomy.

  7. The new astrophysics

    International Nuclear Information System (INIS)

    Longair, M.

    1993-01-01

    The various themes developed are: radioastronomy, X-ray and gamma-ray astronomy, cosmic ray, ultraviolet, neutral hydrogen and molecular line astronomy, optical and theoretical astronomy; the large scale distribution of matter and radiation in the universe, the galaxies, stars and stellar evolution, the interstellar medium (gas, dust) and star formation, galaxies and clusters of galaxies, active galaxies and quasars, astrophysical cosmology, the astronomy of the future. 86 figs., 60 refs

  8. Laue optics for nuclear astrophysics: New detector requirements for focused gamma-ray beams

    Energy Technology Data Exchange (ETDEWEB)

    Barriere, N. [INAF - IASF Roma, via Fosso del Cavaliere 100, 00133 Roma (Italy)], E-mail: nicolas.barriere@iasf-roma.inaf.it; Ballmoos, P. von [CESR - UMR 5187, 9 Av. du Colonel Roche, 31028 Toulouse (France); Abrosimov, N.V. [IKZ, Max Born-Str. 2, D-12489 Berlin (Germany); Bastie, P. [LSP UMR 5588, 140 Av. de la physique, 38402 Saint Martin d' Heres (France); Camus, T. [CESR - UMR 5187, 9 Av. du Colonel Roche, 31028 Toulouse (France); Courtois, P.; Jentschel, M. [ILL, 6 rue Jules Horowitz, 38042 Grenoble (France); Knoedlseder, J. [CESR - UMR 5187, 9 Av. du Colonel Roche, 31028 Toulouse (France); Natalucci, L. [INAF - IASF Roma, via Fosso del Cavaliere 100, 00133 Roma (Italy); Roudil, G.; Rousselle, J. [CESR - UMR 5187, 9 Av. du Colonel Roche, 31028 Toulouse (France); Wunderer, C.B. [SSL, University of California at Berkeley, CA 94708 (United States); Kurlov, V.N. [Institute of Solid State Physics of Russian Academy of Sciences, 142432 Chernogolovka (Russian Federation)

    2009-10-21

    Nuclear astrophysics presents an extraordinary scientific potential for the study of the most powerful sources and the most violent events in the Universe. But in order to take full advantage of this potential, telescopes should be at least an order of magnitude more sensitive than present technologies. Today, Laue lenses have demonstrated their capability of focusing gamma-rays in the 100 keV-1 MeV domain, enabling the possibility of building a new generation of instruments for which sensitive area is decoupled from collecting area. Thus we have now the opportunity of dramatically increase the signal/background ratio and hence improve significantly the sensitivity. With a lens, the best detector is no longer the largest possible within a mission envelope. The point spread function of a Laue lens measures a few centimeters in diameter, but the field of view is limited by the detector size. Requirements for a focal plane instrument are presented in the context of the Gamma-Ray Imager mission (proposed to European Space Agency, ESA in the framework of the first Cosmic Vision AO): a 15-20 cm a side finely pixellated detector capable of Compton events reconstruction seems to be optimal, giving polarization and background rejection capabilities and 30 arcsec of angular resolution within a field of view of 5 arc min.

  9. Discovery of the hard spectrum VHE γ-ray source HESS J1641-463

    International Nuclear Information System (INIS)

    Abramowski, A.; Ait Benkhali, F.

    2014-10-01

    This letter reports the discovery of a remarkably hard spectrum source, HESS J1641.463, by the High Energy Stereoscopic System (H.E.S.S.) in the very high energy (VHE) domain. HESS J1641.463 remained unnoticed by the usual analysis techniques due to confusion with the bright nearby source HESS J1640.465. It emerged at a significance level of 8.5 standard deviations after restricting the analysis to events with energies above 4 TeV. It shows a moderate flux level of φ (E>1 TeV)=(3.64 ± 0.44 stat ± 0.73 sys ) x 10 -13 cm -2 s -1 , corresponding to 1.8% of the Crab Nebula flux above the same energy, and a hard spectrum with a photon index of Γ=2.07±0.11 stat ±0.20 sys . It is a point-like source, although an extension up to a Gaussian width of σ=3 arcmin cannot be discounted due to uncertainties in the H.E.S.S. point-spread function. The VHE γ-ray flux of HESS J1641.463 is found to be constant over the observed period when checking time binnings from the year-by-year to the 28 minute exposure timescales. HESS J1641.463 is positionally coincident with the radio supernova remnant SNR G338.5+0.1. No X-ray candidate stands out as a clear association; however, Chandra and XMM-Newton data reveal some potential weak counterparts. Various VHE γ-ray production scenarios are discussed. If the emission from HESS J1641.463 is produced by cosmic ray protons colliding with the ambient gas, then their spectrum must extend close to 1 PeV. This object may represent a source population contributing significantly to the galactic cosmic ray flux around the knee.

  10. The opacity of the universe for high and very high energy {gamma}-rays

    Energy Technology Data Exchange (ETDEWEB)

    Meyer, Manuel

    2013-08-15

    The flux of high energy (HE, energy 100 MeVVHE, E>or similar 100 GeV) {gamma}-rays originating from cosmological sources is attenuated due to pair production in interactions with photons at ultraviolet to infrared wavelengths of the extragalactic background light (EBL). The main components contributing to the EBL photon density are the starlight integrated over cosmic time and the starlight reprocessed by dust in galaxies. Consequently, the EBL is an integral measure of the cosmic star formation history. Depending on the source distance, the Universe should be opaque to {gamma}-rays above a certain energy. Nevertheless, the number of detected {gamma}-ray sources has increased continuously in recent years. VHE emitting objects beyond redshifts of z>0.5 have been detected with imaging air Cherenkov telescopes (IACTs), while HE {gamma}-rays from active galactic nuclei (AGN) above redshifts z>or similar 3 have been observed with the Large Area Telescope (LAT) on board the Fermi satellite. In this work, a large sample of VHE {gamma}-ray spectra will be combined with data of the Fermi-LAT to derive upper limits on the EBL photon density at z = 0. Generic EBL realizations are used to correct AGN spectra for absorption, which are subsequently tested against model assumptions. The evolution of the EBL with redshift is accounted for, and a possible formation of electromagnetic cascades is considered. As a result, the EBL density is constrained over almost three orders of magnitude in wavelength, between 0.4 {mu}m and 100 {mu}m. At optical wavelengths, an EBL intensity above 24 nW m{sup -2}sr{sup -1} is ruled out, and between 8 {mu}m and 31 {mu}m it is limited to be below 5 nW m{sup -2}sr{sup -1}. In the infrared, the constraints are within a factor {proportional_to} 2 of lower limits derived from galaxy number counts. Additionally,the behavior of VHE spectra in the transition from the optical depth regimes {tau

  11. Gamma-ray transients and related astrophysical phenomena

    International Nuclear Information System (INIS)

    Lingenfelter, R.E.; Hudson, H.S.; Worrall, D.M.

    1982-01-01

    The workshop covered the study of the explosive phenomena responsible for the various gamma ray transients. X-ray burster observations and theories were also reviewed with emphasis on their relationship to gamma ray bursts. Recent observational data, particularly from the SMM, HEAO, and VENERA satellites made the workshop especially timely. Major headings include: gamma-ray transients, x-ray bursts, solar transients, and instrumental concepts. Individual items from the workshop were prepared separately for the data base

  12. Future prospects for. gamma. -ray astronomy

    Energy Technology Data Exchange (ETDEWEB)

    Fichtel, C [National Aeronautics and Space Administration, Greenbelt, MD (USA). Goddard Space Flight Center

    1981-06-30

    As ..gamma..-ray astronomy moves from the discovery to the exploratory phase, the promise of ..gamma..-ray astrophysics noted by theorists in the late 1940s and 1950s is beginning to be realized. In the future, satellites should carry instruments that will have over an order of magnitude greater sensitivity than those flown thus far, and, for at least some portions of the ..gamma..-ray energy range, these detectors will also have substantially improved energy and angular resolution. The information to be obtained from these experiments should greatly enhance our knowledge of several astrophysical phenomena including the very energetic and nuclear processes associated with compact objects, astrophysical nucleosynthesis, solar particle acceleration, the chemical composition of the planets and other bodies of the Solar System, the structure of our Galaxy, the origin and dynamic pressure effects of the cosmic rays, high energy particles and energetic processes in other galaxies especially active ones, and the degree of matter-antimatter symmetry of the Universe. The ..gamma..-ray results of the forthcoming programs such as Gamma-I, the Gamma Ray Observatory, the ..gamma..-ray burst network, Solar Polar, and very high energy ..gamma..-ray telescopes on the ground will almost certainly provide justification for more sophisticated telescopes. These advanced instruments might be placed on the Space Platform currently under study by N.A.S.A.

  13. Allen's astrophysical quantities

    CERN Document Server

    2000-01-01

    This new, fourth, edition of Allen's classic Astrophysical Quantities belongs on every astronomer's bookshelf. It has been thoroughly revised and brought up to date by a team of more than ninety internationally renowned astronomers and astrophysicists. While it follows the basic format of the original, this indispensable reference has grown to more than twice the size of the earlier editions to accommodate the great strides made in astronomy and astrophysics. It includes detailed tables of the most recent data on: - General constants and units - Atoms, molecules, and spectra - Observational astronomy at all wavelengths from radio to gamma-rays, and neutrinos - Planetary astronomy: Earth, planets and satellites, and solar system small bodies - The Sun, normal stars, and stars with special characteristics - Stellar populations - Cataclysmic and symbiotic variables, supernovae - Theoretical stellar evolution - Circumstellar and interstellar material - Star clusters, galaxies, quasars, and active galactic nuclei ...

  14. Very high energy gamma ray astrophysics

    International Nuclear Information System (INIS)

    Lamb, R.C.; Lewis, D.A.

    1991-01-01

    The Whipple Observatory High Resolution Camera will be used in a vigorous program of observations to search for new sources of very-high-energy gamma rays. In addition, a search for antimatter using the moon-earth system as an ion spectrometer will be begun. The first phase of GRANITE, the new 37-element 11-m camera, will be concluded with first light scheduled for September, 1991. The two cameras will operate in support of the Gamma Ray Observatory mission in the winter of 1991/2

  15. Very-high-energy gamma-ray observations of pulsar wind nebulae and cataclysmic variable stars with MAGIC and development of trigger systems for IACTs

    Science.gov (United States)

    Lopez-Coto, Ruben

    2015-07-01

    The history of astronomy is as ancient as the reach of our written records. All the human civilizations have been interested in the study and interpretation of the night sky and its objects and phenomena. These observations were performed with the naked eye until the beginning of the 17th century, when Galileo Galilei started to use an instrument recently developed called telescope. Since then, the range of accessible wavelengths has been increasing, with a burst in the 20th century with the developing of instruments to observe them: antennas (radio and submillimeter), telescopes (optical, IR) and satellites (UV, X-rays and soft gamma rays). The last wavelength range accessed was the Very-High-Energy (VHE) gamma rays. At this range fluxes are so low that it is not possible to use space-based instruments with typical collection areas of O(1) m2. We must resort to the imaging atmospheric Cherenkov technique, which is based on the detection of the flashes of Cherenkov light that VHE gamma rays produce when they interact with the Earth's atmosphere. The field is very young, with the first source discovered in 1989 by the pioneering Whipple telescope. It is very dynamic with more than 150 sources detected to date, most of them by MAGIC, HESS and VERITAS, that make up the current generation of instruments. Finally, the field is also very promising, with the preparation of a next generation of imaging atmospheric Cherenkov telescopes: CTA, that is expected to start full operation in 2020. The work presented in this thesis comprises my efforts to take the ground-based γ-ray astronomy one step forward. Part I of the thesis is an introduction to the non- thermal universe, the imaging atmospheric Cherenkov technique and the Imaging Atmospheric Cherenkov Telescopes (IACTs) MAGIC and CTA. Part II deals with several ways to reduce the trigger threshold of IACTs. This includes the simula- tion, characterization and test of an analog trigger especially designed to achieve the

  16. Investigations in γ-Ray Astrophysics and Astroparticle Physics

    Energy Technology Data Exchange (ETDEWEB)

    Krennrich, Frank [Iowa State Univ., Ames, IA (United States). Dept. of Physics and Astronomy

    2016-06-28

    This report describes the status of data analysis efforts, results and publications of research grant DE-SC0009917. The research is focused on TeV gamma-ray studies of astrophysical sources and related particle physics questions.

  17. Coulomb dissociation studies for astrophysical thermonuclear reactions

    Energy Technology Data Exchange (ETDEWEB)

    Motobayashi, T [Dept. of Physics, Rikkyo Univ., Toshima, Tokyo (Japan)

    1998-06-01

    The Coulomb dissociation method was applied to several radiative capture processes of astrophysical interest. The method has an advantage of high experimental efficiency, which allow measurements with radioactive nuclear beams. The reactions {sup 13}N(p,{gamma}){sup 14}O and {sup 7}Be(p,{gamma}){sup 8}B are mainly discussed. They are the key reaction in the hot CNO cycle in massive stars and the one closely related to the solar neutrino problem, respectively. (orig.)

  18. Towards a network of atmospheric Cherenkov detectors 7

    International Nuclear Information System (INIS)

    Robin, M.; Weekes, T.C.; Mori, M.; Mariotti, M.; Hofmann, W.; Aharonian, F.; Sinitsyna, V.; Smith, D.; Marleau, P.; Sinnis, G.; Volk, H.; Jager, O. de; Harding, A.; Coppi, P.; Dermer, C.; Goldwurm, A.; Paul, J.; Puhlhofer, G.; Bernardini, E.; Swordy, S.; Yoshikoshi, T.; Punch, M.

    2005-01-01

    This document gathers the papers and transparencies presented at the conference. The main part of the conference was organized into 6 sessions: 1) the review of present experiments (Veritas, Cangaroo-3, Magic, Hess-1, Shalon, Cactus, Cygnus-X-3...), 2) calibration and analysis techniques in VHE (very high energy) astrophysics, 3) multi-wavelength observations and phenomenology of sources, 4) the future of ground-based VHE astronomy, 5) developments in instrumentation for Cherenkov telescopes, and 6) the evolution of the field and its link with mainstream astrophysics

  19. Towards a network of atmospheric Cherenkov detectors 7

    Energy Technology Data Exchange (ETDEWEB)

    Robin, M. [Ecole Polytechnique, 91 - Palaiseau (France); Weekes, T.C. [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA (United States); Mori, M. [Tokyo Univ., Institute for Cosmic Ray Research (Japan); Mariotti, M. [Padova Univ., INFN (Italy); Hofmann, W.; Aharonian, F. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Sinitsyna, V. [P.N. Lebedev Physical Institute, Moscow (Russian Federation); Smith, D. [Centre d' Etudes Nucleaires de Bordeaux Gradignan, 33 - Gradignan (France); Marleau, P. [California Univ., Davis, CA (United States); Sinnis, G. [Los Alamos National Lab., NM (United States); Volk, H. [Max-Planck-Institut fur Kernphysik (Germany); Jager, O. de [South Africa Univ., North-West (South Africa); Harding, A. [NASA Goddard Space Flight Center (United States); Coppi, P. [Yale Univ., New Haven, CT (United States); Dermer, C. [Naval Research Laboratory (United States); Goldwurm, A.; Paul, J. [CEA Saclay, Dept. d' Astrophysique, de Physique des Particules de Physique Nucleaire et de l' Instrumentation Associee, 91- Gif sur Yvette (France); Puhlhofer, G. [Landessternwarte Heidelberg (Germany); Bernardini, E. [DESy-Zeuthen (Germany); Swordy, S. [Chicago Univ., IL (United States); Yoshikoshi, T. [Tokyo Univ., Tanashi (Japan). Inst. for Cosmic Ray Research; Teshima, M. [Max-Planck-Institute for Physics, Munich (Germany); Punch, M. [Astrophysique et Cosmologie (APC), College de France, 75 - Paris (France)

    2005-07-01

    This document gathers the papers and transparencies presented at the conference. The main part of the conference was organized into 6 sessions: 1) the review of present experiments (Veritas, Cangaroo-3, Magic, Hess-1, Shalon, Cactus, Cygnus-X-3...), 2) calibration and analysis techniques in VHE (very high energy) astrophysics, 3) multi-wavelength observations and phenomenology of sources, 4) the future of ground-based VHE astronomy, 5) developments in instrumentation for Cherenkov telescopes, and 6) the evolution of the field and its link with mainstream astrophysics.

  20. Design and expected performance of a novel hybrid detector for very-high-energy gamma-ray astrophysics

    Science.gov (United States)

    Assis, P.; Barres de Almeida, U.; Blanco, A.; Conceição, R.; D'Ettorre Piazzoli, B.; De Angelis, A.; Doro, M.; Fonte, P.; Lopes, L.; Matthiae, G.; Pimenta, M.; Shellard, R.; Tomé, B.

    2018-05-01

    Current detectors for Very-High-Energy γ-ray astrophysics are either pointing instruments with a small field of view (Cherenkov telescopes), or large field-of-view instruments with relatively large energy thresholds (extensive air shower detectors). In this article, we propose a new hybrid extensive air shower detector sensitive in an energy region starting from about 100 GeV. The detector combines a small water-Cherenkov detector, able to provide a calorimetric measurement of shower particles at ground, with resistive plate chambers which contribute significantly to the accurate shower geometry reconstruction. A full simulation of this detector concept shows that it is able to reach better sensitivity than any previous gamma-ray wide field-of-view experiment in the sub-TeV energy region. It is expected to detect with a 5σ significance a source fainter than the Crab Nebula in one year at 100 GeV and, above 1 TeV a source as faint as 10% of it. As such, this instrument is suited to detect transient phenomena making it a very powerful tool to trigger observations of variable sources and to detect transients coupled to gravitational waves and gamma-ray bursts.

  1. High energy astrophysics an introduction

    CERN Document Server

    Courvoisier, Thierry J -L

    2013-01-01

    High-energy astrophysics has unveiled a Universe very different from that only known from optical observations. It has revealed many types of objects in which typical variability timescales are as short as years, months, days, and hours (in quasars, X-ray binaries, and other objects), and even down to milli-seconds in gamma ray bursts. The sources of energy that are encountered are only very seldom nuclear fusion, and most of the time gravitation, a paradox when one thinks that gravitation is, by many orders of magnitude, the weakest of the fundamental interactions. The understanding of these objects' physical conditions and the processes revealed by high-energy astrophysics in the last decades is nowadays part of astrophysicists' culture, even of those active in other domains of astronomy. This book evolved from lectures given to master and PhD students at the University of Geneva since the early 1990s. It aims at providing astronomers and physicists intending to be active in high-energy astrophysics a broad...

  2. Probing the very-high-energy gamma-ray spectral curvature in the blazar PG 1553+113 with the MAGIC telescopes

    CERN Document Server

    Aleksić, J.; Antonelli, L A; Antoranz, P; Babic, A; Bangale, P; Barrio, J A; González, J Becerra; Bednarek, W; Bernardini, E; Biasuzzi, B; Biland, A; Blanch, O; Bonnefoy, S; Bonnoli, G; Borracci, F; Bretz, T; Carmona, E; Carosi, A; Colin, P; Colombo, E; Contreras, J.L; Cortina, J; Covino, S; Da Vela, P; Dazzi, F; De Angelis, A; De Caneva, G; De Lotto, B; Wilhelmi, E de Oña; Mendez, C Delgado; Prester, D Dominis; Dorner, D; Doro, M; Einecke, S; Eisenacher, D; Elsaesser, D; Fidalgo, D; Fonseca, M.V; Font, L; Frantzen, K; Fruck, C; Galindo, D; López, R J García; Garczarczyk, M; Terrats, D Garrido; Gaug, M; Godinović, N; Muñoz, A González; Gozzini, S R; Hadasch, D; Hanabata, Y; Hayashida, M; Herrera, J; Hose, J; Hrupec, D; Idec, W; Kadenius, V; Kellermann, H; Knoetig, M L; Kodani, K; Konno, Y; Krause, J; Kubo, H; Kushida, J; La Barbera, A; Lelas, D; Lewandowska, N; Lindfors, E; Lombardi, S; Longo, F; López, M; López-Coto, R; López-Oramas, A; Lorenz, E; Lozano, I; Makariev, M; Mallot, K; Maneva, G; Mannheim, K; Maraschi, L; Marcote, B; Mariotti, M; Martínez, M; Mazin, D; Menzel, U; Miranda, J M; Mirzoyan, R; Moralejo, A; Munar-Adrover, P; Nakajima, D; Neustroev, V; Niedzwiecki, A; Nilsson, K; Nishijima, K; Noda, K; Orito, R; Overkemping, A; Paiano, S; Palatiello, M; Paneque, D; Paoletti, R; Paredes, J M; Paredes-Fortuny, X; Persic, M; Poutanen, J; Moroni, P G Prada; Prandini, E; Puljak, I; Reinthal, R; Rhode, W; Ribó, M; Rico, J; Garcia, J Rodriguez; Rügamer, S; Saito, T; Saito, K; Satalecka, K; Scalzotto, V; Scapin, V; Schultz, C; Schweizer, T; Sillanpää, A; Sitarek, J; Snidaric, I; Sobczynska, D; Spanier, F; Stamerra, A; Steinbring, T; Storz, J; Strzys, M; Takalo, L; Takami, H; Tavecchio, F; Temnikov, P; Terzić, T; Tescaro, D; Teshima, M; Thaele, J; Tibolla, O; Torres, D F; Toyama, T; Treves, A; Vogler, P; Will, M; Zanin, R; D'Ammando, F; Lähteenmäki, A; Tornikoski, M; Hovatta, T; Readhead, A C S; Max-Moerbeck, W; Richards, J.L

    2015-01-01

    PG 1553+113 is a very-high-energy (VHE, E>100 GeV) gamma-ray emitter classified as a BL Lac object. Its redshift is constrained by intergalactic absorption lines in the range 0.40.2). The observed curvature is compatible with the extragalactic background light (EBL) imprint predicted by the current generation of EBL models assuming a redshift z~0.4. New constraints on the redshift were derived from the VHE spectrum. These constraints are compatible with previous limits and suggest that the source is most likely located around the optical lower limit, z=0.4. Finally, we find that the synchrotron self-Compton (SSC) model gives a satisfactory description of the observed multi-wavelength spectral energy distribution during the flare.

  3. High energy astrophysics. An introduction

    Energy Technology Data Exchange (ETDEWEB)

    Courvoisier, Thierry J.L. [Geneva Univ., Versoix (Switzerland). ISDC, Data Centre for Astrophysics

    2013-07-01

    Based on observational examples this book reveals and explains high-energy astrophysical processes. Presents the theory of astrophysical processes in a didactic approach by deriving equations step by step. With several attractive astronomical pictures. High-energy astrophysics has unveiled a Universe very different from that only known from optical observations. It has revealed many types of objects in which typical variability timescales are as short as years, months, days, and hours (in quasars, X-ray binaries, and other objects), and even down to milli-seconds in gamma ray bursts. The sources of energy that are encountered are only very seldom nuclear fusion, and most of the time gravitation, a paradox when one thinks that gravitation is, by many orders of magnitude, the weakest of the fundamental interactions. The understanding of these objects' physical conditions and the processes revealed by high-energy astrophysics in the last decades is nowadays part of astrophysicists' culture, even of those active in other domains of astronomy. This book evolved from lectures given to master and PhD students at the University of Geneva since the early 1990s. It aims at providing astronomers and physicists intending to be active in high-energy astrophysics a broad basis on which they should be able to build the more specific knowledge they will need. While in the first part of the book the physical processes are described and derived in detail, the second part studies astrophysical objects in which high-energy astrophysics plays a crucial role. This two-pronged approach will help students recognise physical processes by their observational signatures in contexts that may differ widely from those presented here.

  4. FERMI LAT OBSERVATIONS OF LS I +610303: FIRST DETECTION OF AN ORBITAL MODULATION IN GeV GAMMA RAYS

    International Nuclear Information System (INIS)

    Abdo, A. A.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Blandford, R.; Bloom, E. D.; Borgland, A. W.; Atwood, W. B.; Axelsson, M.; Baldini, L.; Bellazzini, R.; Bregeon, J.; Brez, A.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Baughman, B. M.; Bonamente, E.; Brigida, M.

    2009-01-01

    This Letter presents the first results from the observations of LS I +61 0 303 using Large Area Telescope data from the Fermi Gamma-Ray Space Telescope between 2008 August and 2009 March. Our results indicate variability that is consistent with the binary period, with the emission being modulated at 26.6 ± 0.5 days. This constitutes the first detection of orbital periodicity in high-energy gamma rays (20 MeV-100 GeV, HE). The light curve is characterized by a broad peak after periastron, as well as a smaller peak just before apastron. The spectrum is best represented by a power law with an exponential cutoff, yielding an overall flux above 100 MeV of 0.82 ± 0.03(stat) ± 0.07(syst) 10 -6 ph cm -2 s -1 , with a cutoff at 6.3 ± 1.1(stat) ± 0.4(syst) GeV and photon index Γ = 2.21 ± 0.04(stat) ± 0.06(syst). There is no significant spectral change with orbital phase. The phase of maximum emission, close to periastron, hints at inverse Compton scattering as the main radiation mechanism. However, previous very high-energy gamma ray (>100 GeV, VHE) observations by MAGIC and VERITAS show peak emission close to apastron. This and the energy cutoff seen with Fermi suggest that the link between HE and VHE gamma rays is nontrivial.

  5. Gamma-rays from decaying dark matter

    Energy Technology Data Exchange (ETDEWEB)

    Bertone, G. [Paris-6 Univ., 75 (France). Inst. d' Astrophysique; Buchmueller, W.; Covi, L.; Ibarra, A. [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany)

    2007-10-15

    We study the prospects for detecting gamma-rays from decaying Dark Matter (DM), focusing in particular on gravitino DM in R-parity breaking vacua. Given the substantially different angular distribution of the predicted gamma-ray signal with respect to the case of annihilating DM, and the relatively poor (of order 0.1 ) angular resolution of gamma-ray detectors, the best strategy for detection is in this case to look for an exotic contribution to the gamma-ray flux at high galactic latitudes, where the decaying DM contribution would resemble an astrophysical extragalactic component, similar to the one inferred by EGRET observations. Upcoming experiments such as GLAST and AMS-02 may identify this exotic contribution and discriminate it from astrophysical sources, or place significant constraints on the mass and lifetime of DM particles. (orig.)

  6. Very high energy gamma-ray astronomy with H.E.S.S. Development of a multivariate analysis and application to study of pulsar wind nebulae

    International Nuclear Information System (INIS)

    Dubois, Florent

    2009-01-01

    H.E.S.S. (High Energy Stereoscopic System) is one of the leading systems of four Imaging Atmospheric Cherenkov Telescopes that investigates very high energy (VHE) cosmic gamma-rays in the 100 GeV to 100 TeV energy range. H.E.S.S. is located in Namibia, near the Gamsberg mountain and operational since December 2003. The H.E.S.S. experiment is mainly aimed to the observation of the southern sky including the galactic plan and the numerous astrophysics sources therein. Three analysis methods have been developed using various properties of the electromagnetic showers generated by the interaction of primary cosmic gamma-rays within the Earth atmosphere. The first goal of this thesis was to combine the information from these methods for the selection and the energy and direction reconstruction of gamma-ray events. The new analysis called X eff improves significantly the quality of the selection and the precision of the reconstruction. This analysis has been afterwards applied to the study of pulsar wind nebulae like Vela X, G0.9+0.1 and MSH 15-52. New results were found concerning the source extension (Vela X) or spectral analysis (G0.9+0.1 and MSH 15-52) at TeV energies, thanks to additional data and to the improved efficiency of the new method. In 2010, a new phase will begin with the achievement of a fifth telescope dedicated to gamma-ray observation from tens GeV. The calibration processes of the photomultipliers equipping the camera of the new telescope, as well as the results of the tests, are also described in this thesis. (author)

  7. MAX: Development of a Laue diffraction lens for nuclear astrophysics

    International Nuclear Information System (INIS)

    Barriere, N.; Ballmoos, P. von; Skinner, G.; Smither, B.; Bastie, P.; Hinglais, E.; Abrosimov, N.; Alvarez, J.M.; Andersen, K.; Courtois, P.; Halloin, H.; Harris, M.; Isern, J.; Jean, P.; Knoedlseder, J.; Ubertini, P.; Vedrenne, G.; Weidenspointner, G.; Wunderer, C.

    2006-01-01

    The next generation of instrumentation for nuclear astrophysics will have to achieve an improvement in sensitivity by a factor of 10-100 over present technologies. With the focusing gamma-ray telescope MAX we take up this challenge and propose to combine the required sensitivity with high spectral and angular resolution, and the capability to measure the polarization of the photons. MAX is a space-borne crystal diffraction telescope, featuring a broad-band Laue lens optimized for the observation of compact sources in two wide energy bands of high astrophysical relevance. Gamma rays will be focused from the large collecting area of a crystal diffraction lens onto a very small detector volume. As a consequence, the signal to background ratio is greatly enhanced, leading to unprecedented sensitivities

  8. Exploring the Cosmic Frontier Astrophysical Instruments for the 21st Century

    CERN Document Server

    Lobanov, Andrei P; Cesarsky, Catherine; Diamond, Phillip J

    2007-01-01

    In the coming decades, astrophysical science will benefit enormously from the construction and operation of several major international ground- and space based facilities, such as ALMA, Herschel/Planck, and SKA in the far infrared to radio band, Extremely Large Telescopes, JWST and GAIA in the optical to near infrared regime, XEUS and Constellation-X in the X-ray, and GLAST in the Gamma-ray regime. These and other new instruments will have a major impact in a wide range of scientific topics including the cosmological epoch of reionization, galactic dynamics and nuclear activity, stellar astronomy, extra-solar planets, gamma-ray bursts, X-ray binaries, and many others. On May 18-21, 2004, the Max-Planck-Society’s Harnack-Haus in Dahlem, Berlin hosted the international symposium "Exploring the Cosmic Frontier: Astrophysical Instruments for the 21st Century". The symposium in Berlin was dedicated to exploring the complementarity and synergies between different branches of astrophysical research, by presenting ...

  9. Astrophysics of “Extreme” Solar-Like Stars

    Czech Academy of Sciences Publication Activity Database

    Caballero-García, María Dolores; Castro-Tirado, A.J.; Claret, A.; Gazeas, K.; Šimon, Vojtěch; Jelínek, Martin; Cwiek, A.; Zarnecki, A.F.; Oates, S.; Jeong, S.; Hudec, René

    2016-01-01

    Roč. 48, č. 2 (2016), s. 59-63 ISSN 1405-2059. [Workshop on Robotic Autonomous Observatories /4./. Malaga, 28.09.2015-02.10.2015] Grant - others:GA ČR(CZ) GA13-33324S Institutional support: RVO:67985815 Keywords : gamma-rays * observations * stars Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  10. DISCOVERY OF THE HARD SPECTRUM VHE γ-RAY SOURCE HESS J1641–463

    Energy Technology Data Exchange (ETDEWEB)

    Abramowski, A. [Institut für Experimentalphysik, Universität Hamburg, Luruper Chaussee 149, D-22761 Hamburg (Germany); Aharonian, F.; Ait Benkhali, F.; Bernlöhr, K. [Max-Planck-Institut für Kernphysik, PO Box 103980, D-69029 Heidelberg (Germany); Akhperjanian, A. G. [National Academy of Sciences of the Republic of Armenia, Marshall Baghramian Avenue, 24, 0019 Yerevan, Republic of Armenia (Armenia); Angüner, E. O.; Birsin, E. [Institut für Physik, Humboldt-Universität zu Berlin, Newtonstr. 15, D-12489 Berlin (Germany); Backes, M. [Department of Physics, University of Namibia, Private Bag 13301, Windhoek (Namibia); Balenderan, S. [Department of Physics, University of Durham, South Road, Durham DH1 3LE (United Kingdom); Balzer, A. [GRAPPA, Anton Pannekoek Institute for Astronomy, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Barnacka, A. [Obserwatorium Astronomiczne, Uniwersytet Jagielloński, ul. Orla 171, 30-244 Kraków (Poland); Becherini, Y. [Department of Physics and Electrical Engineering, Linnaeus University, 351 95 Växjö (Sweden); Becker Tjus, J. [Institut für Theoretische Physik, Lehrstuhl IV: Weltraum und Astrophysik, Ruhr-Universität Bochum, D-44780 Bochum (Germany); Berge, D. [GRAPPA, Anton Pannekoek Institute for Astronomy and Institute of High-Energy Physics, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Bernhard, S. [Institut für Astro- und Teilchenphysik, Leopold-Franzens-Universität Innsbruck, A-6020 Innsbruck (Austria); Biteau, J. [Laboratoire Leprince-Ringuet, Ecole Polytechnique, CNRS/IN2P3, F-91128 Palaiseau (France); Böttcher, M. [Centre for Space Research, North-West University, Potchefstroom 2520 (South Africa); Boisson, C., E-mail: sabrina.casanova@ifj.edu.pl, E-mail: sabrina.casanova@mpi-hd.mpg.de [LUTH, Observatoire de Paris, CNRS, Université Paris Diderot, 5 Place Jules Janssen, F-92190 Meudon (France); Collaboration: H.E.S.S. Collaboration; and others

    2014-10-10

    This Letter reports the discovery of a remarkably hard spectrum source, HESS J1641–463, by the High Energy Stereoscopic System (H.E.S.S.) in the very high energy (VHE) domain. HESS J1641–463 remained unnoticed by the usual analysis techniques due to confusion with the bright nearby source HESS J1640–465. It emerged at a significance level of 8.5 standard deviations after restricting the analysis to events with energies above 4 TeV. It shows a moderate flux level of φ(E>1 TeV) = (3.64 ± 0.44{sub stat} ± 0.73{sub sys}) × 10{sup –13} cm{sup –2} s{sup –1}, corresponding to 1.8% of the Crab Nebula flux above the same energy, and a hard spectrum with a photon index of Γ = 2.07 ± 0.11{sub stat} ± 0.20{sub sys}. It is a point-like source, although an extension up to a Gaussian width of σ = 3 arcmin cannot be discounted due to uncertainties in the H.E.S.S. point-spread function. The VHE γ-ray flux of HESS J1641–463 is found to be constant over the observed period when checking time binnings from the year-by-year to the 28 minute exposure timescales. HESS J1641–463 is positionally coincident with the radio supernova remnant SNR G338.5+0.1. No X-ray candidate stands out as a clear association; however, Chandra and XMM-Newton data reveal some potential weak counterparts. Various VHE γ-ray production scenarios are discussed. If the emission from HESS J1641–463 is produced by cosmic ray protons colliding with the ambient gas, then their spectrum must extend close to 1 PeV. This object may represent a source population contributing significantly to the galactic cosmic ray flux around the knee.

  11. CZT drift strip detectors for high energy astrophysics

    DEFF Research Database (Denmark)

    Kuvvetli, Irfan; Budtz-Jørgensen, Carl; Caroli, E.

    2010-01-01

    Requirements for X- and gamma ray detectors for future High Energy Astrophysics missions include high detection efficiency and good energy resolution as well as fine position sensitivity even in three dimensions.We report on experimental investigations on the CZT drift detector developed DTU Space...

  12. Gamma-Ray Lenses for Astrophysics-and the Gamma-Ray Imager Mission GRI

    DEFF Research Database (Denmark)

    Wunderer, C. B.; Ballmoos, P. V.; Barriere, N.

    2009-01-01

    Observations of the gamma-ray sky reveal the most powerful sources and the most violent events in the Universe. While at lower wavebands the observed emission is generally dominated by thermal processes, the gamma-ray sky provides us with a view on the non-thermal Universe. Here particles are acc...

  13. Exploring the cosmic frontier. Astrophysical instruments for the 21st century

    International Nuclear Information System (INIS)

    Lobanov, A.P.; Zensus, J.A.; Cesarsky, C.; Diamond, P.

    2007-01-01

    In the coming decades, astrophysical science will benefit enormously from the construction and operation of several major international ground- and space based facilities, such as ALMA, Herschel/Planck, and SKA in the far infrared to radio band, Extremely Large Telescopes, JWST and GAIA in the optical to near infrared regime, XEUS and Constellation-X in the X-ray, and GLAST in the Gamma-ray regime. These and other new instruments will have a major impact in a wide range of scientific topics including the cosmological epoch of reionization, galactic dynamics and nuclear activity, stellar astronomy, extra-solar planets, gamma-ray bursts, X-ray binaries, and many others. On May 18-21, 2004, the Max-Planck-Society's Harnack-Haus in Dahlem, Berlin hosted the international symposium ''Exploring the Cosmic Frontier: Astrophysical Instruments for the 21st Century''. The symposium in Berlin was dedicated to exploring the complementarity and synergies between different branches of astrophysical research, by presenting and discussing the fundamental scientific problems that will be addressed by major future astrophysical facilities in the next few decades. This book contains 70 papers from the meeting and is intended to give a lasting account of a snapshot of an evolving scientific discourse and interaction throughout our field of research. (orig.)

  14. Effect of stars in the field of view of the VHE gamma-ray atmospheric Cherenkov telescope

    International Nuclear Information System (INIS)

    Badran, H.M.

    2004-01-01

    Very high energy gamma-ray astronomy in the energy range above 100 GeV has made dramatic progress through the development of imaging atmospheric Cherenkov telescopes (lACTs). The technique has been pivotal in the establishing the existence of a number of discrete gamma-ray sources. Normally due to the presence of stars in the field of view (FOV), a number of photomultiplier tubes (pmts) in the camera has to be turned off. This may have the effect of distorting some images that happens to be in that part of the camera. This may in turn affect the gamma-ray sensitivity of the telescope. The present study aims to shade some light on this possible effect. Experimental data on the extragalactic gamma-ray source Mrk 421 measured using the 10-m Whipple IACT were used for this purpose because of its relative dark FOV compared with other sources; e.g. the Crab nebula. To simulate the presence of star(s) in the FOV, the analysis program selects randomly a number of clusters of pmts to be turned off in the software. The pmts in each cluster have to be adjacent to each other (neighbors) and the selected clusters have to be separated from each other. The significance of the detected signal and the gamma-ray rate were then determined and compared with the original results. Clusters of 2, 3 and 4 pmts were used. The number of clusters was increased up to 12 clusters at various distances from the center of the FOV

  15. VI European Summer School on Experimental Nuclear Astrophysics

    Science.gov (United States)

    The European Summer School on Experimental Nuclear Astrophysics has reached the sixth edition, marking the tenth year's anniversary. The spirit of the school is to provide a very important occasion for a deep education of young researchers about the main topics of experimental nuclear astrophysics. Moreover, it should be regarded as a forum for the discussion of the last-decade research activity. Lectures are focused on various aspects of primordial and stellar nucleosynthesis, including novel experimental approaches and detectors, indirect methods and radioactive ion beams. Moreover, in order to give a wide educational offer, some lectures cover complementary subjects of nuclear astrophysics such as gamma ray astronomy, neutron-induced reactions, short-lived radionuclides, weak interaction and cutting-edge facilities used to investigate nuclear reactions of interest for astrophysics. Large room is also given to young researcher oral contributions. Traditionally, particular attention is devoted to the participation of students from less-favoured countries, especially from the southern coast of the Mediterranean Sea. The school is organised by the Catania Nuclear Astrophysics research group with the collaboration of Dipartimento di Fisica e Astromomia - Università di Catania and Laboratori Nazionali del Sud - Istituto Nazionale di Fisica Nucleare.

  16. ASTROPHYSICAL PARAMETERS OF LS 2883 AND IMPLICATIONS FOR THE PSR B1259-63 GAMMA-RAY BINARY

    International Nuclear Information System (INIS)

    Negueruela, Ignacio; Lorenzo, Javier; Ribo, Marc; Herrero, Artemio; Khangulyan, Dmitry; Aharonian, Felix A.

    2011-01-01

    Only a few binary systems with compact objects display TeV emission. The physical properties of the companion stars represent basic input for understanding the physical mechanisms behind the particle acceleration, emission, and absorption processes in these so-called gamma-ray binaries. Here we present high-resolution and high signal-to-noise optical spectra of LS 2883, the Be star forming a gamma-ray binary with the young non-accreting pulsar PSR B1259-63, showing it to rotate faster and be significantly earlier and more luminous than previously thought. Analysis of the interstellar lines suggests that the system is located at the same distance as (and thus is likely a member of) Cen OB1. Taking the distance to the association, d = 2.3 kpc, and a color excess of E(B - V) = 0.85 for LS 2883 results in M V ∼ -4.4. Because of fast rotation, LS 2883 is oblate (R eq ≅ 9.7 R sun and R pole ≅ 8.1 R sun ) and presents a temperature gradient (T eq ∼ 27,500 K, log g eq = 3.7; T pole ∼ 34,000 K, log g pole = 4.1). If the star did not rotate, it would have parameters corresponding to a late O-type star. We estimate its luminosity at log(L * /L sun ) ≅ 4.79 and its mass at M * ∼ 30 M sun . The mass function then implies an inclination of the binary system i orb ∼ 23 0 , slightly smaller than previous estimates. We discuss the implications of these new astrophysical parameters of LS 2883 for the production of high-energy and very high-energy gamma rays in the PSR B1259-63/LS 2883 gamma-ray binary system. In particular, the stellar properties are very important for prediction of the line-like bulk Comptonization component from the unshocked ultrarelativistic pulsar wind.

  17. TEV GAMMA-RAY OBSERVATIONS OF THE GALACTIC CENTER RIDGE BY VERITAS

    Energy Technology Data Exchange (ETDEWEB)

    Archer, A.; Buckley, J. H.; Bugaev, V. [Department of Physics, Washington University, St. Louis, MO 63130 (United States); Benbow, W.; Cerruti, M. [Fred Lawrence Whipple Observatory, Harvard-Smithsonian Center for Astrophysics, Amado, AZ 85645 (United States); Bird, R.; Collins-Hughes, E. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Buchovecky, M. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Byrum, K. [Argonne National Laboratory, 9700 S. Cass Avenue, Argonne, IL 60439 (United States); Cardenzana, J. V; Eisch, J. D. [Department of Physics and Astronomy, Iowa State University, Ames, IA 50011 (United States); Chen, X. [Institute of Physics and Astronomy, University of Potsdam, D-14476 Potsdam-Golm (Germany); Ciupik, L. [Astronomy Department, Adler Planetarium and Astronomy Museum, Chicago, IL 60605 (United States); Connolly, M. P. [School of Physics, National University of Ireland Galway, University Road, Galway (Ireland); Falcone, A. [Department of Astronomy and Astrophysics, 525 Davey Lab, Pennsylvania State University, University Park, PA 16802 (United States); Feng, Q.; Finley, J. P. [Department of Physics and Astronomy, Purdue University, West Lafayette, IN 47907 (United States); Fleischhack, H. [DESY, Platanenallee 6, D-15738 Zeuthen (Germany); Flinders, A. [Department of Physics and Astronomy, University of Utah, Salt Lake City, UT 84112 (United States); Fortson, L., E-mail: asmith44@umd.edu [School of Physics and Astronomy, University of Minnesota, Minneapolis, MN 55455 (United States); and others

    2016-04-20

    The Galactic Center ridge has been observed extensively in the past by both GeV and TeV gamma-ray instruments revealing a wealth of structure, including a diffuse component and the point sources G0.9+0.1 (a composite supernova remnant) and Sgr A* (believed to be associated with the supermassive black hole located at the center of our Galaxy). Previous very high energy (VHE) gamma-ray observations with the H.E.S.S. experiment have also detected an extended TeV gamma-ray component along the Galactic plane in the >300 GeV gamma-ray regime. Here we report on observations of the Galactic Center ridge from 2010 to 2014 by the VERITAS telescope array in the >2 TeV energy range. From these observations we (1) provide improved measurements of the differential energy spectrum for Sgr A* in the >2 TeV gamma-ray regime, (2) provide a detection in the >2 TeV gamma-ray emission from the composite SNR G0.9+0.1 and an improved determination of its multi-TeV gamma-ray energy spectrum, and (3) report on the detection of VER J1746-289, a localized enhancement of >2 TeV gamma-ray emission along the Galactic plane.

  18. Astrophysics a new approach

    CERN Document Server

    Kundt, Wolfgang

    2005-01-01

    For a quantitative understanding of the physics of the universe - from the solar system through the milky way to clusters of galaxies all the way to cosmology - these edited lecture notes are perhaps among the most concise and also among the most critical ones: Astrophysics has not yet stood the redundancy test of laboratory physics, hence should be wary of early interpretations. Special chapters are devoted to magnetic and radiation processes, supernovae, disks, black-hole candidacy, bipolar flows, cosmic rays, gamma-ray bursts, image distortions, and special sources. At the same time, planet earth is viewed as the arena for life, with plants and animals having evolved to homo sapiens during cosmic time. -- This text is unique in covering the basic qualitative and quantitative tools, formulae as well as numbers, needed for the precise interpretation of frontline phenomena in astrophysical research. The author compares mainstream interpretations with new and even controversial ones he wishes to emphasize. The...

  19. The high intensity {gamma}-ray source (HI{gamma}S) and recent results

    Energy Technology Data Exchange (ETDEWEB)

    Tonchev, A.P. [Duke University and TUNL, Triangle University Nuclear Laboratory, P.O. Box 90308, Durham, NC 27708 0308 (United States)]. E-mail: tonchev@tunl.duke.edu; Boswell, M. [University of North Carolina at Chapel Hill and TUNL, Chapel Hill, NC 27599 (United States); Howell, C.R. [Duke University and TUNL, Triangle University Nuclear Laboratory, P.O. Box 90308, Durham, NC 27708 0308 (United States); Karwowski, H.J. [University of North Carolina at Chapel Hill and TUNL, Chapel Hill, NC 27599 (United States); Kelley, J.H. [North Carolina State University and TUNL, Raleigh, NC 27695 (United States); Tornow, W. [Duke University and TUNL, Triangle University Nuclear Laboratory, P.O. Box 90308, Durham, NC 27708 0308 (United States); Wu, Y.K. [Duke University and Duke Free Electron Laser Laboratory, Durham, NC 27708-0319 (United States)

    2005-12-15

    The high intensity {gamma}-ray source (HI{gamma}S) utilizes intra-cavity backscattering of free electron laser photons from the Duke electron storage ring to produce a unique monoenergetic beam of high-flux {gamma}-rays with high polarization and selectable energy resolution. At present, {gamma}-ray beams with energies from 2 to 58 MeV are available with intensities as high as 10{sup 5}-5 x 10{sup 6} {gamma}/s, energy spreads of 3% or better, and nearly 100% linear polarization. The quality and intensity of the {gamma}-ray beams at HI{gamma}S are responsible for the unprecedented performance of this facility in a broad range of research programs in nuclear structure, nuclear astrophysics and nuclear applications. Recent results from excitation of isomeric states in ({gamma}, n) reactions and parity assignments of dipole states determined via the ({gamma}, {gamma}') reaction are presented.

  20. Gamma-Ray Astronomy Technology Needs

    Science.gov (United States)

    Gehrels, N.; Cannizzo, J. K.

    2012-01-01

    In recent decades gamma-ray observations have become a valuable tool for studying the universe. Progress made in diverse 8re1lS such as gamma-ray bursts (GRBs), nucleosynthesis, and active galactic nuclei (AGNs) has complimented and enriched our astrophysical understanding in many ways. We present an overview of current and future planned space y-ray missions and discussion technology needs for- the next generation of space gamma-ray instruments.

  1. The Advanced Gamma-Ray Imaging System (AGIS)

    Science.gov (United States)

    Otte, Nepomuk

    The Advanced Gamma-ray Imaging System (AGIS) is a concept for the next generation of imag-ing atmospheric Cherenkov telescope arrays. It has the goal of providing an order of magnitude increase in sensitivity for Very High Energy Gamma-ray ( 100 GeV to 100 TeV) astronomy compared to currently operating arrays such as CANGAROO, HESS, MAGIC, and VERITAS. After an overview of the science such an array would enable, we discuss the development of the components of the telescope system that are required to achieve the sensitivity goal. AGIS stresses improvements in several areas of IACT technology including component reliability as well as exploring cost reduction possibilities in order to achieve its goal. We discuss alterna-tives for the telescopes and positioners: a novel Schwarzschild-Couder telescope offering a wide field of view with a relatively smaller plate scale, and possibilities for rapid slewing in order to address the search for and/or study of Gamma-ray Bursts in the VHE gamma-ray regime. We also discuss options for a high pixel count camera system providing the necessary finer solid angle per pixel and possibilities for a fast topological trigger that would offer improved realtime background rejection and lower energy thresholds.

  2. Discovery of a point-like very-high-energy gamma-ray source in Monoceros

    International Nuclear Information System (INIS)

    Aharonian, F.A.; Benbow, W.; Berge, D.; Bernlohr, K.; Bolz, O.; Braun, I.; Buhler, R.; Carrigan, S.; Costamante, L.; Domainko, W.; Egberts, K.; Forster, A.; Funk, S.; Hauser, D.; Hermann, G.; Hinton, J.A.; Hofmann, W.; Hoppe, S.; Khelifi, B.; Kosack, K.; Masterson, C.; Panter, M.; Rowell, G.; van Eldik, C.; Volk, H.J.; Akhperjanian, A.G.; Sahakian, V.; Bazer-Bachi, A.R.; Borrel, V.; Marcowith, A.; Olive, J.P.; Beilicke, M.; Cornils, R.; Heinzelmann, G.; Raue, M.; Ripken, J.; Bernlohr, K.; Funk, Seb.; Fussling, M.; Kerschhaggl, M.; Lohse, T.; Schlenker, S.; Schwanke, U.; Boisson, C.; Martin, J.M.; Sol, H.; Brion, E.; Glicenstein, J.F.; Goret, P.; Moulin, E.; Rolland, L.

    2007-01-01

    Aims. The complex Monoceros Loop SNR/Rosette Nebula region contains several potential sources of very-high-energy (VHE) γ-ray emission and two as yet unidentified high-energy EGRET sources. Sensitive VHE observations are required to probe acceleration processes in this region. Methods. The HESS telescope array has been used to search for very high-energy gamma-ray sources in this region. CO data from the NANTEN telescope were used to map the molecular clouds in the region, which could act as target material for γ-ray production via hadronic interactions. Results. We announce the discovery of a new γ-ray source, HESS J0632+057, located close to the rim of the Monoceros SNR. This source is unresolved by HESS and has no clear counterpart at other wavelengths but is possibly associated with the weak X-ray source 1RXS J063258.3+054857, the Be-star MWC148 and/or the lower energy γ-ray source 3EGJ0634+0521. No evidence for an associated molecular cloud was found in the CO data. (authors)

  3. Broad Band Observations of Gravitationally Lensed Blazar during a Gamma-Ray Outburst

    Directory of Open Access Journals (Sweden)

    Julian Sitarek

    2016-09-01

    Full Text Available QSO B0218+357 is a gravitationally lensed blazar located at a cosmological redshift of 0.944. In July 2014 a GeV flare was observed by Fermi-LAT, triggering follow-up observations with the MAGIC telescopes at energies above 100 GeV. The MAGIC observations at the expected time of arrival of the trailing component resulted in the first detection of QSO B0218+357 in Very-High-Energy (VHE, >100 GeV gamma rays. We report here the observed multiwavelength emission during the 2014 flare.

  4. AGIS -- the Advanced Gamma-ray Imaging System

    Science.gov (United States)

    Krennrich, Frank

    2009-05-01

    The Advanced Gamma-ray Imaging System, AGIS, is envisioned to become the follow-up mission of the current generation of very high energy gamma-ray telescopes, namely, H.E.S.S., MAGIC and VERITAS. These instruments have provided a glimpse of the TeV gamma-ray sky, showing more than 70 sources while their detailed studies constrain a wealth of physics and astrophysics. The particle acceleration, emission and absorption processes in these sources permit the study of extreme physical conditions found in galactic and extragalactic TeV sources. AGIS will dramatically improve the sensitivity and angular resolution of TeV gamma-ray observations and therefore provide unique prospects for particle physics, astrophysics and cosmology. This talk will provide an overview of the science drivers, scientific capabilities and the novel technical approaches that are pursued to maximize the performance of the large array concept of AGIS.

  5. Statistical gamma-ray emission of gold and its astrophysical implications

    Directory of Open Access Journals (Sweden)

    Giacoppo F.

    2014-03-01

    Full Text Available The properties of the excited states of gold isotopes were investigated at the Oslo Cyclotron Laboratory. This study is important for the understanding of neutron capture rates in astrophysical plasmas relevant for heavy element nucleosynthesys.

  6. A holistic view of unstable dark matter. Spectral and anisotropy signatures in astrophysical backgrounds

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Le

    2010-11-15

    The nature of dark matter is one of the key outstanding problems in both particle and astrophysics. If dark matter decays or annihilates into electrons and positrons, it can affect diffuse radiation backgrounds observed in astrophysics. In this thesis, we propose a new, more general analysis of constraints on dark matter models. For any decaying dark matter model, constraints on mass and lifetime can be obtained by folding the specific dark matter decay spectrum with a response function. We derive these response functions from full-sky radio surveys and Fermi-LAT gamma-ray observations as well as from the local positron fluxes measured by the PAMELA satellite experiment and apply them to place constraints on some specific dark matter decay models. We also discuss the influence of astrophysical uncertainties on the response function, such as the uncertainties from propagation models and from the spatial distribution of the dark matter. Moreover, an anisotropy analysis of full-sky emission gamma-ray and radio maps is performed to identify possible signatures of annihilating dark matter. We calculate angular power spectra of the cosmological background of synchrotron emission from dark matter annihilations into electron positron pairs. We compare the power spectra with the anisotropy of astrophysical and cosmological radio backgrounds, from normal galaxies, radio-galaxies, galaxy cluster accretion shocks, the cosmic microwave background and Galactic foregrounds. In addition, we develop a numerical tool to compute gamma-ray emission from such electrons and positrons diffusing in the smooth host halo and in substructure halos with masses down to 10{sup -6}M{sub s}un. We show that, unlike the total gamma-ray angular power spectrum observed by Fermi-LAT, the angular power spectrum from the inverse Compton scattering is exponentially suppressed below an angular scale determined by the diffusion length of electrons and positrons. (orig.)

  7. A holistic view of unstable dark matter. Spectral and anisotropy signatures in astrophysical backgrounds

    International Nuclear Information System (INIS)

    Zhang, Le

    2010-11-01

    The nature of dark matter is one of the key outstanding problems in both particle and astrophysics. If dark matter decays or annihilates into electrons and positrons, it can affect diffuse radiation backgrounds observed in astrophysics. In this thesis, we propose a new, more general analysis of constraints on dark matter models. For any decaying dark matter model, constraints on mass and lifetime can be obtained by folding the specific dark matter decay spectrum with a response function. We derive these response functions from full-sky radio surveys and Fermi-LAT gamma-ray observations as well as from the local positron fluxes measured by the PAMELA satellite experiment and apply them to place constraints on some specific dark matter decay models. We also discuss the influence of astrophysical uncertainties on the response function, such as the uncertainties from propagation models and from the spatial distribution of the dark matter. Moreover, an anisotropy analysis of full-sky emission gamma-ray and radio maps is performed to identify possible signatures of annihilating dark matter. We calculate angular power spectra of the cosmological background of synchrotron emission from dark matter annihilations into electron positron pairs. We compare the power spectra with the anisotropy of astrophysical and cosmological radio backgrounds, from normal galaxies, radio-galaxies, galaxy cluster accretion shocks, the cosmic microwave background and Galactic foregrounds. In addition, we develop a numerical tool to compute gamma-ray emission from such electrons and positrons diffusing in the smooth host halo and in substructure halos with masses down to 10 -6 M s un. We show that, unlike the total gamma-ray angular power spectrum observed by Fermi-LAT, the angular power spectrum from the inverse Compton scattering is exponentially suppressed below an angular scale determined by the diffusion length of electrons and positrons. (orig.)

  8. Observing with a space-borne gamma-ray telescope: selected results from INTEGRAL

    International Nuclear Information System (INIS)

    Schanne, Stephane

    2006-01-01

    The International Gamma-Ray Astrophysics Laboratory, i.e. the INTEGRAL satellite of ESA, in orbit since about 3 years, performs gamma-ray observations of the sky in the 15 keV to 8 MeV energy range. Thanks to its imager IBIS, and in particular the ISGRI detection plane based on 16384 CdTe pixels, it achieves an excellent angular resolution (12 arcmin) for point source studies with good continuum spectrum sensitivity. Thanks to its spectrometer SPI, based on 19 germanium detectors maintained at 85 K by a cryogenic system, located inside an active BGO veto shield, it achieves excellent spectral resolution of about 2 keV for 1 MeV photons, which permits astrophysical gamma-ray line studies with good narrow-line sensitivity. In this paper we review some goals of gamma-ray astronomy from space and present the INTEGRAL satellite, in particular its instruments ISGRI and SPI. Ground and in-flight calibration results from SPI are presented, before presenting some selected astrophysical results from INTEGRAL. In particular results on point source searches are presented, followed by results on nuclear astrophysics, exemplified by the study of the 1809 keV gamma-ray line from radioactive 26 Al nuclei produced by the ongoing stellar nucleosynthesis in the Galaxy. Finally a review on the study of the positron-electron annihilation in the Galactic center region, producing 511 keV gamma-rays, is presented

  9. Goddard's Astrophysics Science Divsion Annual Report 2014

    Science.gov (United States)

    Weaver, Kimberly (Editor); Reddy, Francis (Editor); Tyler, Pat (Editor)

    2015-01-01

    The Astrophysics Science Division (ASD, Code 660) is one of the world's largest and most diverse astronomical organizations. Space flight missions are conceived, built and launched to observe the entire range of the electromagnetic spectrum, from gamma rays to centimeter waves. In addition, experiments are flown to gather data on high-energy cosmic rays, and plans are being made to detect gravitational radiation from space-borne missions. To enable these missions, we have vigorous programs of instrument and detector development. Division scientists also carry out preparatory theoretical work and subsequent data analysis and modeling. In addition to space flight missions, we have a vibrant suborbital program with numerous sounding rocket and balloon payloads in development or operation. The ASD is organized into five labs: the Astroparticle Physics Lab, the X-ray Astrophysics Lab, the Gravitational Astrophysics Lab, the Observational Cosmology Lab, and the Exoplanets and Stellar Astrophysics Lab. The High Energy Astrophysics Science Archive Research Center (HEASARC) is an Office at the Division level. Approximately 400 scientists and engineers work in ASD. Of these, 80 are civil servant scientists, while the rest are resident university-based scientists, contractors, postdoctoral fellows, graduate students, and administrative staff. We currently operate the Swift Explorer mission and the Fermi Gamma-ray Space Telescope. In addition, we provide data archiving and operational support for the XMM mission (jointly with ESA) and the Suzaku mission (with JAXA). We are also a partner with Caltech on the NuSTAR mission. The Hubble Space Telescope Project is headquartered at Goddard, and ASD provides Project Scientists to oversee operations at the Space Telescope Science Institute. Projects in development include the Neutron Interior Composition Explorer (NICER) mission, an X-ray timing experiment for the International Space Station; the Transiting Exoplanet Sky Survey (TESS

  10. Magnetic Reconnection in Extreme Astrophysical Environments

    Science.gov (United States)

    Uzdensky, Dmitri

    Magnetic reconnection is a fundamental plasma physics process of breaking ideal-MHD's frozen-in constraints on magnetic field connectivity and of dramatic rearranging of the magnetic topol-ogy, which often leads to a violent release of the free magnetic energy. Reconnection has long been acknowledged to be of great importance in laboratory plasma physics (magnetic fusion) and in space and solar physics (responsible for solar flares and magnetospheric substorms). In addition, its importance in Astrophysics has been increasingly recognized in recent years. However, due to a great diversity of astrophysical environments, the fundamental physics of astrophysical magnetic reconnection can be quite different from that of the traditional recon-nection encountered in the solar system. In particular, environments like the solar corona and the magnetosphere are characterized by relatively low energy densities, where the plasma is ad-equately described as a mixture of electrons and ions whose numbers are conserved and where the dissipated magnetic energy basically stays with the plasma. In contrast, in many high-energy astrophysical phenomena the energy density is so large that photons play as important a role as electrons and ions and, in particular, radiation pressure and radiative cooling become dominant. In this talk I focus on the most extreme case of high-energy-density astrophysical reconnec-tion — reconnection of magnetar-strength (1014 - 1015 Gauss) magnetic fields, important for giant flares in soft-gamma repeaters (SGRs), and for rapid magnetic energy release in either the central engines or in the relativistic jets of Gamma Ray Bursts (GRBs). I outline the key relevant physical processes and present a new theoretical picture of magnetic reconnection in these environments. The corresponding magnetic energy density is so enormous that, when suddenly released, it inevitably heats the plasma to relativistic temperatures, resulting in co-pious production of electron

  11. Constraints on a Proton Synchrotron Origin of VHE Gamma Rays from the Extended Jet of AP Librae

    Energy Technology Data Exchange (ETDEWEB)

    Basumallick, Partha Pratim; Gupta, Nayantara, E-mail: basuparth314@gmail.com [Raman Research Institute, C. V. Raman Avenue, Sadashivanagar, Bangalore 560080 (India)

    2017-07-20

    The multiwavelength photon spectrum from the BL Lac object AP Librae extends from radio to TeV gamma rays. The X-ray to very high-energy gamma-ray emission from the extended jet of this source has been modeled with inverse Compton (IC) scattering of relativistic electrons off the cosmic microwave background (CMB) photons. The IC/CMB model requires the kpc-scale extended jet to be highly collimated with a bulk Lorentz factor close to 10. Here we discuss the possibility of a proton synchrotron origin of X-rays and gamma rays from the extended jet with a bulk Lorentz factor of 3. This scenario requires an extreme proton energy of 3.98 × 10{sup 21} eV and a high magnetic field of 1 mG of the extended jet with jet power ∼5 × 10{sup 48} erg s{sup −1} in particles and the magnetic field (which is more than 100 times the Eddington luminosity of AP Librae) to explain the very high-energy gamma-ray emission. Moreover, we have shown that X-ray emission from the extended jets of 3C 273 and PKS 0637-752 could be possible by proton synchrotron emission with jet power comparable to the Eddington luminosities.

  12. Constraints on particle acceleration in SS433/W50 from MAGIC and H.E.S.S. observations

    OpenAIRE

    MAGIC Collaboration; Ahnen, M. L.; Ansoldi, S.; Antonelli, L. A.; Arcaro, C.; Babić, A.; Banerjee, B.; Bangale, P.; de Almeida, U. Barres; Barrio, J. A.; González, J. Becerra; Bednarek, W.; Bernardini, E.; Berti, A.; Biasuzzi, B.

    2017-01-01

    The large jet kinetic power and non-thermal processes occurring in the microquasar SS 433 make this source a good candidate for a very high-energy (VHE) gamma-ray emitter. Gamma-ray fluxes have been predicted for both the central binary and the interaction regions between jets and surrounding nebula. Also, non-thermal emission at lower energies has been previously reported. We explore the capability of SS 433 to emit VHE gamma rays during periods in which the expected flux attenuation due to ...

  13. DISCOVERY OF VERY HIGH ENERGY GAMMA RAYS FROM PKS 1424+240 AND MULTIWAVELENGTH CONSTRAINTS ON ITS REDSHIFT

    International Nuclear Information System (INIS)

    Acciari, V. A.; Benbow, W.; Aliu, E.; Boltuch, D.; Arlen, T.; Chow, Y. C.; Aune, T.; Bautista, M.; Cogan, P.; Beilicke, M.; Buckley, J. H.; Bugaev, V.; Boettcher, M.; Bradbury, S. M.; Byrum, K.; Cannon, A.; Cesarini, A.; Ciupik, L.; Cui, W.; Duke, C.

    2010-01-01

    We report the first detection of very high energy 83 Gamma-ray emission above 100 GeV. (VHE) gamma-ray emission above 140 GeV from PKS 1424+240, a BL Lac object with an unknown redshift. The photon spectrum above 140 GeV measured by VERITAS is well described by a power law with a photon index of 3.8 ± 0.5 stat ± 0.3 syst and a flux normalization at 200 GeV of (5.1 ± 0.9 stat ± 0.5 syst ) x 10 -11 TeV -1 cm -2 s -1 , where stat and syst denote the statistical and systematical uncertainties, respectively. The VHE flux is steady over the observation period between MJD 54881 and 55003 (from 2009 February 19 to June 21). Flux variability is also not observed in contemporaneous high-energy observations with the Fermi Large Area Telescope. Contemporaneous X-ray and optical data were also obtained from the Swift XRT and MDM observatory, respectively. The broadband spectral energy distribution is well described by a one-zone synchrotron self-Compton model favoring a redshift of less than 0.1. Using the photon index measured with Fermi in combination with recent extragalactic background light absorption models it can be concluded from the VERITAS data that the redshift of PKS 1424+240 is less than 0.66.

  14. Gamma-ray bursts

    CERN Document Server

    Wijers, Ralph A M J; Woosley, Stan

    2012-01-01

    Cosmic gamma ray bursts (GRBs) have fascinated scientists and the public alike since their discovery in the late 1960s. Their story is told here by some of the scientists who participated in their discovery and, after many decades of false starts, solved the problem of their origin. Fourteen chapters by active researchers in the field present a detailed history of the discovery, a comprehensive theoretical description of GRB central engine and emission models, a discussion of GRB host galaxies and a guide to how GRBs can be used as cosmological tools. Observations are grouped into three sets from the satellites CGRO, BeppoSAX and Swift, and followed by a discussion of multi-wavelength observations. This is the first edited volume on GRB astrophysics that presents a fully comprehensive review of the subject. Utilizing the latest research, Gamma-ray Bursts is an essential desktop companion for graduate students and researchers in astrophysics.

  15. Gamma-ray imaging. Applications in nuclear non-proliferation and homeland security

    International Nuclear Information System (INIS)

    Vetter, Kai; Mihailescu, Lucian

    2010-01-01

    This paper provides the motivation and describes implementations of gamma-ray imaging for homeland security applications and more general for national and international nuclear security. As in nuclear medicine and astrophysics, the goal of gamma-ray imaging is the detection and localization of nuclear materials, however, here in a terrestrial environment with distances between nuclear medicine and astrophysics, i.e. in the range of 1-100 meters. Due to the recently increased threat of nuclear terrorism, the detection of illicit nuclear materials and the prevention of nuclear proliferation through the development of advanced gamma-ray imaging concepts and technologies has become and active research field. (author)

  16. Very high energy gamma ray astrophysics

    International Nuclear Information System (INIS)

    Lamb, R.C.; Lewis, D.A.

    1990-02-01

    Our scientific goal is to discover and study by means of gamma-ray astronomy those regions of the universe where particles are accelerated to extreme energies. The atmospheric Cherenkov technique provides a unique and potentially sensitive window in the region of 10 11 to approximately 10 14 eV for this purpose. The Whipple Observatory Collaboration is currently engaged in the development of a Cherenkov camera which has the ultimate capability of distinguishing gamma-ray showers from the numerous cosmic-ray background showers by imaging the Cherenkov light from each shower. We have recently demonstrated the potential of the imaging technique with our 18 sigma detection of TeV photons from the Crab Nebula using a camera of 10 elements, pixel spacing 0.25 degrees. This detection represents a factor of 10 improvement in sensitivity compared to a non-imaging detector. The next step in the development of the detector is to obtain a second large reflector, similar to the present 10 meter instrument, for stereoscopic viewing of showers. This project, named GRANITE, is now approved by DOE. With GRANITE it should be possible to probe more deeply in space by a factor of 7, and to fully investigate the possibility of new physics which has been suggested by reports of anomalous radiation from Hercules X-1. 18 refs

  17. Very high energy gamma ray astrophysics

    International Nuclear Information System (INIS)

    Lamb, R.C.; Lewis, D.A.

    1986-01-01

    The Whipple Observatory's atmospheric Cerenkov camera has detected TeV radiation from four galactic sources: the Crab Nebula, Cygnus X-3, Hercules X-1, and 4U0115+63. Recent simulations encourage the view that unwanted cosmic-ray background showers may be suppressed by a large factor. Emphasis in the coming year will be on determining optimum selection criteria for enhancing gamma-ray signals and in developing a prototype camera with finer angular resolution as a first step towards implementation of the HERCULES concept

  18. A new method for the reconstruction of very-high-energy gamma-ray spectra and application to galatic cosmic-ray accelerators

    Energy Technology Data Exchange (ETDEWEB)

    Fernandes, Milton Virgilio

    2014-09-15

    previously reported, but unidentified extended TeV γ-ray source HESSJ1614-518. Unpublished H.E.S.S. data and archival multi-wavelength (MWL) data (radio, X-ray, and He data) as well various astrophysical objects in the FoV were investigated in search of a counterpart. The energy-dependent TeV morphology (with at least two source regions) can hardly be reconciled with the MWL data. A SC-wind scenario appears unlikely and the FoV lacks plausible counterpart, but a relic pulsar wind nebula could explain the lack of prominent X-ray emission. The VHE γ-ray source remains unidentified. The analysis of unpublished H.E.S.S. data on the SFR the Gould Belt (GB) did not provide any firm evidence of VHE γ-ray emission, and upper limits on the flux and the cosmic-ray enhancement were derived. The analysis of current IACTs. Towards Orion A, a possible discovery of extended VHE γ rays with flux of 10.8 % of the Crab Nebula is found with TBS, but cannot be confirmed and could be an artifact od the analysis of this region. Observations with the H.E.S.S. telescope system motivate that SCs and SFRs can accelerate GCRs. However, further H.E.S.S. observations are needed for further morphological and spectral studies. Also, more X-ray observations (in the case of HESSJ1614-518) and further studies on the background-estimation methods and their systematics (in the case of the GB) are required.

  19. A new method for the reconstruction of very-high-energy gamma-ray spectra and application to galatic cosmic-ray accelerators

    International Nuclear Information System (INIS)

    Fernandes, Milton Virgilio

    2014-09-01

    previously reported, but unidentified extended TeV γ-ray source HESSJ1614-518. Unpublished H.E.S.S. data and archival multi-wavelength (MWL) data (radio, X-ray, and He data) as well various astrophysical objects in the FoV were investigated in search of a counterpart. The energy-dependent TeV morphology (with at least two source regions) can hardly be reconciled with the MWL data. A SC-wind scenario appears unlikely and the FoV lacks plausible counterpart, but a relic pulsar wind nebula could explain the lack of prominent X-ray emission. The VHE γ-ray source remains unidentified. The analysis of unpublished H.E.S.S. data on the SFR the Gould Belt (GB) did not provide any firm evidence of VHE γ-ray emission, and upper limits on the flux and the cosmic-ray enhancement were derived. The analysis of current IACTs. Towards Orion A, a possible discovery of extended VHE γ rays with flux of 10.8 % of the Crab Nebula is found with TBS, but cannot be confirmed and could be an artifact od the analysis of this region. Observations with the H.E.S.S. telescope system motivate that SCs and SFRs can accelerate GCRs. However, further H.E.S.S. observations are needed for further morphological and spectral studies. Also, more X-ray observations (in the case of HESSJ1614-518) and further studies on the background-estimation methods and their systematics (in the case of the GB) are required.

  20. Gamma radiation from active galaxy nuclei detected at very high energies with H.E.S.S: Multi-wavelength study and simulation of radioactive processes

    International Nuclear Information System (INIS)

    Lenain, J.P.

    2009-01-01

    Active Galactic Nuclei (AGN) are among the most energetic sources in the Universe. A subgroup of AGN possesses relativistic jets, the emission of which is purely non-thermal. In the case where the jet is aligned to the line of sight, these objects, called 'blazars', have their emission amplified by the relativistic Doppler effect. Since the advent of very high energy (VHE; E > 100 GeV) γ-ray astrophysics, Cerenkov telescopes like H.E.S.S. have observed almost thirty AGN, mainly blazars, from the ground. Cerenkov radiation from particle showers created by the interaction of γ-rays in the terrestrial atmosphere is used to derive the properties of the incident photon and thus to study these extragalactic sources. We have studied the highly variable VHE γ-ray emission from the blazar PKS 2155-304, from which 2 major outbursts were detected in July 2006, within the framework of a dynamic Synchrotron self-Compton (SSC) model. This variable emission presents properties excluding the most standard emission scenarios for blazars. We have also developed an SSC emission model for misaligned relativistic jets, to interpret the recent discovery of VHE γ-ray emission from 2 radio galaxies, M87 and Cen-A, which established the emergence of a new family of cosmic TeV emitters. We conclude with a systematic study conducted on all the AGN currently known at TeV with a stationary SSC model. We present tools for predictions of flux densities in these objects, which can be confronted with future observations by the Cerenkov Telescope Array (CTA). (author)

  1. The History of Ground-Based Very High Energy Gamma-Ray Astrophysics with the Atmospheric Air Cherenkov Telescope Technique

    Energy Technology Data Exchange (ETDEWEB)

    Mirzoyan, Razmik

    2013-06-15

    In the recent two decades the ground-based technique of imaging atmosphericescopes has established itself as a powerful new discipline in science. As of today some ∼ 150 sources of gamma rays of very different types, of both galactic and extragalactic origin, have been discovered due to this technique. The study of these sources is providing clues to many basic questions in astrophysics, astro-particle physics, physics of cosmic rays and cosmology. The current generation of telescopes, despite the young age of the technique, offers a solid performance. The technique is still maturing, leading to the next generation large instrument known under the name Cherenkov Telescope Array. The latter's sensitivity will be an order of magnitude higher than that of the currently best instruments VERITAS, H.E.S.S. and MAGIC. This article is devoted to outlining the milestones in a long history that step-by-step have given shape to this technique and have brought about today's successful source marathon.

  2. Cosmic ray and gamma astrophysics with the AMS-02 experiment

    International Nuclear Information System (INIS)

    Natale, Sonia

    2006-01-01

    The Alpha Magnetic Spectrometer (AMS) is a particle physics detector designed to operate on the International Space Station (ISS) for a minimum period of three years. The aim of AMS is the direct detection of charged particles in the rigidity range from 0.5 GV to few TV to perform high statistics studies of cosmic rays in space and a search for antimatter and dark matter. AMS will provide precise gamma measurements in the GeV range. In addition, the good angular resolution and identification capabilities of the detector will allow clean studies of galactic and extra-galactic sources, the diffuse gamma background and gamma ray bursts

  3. INTEGRAL and XMM-Newton observations of the weak gamma-ray burst GRB 030227

    DEFF Research Database (Denmark)

    Mereghetti, S.; Gotz, D.; Tiengo, A.

    2003-01-01

    We present International Gamma-Ray Astrophysical Laboratory ( INTEGRAL) and XMM-Newton observations of the prompt gamma-ray emission and the X-ray afterglow of GRB 030227, the first gamma-ray burst for which the quick localization obtained with the INTEGRAL Burst Alert System has led...

  4. Search for cosmic ray origins by the study of supernova remnants associated with molecular clouds with HESS and test of HESS II sampling system

    International Nuclear Information System (INIS)

    Fiasson, A.

    2008-03-01

    The H.E.S.S. telescope (High energy Stereoscopic System), located in Namibia, is currently the most efficient for the observation of very high energy (VHE) gamma-ray sources. It is composed of 4 large diameter telescopes working in stereoscopic mode and allows an unequaled survey of the galactic plane at these extreme wavelengths. The H.E.S.S. experiment showed the presence of high energy particles up to 100 TeV within supernova remnant. This astrophysical objects are believed to be the main particle accelerator within the Galaxy. However, the particle nature remains unclear. This thesis presents a new observational approach in order to show hadronic particles acceleration through diffusive shock within supernova remnant. A search of supernova remnant associated with molecular cloud have been led within the HESS source catalog and the H.E.S.S. observations. An analysis of the new VHE gamma-ray source in Monoceros and its interpretation are presented. As well, the analysis and interpretation of new observations of the unidentified source HESS J1745-303 are presented. The multi-wavelength analysis of the new source HESS J1714-385, coincident with the supernova remnant CTB37A is presented. A contribution to the H.E.S.S. phase II building is also presented. This second phase consists in the building of a fifth telescope at the center of the existing system. The series tests of the new camera sampling system are reported. (author)

  5. sup 4 sup 4 Ti atom counting for nuclear astrophysics

    CERN Document Server

    Hui, S K; Berkovits, D; Boaretto, E; Ghelberg, S; Hass, M; Hershkowitz, A; Navon, E

    2000-01-01

    The nuclide sup 4 sup 4 Ti (T sub 1 sub / sub 2 =59.2 yr) has recently become an important asset to nuclear astrophysics through the measurement of its cosmic radioactivity, yielding significant information on fresh sup 4 sup 4 Ti nucleosynthesis in supernovae. We propose to use AMS to determine the production rate of sup 4 sup 4 Ti by the main channel believed to be responsible for sup 4 sup 4 Ti astrophysical production, namely sup 4 sup 0 Ca(alpha,gamma). A preliminary experiment conducted at the Koffler 14UD Pelletron accelerator demonstrates a sensitivity of 1x10 sup - sup 1 sup 4 for the sup 4 sup 4 Ti/Ti ratio. The AMS detection was performed using sup 4 sup 4 Ti sup - ions sputtered from a TiO sub 2 sample, reducing considerably the sup 4 sup 4 Ca isobaric interference. The present limit corresponds effectively to sup 4 sup 4 Ti production with resonance strength in the range 10-100 meV for a one-day sup 4 sup 0 Ca(alpha,gamma) activation. Several such resonances are known to be responsible for sup 4 ...

  6. Gamma-Ray Imaging Spectrometer (GRIS): a new balloon-borne experiment for gamma-ray line astronomy

    International Nuclear Information System (INIS)

    Teegarden, B.J.; Cline, T.L.; Gehrels, N.; Porreca, G.; Tueller, J.; Leventhal, M.; Huters, A.F.; Maccallum, C.J.; Stang, P.D.; Sandia Labs., Albuquerque, NM)

    1985-01-01

    High resolution gamma-ray spectroscopy is a relatively new field that holds great promise for further understanding of high energy astrophysical processes. When the high resolution gamma-ray spectrometer (GRSE) was removed from the GRO payload, a balloon program was initiated to permit continued development and improvement of instrumentation in this field, as well as continued scientific observations. The Gamma-Ray Imaging Spectrometer (GRIS) is one of the experiments selected as part of this program. The instrument contains a number of new and innovative features that are expected to produce a significant improvement in source location accuracy and sensitivity over previous balloon and satellite experiments

  7. When neutrinos attack - the impact of agressive neutrinos in astrophysics.

    Science.gov (United States)

    Kneller, James

    2004-11-01

    Of all the constituents within the standard model of particle physics our understanding of the neutrino has benefited the most from the interaction of astrophysics and `terraphysics'. Much has been learned about the properties of the neutrino from each: experiments here on Earth temper our appreciation of the role that neutrinos play in the cosmos while astrophysics can provide the densities and temperatures in which the neutrinos do more than simply flee. But their reluctance to interact means that it is not until we venture into the most extreme environments of astrophysics that we observe neutrinos pushing back' as hard as they are being pushed'. We review two sites where this occurs: the early Universe and the accretion disk, engines' of gamma ray bursts. Neutrinos play an important role in the evolution of the early Universe with a particular focus upon the electron neutrino in determining the primordial elemental composition via its participation in the most important reaction at that time. Within gamma ray burst accretion disks we again see the electron neutrinos at work in the nuclear reactions and through their function as the coolant' for the disk. Removal of the disk energy, and its deposition into the remnants of the massive star surrounding the disk, may lead to the formation of highly relativistic jets that will later be observed as the burst. We show what has been learned so far about the neutrino and its properties from the study of such environments and discuss where future research is heading.

  8. Quark matter in astrophysics and cosmology

    International Nuclear Information System (INIS)

    Olinto, A.V.

    1987-10-01

    We dicuss the role of quark matter in astrophysics and cosmology. The implications of the dynamics of the quark-hadron phase transition in the early universe for the element abundances from big bang nucleosynthesis and the composition of the dark matter in the universe are addressed. We discuss the possibility of deciding on an equation of state for high density matter by observing the cooling of a neutron star remnant of SN1987A. Quark matter models for the Centauros events, Cygnus X-3 cosmic ray events, high energy gamma-ray bursts and the solar neutrino problem are described. 25 refs., 3 figs

  9. Investigations of astrophysically interesting nuclear reactions by the use of gas target techniques

    Energy Technology Data Exchange (ETDEWEB)

    Hammer, J W [Inst. fuer Strahlenphysik, Univ. Stuttgart, Stuttgart (Germany)

    1998-06-01

    A brief review of the common properties of windowless and recirculating gas targets is presented. As example the Stuttgart gas target facility Rhinoceros in the extended and in the supersonic jet mode with its properties and techniques is explained, also with respect to gas purification techniques. Furthermore several typical experiments from the field of nuclear astrophysics with characteristic results are described (D({alpha},{gamma}){sup 6}Li, {sup 15}N({alpha},{gamma}){sup 19}F, {sup 16}O(p,{gamma}){sup 17}F, {sup 16}O({alpha},{gamma}){sup 20}Ne, {sup 20}Ne({alpha},{gamma}){sup 24}Mg, {sup 21}Ne({alpha},n){sup 24}Mg, {sup 18}O({alpha},n){sup 21}Ne, {sup 17}O({alpha},n){sup 20}Ne). In several cases the experimental sensitivity could be raised by up to a factor of 10{sup 6}. (orig.)

  10. Steady-state emission of blazars at very high energies

    Energy Technology Data Exchange (ETDEWEB)

    Hoehne-Moench, Daniel

    2010-07-01

    One key scientific program of the MAGIC telescope project is the discovery and detection of blazars. They constitute the most prominent extragalactic source class in the very high energy (VHE) {gamma}-ray regime with 29 out of 34 known objects. Therefore a major part of the available observation time was spent in the last years on high-frequency peaked blazars. The selection criteria were chosen to increase the detection probability. As the X-ray flux is believed to be correlated to the VHE {gamma}-ray flux, only X-ray selected sources with a flux F{sub X}>2 {mu}Jy at 1 keV were considered. To avoid strong attenuation of the -rays in the extragalactic infrared background, the redshift was restricted to values between z<0.15 and z<0.4, depending on the declination of the objects. The latter determines the zenith distance during culmination which should not exceed 30 (for z<0.4) and 45 (for z<0.15), respectively. Between August 2005 and April 2009, a sample of 24 X-ray selected high-frequency peaked blazars has been observed with the MAGIC telescope. Three of them were detected including 1ES 1218+304 being the first high-frequency peaked BL Lacertae object (HBL) to be discovered with MAGIC in VHE {gamma}-rays. One previously detected object was not confirmed as VHE emitter in this campaign by MAGIC. A set of 20 blazars previously not detected is treated more closely in this work. In this campaign, during almost four years {proportional_to}450 hrs or {proportional_to}22% of the available observation time for extragalactic objects were dedicated to investigate the baseline emission of blazars and their broadband spectral properties in this emission state. For the sample of 20 objects in a redshift range of 0.018VHE range on the 99.7% confidence level (corresponding to 3 standard deviations) were calculated resulting in values between 2.9% and 14.7% of the integral flux of the Crab Nebula. As the distribution of significances

  11. Ground-based VHE γ ray astronomy with air Cherenkov imaging telescopes

    International Nuclear Information System (INIS)

    Mirzoyan, R.

    2000-01-01

    The history of astronomy has been one of the scientific discovery following immediately the introduction of new technology. In this report, we will review shortly the basic development of the atmospheric air Cherenkov light detection technique, particularly the imaging telescope technique, which in the last years led to the firm establishment of a new branch in experimental astronomy, namely ground-based very high-energy (VHE) γ ray astronomy. Milestones in the technology and in the analysis of imaging technique will be discussed. The design of the 17 m diameter MAGIC Telescope, being currently under construction, is based on the development of new technologies for all its major parts and sets new standards in the performance of the ground-based γ detectors. MAGIC is one of the next major steps in the development of the technique being the first instrument that will allow one to carry out measurements also in the not yet investigated energy gap i.e. between 10 and 300 GeV

  12. Astrophysics and the exploration of the universe

    International Nuclear Information System (INIS)

    Turck-Chieze, S.; Garcia, R.A.; Brun, A.S.; Minier, V.; Andre, Ph.; Motte, F.; Mathis, St.; Foglizzo, Th.; Decourchelle, A.; Ballet, J.; Chaty, S.; Corbel, St.; Rodriguez, J.; Brahic, A.; Charnoz, S.; Ferrari, C.; Lagage, P.O.; Masset, F.; Pantin, E.; Sauvage, M.; Galliano, F.; Goldwurm, A.; Ballet, J.; Decourchelle, A.; Grenier, I.; Daddi, E.; Elbaz, D.; Bournaud, F.; Yvon, D.; Arnaud, M.; Teyssier, R.; Lehoucq, R.; Palanque-Delabrouille, N.; Lehoucq, R.; Cirelli, M.; Bonvin, C.; Mansoulie, B.; Ruhlmann-Kleider, V.; Refregier, A.; Brax, Ph.; Lavignac, St.; Starck, J.L.; Talvard, M.; Sauvage, M.; Cara, Ch.; Lagage, P.O.; Ferrari, C.; Rodriguez, L.; Sauvageot, J.L.; Lebrun, F.; Grenier, I.; Glicenstein, J.F.; Gerbier, G.

    2009-01-01

    This special issue of Clefs CEA journal is entirely devoted to astrophysics and to the exploration and probing of the Universe. A first part of this dossier, described here, makes a status of our present day knowledge about stars, planets, galaxies, the Universe structure and dark matter. Content: 1 - Stars seed the Universe: What does the Sun tell us?, Probing stellar interiors, From the Sun to the stars, A tour of stellar nurseries, How heavy elements arise, How supernovae explode, Supernova remnants, High-energy objects - sources for astonishment, Focus: A Probing the Universe across the entire light spectrum; 2 - Planets: a dance of small bodies, swirling around up to the finale of their birth: How our world was born, The rings of Saturn: a magnificent research laboratory, Planetary cocoons; 3 - Galaxies: a richly paradoxical evolution: The active life of galaxies, A mysterious black hole, Elucidating the cosmic ray acceleration mechanism, Seeking out the great ancestors, The formation of galaxies: a story of paradoxes, The morphogenesis of galaxies; 4 - The Universe, a homogeneous 'soup' that has turned into a hierarchical structure: The grand thermal history of the Universe, The cosmic web, The formation of the structures of the Universe: the interplay of models, Does the Universe have a shape? Is it finite, or infinite?; 5 - Odyssey across the dark side of the Universe: The puzzle of dark matter, Astrophysics and the observation of dark matter, The theory of dark matter, Could dark matter be generated some day at LHC? A Universe dominated by dark energy, Astrophysics and the observation of dark energy, Theories of dark energy, The matter-antimatter asymmetry of the Universe; 6 - Journey into the lights of the Universe: Microwave - ESA Planck Surveyor, Submillimeter and infrared - ArTeMis, Herschel Space Observatory, VLT-VISIR, Cassini-CIRS, Visible - SoHo-GOLF, X-ray - XMM-Newton, Gamma ray - INTEGRAL, Fermi Gamma-Ray Space Telescope, HESS, EDELWEISS

  13. A directional gamma-ray detector based on scintillator plates

    Energy Technology Data Exchange (ETDEWEB)

    Hanna, D., E-mail: hanna@physics.mcgill.ca; Sagnières, L.; Boyle, P.J.; MacLeod, A.M.L.

    2015-10-11

    A simple device for determining the azimuthal location of a source of gamma radiation, using ideas from astrophysical gamma-ray burst detection, is described. A compact and robust detector built from eight identical modules, each comprising a plate of CsI(Tl) scintillator coupled to a photomultiplier tube, can locate a point source of gamma rays with degree-scale precision by comparing the count rates in the different modules. Sensitivity to uniform environmental background is minimal.

  14. Fermi-LAT Observations of the Gamma-Ray Burst GRB 130427A

    NARCIS (Netherlands)

    Ackermann, M.; et al., [Unknown; van der Horst, A.J.

    2014-01-01

    The observations of the exceptionally bright gamma-ray burst (GRB) 130427A by the Large Area Telescope aboard the Fermi Gamma-ray Space Telescope provide constraints on the nature of these unique astrophysical sources. GRB 130427A had the largest fluence, highest-energy photon (95 GeV), longest

  15. Astrophysical Flows

    Science.gov (United States)

    Pringle, James E.; King, Andrew

    2003-07-01

    Almost all conventional matter in the Universe is fluid, and fluid dynamics plays a crucial role in astrophysics. This new graduate textbook provides a basic understanding of the fluid dynamical processes relevant to astrophysics. The mathematics used to describe these processes is simplified to bring out the underlying physics. The authors cover many topics, including wave propagation, shocks, spherical flows, stellar oscillations, the instabilities caused by effects such as magnetic fields, thermal driving, gravity, shear flows, and the basic concepts of compressible fluid dynamics and magnetohydrodynamics. The authors are Directors of the UK Astrophysical Fluids Facility (UKAFF) at the University of Leicester, and editors of the Cambridge Astrophysics Series. This book has been developed from a course in astrophysical fluid dynamics taught at the University of Cambridge. It is suitable for graduate students in astrophysics, physics and applied mathematics, and requires only a basic familiarity with fluid dynamics.• Provides coverage of the fundamental fluid dynamical processes an astrophysical theorist needs to know • Introduces new mathematical theory and techniques in a straightforward manner • Includes end-of-chapter problems to illustrate the course and introduce additional ideas

  16. The Multi-Messenger Approach to High-Energy Gamma-Ray Sources

    CERN Document Server

    Paredes, Josep M; Torres, Diego F

    2008-01-01

    This book provides a theoretical and observational overview of the state of the art of gamma-ray astrophysics, and their impact and connection with the physics of cosmic rays and neutrinos. With the aim of shedding new and fresh light on the problem of the nature of the gamma-ray sources, particularly those yet unidentified, this book summarizes contributions to a workshop that continues with the series initiated by the meeting held at Tonantzintla in October 2000, and Hong-Kong in May 2004. This books will be of interest for all active researchers in the field of high energy astrophysics and astroparticle physics, as well as for graduate students entering into the subject.

  17. Hard X-ray/soft gamma-ray telescope designs for future astrophysics missions

    DEFF Research Database (Denmark)

    Ferreira, Desiree Della Monica; Christensen, Finn Erland; Pivovaroff, Michael J.

    2013-01-01

    We present several concept designs of hard X-ray/soft λ-ray focusing telescopes for future astrophysics missions. The designs are based on depth graded multilayer coatings. These have been successfully employed on the NuSTAR mission for energies up to 80 keV. Recent advances in demonstrating...

  18. Theoretical nuclear structure and astrophysics. Progress report for 1996

    International Nuclear Information System (INIS)

    Guidry, M.W.; Nazarewicz, W.; Strayer, M.R.

    1996-01-01

    This research effort is directed toward theoretical support and guidance for the fields of radioactive ion beam physics, gamma ray spectroscopy, computational and nuclear astrophysics, and the interface between these disciplines. The authors report substantial progress in all those areas. One measure of progress is publications and invited material. The research described here has led to more than 43 papers that are published, accepted, or submitted to refereed journals, and to 15 invited presentations at conferences and workshops

  19. FIRST LIGHT: MeV ASTROPHYSICS FROM THE MOON

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Richard S. [University of Alabama in Huntsville, 301 Sparkman Drive, Huntsville, AL 35899 (United States); Lawrence, David J., E-mail: richard.s.miller@uah.edu [Johns Hopkins University Applied Physics Laboratory, 11100 Johns Hopkins Road, Laurel, MD 20723 (United States)

    2016-06-01

    We report evidence of the first astrophysical source detected from the Moon at MeV energies. Our detection of Cygnus X-1 is a validation of a new investigative paradigm in which the lunar environment is intrinsic to the detection approach: the Lunar Occultation Technique (LOT). NASA’s Lunar Prospector mission served as a proxy for a dedicated LOT-based mission. The characteristic signature of temporal modulation, generated by repeated lunar occultations and encoded within acquired gamma-ray data (0.5–9 MeV), is consistent with an unambiguous detection of Cygnus X-1 at 5.4 σ significance. Source localization and long-term monitoring capabilities of the LOT are also demonstrated. This “first light” detection verifies the basic tenets of the LOT methodology, reinforces its feasibility as an alternative astronomical detection paradigm for nuclear astrophysics investigations, and is an illustration of the fundamental benefits of the Moon as a platform for science.

  20. GRIPS - Gamma-Ray Imaging, Polarimetry and Spectroscopy

    Czech Academy of Sciences Publication Activity Database

    Greiner, J.; Mannheim, K.; Hudec, René; Mészáros, A.

    2012-01-01

    Roč. 34, č. 2 (2012), s. 551-582 ISSN 0922-6435 Institutional research plan: CEZ:AV0Z10030501 Keywords : compton and pair creation telescope * gamma-ray bursts * nucleosynthesis Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 2.969, year: 2012

  1. VI School on Cosmic Rays and Astrophysics

    International Nuclear Information System (INIS)

    2017-01-01

    VI School on Cosmic Rays and Astrophysics 17-25 November 2015, Chiapas, Mexico The VI School on Cosmic Rays and Astrophysics was held at the MCTP, at the Autonomous University of Chiapas (UNACH), Tuxtla Gutiérrez, Chiapas, Mexico thanks to the Science for Development ICTP-UNACH-UNESCO Regional Seminar, 17-25 November 2015 (http://mctp.mx/e-VI-School-on-Cosmic-Rays-and-Astrophysics.html). The School series started in La Paz, Bolivia in 2004 and it has been, since then, hosted by several Latin American countires: 1.- La Paz, Bolivia (August, 2004), 2.- Puebla, Mexico (September, 2006), 3.- Arequipa, Peru (September, 2008), 4.- Santo André, Brazil (September, 2010), 5.- La Paz, Bolivia (August, 2012). It aims to promote Cosmic Ray (CR) Physics and Astrophysics in the Latin American community and to provide a general overview of theoretical and experimental issues on these topics. It is directed to undergraduates, postgraduates and active researchers in the field. The lectures introduce fundamental Cosmic Ray Physics and Astrophysics with a review of standards of the field. It is expected the school continues happening during the next years following a tradition. In this edition, the list of seminars included topics such as experimental techniques of CR detection, development of CR showers and hadronic interactions, composition and energy spectrum of primary CR, Gamma-Ray Bursts (GRBs), neutrino Astrophysics, spacecraft detectors, simulations, solar modulation, and the current state of development and results of several astroparticle physics experiments such as The Pierre Auger Observatory in Argentina, HAWC in Mexico, KASCADE and KASCADE Grande, HESS, IceCube, JEM-EUSO, Fermi-LAT, and others. This time the school has been complemented with the ICTP-UNACH-UNESCO Seminar of theory on Particle and Astroparticle Physics. The organization was done by MCTP, the Mesoamerican Centre for Theoretical Physics. The school had 46 participants, 30 students from Honduras, Brazil

  2. Self-Organized Criticality in Astrophysics The Statistics of Nonlinear Processes in the Universe

    CERN Document Server

    Aschwanden, Markus

    2011-01-01

    The concept of ‘self-organized criticality’ (SOC) has been applied to a variety of problems, ranging from population growth and traffic jams to earthquakes, landslides and forest fires. The technique is now being applied to a wide range of phenomena in astrophysics, such as planetary magnetospheres, solar flares, cataclysmic variable stars, accretion disks, black holes and gamma-ray bursts, and also to phenomena in galactic physics and cosmology. Self-organized Criticality in Astrophysics introduces the concept of SOC and shows that, due to its universality and ubiquity, it is a law of nature. The theoretical framework and specific physical models are described, together with a range of applications in various aspects of astrophyics. The mathematical techniques, including the statistics of random processes, time series analysis, time scale and waiting time distributions, are presented and the results are applied to specific observations of astrophysical phenomena.

  3. Cosmic gamma-ray background from dark matter annihilation

    International Nuclear Information System (INIS)

    Ando, Shin'ichiro

    2007-01-01

    High-energy photons from pair annihilation of dark matter particles contribute to the cosmic gamma-ray background (CGB) observed in a wide energy range. The precise shape of the energy spectrum of CGB depends on the nature of dark matter particles. In order to discriminate between the signals from dark matter annihilation and other astrophysical sources, however, the information from the energy spectrum of CGB may not be sufficient. We show that dark matter annihilation not only contributes to the mean CGB intensity, but also produces a characteristic anisotropy, which provides a powerful tool for testing the origins of the observed CGB. We show that the expected sensitivity of future gamma-ray detectors such as GLAST should allow us to measure the angular power spectrum of CGB anisotropy, if dark matter particles are supersymmetric neutralinos and they account for most of the observed mean intensity. As the intensity of photons from annihilation is proportional to the density squared, we show that the predicted shape of the angular power spectrum of gamma rays from dark matter annihilation is different from that due to other astrophysical sources such as blazars, whose intensity is linearly proportional to density. Therefore, the angular power spectrum of the CGB provides a 'smoking-gun' signature of gamma rays from dark matter annihilation

  4. Investigating High Field Gravity using Astrophysical Techniques

    International Nuclear Information System (INIS)

    Bloom, Elliott D.

    2008-01-01

    The purpose of these lectures is to introduce particle physicists to astrophysical techniques. These techniques can help us understand certain phenomena important to particle physics that are currently impossible to address using standard particle physics experimental techniques. As the subject matter is vast, compromises are necessary in order to convey the central ideas to the reader. Many general references are included for those who want to learn more. The paragraphs below elaborate on the structure of these lectures. I hope this discussion will clarify my motivation and make the lectures easier to follow. The lectures begin with a brief review of more theoretical ideas. First, elements of general relativity are reviewed, concentrating on those aspects that are needed to understand compact stellar objects (white dwarf stars, neutron stars, and black holes). I then review the equations of state of these objects, concentrating on the simplest standard models from astrophysics. After these mathematical preliminaries, Sec. 2(c) discusses 'The End State of Stars'. Most of this section also uses the simplest standard models. However, as these lectures are for particle physicists, I also discuss some of the more recent approaches to the equation of state of very dense compact objects. These particle-physics-motivated equations of state can dramatically change how we view the formation of black holes. Section 3 focuses on the properties of the objects that we want to characterize and measure. X-ray binary systems and Active Galactic Nuclei (AGN) are stressed because the lectures center on understanding very dense stellar objects, black hole candidates (BHCs), and their accompanying high gravitational fields. The use of x-ray timing and gamma-ray experiments is also introduced in this section. Sections 4 and 5 review information from x-ray and gamma-ray experiments. These sections also discuss the current state of the art in x-ray and gamma-ray satellite experiments and

  5. Investigating High Field Gravity using Astrophysical Techniques

    Energy Technology Data Exchange (ETDEWEB)

    Bloom, Elliott D.; /SLAC

    2008-02-01

    The purpose of these lectures is to introduce particle physicists to astrophysical techniques. These techniques can help us understand certain phenomena important to particle physics that are currently impossible to address using standard particle physics experimental techniques. As the subject matter is vast, compromises are necessary in order to convey the central ideas to the reader. Many general references are included for those who want to learn more. The paragraphs below elaborate on the structure of these lectures. I hope this discussion will clarify my motivation and make the lectures easier to follow. The lectures begin with a brief review of more theoretical ideas. First, elements of general relativity are reviewed, concentrating on those aspects that are needed to understand compact stellar objects (white dwarf stars, neutron stars, and black holes). I then review the equations of state of these objects, concentrating on the simplest standard models from astrophysics. After these mathematical preliminaries, Sec. 2(c) discusses 'The End State of Stars'. Most of this section also uses the simplest standard models. However, as these lectures are for particle physicists, I also discuss some of the more recent approaches to the equation of state of very dense compact objects. These particle-physics-motivated equations of state can dramatically change how we view the formation of black holes. Section 3 focuses on the properties of the objects that we want to characterize and measure. X-ray binary systems and Active Galactic Nuclei (AGN) are stressed because the lectures center on understanding very dense stellar objects, black hole candidates (BHCs), and their accompanying high gravitational fields. The use of x-ray timing and gamma-ray experiments is also introduced in this section. Sections 4 and 5 review information from x-ray and gamma-ray experiments. These sections also discuss the current state of the art in x-ray and gamma-ray satellite

  6. A Search for bursts of TeV gamma rays with Milagro

    Science.gov (United States)

    Smith, A. J.; MILAGRO Collaboration

    2001-08-01

    The Very High Energy (VHE, E > 100 GeV) component of Gamma-Ray Bursts (GRBs) remains unmeasured, despite the fact that models predict that the spectrum of GRBs extends beyond 1 TeV. Satellite detectors capable of observing GRBs lack the sensitivity to detect γ-rays with energies greater than ≈ 30 GeV due to their small effective area. Air ˇCerenkov telescopes, capable of detecting TeV point sources with excellent sensitivity have limited sensitivity to GRBs due to their small fields of view and limited duty cycles. The detection of TeV emission from GRBs is further complicated by the attenuation of VHE photons by interaction with the intergalactic infrared radiation. This process limits the horizon for TeV observations of GRBs to z pond (4800 m2 ) instrumented with an array of photo-multiplier tubes. Milagro operates 24 hours a day and continuously observes the entire overhead sky (≈2 sr). Because of its wide field of view and high duty cycle Milagro is uniquely capable of searching for TeV emission from GRBs. An efficient algorithm has been developed to search the Milagro data for GRBs with durations from 250 microseconds to 40s. The search, while designed to search for the TeV component of GRBs, may also be sensitive to the evaporation of primordial black holes, or some other yet undiscovered phenomenon. The results of this search are presented.

  7. Particle and astrophysics aspects of ultrahigh energy cosmic rays

    Energy Technology Data Exchange (ETDEWEB)

    Sigl, G [Institut d' Astrophysique de Paris, Paris (France)

    2001-11-15

    The origin of cosmic rays is one of the major unresolved astrophysical questions. In particular, the highest energy cosmic rays observed possess macroscopic energies and their origin is likely to be associated with the most energetic processes in the Universe. Their existence triggered a flurry of theoretical explanations ranging from conventional shock acceleration to particle physics beyond the Standard Model and processes taking place at the earliest moments of our Universe. Furthermore, many new experimental activities promise a strong increase of statistics at the highest energies and a combination with {gamma}-ray and neutrino astrophysics will put strong constraints on these theoretical models. Detailed Monte Carlo simulations indicate that charged ultra-high energy cosmic rays can also be used as probes of large scale magnetic fields whose origin may open another window into the very early Universe. We give an overview over this quickly evolving research field. (author)

  8. Characterising the VHE diffuse emission in the central 200 parsecs of our Galaxy with H.E.S.S.

    Science.gov (United States)

    H.E.S.S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Akhperjanian, A. G.; Andersson, T.; Angüner, E. O.; Arakawa, M.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bonnefoy, S.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Büchele, M.; Bulik, T.; Capasso, M.; Carr, J.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Coffaro, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Cui, Y.; Davids, I. D.; Decock, J.; Degrange, B.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dutson, K.; Dyks, J.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holch, T. L.; Holler, M.; Horns, D.; Ivascenko, A.; Iwasaki, H.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jogler, T.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katsuragawa, M.; Katz, U.; Kerszberg, D.; Khangulyan, D.; Khélifi, B.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Nakashima, S.; de Naurois, M.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Rauth, R.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Richter, S.; Rieger, F.; Romoli, C.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Saito, S.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seglar-Arroyo, M.; Settimo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stycz, K.; Sushch, I.; Takahashi, T.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tsuji, N.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Żywucka, N.

    2018-04-01

    The diffuse very high-energy (VHE; >100 GeV) γ-ray emission observed in the central 200 pc of the Milky Way by H.E.S.S. was found to follow dense matter distribution in the central molecular zone (CMZ) up to a longitudinal distance of about 130 pc to the Galactic centre (GC), where the flux rapidly decreases. This was initially interpreted as the result of a burst-like injection of energetic particles 104 yr ago, but a recent more sensitive H.E.S.S. analysis revealed that the cosmic-ray (CR) density profile drops with the distance to the centre, making data compatible with a steady cosmic PeVatron at the GC. In this paper, we extend this analysis to obtain, for the first time, a detailed characterisation of the correlation with matter and to search for additional features and individual γ-ray sources in the inner 200 pc. Taking advantage of 250 h of H.E.S.S. data and improved analysis techniques, we perform a detailed morphology study of the diffuse VHE emission observed from the GC ridge and reconstruct its total spectrum. To test the various contributions to the total γ-ray emission, we used an iterative 2D maximum-likelihood approach that allows us to build a phenomenological model of the emission by summing a number of different spatial components. We show that the emission correlated with dense matter covers the full CMZ and that its flux is about half the total diffuse emission flux. We also detect some emission at higher latitude that is likely produced by hadronic collisions of CRs in less dense regions of the GC interstellar medium. We detect an additional emission component centred on the GC and extending over about 15 pc that is consistent with the existence of a strong CR density gradient and confirms the presence of a CR accelerator at the very centre of our Galaxy. We show that the spectrum of full ridge diffuse emission is compatible with that previously derived from the central regions, suggesting that a single population of particles fills the

  9. Laboratory Astrophysics Using High Energy Density Photon and Electron Beams

    CERN Document Server

    Bingham, Robert

    2005-01-01

    The development of intense laser and particle beams has opened up new opportunities to study high energy density astrophysical processes in the Laboratory. With even higher laser intensities possible in the near future vacuum polarization processes such as photon - photon scattering with or without large magnetic fields may also be experimentally observed. In this talk I will review the status of laboratory experiments using intense beans to investigate extreme astrophysical phenomena such as supernovae explosions, gamma x-ray bursts, ultra-high energy cosmic accelerators etc. Just as intense photon or electron beams can excite relativistic electron plasma waves or wakefields used in plasma acceleration, intense neutrino beams from type II supernovae can also excite wakefields or plasma waves. Other instabilities driven by intense beams relevant to perhaps x-ray bursts is the Weibel instability. Simulation results of extreme processes will also be presented.

  10. Gamma-Ray Instrument for Polarimetry, Spectroscopy and Imaging (GIPSI)

    National Research Council Canada - National Science Library

    Kroeger, R. A; Johnson, W. N; Kinzer, R. L; Kurfess, J. D; Inderhees, S. E; Phlips, B. F; Graham, B. L

    1996-01-01

    .... Gamma-ray polarimetry in the energy band around 60-300 keV is an interesting area of high energy astrophysics where observations have not been possible with the technologies employed in current and past space missions...

  11. Essential astrophysics

    CERN Document Server

    Lang, Kenneth R

    2013-01-01

    Essential Astrophysics is a book to learn or teach from, as well as a fundamental reference volume for anyone interested in astronomy and astrophysics. It presents astrophysics from basic principles without requiring any previous study of astronomy or astrophysics. It serves as a comprehensive introductory text, which takes the student through the field of astrophysics in lecture-sized chapters of basic physical principles applied to the cosmos. This one-semester overview will be enjoyed by undergraduate students with an interest in the physical sciences, such as astronomy, chemistry, engineering or physics, as well as by any curious student interested in learning about our celestial science. The mathematics required for understanding the text is on the level of simple algebra, for that is all that is needed to describe the fundamental principles. The text is of sufficient breadth and depth to prepare the interested student for more advanced specialized courses in the future. Astronomical examples are provide...

  12. The Extragalactic Background Light and the Gamma-ray Opacity of the Universe

    Science.gov (United States)

    Dwek, Eli; Krennrich, Frank

    2012-01-01

    The extragalactic background light (EBL) is one of the fundamental observational quantities in cosmology. All energy releases from resolved and unresolved extragalactic sources, and the light from any truly diffuse background, excluding the cosmic microwave background (CMB), contribute to its intensity and spectral energy distribution. It therefore plays a crucial role in cosmological tests for the formation and evolution of stellar objects and galaxies, and for setting limits on exotic energy releases in the universe. The EBL also plays an important role in the propagation of very high energy gamma-rays which are attenuated en route to Earth by pair producing gamma-gamma interactions with the EBL and CMB. The EBL affects the spectrum of the sources, predominantly blazars, in the approx 10 GeV to 10 TeV energy regime. Knowledge of the EBL intensity and spectrum will allow the determination of the intrinsic blazar spectrum in a crucial energy regime that can be used to test particle acceleration mechanisms and VHE gamma-ray production models. Conversely, knowledge of the intrinsic gamma-ray spectrum and the detection of blazars at increasingly higher redshifts will set strong limits on the EBL and its evolution. This paper reviews the latest developments in the determination of the EBL and its impact on the current understanding of the origin and production mechanisms of gamma-rays in blazars, and on energy releases in the universe. The review concludes with a summary and future directions in Cherenkov Telescope Array techniques and in infrared ground-based and space observatories that will greatly improve our knowledge of the EBL and the origin and production of very high energy gamma-rays.

  13. Astrophysical interpretation of the anisotropies in the unresolved gamma-ray background

    Science.gov (United States)

    Ando, Shin'ichiro; Fornasa, Mattia; Fornengo, Nicolao; Regis, Marco; Zechlin, Hannes-S.

    2017-06-01

    Recently, a new measurement of the auto- and cross-correlation angular power spectrum (APS) of the isotropic gamma-ray background was performed, based on 81 months of data of the Fermi Large-Area Telescope (LAT). Here, we fit, for the first time, the new APS data with a model describing the emission of unresolved blazars. These sources are expected to dominate the anisotropy signal. The model we employ in our analysis reproduces well the blazars resolved by Fermi LAT. When considering the APS obtained by masking the sources listed in the 3FGL catalog, we find that unresolved blazars underproduce the measured APS below ˜1 GeV . Contrary to past results, this suggests the presence of a new contribution to the low-energy APS, with a significance of, at least, 5 σ . The excess can be ascribed to a new class of faint gamma-ray emitters. If we consider the APS obtained by masking the sources in the 2FGL catalog, there is no underproduction of the APS below 1 GeV, but the new source class is still preferred over the blazars-only scenario (with a significance larger than 10 σ ). The properties of the new source class and the level of anisotropies induced in the isotropic gamma-ray background are the same, independent of the APS data used. In particular, the new gamma-ray emitters must have a soft energy spectrum, with a spectral index ranging, approximately, from 2.7 to 3.2. This complicates their interpretation in terms of known sources, since, normally, star-forming and radio galaxies are observed with a harder spectrum. The new source class identified here is also expected to contribute significantly to the intensity of the isotropic gamma-ray background.

  14. Very high-frequency gravitational waves from magnetars and gamma-ray bursts

    Science.gov (United States)

    Wen, Hao; Li, Fang-Yu; Li, Jin; Fang, Zhen-Yun; Beckwith, Andrew

    2017-12-01

    Extremely powerful astrophysical electromagnetic (EM) systems could be possible sources of high-frequency gravitational waves (HFGWs). Here, based on properties of magnetars and gamma-ray bursts (GRBs), we address “Gamma-HFGWs” (with very high-frequency around 1020 Hz) caused by ultra-strong EM radiation (in the radiation-dominated phase of GRB fireballs) interacting with super-high magnetar surface magnetic fields (˜1011 T). By certain parameters of distance and power, the Gamma-HFGWs would have far field energy density Ω gw around 10-6, and they would cause perturbed signal EM waves of ˜10-20 W/m2 in a proposed HFGW detection system based on the EM response to GWs. Specially, Gamma-HFGWs would possess distinctive envelopes with characteristic shapes depending on the particular structures of surface magnetic fields of magnetars, which could be exclusive features helpful to distinguish them from background noise. Results obtained suggest that magnetars could be involved in possible astrophysical EM sources of GWs in the very high-frequency band, and Gamma-HFGWs could be potential targets for observations in the future. Supported by National Natural Science Foundation of China (11605015, 11375279, 11205254, 11647307) and the Fundamental Research Funds for the Central Universities (106112017CDJXY300003, 106112017CDJXFLX0014)

  15. Some perspectives in nuclear astrophysics on non-thermal phenomena

    International Nuclear Information System (INIS)

    Tatischeff, V.

    2012-01-01

    In this HDR (Accreditation to Supervise Researches) report, the author presents and comments his research activities on nuclear phenomena in stellar eruptions (solar eruptions, lithium nucleosynthesis in stellar eruptions), on particle acceleration in shock waves of stellar explosions (diffusive acceleration by shock wave, particle acceleration in symbiotic novae, particle acceleration in radio-detected supernovae), of research on low energy cosmic rays (galactic emission of nuclear gamma rays, non thermal soft X rays as new tracer of accelerated particles), and on the origin of short period radioactivities in the primitive solar system (extinguished radio-activities and formation of the solar system, origin of berylium-10 in the primitive solar system). The author concludes with some perspectives on non thermal phenomena in nuclear astrophysics, and on research and development for the future of medium-energy gamma astronomy [fr

  16. Focusing telescopes in nuclear astrophysics

    International Nuclear Information System (INIS)

    Von Ballmoos, P.; Knodlseder, R.; Sazonov, S.; Griffiths, R.; Bastie, P.; Halloin, H.; Pareschi, G.; Ramsey, B.; Jensen, C.; Buis, E.J.; Ulmer, M.; Giommi, P.; Colafrancesco, S.; Comastri, A.; Barret, D.; Leising, M.; Hernanz, M.; Smith, D.; Abrosimov, N.; Smither, B.; Ubertini, P.; Olive, J.F.; Lund, N.; Pisa, A.; Courtois, P.; Roa, D.; Harrison, F.; Pareschi, G.; Frontera, F.; Von Ballmoos, P.; Barriere, N.; Rando, N.; Borde, J.; Hinglais, E.; Cledassou, R.; Duchon, P.; Sghedoni, M.; Huet, B.; Takahashi, T.; Caroli, E.; Quadrinin, L.; Buis, E.J.; Skinner, G.; Krizmanic, J.; Pareschi, G.; Loffredo, G.; Wunderer, C.; Weidenspointner, G.; Wunderer, C.; Koechlin, L.; Bignami, G.; Von Ballmoos, P.; Tueller, J.; Andritschke, T.; Laurens, A.; Evrard, J.

    2005-01-01

    The objective of this workshop is to consider the next generation of instrumentation to be required within the domain of nuclear astrophysics. A small, but growing community has been pursuing various techniques for the focusing of hard X-rays and gamma-rays with the aim of achieving a factor of up to 100 improvement in sensitivity over present technologies. Balloon flight tests of both multilayer mirrors and a Laue lens have been performed and ideas abound. At present, implementation scenarios for space missions are being studied at Esa, CNES, and elsewhere. The workshop will provide a first opportunity for this new community to meet, exchange technological know-how, discuss scientific objectives and synergies, and consolidate implementation approaches within National and European Space Science programs. This document gathers the slides of all the presentations

  17. Focusing telescopes in nuclear astrophysics

    Energy Technology Data Exchange (ETDEWEB)

    Von Ballmoos, P; Knodlseder, R; Sazonov, S; Griffiths, R; Bastie, P; Halloin, H; Pareschi, G; Ramsey, B; Jensen, C; Buis, E J; Ulmer, M; Giommi, P; Colafrancesco, S; Comastri, A; Barret, D; Leising, M; Hernanz, M; Smith, D; Abrosimov, N; Smither, B; Ubertini, P; Olive, J F; Lund, N; Pisa, A; Courtois, P; Roa, D; Harrison, F; Pareschi, G; Frontera, F; Von Ballmoos, P; Barriere, N; Rando, N; Borde, J; Hinglais, E; Cledassou, R; Duchon, P; Sghedoni, M; Huet, B; Takahashi, T; Caroli, E; Quadrinin, L; Buis, E J; Skinner, G; Krizmanic, J; Pareschi, G; Loffredo, G; Wunderer, C; Weidenspointner, G; Wunderer, C; Koechlin, L; Bignami, G; Von Ballmoos, P; Tueller, J; Andritschke, T; Laurens, A; Evrard, J

    2005-07-01

    The objective of this workshop is to consider the next generation of instrumentation to be required within the domain of nuclear astrophysics. A small, but growing community has been pursuing various techniques for the focusing of hard X-rays and gamma-rays with the aim of achieving a factor of up to 100 improvement in sensitivity over present technologies. Balloon flight tests of both multilayer mirrors and a Laue lens have been performed and ideas abound. At present, implementation scenarios for space missions are being studied at Esa, CNES, and elsewhere. The workshop will provide a first opportunity for this new community to meet, exchange technological know-how, discuss scientific objectives and synergies, and consolidate implementation approaches within National and European Space Science programs. This document gathers the slides of all the presentations.

  18. Studies of weak capture-gamma-ray resonances via coincidence techniques

    CERN Document Server

    Rowland, C; Champagne, A E; Dummer, A K; Fitzgerald, R; Harley, E C T; Mosher, J; Runkle, R

    2002-01-01

    A method for measuring weak capture-gamma-ray resonances via gamma gamma-coincidence counting techniques is described. The coincidence apparatus consisted of a large-volume germanium detector and an annular NaI(Tl) crystal. The setup was tested by measuring the weak E sub R =227 keV resonance in sup 2 sup 6 Mg(p,gamma) sup 2 sup 7 Al. Absolute germanium and NaI(Tl) counting efficiencies for a range of gamma-ray energies and for different detector-target geometries are presented. Studies of the gamma-ray background in our spectra are described. Compared to previous work, our method improves the detection sensitivity for weak capture-gamma-ray resonances by a factor of approx 100. The usefulness of the present technique for investigations of interest to nuclear astrophysics is discussed.

  19. The Advanced Gamma-ray Imaging System (AGIS): Galactic Astrophysics

    Science.gov (United States)

    Digel, Seth William; Funk, S.; Kaaret, P. E.; Tajima, H.; AGIS Collaboration

    2010-03-01

    The Advanced Gamma-ray Imaging System (AGIS), a concept for a next-generation atmospheric Cherenkov telescope array, would provide unprecedented sensitivity and resolution in the energy range >50 GeV, allowing great advances in the understanding of the populations and physics of sources of high-energy gamma rays in the Milky Way. Extrapolation based on the known source classes and the performance parameters for AGIS indicates that a survey of the Galactic plane with AGIS will reveal hundreds of TeV sources in exquisite detail, for population studies of a variety of source classes, and detailed studies of individual sources. AGIS will be able to study propagation effects on the cosmic rays produced by Galactic sources by detecting the diffuse glow from their interactions in dense interstellar gas. AGIS will complement and extend results now being obtained in the GeV range with the Fermi mission, by providing superior angular resolution and sensitivity to variability on short time scales, and of course by probing energies that Fermi cannot reach.

  20. LHC, Astrophysics and Cosmology

    Directory of Open Access Journals (Sweden)

    Giulio Auriemma

    2014-12-01

    Full Text Available In this paper we discuss the impact on cosmology of recent results obtained by the LHC (Large Hadron Collider experiments in the 2011-2012 runs, respectively at √s = 7 and 8 TeV. The capital achievement of LHC in this period has been the discovery of a spin-0 particle with mass 126 GeV/c2, very similar to the Higgs boson of the Standard Model of Particle Physics. Less exciting, but not less important, negative results of searches for Supersymmetric particles or other exotica in direct production or rare decays are discussed in connection with particles and V.H.E. astronomy searches for Dark Matter.

  1. Constraints on Cosmic Rays, Magnetic Fields, and Dark Matter from Gamma-ray Observations of the Coma Cluster of Galaxies with VERITAS and FERMI

    Science.gov (United States)

    Arlen, T.; Aune, T.; Beilicke, M.; Benbow, W.; Bouvier, A.; Buckley, J. H.; Bugaev, V.; Byrum, K.; Cannon, A.; Cesarini, A.; hide

    2012-01-01

    Observations of radio halos and relics in galaxy clusters indicate efficient electron acceleration. Protons should likewise be accelerated and, on account of weak energy losses, can accumulate, suggesting that clusters may also be sources of very high energy (VHE; E greater than100 GeV) gamma-ray emission. We report here on VHE gamma-ray observations of the Coma galaxy cluster with the VERITAS array of imaging Cerenkov telescopes, with complementing Fermi Large Area Telescope observations at GeV energies. No significant gamma-ray emission from the Coma Cluster was detected. Integral flux upper limits at the 99 confidence level were measured to be on the order of (2-5) x 10(sup -8) photons m(sup -2) s(sup -1) (VERITAS,greater than 220 GeV) and approximately 2 x 10(sup -6) photons m(sup -2) s(sup -1) (Fermi, 1-3 GeV), respectively. We use the gamma-ray upper limits to constrain cosmic rays (CRs) and magnetic fields in Coma. Using an analytical approach, the CR-to-thermal pressure ratio is constrained to be less than 16% from VERITAS data and less than 1.7% from Fermi data (averaged within the virial radius). These upper limits are starting to constrain the CR physics in self-consistent cosmological cluster simulations and cap the maximum CR acceleration efficiency at structure formation shocks to be 50. Alternatively, this may argue for non-negligible CR transport processes such as CR streaming and diffusion into the outer cluster regions. Assuming that the radio-emitting electrons of the Coma halo result from hadronic CR interactions, the observations imply a lower limit on the central magnetic field in Coma of approximately (2-5.5)microG, depending on the radial magnetic field profile and on the gamma-ray spectral index. Since these values are below those inferred by Faraday rotation measurements in Coma (for most of the parameter space), this renders the hadronic model a very plausible explanation of the Coma radio halo. Finally, since galaxy clusters are dark

  2. Some highlights of the 14th Texas symposium on relativistic astrophysics

    International Nuclear Information System (INIS)

    Shapiro, M.M.

    1989-01-01

    The new channels in astrophysics, complementing the ancient science of optical astronomy, have come into their own in the past half-century. To be sure, the first of these disciplines---cosmic radiation---was discovered about 75 years ago, but two or three decades passed before it was perceived as a significant astrophysical phenomenon. Even the nature of the incoming radiation was not established until the 1940s. Then, in successive decades, came radio astronomy, x-ray and gamma-ray astronomy, and neutrino astronomy. With the growing sensitivity of gravitational-wave detectors, the confirmation of signals arriving in this channel of astronomy may happen within the next decade. Thus, the effective history of contemporary astronomy spans hardly more than half a century---twice the lifetime of the Texas symposia. This paper reports on some of the topics covered at the 14th Texas symposium

  3. High energy astrophysical techniques

    CERN Document Server

    Poggiani, Rosa

    2017-01-01

    This textbook presents ultraviolet and X-ray astronomy, gamma-ray astronomy, cosmic ray astronomy, neutrino astronomy, and gravitational wave astronomy as distinct research areas, focusing on the astrophysics targets and the requirements with respect to instrumentation and observation methods. The purpose of the book is to bridge the gap between the reference books and the specialized literature. For each type of astronomy, the discussion proceeds from the orders of magnitude for observable quantities. The physical principles of photon and particle detectors are then addressed, and the specific telescopes and combinations of detectors, presented. Finally the instruments and their limits are discussed with a view to assisting readers in the planning and execution of observations. Astronomical observations with high-energy photons and particles represent the newest additions to multimessenger astronomy and this book will be of value to all with an interest in the field.

  4. Gamma Ray Bursts-Afterglows and Counterparts

    Science.gov (United States)

    Fishman, Gerald J

    1998-01-01

    Several breakthrough discoveries were made last year of x-ray, optical and radio afterglows and counterparts to gamma-ray bursts, and a redshift has been associated with at least one of these. These discoveries were made possible by the fast, accurate gamma-ray burst locations of the BeppoSAX satellite. It is now generally believed that the burst sources are at cosmological distances and that they represent the most powerful explosions in the Universe. These observations also open new possibilities for the study of early star formation, the physics of extreme conditions and perhaps even cosmology. This session will concentrate on recent x-ray, optical and radio afterglow observations of gamma-ray bursts, associated redshift measurements, and counterpart observations. Several review and theory talks will also be presented, along with a summary of the astrophysical implications of the observations. There will be additional poster contributions on observations of gamma-ray burst source locations at wavelengths other than gamma rays. Posters are also solicited that describe new observational capabilities for rapid follow-up observations of gamma-ray bursts.

  5. Cosmic matrix in the jubilee of relativistic astrophysics

    International Nuclear Information System (INIS)

    Ruffini, R.; Aimuratov, Y.; Enderli, M.; Kovacevic, M.; Belinski, V.; Bianco, C. L.; Izzo, L.; Moradi, R.; Muccino, M.; Rueda, J. A.; Vereshchagin, G. V.; Wang, Y.; Xue, S.-S.; Mathews, G. J.; Penacchioni, A. V.; Pisani, G. B.

    2015-01-01

    Following the classical works on Neutron Stars, Black Holes and Cosmology, I outline some recent results obtained in the IRAP-PhD program of ICRANet on the “Cosmic Matrix”: a new astrophysical phenomenon recorded by the X- and Gamma-Ray satellites and by the largest ground based optical telescopes all over our planet. In 3 minutes it has been recorded the occurrence of a “Supernova”, the “Induced-Gravitational-Collapse” on a Neutron Star binary, the formation of a “Black Hole”, and the creation of a “Newly Born Neutron Star”. This presentation is based on a document describing activities of ICRANet and recent developments of the paradigm of the Cosmic Matrix in the comprehension of Gamma Ray Bursts (GRBs) presented on the occasion of the Fourteenth Marcel Grossmann Meeting on Recent Developments in Theoretical and Experimental General Relativity, Gravitation, and Relativistic Field Theory. A Portuguese version of this document can be downloaded at: http://www.icranet.org/documents/brochure_icranet_pt.pdf

  6. Nuclear astrophysics

    International Nuclear Information System (INIS)

    Lehoucq, Roland; Klotz, Gregory

    2015-11-01

    Astronomy deals with the position and observation of the objects in our Universe, from planets to galaxies. It is the oldest of the sciences. Astrophysics is the study of the physical properties of these objects. It dates from the start of the 20. century. Nuclear astrophysics is the marriage of nuclear physics, a laboratory science concerned with the infinitely small, and astrophysics, the science of what is far away and infinitely large. Its aim is to explain the origin, evolution and abundance of the elements in the Universe. It was born in 1938 with the work of Hans Bethe, an American physicist who won the Nobel Prize for physics in 1967, on the nuclear reactions that can occur at the center of stars. It explains where the incredible energy of the stars and the Sun comes from and enables us to understand how they are born, live and die. The matter all around us and from which we are made, is made up of ninety-two chemical elements that can be found in every corner of the Universe. Nuclear astrophysics explains the origin of these chemical elements by nucleosynthesis, which is the synthesis of atomic nuclei in different astrophysical environments such as stars. Nuclear astrophysics provides answers to fundamental questions: - Our Sun and the stars in general shine because nuclear reactions are taking place within them. - The stars follow a sequence of nuclear reaction cycles. Nucleosynthesis in the stars enables us to explain the origin and abundance of elements essential to life, such as carbon, oxygen, nitrogen and iron. - Star explosions, in the form of supernovae, disperse the nuclei formed by nucleosynthesis into space and explain the formation of the heaviest chemical elements such as gold, platinum and lead. Nuclear astrophysics is still a growing area of science. (authors)

  7. Technology Development for AGIS (Advanced Gamma-ray Imaging System).

    Science.gov (United States)

    Krennrich, Frank

    2008-04-01

    Next-generation arrays of atmospheric Cherenkov telescopes are at the conceptual planning stage and each could consist of on the order of 100 telescopes. The two currently-discussed projects AGIS in the US and CTA in Europe, have the potential to achieve an order of magnitude better sensitivity for Very High Energy (VHE) gamma-ray observations over state-to-the-art observatories. These projects require a substantial increase in scale from existing 4-telescope arrays such as VERITAS and HESS. The optimization of a large array requires exploring cost reduction and research and development for the individual elements while maximizing their performance as an array. In this context, the technology development program for AGIS will be discussed. This includes developing new optical designs, evaluating new types of photodetectors, developing fast trigger systems, integrating fast digitizers into highly-pixilated cameras, and reliability engineering of the individual components.

  8. Low-energy resonances in sup 25 Mg(p,. gamma. ) sup 26 Al, sup 26 Mg(p,. gamma. ) sup 27 Al and sup 27 Al(p,. gamma. ) sup 28 Si

    Energy Technology Data Exchange (ETDEWEB)

    Iliadis, C; Schange, T; Rolfs, C; Schroeder, U; Somorjai, E; Trautvetter, H P; Wolke, K [Muenster Univ. (Germany, F.R.). Inst. fuer Kernphysik; Endt, P M; Kikstra, S W [Rijksuniversiteit Utrecht (Netherlands). Robert van de Graaff Lab.; Champagne, A E [Princeton Univ., NJ (USA). Dept. of Physics; Arnould, M; Paulus, G [Universite Libre de Bruxelles (Belgium). Inst. d' Astronomie et d' Astrophysique

    1990-06-11

    Gamma-ray decay schemes have been measured with bare and Compton-suppressed Ge detectors at low-energy resonances (E{sub p}<340 keV) in the (p, {gamma}) reactions on {sup 25}Mg, {sup 26}Mg and {sup 27}Al. Althogether 58 new decay branches have been observed and a new {sup 26}Mg(p, {gamma}){sup 27}Al resonance has been found at E{sub p}=154.5{plus minus}1.0 keV. The new branchings lead to J{sup {pi}}; T determinations (or limitations) for two states in {sup 26}Al and four states in {sup 28}Si. The absolute strengths of the {sup 25}Mg(p, {gamma}){sup 26}Al and {sup 26}Mg(p, {gamma}){sup 27}Al resonances have also been obtained, and the uncertainties of the stellar rates, deduced from the available data for both reactions, are significantly reduced. Some astrophysical consequences are discussed. (orig.).

  9. FAST TIMING ANALYSIS OF CYGNUS X-1 USING THE SPECTROMETER ON THE INTERNATIONAL GAMMA-RAY ASTROPHYSICS LABORATORY

    International Nuclear Information System (INIS)

    Cabanac, Clement; Roques, Jean-Pierre; Jourdain, Elisabeth

    2011-01-01

    We report for the first time the high-frequency analysis of Cyg X-1 up to hard X-ray using the spectrometer on International Gamma-Ray Astrophysics Laboratory (INTEGRAL). After analyzing the possible contribution from the background, and using the INTEGRAL archive from 2005 March to 2008 May, power density spectra were obtained up to 130 keV. First, we show that their overall shape is very similar to that observed at lower energies as they are well described by sets of Lorentzians. The strength of this fast variability (up to 40 Hz) does not drop at high energy since we show that it remains at ∼25% rms, even in the highest energy bands. Second, the hard X-ray variability patterns of Cyg X-1 are state dependent: the softer the spectrum (or the lower the hardness ratio), the lower the total fractional variability and the higher the typical frequencies observed. The strength of the total variability as a function of energy and state is then investigated. By comparison with simultaneous and published RXTE/Proportional Counter Array data, we show that in the hard state it remains quite constant in the 2-130 keV energy range. In the softer state it is also flat up to 50 keV and may increase at higher energy. The implications of this behavior on the models are then discussed.

  10. Observational techniques of gamma rays astronomy in low energy

    International Nuclear Information System (INIS)

    Costa, J.M. da.

    1982-02-01

    Due to the absorption of great part of the gamma-ray spectrum of cosmic origin, by the earth's atmosphere at heights above 20Km, gamma-ray astronomy achieved its full development only after the advent of the space age. Ballons and satellites are the space vehicles which have been used to transport gamma-ray telescopes to observational heights in the atmosphere, or out of it. The results of these experiments can determine the sources, the energy spectra and the intensities of the cosmic gamma-rays, and provide other important information of astrophysical interest. The detection of gamma-rays of cosmic origin is very difficult. The observational techniques used in gamma-ray astronomy are dependent on the energy range of the gamma-rays which one desires to detect. The most common telescopes of low energy gamma-ray astronomy (50KeV - 20MeV) use NaI(Tl) scintillators, or germanium diodes, as principal detectors, surrounded by an active shield (anticoincidence) of organic or inorganic scintillators. (Author) [pt

  11. Intermittent Astrophysical Radiation Sources and Terrestrial Life

    Science.gov (United States)

    Melott, Adrian

    2013-04-01

    Terrestrial life is exposed to a variety of radiation sources. Astrophysical observations suggest that strong excursions in cosmic ray flux and spectral hardness are expected. Gamma-ray bursts and supernovae are expected to irradiate the atmosphere with keV to GeV photons at irregular intervals. Supernovae will produce large cosmic ray excursions, with time development varying with distance from the event. Large fluxes of keV to MeV protons from the Sun pose a strong threat to electromagnetic technology. The terrestrial record shows cosmogenic isotope excursions which are consistent with major solar proton events, and there are observations of G-stars suggesting that the rate of such events may be much higher than previously assumed. In addition there are unknown and unexplained astronomical transients which may indicate new classes of events. The Sun, supernovae, and gamma-ray bursts are all capable of producing lethal fluences, and some are expected on intervals of 10^8 years or so. The history of life on Earth is filled with mass extinctions at a variety of levels of intensity. Most are not understood. Astrophysical radiation may play a role, particularly from large increases in muon irradiation on the ground, and changes in atmospheric chemistry which deplete ozone, admitting increased solar UVB. UVB is strongly absorbed by DNA and proteins, and breaks the chemical bonds---it is a known carcinogen. High muon fluxes will also be damaging to such molecules, but experiments are needed to pin down the rate. Solar proton events which are not directly dangerous for the biota may nevertheless pose a major threat to modern electromagnetic technology through direct impact on satellites and magnetic induction of large currents in power grids, disabling transformers. We will look at the kind of events that are expected on timescales from human to geological, and their likely consequences.

  12. The future of high energy gamma ray astronomy and its potential astrophysical implications

    Science.gov (United States)

    Fichtel, C. E.

    1982-01-01

    Future satellites should carry instruments having over an order of magnitude greater sensitivity than those flown thus far as well as improved energy and angular resolution. The information to be obtained from these experiments should greatly enhance knowledge of: the very energetic and nuclear processes associated with compact objects; the structure of our galaxy; the origin and dynamic pressure effects of the cosmic rays; the high energy particles and energetic processes in other galaxies; and the degree of matter-antimatter symmetry of the universe. The relevant aspects of extragalactic gamma ray phenomena are emphasized along with the instruments planned. The high energy gamma ray results of forthcoming programs such as GAMMA-1 and the Gamma Ray Observatory should justify even more sophisticated telescopes. These advanced instruments might be placed on the space station currently being considered by NASA.

  13. Recent astrophysical applications of the Trojan Horse Method to nuclear astrophysics

    International Nuclear Information System (INIS)

    Spitaleri, C.; Cherubini, S.; Crucilla, V.; Gulino, M.; La Cognata, M.; Lamia, L.; Pizzone, R. G.; Puglia, S. M. R.; Rapisarda, G. G.; Romano, S.; Sergi, M. L.; Tumino, A.; Fu, C.; Tribble, R.; Banu, A.; Al-Abdullah, T.; Goldberg, V.; Mukhamedzhanov, A.; Tabacaru, G.; Trache, L.

    2008-01-01

    The Trojan Horse Method (THM) is an unique indirect technique allowing to measure astrophysical rearrangement reactions down to astrophysical relevant energies. The basic principle and a review of the recent applications of the Trojan Horse Method are presented. The applications aiming to the extraction of the bare astrophysical S b (E) for some two-body processes are discussed

  14. Nuclear astrophysics. Irfu - IN2P3 prospective of 2012

    International Nuclear Information System (INIS)

    Assie, M.; Hammache, F.; Khan, E.; Margueron, J.; Sereville, N. de; Bastin, B.; Oliveira Santos, F. de; Ploszajczak, M.; Sorlin, O.; Bernard, D.; Chieze, J.-P.; Decourchelle, A.; Ducret, J. E.; Foglizzo, T.; Gilles, D.; Schanne, S.; Turck-Chieze, S.; Coc, A.; Duprat, J.; Kiener, J.; Lefebvre-Schuhl, A.; Tatischeff, V.; Courtin, S.; Dufour, M.; Haas, F.; Gulminelli, F.; Gunsing, F.; Obertelli, A.; Maurin, D.; Renaud, M.; Smirnova, N.

    2011-01-01

    This document proposes a rather detailed overview of the different research works performed by nuclear astrophysicists belonging to the Irfu and to the IN2P3. It also presents the main results and envisaged researches. These issues are herein presented by distinguishing four main themes. The first one concerns the main issues of the field: cosmology and nuclear physics, hydrostatic nucleosynthesis and stellar evolution, explosive nucleosynthesis (supernovae, novae, X-bursts), neutron stars and protostars, galactic cosmic radiation and nuclear astrophysics, formation of the Solar System. The second theme concerns means of observation: astro-seismology, X astronomy, nuclear gamma astronomy, meteorites and micro-meteorites. The third theme concerns measurements in laboratory: steady beam accelerators, radioactive beam accelerators, neutron beams, production of radioactive targets, power lasers, isotopic analysis of extraterrestrial matter. The fourth theme concerns nuclear theories for astrophysics. Appendices propose summaries of objectives of current projects, and tables indicating involved staff and budgets

  15. Relativistic Astrophysics

    International Nuclear Information System (INIS)

    Font, J. A.

    2015-01-01

    The relativistic astrophysics is the field of astrophysics employing the theory of relativity Einstein as physical-mathematical model is to study the universe. This discipline analyzes astronomical contexts in which the laws of classical mechanics of Newton's law of gravitation are not valid. (Author)

  16. Space instrumentation for gamma-ray astronomy

    Energy Technology Data Exchange (ETDEWEB)

    Teegarden, B.J

    1999-02-11

    The decade of the 1990s has witnessed a renaissance in the field of gamma-ray astronomy. The seminal event was the launch of the Compton Gamma-Ray Observatory (CGRO) in April 1991. There have been a flood of major discoveries from CGRO including breakthroughs in gamma-ray bursts, annihilation radiation, and blazars. The Italian SAX satellite was launched in April 1996. Although not primarily a gamma-ray mission, it has added a new dimension to our understanding of gamma-ray bursts. Along with these new discoveries a firm groundwork has been laid for missions and new technology development that should maintain a healthy and vigorous field throughout most of the next decade. These include the ESA INTEGRAL mission (INTErnational Gamma-Ray Astrophysics Laboratory, to be launched in mid-2001) and the NASA GLAST mission (Gamma-Ray Large Area Space Telescope) with a likely launch in the middle of the next decade. These two missions will extend the observational capabilities well beyond those of CGRO. New technologies (to gamma-ray astronomy), such as cooled germanium detectors, silicon strip detectors, and CdTe detectors are planned for these new missions. Additional promising new technologies such as CdZnTe strip detectors, scintillator fibers, and a gamma-ray lens for future gamma-ray astronomy missions are under development in laboratories around the world.

  17. Space instrumentation for gamma-ray astronomy

    International Nuclear Information System (INIS)

    Teegarden, B.J.

    1999-01-01

    The decade of the 1990s has witnessed a renaissance in the field of gamma-ray astronomy. The seminal event was the launch of the Compton Gamma-Ray Observatory (CGRO) in April 1991. There have been a flood of major discoveries from CGRO including breakthroughs in gamma-ray bursts, annihilation radiation, and blazars. The Italian SAX satellite was launched in April 1996. Although not primarily a gamma-ray mission, it has added a new dimension to our understanding of gamma-ray bursts. Along with these new discoveries a firm groundwork has been laid for missions and new technology development that should maintain a healthy and vigorous field throughout most of the next decade. These include the ESA INTEGRAL mission (INTErnational Gamma-Ray Astrophysics Laboratory, to be launched in mid-2001) and the NASA GLAST mission (Gamma-Ray Large Area Space Telescope) with a likely launch in the middle of the next decade. These two missions will extend the observational capabilities well beyond those of CGRO. New technologies (to gamma-ray astronomy), such as cooled germanium detectors, silicon strip detectors, and CdTe detectors are planned for these new missions. Additional promising new technologies such as CdZnTe strip detectors, scintillator fibers, and a gamma-ray lens for future gamma-ray astronomy missions are under development in laboratories around the world

  18. Discovery of Very High Energy Gamma Rays from PKS 1424+240 and Multiwavelength Constraints on its Redshift

    Energy Technology Data Exchange (ETDEWEB)

    Acciari, V.A.; /Harvard-Smithsonian Ctr. Astrophys.; Aliu, E.; /Delaware U., Bartol Inst.; Arlen, T.; /UCLA; Aune, T.; /UC, Santa Cruz; Bautista, M.; /McGill U.; Beilicke, M. /Washington U., St. Louis; Benbow, W.; /Harvard-Smithsonian Ctr. Astrophys.; Bottcher, M.; /Ohio U.; Boltuch, D.; /Delaware U., Bartol Inst.; Bradbury, S.M.; /Leeds U.; Buckley, J.H.; /Washington U., St. Louis; Bugaev, V.; /Washington U., St. Louis; Byrum, K.; /Argonne; Cannon, A.; /University Coll., Dublin; Cesarini, A.; /Natl. U. of Ireland, Galway; Chow, Y.C.; /UCLA; Ciupik, L.; /Roosevelt U., Chicago; Cogan, P.; /McGill U.; Cui, W.; /Purdue U.; Duke, C.; /Grinnell Coll.; Falcone, A.; /Penn State U. /Purdue U. /Utah U. /Roosevelt U., Chicago /Harvard-Smithsonian Ctr. Astrophys. /Purdue U. /Natl. U. of Ireland, Galway /Utah U. /University Coll., Dublin /McGill U. /Roosevelt U., Chicago /McGill U. /Delaware U., Bartol Inst. /Utah U. /Chicago U., EFI /Iowa State U. /Roosevelt U., Chicago /DePauw U. /Utah U. /Pittsburg State U. /Washington U., St. Louis /Iowa State U. /Natl. U. of Ireland, Galway /Utah U. /McGill U. /Washington U., St. Louis /McGill U. /McGill U. /Purdue U. /Anderson U. /Galway-Mayo Inst. of Tech. /Iowa State U. /UCLA; /more authors..

    2012-04-05

    We report the first detection of very-high-energy (VHE) gamma-ray emission above 140GeV from PKS 1424+240, a BL Lac object with an unknown redshift. The photon spectrum above 140GeV measured by VERITAS is well described by a power law with a photon index of 3.8 {+-}0.5{sub stat} {+-} 0.3{sub syst} and a flux normalization at 200 GeV of (5.1 {+-} 0.9{sub stat} {+-} 0.5{sub syst}) x 10{sup -11} TeV{sup -1} cm{sup -2} s{sup -1}, where stat and syst denote the statistical and systematical uncertainty, respectively. The VHE flux is steady over the observation period between MJD 54881 and 55003 (2009 February 19 to June 21). Flux variability is also not observed in contemporaneous high energy observations with the Fermi Large Area Telescope (LAT). Contemporaneous X-ray and optical data were also obtained from the Swift XRT and MDM observatory, respectively. The broadband spectral energy distribution (SED) is well described by a one-zone synchrotron self-Compton (SSC) model favoring a redshift of less than 0.1. Using the photon index measured with Fermi in combination with recent extragalactic background light (EBL) absorption models it can be concluded from the VERITAS data that the redshift of PKS 1424+240 is less than 0.66.

  19. Decay Spectroscopy for Nuclear Astrophysics: {beta}-delayed Proton Decay

    Energy Technology Data Exchange (ETDEWEB)

    Trache, L.; Simmons, E.; Spiridon, A.; McCleskey, M.; Roeder, B. T.; Tribble, R. E. [Texas A and M University, College Station, TX 77845 (United States); Saastamoinen, A.; Jokinen, A.; Aysto, J. [University of Jyvaskyla, Jyvaskyla (Finland); Davinson, T.; Woods, P. J. [University of Edinburgh, Edinburgh (United Kingdom); Pollacco, E.; Kebbiri, M. [CEA/IRFU Saclay (France); Pascovici, G. [IKP, Universitaet zu Koeln (Germany)

    2011-11-30

    Decay spectroscopy is one of the oldest indirect methods in nuclear astrophysics. We have developed at TAMU techniques to measure beta- and beta-delayed proton decay of sd-shell, proton-rich nuclei. The short-lived radioactive species are produced in-flight, separated, then slowed down (from about 40 MeV/u) and implanted in the middle of very thin Si detectors. These allowed us to measure protons with energies as low as 200 keV from nuclei with lifetimes of 100 ms or less. At the same time we measure gamma-rays up to 8 MeV with high resolution HPGe detectors. We have studied the decay of {sup 23}Al, {sup 27}P, {sup 31}Cl, all important for understanding explosive H-burning in novae. The technique has shown a remarkable selectivity to beta-delayed charged-particle emission and works even at radioactive beam rates of a few pps. The states populated are resonances for the radiative proton capture reactions {sup 22}Na(p,{gamma}){sup 23}Mg(crucial for the depletion of {sup 22}Na in novae), {sup 26m}Al(p,{gamma}){sup 27}Si and {sup 30}P(p,{gamma}){sup 31}S(bottleneck in novae and XRB burning), respectively. More recently we have radically improved the technique using a gas based detector we call AstroBox.

  20. Frontier Research in Astrophysics - II

    Science.gov (United States)

    2016-05-01

    The purpose of this international workshop is to bring together astrophysicists and physicists who are involved in various topics at the forefront of modern astrophysics and particle physics. The workshop will discuss the most recent experimental and theoretical results in order to advance our understanding of the physics governing our Universe. To accomplish the goals of the workshop, we believe it is necessary to use data from ground-based and space-based experiments and results from theoretical developments: work on the forefront of science which has resulted (or promises to result in) high-impact scientific papers. Hence, the main purpose of the workshop is to discuss in a unique and collaborative setting a broad range of topics in modern astrophysics, from the Big Bang to Planets and Exoplanets. We believe that this can provide a suitable framework for each participant who (while obviously not involved in all the topics discussed), will be able to acquire a general view of the main experimental and theoretical results currently obtained. Such an up-to-date view of the current research on cosmic sources can help guide future research projects by the participants, and will encourage collaborative efforts across various topical areas of research. The proceedings will be published in Proceedings of Science (PoS)- SISSA and will provide a powerful resource for all the scientific community and will be especially helpful for PhD students. The following items will be reviewed: Cosmology: Cosmic Background, Dark Matter, Dark Energy, Clusters of Galaxies. Physics of the Diffuse Cosmic Sources. Physics of Cosmic Rays. Physics of Discrete Cosmic Sources. Extragalactic Sources: Active Galaxies, Normal Galaxies, Gamma-Ray Bursts. Galactic Sources: Star Formation, Pre-Main-Sequence and Main- Sequence Stars, the Sun, Cataclysmic Variables and Novae, Supernovae and SNRs, X-Ray Binary Systems, Pulsars, Black Holes, Gamma-Ray Sources, Nucleosynthesis, Asteroseismology

  1. Germination test for identification of gamma-irradiated bean seeds

    International Nuclear Information System (INIS)

    Wesolowska, B.; Ignatowicz, S.

    1993-01-01

    The feasibility of germination test for the practical detection of irradiated beans has not been investigated. The objective of this study was to determine if the relationship between the root growth rate and radiation dose could be used to produce a rapid analytical method for identification of irradiated beans. Such detection method could be potentially used for both (a) identification of irradiated food, and (b) for quarantine inspection (to certify that the agricultural product has been irradiated, and the pests present in it do not pose a quarantine risk). Results presented in this paper indicate that the germination test is not always capable of discriminating satisfactorily between irradiated and unirradiated samples of bean seeds, because the sensitivity of the test is often higher than the low doses which are suggested for disinfestation purposes. However, using the germination test, an unexperienced person can easily discriminate untreated bean seeds from those irradiated with 0.3-1.5 kGy doses of gamma radiation. (orig./vhe)

  2. Gamma-ray imaging spectrometer (GRIS): a new balloon-borne experiment for gamma-ray line astronomy

    International Nuclear Information System (INIS)

    Teegarden, B.J.; Cline, T.L.; Gehrels, N.; Porreca, G.; Tueller, J.; Leventhal, M.; Huters, A.F.; MacCallum, C.J.; Stang, P.D.

    1985-01-01

    High resolution gamma-ray spectroscopy is a relatively new field that holds great promise for further understanding of high energy astrophysical processes. Preliminary results such as the annihilation radiation from the galactic center, the 26 Al line from the galactic plane and cyclotron lines from neutron stars may well be just the initial discoveries of a rich and as yet undeveloped field. When the high resolution gamma-ray spectrometer (GRSE) was removed from the GRO payload NASA decided to initiate a balloon program to permit continued development and improvement of instrumentation in this field, as well as continued scientific observations. The Gamma-Ray Imaging Spectrometer (GRIS) is one of the experiments selected as part of this program. The instrument contains a number of new and innovative features that are expected to produce a significant improvement in source location accuracy and sensitivity over previous balloon and satellite experiments. 6 refs., 2 figs

  3. An X-ray perspective on a gamma-ray mission

    DEFF Research Database (Denmark)

    Lund, Niels

    2003-01-01

    The most recent astrophysics mission of ESA is INTEGRAL, a mission dedicated to gamma-ray astronomy (Winkler et al. 2003). INTEGRAL carries two gamma-ray instruments: the imager, IBIS, and the spectrometer, SPI, and in addition an optical monitor, OMC, and an X-ray monitor, JEM-X. INTEGRAL is an ...... is an observatory mission with 70% of the observation time available to the general astronomical community through a peer-reviewed selection process. This paper describes the INTEGRAL mission primarily as seen from the JEM-X perspective....

  4. CELESTE: an atmospheric Cherenkov telescope for high energy gamma astrophysics

    Czech Academy of Sciences Publication Activity Database

    Paré, E.; Balauge, B.; Bazer-Bachi, R.; Bergeret, H.; Berny, F.; Briand, N.; Bruel, P.; Cerutti, M.; Collon, J.; Cordier, A.; Cornbise, P.; Debiais, G.; Dezalay, J. P.; Dumora, D.; Durand, E.; Eschstruth, P.; Espigat, P.; Fabre, B.; Fleury, P.; Gilly, J.; Gouillaud, J. C.; Gregory, C.; Hérault, N.; Holder, J.; Hrabovský, Miroslav; Incerti, S.; Jouenne, A.; Kalt, L.; LeGallou, R.; Lott, B.; Manigot, P.; Neveu, J.; Olive, J. F.; Palatka, Miroslav; Perez, A.; Rebii, A.; Rob, L.; Sans, J. L.; Schovánek, Petr; Villard, G.

    2002-01-01

    Roč. 490, - (2002), s. 71-89 ISSN 0168-9002 R&D Projects: GA MŠk LN00A006 Institutional research plan: CEZ:AV0Z1010920 Keywords : gamma-ray astronopy * atmospheric Cherenkov detector Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 1.167, year: 2002

  5. γ astrophysics above 10-30 GeV with the MAGIC telescope

    International Nuclear Information System (INIS)

    Mirzoyan, Razmick

    1999-01-01

    The project on the 17 m oe telescope, dubbed MAGIC (Major Atmospheric Gamma Imaging Cherenkov Telescope), is dedicated for γ astrophysics in the energy range from 10-30 GeV till 50-100 TeV. MAGIC will for the first time allow to explore with very high sensitivity the energy range 10-300 GeV and to bridge the existing energy gap between satellite and ground-based air Cherenkov measurements. We believe MAGIC will serve as a prototype for future multi-telescope γ ray observatories

  6. Report on the workshop "Decay spectroscopy at CARIBU: advanced fuel cycle applications, nuclear structure and astrophysics". 14-16 April 2011, Argonne National Laboratory, USA.

    Energy Technology Data Exchange (ETDEWEB)

    Kondev, F.; Carpenter, M.P.; Chowdhury, P.; Clark, J.A.; Lister, C.J.; Nichols, A.L.; Swewryniak, D. (Nuclear Engineering Division); (Univ. of Massachusetts); (Univ. of Surrey)

    2011-10-06

    A workshop on 'Decay Spectroscopy at CARIBU: Advanced Fuel Cycle Applications, Nuclear Structure and Astrophysics' will be held at Argonne National Laboratory on April 14-16, 2011. The aim of the workshop is to discuss opportunities for decay studies at the Californium Rare Isotope Breeder Upgrade (CARIBU) of the ATLAS facility with emphasis on advanced fuel cycle (AFC) applications, nuclear structure and astrophysics research. The workshop will consist of review and contributed talks. Presentations by members of the local groups, outlining the status of relevant in-house projects and availabile equipment, will also be organized. time will also be set aside to discuss and develop working collaborations for future decay studies at CARIBU. Topics of interest include: (1) Decay data of relevance to AFC applications with emphasis on reactor decay heat; (2) Discrete high-resolution gamma-ray spectroscopy following radioactive decya and related topics; (3) Calorimetric studies of neutron-rich fission framgents using Total ABsorption Gamma-Ray Spectrometry (TAGS) technique; (4) Beta-delayed neutron emissions and related topics; and (5) Decay data needs for nuclear astrophysics.

  7. Nuclear physics and astrophysics

    International Nuclear Information System (INIS)

    Schramm, D.N.; Olinto, A.V.

    1992-09-01

    We have investigated a variety of research topics on the interface of nuclear physics and astrophysics during the past year. We have continued our study of dihyperon states in dense matter and have started to make a connection between their properties in the core of neutron stars with the ongoing experimental searches at Brookhaven National Laboratory. We started to build a scenario for the origin of gamma-ray bursts using the conversion of neutron stars to strange stars close to an active galactic nucleous. We have been reconsidering the constraints due to neutron star cooling rates on the equation of state for high density matter in the light, of recent findings which show that the faster direct Urca cooling process is possible for a range of nuclear compositions. We have developed a model for the formation of primordial magnetic fields due to the dynamics of the quark-hadron phase transition. Encouraged by the most recent observational developments, we have investigated the possible origin of the boron and beryllium abundances. We have greatly improved the calculations of the primordial abundances of these elements I>y augmenting the reaction networks and by updating the most recent experimental nuclear reaction rates. Our calculations have shown that the primordial abundances are much higher than previously thought but that the observed abundances cannot be explained by primordial sources alone. We have also studied the origin of the boron and beryllium abundances due to cosmic ray spallation. Finally, we have continued to address the solar neutrino problem by investigating the impact of astrophysical uncertainties on the MSW solution for a full three-family treatment of MSW mixing

  8. Nuclear physics and astrophysics

    Energy Technology Data Exchange (ETDEWEB)

    Schramm, D.N.; Olinto, A.V.

    1992-09-01

    We have investigated a variety of research topics on the interface of nuclear physics and astrophysics during the past year. We have continued our study of dihyperon states in dense matter and have started to make a connection between their properties in the core of neutron stars with the ongoing experimental searches at Brookhaven National Laboratory. We started to build a scenario for the origin of gamma-ray bursts using the conversion of neutron stars to strange stars close to an active galactic nucleous. We have been reconsidering the constraints due to neutron star cooling rates on the equation of state for high density matter in the light, of recent findings which show that the faster direct Urca cooling process is possible for a range of nuclear compositions. We have developed a model for the formation of primordial magnetic fields due to the dynamics of the quark-hadron phase transition. Encouraged by the most recent observational developments, we have investigated the possible origin of the boron and beryllium abundances. We have greatly improved the calculations of the primordial abundances of these elements I>y augmenting the reaction networks and by updating the most recent experimental nuclear reaction rates. Our calculations have shown that the primordial abundances are much higher than previously thought but that the observed abundances cannot be explained by primordial sources alone. We have also studied the origin of the boron and beryllium abundances due to cosmic ray spallation. Finally, we have continued to address the solar neutrino problem by investigating the impact of astrophysical uncertainties on the MSW solution for a full three-family treatment of MSW mixing.

  9. Cosmic matrix in the jubilee of relativistic astrophysics

    Energy Technology Data Exchange (ETDEWEB)

    Ruffini, R., E-mail: ruffini@icra.it [Dip. di Fisica, Sapienza University of Rome and ICRA Piazzale Aldo Moro 5, I–00185, Rome (Italy); ICRANet, Piazza della Repubblica 10, I–65122 Pescara (Italy); Université de Nice Sophie Antipolis, Nice, CEDEX 2, Grand Château Parc Valrose (France); ICRANet-Rio, Centro Brasileiro de Pesquisas Físicas, Rua Dr. Xavier Sigaud 150, Rio de Janeiro, RJ, 22290–180 (Brazil); Aimuratov, Y.; Enderli, M.; Kovacevic, M. [Dip. di Fisica, Sapienza University of Rome and ICRA Piazzale Aldo Moro 5, I–00185, Rome (Italy); Université de Nice Sophie Antipolis, Nice, CEDEX 2, Grand Château Parc Valrose (France); Belinski, V.; Bianco, C. L.; Izzo, L.; Moradi, R.; Muccino, M.; Rueda, J. A.; Vereshchagin, G. V.; Wang, Y.; Xue, S.-S. [Dip. di Fisica, Sapienza University of Rome and ICRA Piazzale Aldo Moro 5, I–00185, Rome (Italy); ICRANet, Piazza della Repubblica 10, I–65122 Pescara (Italy); Mathews, G. J. [ICRANet, Piazza della Repubblica 10, I–65122 Pescara (Italy); Center for Astrophysics, University of Notre Dame, US (United States); Penacchioni, A. V. [INPE - Av. dos Astronautas, 1758 - Sao Jose dos Campos - Sao Paulo – Brazil (Brazil); Pisani, G. B. [Dip. di Fisica, Sapienza University of Rome and ICRA Piazzale Aldo Moro 5, I–00185, Rome (Italy)

    2015-12-17

    Following the classical works on Neutron Stars, Black Holes and Cosmology, I outline some recent results obtained in the IRAP-PhD program of ICRANet on the “Cosmic Matrix”: a new astrophysical phenomenon recorded by the X- and Gamma-Ray satellites and by the largest ground based optical telescopes all over our planet. In 3 minutes it has been recorded the occurrence of a “Supernova”, the “Induced-Gravitational-Collapse” on a Neutron Star binary, the formation of a “Black Hole”, and the creation of a “Newly Born Neutron Star”. This presentation is based on a document describing activities of ICRANet and recent developments of the paradigm of the Cosmic Matrix in the comprehension of Gamma Ray Bursts (GRBs) presented on the occasion of the Fourteenth Marcel Grossmann Meeting on Recent Developments in Theoretical and Experimental General Relativity, Gravitation, and Relativistic Field Theory. A Portuguese version of this document can be downloaded at: http://www.icranet.org/documents/brochure{sub i}cranet{sub p}t.pdf.

  10. Fermi-LAT Observations of the Gamma-Ray Burst GRB 130427A

    Science.gov (United States)

    Ackermann, M.; Ajello, M.; Asano, K.; Atwood, W. B.; Axelsson, M.; Baldini, L.; Ballet, J.; Barbiellini, G.; Baring, M. G.; Bastieri, D.; hide

    2013-01-01

    The observations of the exceptionally bright gamma-ray burst (GRB) 130427A by the Large Area Telescope aboard the Fermi Gamma-ray Space Telescope provide constraints on the nature of these unique astrophysical sources. GRB 130427A had the largest fluence, highest-energy photon (95 GeV), longest gamma-ray duration (20 hours), and one of the largest isotropic energy releases ever observed from a GRB. Temporal and spectral analyses of GRB 130427A challenge the widely accepted model that the nonthermal high-energy emission in the afterglow phase of GRBs is synchrotron emission radiated by electrons accelerated at an external shock.

  11. Worrying about the LHC, a lesson from astrophysics?

    CERN Multimedia

    CERN. Geneva

    2008-01-01

    To worry about the LHC is a popular sport. I shall share my own worries, hopefully original, and do it via a parable (for this method, I can quote earlier authors). The parable concerns a topic in astrophysics (gamma-ray bursts) which happens to be a simple exercise --but quite an interesting one-- on elementary particle-physics and beam dynamics, topics not unrelated to the LHC. Though most of the talk will be dedicated to the physics and, in particular, to its recent developments, the allegory will allow me to detect what, I shall argue, may be dangerous 'viruses' invading science. I do not have the decisive antidotes, but I shall discuss some possible ones.

  12. Workshop on the origin of the heavy elements: Astrophysical models and experimental challenges, Santa Fe, New Mexico, September 3-4, 1999

    International Nuclear Information System (INIS)

    Haight, Robert C.; Ullmann, John L.; Strottman, Daniel D.; Koehler, Paul E.; Kaeppeler, Franz

    2000-01-01

    This Workshop was held on September 3--4, 1999, following the 10th International Symposium on Capture Gamma-Ray Spectroscopy. Presentations were made by 14 speakers, 6 from the US and 8 from other countries on topics relevant to s-, r- and rp-process nucleosynthesis. Laboratory experiments, both present and planned, and astrophysical observations were represented as were astrophysical models. Approximately 50 scientists participated in this Workshop. These Proceedings consist of copies of vu-graphs presented at the Workshop. For further information, the interested readers are referred to the authors

  13. Monopole, astrophysics and cosmic ray observatory at Gran Sasso

    International Nuclear Information System (INIS)

    Demarzo, C.; Enriquez, O.; Giglietto, N.

    1985-01-01

    A new large area detector, MACRO was approved for installation at the Gran Sasso Laboratory in Italy. The detector will be dedicated to the study of naturally penetrating radiation deep underground. It is designed with the general philosophy of covering the largest possible area with a detector having both sufficient built-in redundancy and use of complementary techniques to study very rare phenomena. The detector capabilities will include monopole investigations significantly below the Parker bound; astrophysics studies of very high energy gamma ray and neutrino point sources; cosmic ray measurements of single and multimuons; and the general observation of rare new forms of matter in the cosmic rays

  14. Monopole, astrophysics and cosmic ray observatory at Gran Sasso

    Science.gov (United States)

    Demarzo, C.; Enriquez, O.; Giglietto, N.; Posa, F.; Attolini, M.; Baldetti, F.; Giacomelli, G.; Grianti, F.; Margiotta, A.; Serra, P.

    1985-01-01

    A new large area detector, MACRO was approved for installation at the Gran Sasso Laboratory in Italy. The detector will be dedicated to the study of naturally penetrating radiation deep underground. It is designed with the general philosophy of covering the largest possible area with a detector having both sufficient built-in redundancy and use of complementary techniques to study very rare phenomena. The detector capabilities will include monopole investigations significantly below the Parker bound; astrophysics studies of very high energy gamma ray and neutrino point sources; cosmic ray measurements of single and multimuons; and the general observation of rare new forms of matter in the cosmic rays.

  15. Promising lines of investigations in the realms of laboratory astrophysics with the aid of powerful lasers

    International Nuclear Information System (INIS)

    Belyaev, V. S.; Batishchev, P. A.; Bolshakov, V. V.; Elkin, K. S.; Karabadzhak, G. F.; Kovkov, D. V.; Matafonov, A. P.; Raykunov, G. G.; Yakhin, R. A.; Pikuz, S. A.; Skobelev, I. Yu.; Faenov, A. Ya.; Fortov, V. E.; Krainov, V. P.; Rozanov, V. B.

    2013-01-01

    The results of work on choosing and substantiating promising lines of research in the realms of laboratory astrophysics with the aid of powerful lasers are presented. These lines of research are determined by the possibility of simulating, under laboratory conditions, problematic processes of presentday astrophysics, such as (i) the generation and evolution of electromagnetic fields in cosmic space and the role of magnetic fields there at various spatial scales; (ii) the mechanisms of formation and evolution of cosmic gamma-ray bursts and relativistic jets; (iii) plasma instabilities in cosmic space and astrophysical objects, plasma jets, and shock waves; (iv) supernova explosions and mechanisms of the explosion of supernovae featuring a collapsing core; (v) nuclear processes in astrophysical objects; (vi) cosmic rays and mechanisms of their production and acceleration to high energies; and (vii) astrophysical sources of x-ray radiation. It is shown that the use of existing powerful lasers characterized by an intensity in the range of 10 18 –10 22 W/cm 2 and a pulse duration of 0.1 to 1 ps and high-energy lasers characterized by an energy in excess of 1 kJ and a pulse duration of 1 to 10 ns makes it possible to perform investigations in laboratory astrophysics along all of the chosen promising lines. The results obtained by experimentally investigating laser plasma with the aid of the laser facility created at Central Research Institute of Machine Building (TsNIIMash) and characterized by a power level of 10 TW demonstrate the potential of such facilities for performing a number of experiments in the realms of laboratory astrophysics.

  16. Nuclear astrophysics

    International Nuclear Information System (INIS)

    Arnould, M.; Takahashi, K.

    1999-01-01

    Nuclear astrophysics is that branch of astrophysics which helps understanding of the Universe, or at least some of its many faces, through the knowledge of the microcosm of the atomic nucleus. It attempts to find as many nuclear physics imprints as possible in the macrocosm, and to decipher what those messages are telling us about the varied constituent objects in the Universe at present and in the past. In the last decades much advance has been made in nuclear astrophysics thanks to the sometimes spectacular progress made in the modelling of the structure and evolution of the stars, in the quality and diversity of the astronomical observations, as well as in the experimental and theoretical understanding of the atomic nucleus and of its spontaneous or induced transformations. Developments in other subfields of physics and chemistry have also contributed to that advance. Notwithstanding the accomplishment, many long-standing problems remain to be solved, and the theoretical understanding of a large variety of observational facts needs to be put on safer grounds. In addition, new questions are continuously emerging, and new facts endangering old ideas. This review shows that astrophysics has been, and still is, highly demanding to nuclear physics in both its experimental and theoretical components. On top of the fact that large varieties of nuclei have to be dealt with, these nuclei are immersed in highly unusual environments which may have a significant impact on their static properties, the diversity of their transmutation modes, and on the probabilities of these modes. In order to have a chance of solving some of the problems nuclear astrophysics is facing, the astrophysicists and nuclear physicists are obviously bound to put their competence in common, and have sometimes to benefit from the help of other fields of physics, like particle physics, plasma physics or solid-state physics. Given the highly varied and complex aspects, we pick here some specific nuclear

  17. EDGE: explorer of diffuse emission and gamma-ray burst explosions

    NARCIS (Netherlands)

    den Herder, J.W.; Piro, L.; Ohashi, T.; Amati, L.; Atteia, J.; Barthelmy, S.D.; Barbera, M.; Barret, D.; Basso, S.; de Boer, M.; Borgani, S.; Boyarskiy, O.; Branchini, E.; Branduardi-Raymont, G.; Briggs, M.; Brunetti, G.; Budtz-Jorgensenf, C.; Burrows, D.N.; Campana, S.; Caroli, E.; Chincarini, G.; Christensen, F.; Cocchi, M.; Comastri, A.; Corsi, A.; Cotroneo, V.; Conconi, P.; Colasanti, L.; Cusamano, G.; Rosa, A.; Del Santo, M.; Ettori, S.; Ezoe, Y.; Ferrari, L.; Feroci, M.; Finger, M.; Fishman, G.; Fujimoto, R.; Galeazzi, M.; Galli, A.; Gatti, F.; Gehrels, N.; Gendre, B.; Ghirlanda, G.; Ghisellini, G.; Giommi, P.; Girardi, M.; Guzzo, L.; Haardt, F.; Hepburn, I.; Hermsen, W.; Hoevers, H.; Holland, A.; in 't Zand, J.J.M.; Ishisaki, Y.; Kawahara, H.; Kawai, N.; Kaastra, J.; Kippen, M.; de Korte, P.A.J.; Kouveliotou, C.; Kusenko, A.; Labanti, C.; Lieu, R.; Macculi, C.; Makishima, K.; Matt, G.; Mazotta, P.; McCammon, D.; Méndez, M.; Mineo, T.; Mitchell, S.; Mitsuda, K.; Molendi, S.; Moscardini, L.; Mushotzky, R.; Natalucci, L.; Nicastro, F.; O'Brien, P.; Osborne, J.; Paerels, F.; Page, M.; Paltani, S.; Pareschi, G.; Perinati, E.; Perola, C.; Ponman, T.; Rasmussen, A.; Roncarelli, M.; Rosati, P.; Ruchayskiy, O.; Quadrini, E.; Sakurai, I.; Salvaterra, R.; Sasaki, S.; Wijers, R.; et al., [Unknown

    2007-01-01

    How structures of various scales formed and evolved from the early Universe up to present time is a fundamental question of astrophysics. EDGE will trace the cosmic history of the baryons from the early generations of massive stars by Gamma-Ray Burst (GRB) explosions, through the period of galaxy

  18. Seroprevalence for hepatitis E virus (HEV infection among volunteer blood donors of the Regional Blood Bank of Londrina, State of Paraná , Brazil Soroprevalência da infecção pelo virus da hepatite E (VHE em candidatos a doadores de sangue voluntários do Hemocentro Regional de Londrina, Londrina, Estado do Paraná, Brasil

    Directory of Open Access Journals (Sweden)

    André Luiz Bortoliero

    2006-04-01

    Full Text Available A cross-sectional study was carried out among 996 volunteer blood donors enrolled from May 1999 to December 1999 to determine the seroprevalence of hepatitis E virus (HEV infection among volunteer blood donors of the Regional Blood Bank of Londrina, State of Paraná, Brazil, and to evaluate whether the rate of seroprevalence of IgG anti-HEV antibodies is associated with sociodemographic variables and with seropositivity for hepatitis A virus (HAV infection. All participants answered the questionnaire regarding the sociodemographic characterisitcs. Serum samples were tested for IgG antibodies to HEV (anti-HEV by an enzyme linked immunoassay (ELISA. All serum samples positive for anti-HEV IgG and 237 serum samples negative for anti-HEV were also assayed for IgG anti-HAV antibodies by ELISA. Anti-HEV IgG was confirmed in 23/996 samples, resulting in a seroprevalence of 2.3% for HEV infection, similar to previous results obtained in developed countries. No significant association was found between the presence of anti-HEV IgG antibodies and the sociodemographic variables including gender, age, educational level, rural or urban areas, source of water, and sewer system (p > 0.05. Also, no association with seropositivity for anti-HAV IgG antibodies was observed (p > 0.05. Although this study revealed a low seroprevalence of HEV infection in the population evaluated, the results showed that this virus is circulating among the population from Londrina, South Brazil, and point out the need of further studies to define the clinical and epidemiological importance of HEV infection and to identify additional risk factors involved in the epidemiology and pathogenesis of this infection in this population.Os objetivos do estudo foram determinar a soroprevalência da infecção pelo vírus da hepatite E (VHE em candidatos a doadores de sangue voluntários do Hemocentro Regional de Londrina, Paraná, e avaliar se essa soroprevalência está associada com vari

  19. The Fermi Gamma-Ray Space Telescope, Exploding Stars, Neutron Stars, and Black Holes

    Science.gov (United States)

    Thompson, David J.

    2010-01-01

    Since August, 2008, the Fermi Gamma-ray Space Telescope has been scanning the sky, producing a full-sky image every three hours. These cosmic gamma-rays come from extreme astrophysical phenomena, many related to exploding stars (supernovae) or what these explosions leave behind: supernova remnants, neutron stars, and black holes. This talk uses sample Fermi results, plus simple demonstrations, to illustrate the exotic properties of these endpoints of stellar evolution.

  20. Scientific and technical progress in high-energy astrophysics at INPE

    International Nuclear Information System (INIS)

    Bui-Van, N.A.; Jayanthi, U.B.; Jardim, J.O.D.; Braga, J.; Santo, C.M.E.

    1984-01-01

    The recent advances in high-energy Astrophysics pertains to the study of compact objects in galactic nuclei, binary systems and pulsars. These aspects are best understood by the study of the emissions in X- and gamma rays of these objects through the temporal variation in flux and spectrum. The Southern Hemisphere offers some of the unique objects for investigations such as galactic center, the Vela pulsar etc. For high temporal and spectra resolution studies two telescopes 'GeLi' and 'Pulsar' were designed and constructed. To support these scientific activities, a program in balloon launching and data acquisition facilities has been developed since 1971. The 'Balloon Launching Center' of INPE has capacity to launch balloons of -850,000 m 3 with payloads weighting about 1,000 Kg. Taking advantage of these facilities, project 'Bantar', with the goal to measure the atmospheric gamma-ray radiation in the Antartic Region, is under progress. (Author) [pt

  1. INTEGRAL Upper Limits on Gamma-Ray Emission Associated with the Gravitational Wave Event GW150914

    DEFF Research Database (Denmark)

    Savchenko, V.; Ferrigno, C.; Natalucci, L.

    Using observations of the INTErnational Gamma-Ray Astrophysics Laboratory (INTEGRAL), we place upper limits on the gamma-ray and hard X-ray prompt emission associated with the gravitational wave event GW150914, discovered by the LIGO/Virgo Collaboration. The omnidirectional view of the INTEGRAL...... MeV energy range for typical spectral models. Our results constrain the ratio of the energy promptly released in gamma-rays in the direction of the observer to the gravitational wave energy Eγ/EGW gravitational wave...

  2. Astrophysical Hydrodynamics An Introduction

    CERN Document Server

    Shore, Steven N

    2007-01-01

    This latest edition of the proven and comprehensive treatment on the topic -- from the bestselling author of ""Tapestry of Modern Astrophysics"" -- has been updated and revised to reflect the newest research results. Suitable for AS0000 and AS0200 courses, as well as advanced astrophysics and astronomy lectures, this is an indispensable theoretical backup for studies on celestial body formation and astrophysics. Includes exercises with solutions.

  3. Indirect techniques in nuclear astrophysics

    International Nuclear Information System (INIS)

    Mukhamedzhanov, A.M.; Tribble, R.E.; Blokhintsev, L.D.; Cherubini, S.; Spitaleri, C.; Kroha, V.; Nunes, F.M.

    2005-01-01

    It is very difficult or often impossible to measure in the lab conditions nuclear cross sections at astrophysically relevant energies. That is why different indirect techniques are used to extract astrophysical information. In this talk different experimental possibilities to get astrophysical information using radioactive and stable beams will be addressed. 1. The asymptotic normalization coefficient (ANC) method. 2. Radiative neutron captures are determined by the spectroscopic factors (SP). A new experimental technique to determine the neutron SPs will be addressed. 3. 'Trojan Horse' is another unique indirect method, which allows one to extract the astrophysical factors for direct and resonant nuclear reactions at astrophysically relevant energies. (author)

  4. Scaling law in laboratory astrophysics

    International Nuclear Information System (INIS)

    Xia Jiangfan; Zhang Jie

    2001-01-01

    The use of state-of-the-art lasers makes it possible to produce, in the laboratory, the extreme conditions similar to those in astrophysical processes. The introduction of astrophysics-relevant ideas in laser-plasma interaction experiments is propitious to the understanding of astrophysical phenomena. However, the great difference between laser-produced plasma and astrophysical objects makes it awkward to model the latter by laser-plasma experiments. The author presents the physical reasons for modeling astrophysical plasmas by laser plasmas, connecting these two kinds of plasmas by scaling laws. This allows the creation of experimental test beds where observation and models can be quantitatively compared with laboratory data

  5. Astrophysical s-factor measurements for {sup 1}20Te(p,{gamma}){sup 1}21I and {sup 1}20Te(p,n){sup 1}20I reactions; {sup 1}20Te(p,{gamma}){sup 1}21I ve {sup 1}20Te(p,n){sup 1}20I reaksiyonlarinin astrofiziksel s-factor oelcuemleri

    Energy Technology Data Exchange (ETDEWEB)

    Gueray, R T; Oezkan, N; Yalcin, C [Kocaeli University, Kocaeli (Turkey); Goerres, J; DeBoer, R; Palumbo, A; Tan, W P; Wiescher, M [University of Notre Dame, (United States); Fueloep, Zs; Somorjai, E [Institute of Nuclear Research ATOMKI (Hungary); Lee, H Y [Argonne National Laboratory (United States)

    2009-07-01

    Astrophysical S-factors for the {sup 1}20Te(p,{gamma}){sup 1}21I and {sup 1}20Te(p,n){sup 1}20I reactions have been measured in the effective center-of-mass energies between 2.47 MeV and 7.93 MeV. Experimental data have been compared with the Hauser-Fesbach statistical model calculations obtained with the model codes NON-SMOKER and TALYS. The discrepancies between the experimental results and calculations can mainly be attributed to the optical model potentials used in the codes.

  6. Nuclear astrophysics

    International Nuclear Information System (INIS)

    Haxton, W.C.

    1992-01-01

    The problem of core-collapse supernovae is used to illustrate the many connections between nuclear astrophysics and the problems nuclear physicists study in terrestrial laboratories. Efforts to better understand the collapse and mantle ejection are also motivated by a variety of interdisciplinary issues in nuclear, particle, and astrophysics, including galactic chemical evolution, neutrino masses and mixing, and stellar cooling by the emission of new particles. The current status of theory and observations is summarized

  7. GRASP. Development of an event reconstruction method using a gamma ray air shower parameterisation and applications to γ-ray sources with H.E.S.S

    Energy Technology Data Exchange (ETDEWEB)

    Hillert, Andreas

    2014-07-24

    The H.E.S.S. experiment, with its high sensitivity and large field-of-view, is an ideal instrument to survey the Milky Way in VHE γ-rays. An accurate reconstruction of the γ-ray direction as well as a strong reduction of the hadronic background is essential for the analysis of the data. In this work a reconstruction algorithm is developed that applies a fit of pixel amplitudes to an expected image obtained from a Gamma Ray Air Shower Parameterisation (GRASP). This parameterisation was obtained using Monte Carlo air shower simulations by parameterising the angular Cherenkov photon distribution with suitable analytical functions. Furthermore, it provides new classifying variables to differentiate γ-ray induced air showers from hadronic ones. The reconstruction of air shower parameters is achieved by a maximum likelihood fit and improves the angular resolution by 20-30% with respect to traditional image moment analysis methods. In combination with a MVA-based background rejection method using these new classifying variables the sensitivity can be improved by about 70%. An analysis of the Pulsar Wind Nebula MSH 15-5-2 and investigation of its morphology and spectral properties show an indication of energy dependent morphology in VHE γ-rays.

  8. Experimental studies of nuclear astrophysics

    International Nuclear Information System (INIS)

    He Jianjun; Zhou Xiaohong; Zhang Yuhu

    2013-01-01

    Nuclear astrophysics is an interdisciplinary subject combining micro-scale nuclear physics and macro-scale astrophysics. Its main aims are to understand the origin and evolution of the elements in the universe, the time scale of stellar evolution, the stellar environment and sites, the energy generation of stars from thermonuclear processes and its impact on stellar evolution and the mechanisms driving astrophysical phenomena, and the structure and property of compact stars. This paper presents the significance and current research status of nuclear astrophysics; we introduce some fundamental concepts, the nuclear physics input parameters required by certain astrophysics models, and some widely-used experimental approaches in nuclear astrophysics research. The potential and feasibility of research in this field using China’s current and planned large-scale scientific facilities are analyzed briefly. Finally, the prospects of the establishing a deep underground science and engineering laboratory in China are envisaged. (authors)

  9. Important plasma problems in astrophysics

    International Nuclear Information System (INIS)

    Kulsrud, R.M.

    1995-01-01

    In astrophysics, plasmas occur under very extreme conditions. For example, there are ultrastrong magnetic fields in neutron stars, relativistic plasmas around black holes and in jets, extremely energetic particles such as cosmic rays in the interstellar medium, extremely dense plasmas in accretion disks, and extremely large magnetic Reynolds numbers in the interstellar medium. These extreme limits for astrophysical plasmas make plasma phenomena much simpler to analyze in astrophysics than in the laboratory. An understanding of such phenomena often results in an interesting way, by simply taking the extreme limiting case of a known plasma theory. The author will describe one of the more exciting examples and will attempt to convey the excitement he felt when he was first exposed to it. However, not all plasma astrophysical phenomena are so simple. There are certain important plasma phenomena in astrophysics that have not been so easily resolved. In fact, a resolution of them is blocking significant progress in astrophysical research. They have not yet yielded to attacks by theoretical astrophysicists nor to extensive numerical simulation. The author will attempt to describe one of the more important of these plasma--astrophysical problems, and discuss why its resolution is so important to astrophysics. This significant example is fast, magnetic reconnection. Another significant example is the large-magnetic-Reynolds number magnetohydrodynamics (MHD) dynamos

  10. Relativistic astrophysics

    CERN Document Server

    Demianski, Marek

    2013-01-01

    Relativistic Astrophysics brings together important astronomical discoveries and the significant achievements, as well as the difficulties in the field of relativistic astrophysics. This book is divided into 10 chapters that tackle some aspects of the field, including the gravitational field, stellar equilibrium, black holes, and cosmology. The opening chapters introduce the theories to delineate gravitational field and the elements of relativistic thermodynamics and hydrodynamics. The succeeding chapters deal with the gravitational fields in matter; stellar equilibrium and general relativity

  11. Relativistic astrophysics and theory of gravity

    International Nuclear Information System (INIS)

    Zel'dovich, Ya.B.

    1982-01-01

    A brief historical review of the development of astrophysical science in the State Astrophysical Institute named after Shternberg (SAISh) has been given in a popular form. The main directions of the SAISh astrophysical investigations have been presented: relativistic theory of gravity, relativistic astrophysics of interplanetary medium and cosmology

  12. Astrophysics Decoding the cosmos

    CERN Document Server

    Irwin, Judith A

    2007-01-01

    Astrophysics: Decoding the Cosmos is an accessible introduction to the key principles and theories underlying astrophysics. This text takes a close look at the radiation and particles that we receive from astronomical objects, providing a thorough understanding of what this tells us, drawing the information together using examples to illustrate the process of astrophysics. Chapters dedicated to objects showing complex processes are written in an accessible manner and pull relevant background information together to put the subject firmly into context. The intention of the author is that the book will be a 'tool chest' for undergraduate astronomers wanting to know the how of astrophysics. Students will gain a thorough grasp of the key principles, ensuring that this often-difficult subject becomes more accessible.

  13. Gravity, particles and astrophysics

    International Nuclear Information System (INIS)

    Wesson, P.S.

    1980-01-01

    The author deals with the relationship between gravitation and elementary particle physics, and the implications of these subjects for astrophysics. The text is split up into two parts. The first part represents a relatively non-technical overview of the subject, while the second part represents a technical examination of the most important aspects of non-Einsteinian gravitational theory and its relation to astrophysics. Relevant references from the fields of gravitation, elementary particle theory and astrophysics are included. (Auth.)

  14. Astrophysical Concepts

    CERN Document Server

    Harwit, Martin

    2006-01-01

    This classic text, aimed at senior undergraduates and beginning graduate students in physics and astronomy, presents a wide range of astrophysical concepts in sufficient depth to give the reader a quantitative understanding of the subject. Emphasizing physical concepts, the book outlines cosmic events but does not portray them in detail: it provides a series of astrophysical sketches. For this fourth edition, nearly every part of the text has been reconsidered and rewritten, new sections have been added to cover recent developments, and others have been extensively revised and brought up to date. The book begins with an outline of the scope of modern astrophysics and enumerates some of the outstanding problems faced in the field today. The basic physics needed to tackle these questions are developed in the next few chapters using specific astronomical processes as examples. The second half of the book enlarges on these topics and shows how we can obtain quantitative insight into the structure and evolution of...

  15. Nuclear physics with advanced brilliant gamma beams at ELI–NP

    Directory of Open Access Journals (Sweden)

    Ur Călin A.

    2016-01-01

    Full Text Available The Extreme Light Infrastructure - Nuclear Physics facility is dedicated to nuclear physics studies with the use of extreme electromagnetic radiation. One of the main research system to be installed and operated in the facility is an outstanding high brilliance gamma beam system. The Gamma Beam System of ELI–NP will produce intense, quasi–monochromatic gamma beams via inverse Compton scattering of short laser pulses on relativistic electron beam pulses. The gamma beams available at ELI–NP will allow for the performance of photo-nuclear reactions aiming to reveal the intimate structure of the atomic nucleus. Nuclear Resonance Fluorescence, photo-fission, photo-disintegration reactions above the particle threshold will be used to study the dipole response of nuclei, the structure of the Pygmy resonances, nuclear processes relevant for astrophysics, production and study of exotic neutron–rich nuclei.

  16. Encyclopedia of Astronomy and Astrophysics

    CERN Document Server

    2002-01-01

    Interstellar medium, Light, Magnetisphere, Matter, Planet Earth, Public Impact, Solar Activity, Solar Heliosphere, Solar Interior, Solar Systems, Space, Stellar Astrophysics, Stellar Populations, Telescopes, Time The Encyclopedia of Astronomy and Astrophysics covers 30 major subject areas, such as Active galaxies, Astrometry, Astrophysical theory, Atmospheres, Binary stars, Biography, Clusters, Coordinates, Cosmology, Earth, Education, Galaxies,

  17. Astrophysics and particle physics in space with the Alpha Magnetic Spectrometer

    CERN Document Server

    Lamanna, G

    2003-01-01

    The Alpha Magnetic Spectrometer is a high energy particle physics experiment in space scheduled to be installed on the International Space Station (ISS) by 2006 for a three-year mission. After a precursor flight of a prototype detector on board of the NASA Space Shuttle in June 1998, the construction of the detector in its final configuration is started and it will be completed by 2004. The purpose of this experiment is to provide a high statistics measurement of charged particles and nuclei in rigidity range 0.5 GV to few TV and to explore the high-energy (>1 GeV) gamma-ray sky. In this paper we describe the detector layout and present an overview of the main scientific goals both in the domain of astrophysics: cosmic- ray origin, age and propagation and the exploration of the most energetic gamma-ray sources; and in the domain of astroparticle: the antimatter and the dark matter searches. (53 refs).

  18. Plasma in astrophysics

    International Nuclear Information System (INIS)

    Kulsrud, R.M.

    1982-10-01

    Two examples of plasma phenomena of importance to astrophysics are reviewed. These are examples where astrophysical understanding hinges on further progress in plasma physics understanding. The two examples are magnetic reconnection and the collisionless interaction between a population of energetic particles and a cooler gas or plasma, in particular the interaction between galactic cosmic rays and the interstellar medium

  19. Astrophysics in a nutshell

    CERN Document Server

    Maoz, Dan

    2007-01-01

    A concise but thorough introduction to the observational data and theoretical concepts underlying modern astronomy, Astrophysics in a Nutshell is designed for advanced undergraduate science majors taking a one-semester course. This well-balanced and up-to-date textbook covers the essentials of modern astrophysics--from stars to cosmology--emphasizing the common, familiar physical principles that govern astronomical phenomena, and the interplay between theory and observation. In addition to traditional topics such as stellar remnants, galaxies, and the interstellar medium, Astrophysics in a N

  20. CELESTE an atmospheric Cherenkov telescope for high energy gamma astrophysics

    CERN Document Server

    Paré, E; Bazer-Bachi, R; Bergeret, H; Berny, F; Briand, N; Bruel, P; Cerutti, M; Collon, J; Cordier, A; Cornebise, P; Debiais, G; Dezalay, J P; Dumora, D; Durand, E; Eschstruth, P T; Espigat, P; Fabre, B; Fleury, P; Gilly, J; Gouillaud, J C; Gregory, C; Herault, N; Holder, J; Hrabovsky, M; Incerti, S; Jouenne, A; Kalt, L; Legallou, R; Lott, B; Lodygensky, O; Manigot, P; Manseri, H; Manitaz, H; Martin, M; Morano, R; Morineaud, G; Muenz, F; Musquere, A; Naurois, M D; Neveu, J; Noppe, J M; Olive, J F; Palatka, M; Pérez, A; Quebert, J; Rebii, A; Reposeur, T; Rob, L; Roy, P; Sans, J L; Sako, T; Schovanek, P; Smith, D A; Snabre, P; Villard, G

    2002-01-01

    CELESTE is an atmospheric Cherenkov telescope based on the sampling method which makes use of the de-commissioned THEMIS solar electrical plant in the French Pyrenees. A large (2000 m sup 2) mirror surface area from 40 independent heliostats followed by a secondary optic, a trigger system using analog summing techniques and signal digitization with 1 GHz flash ADCs make possible the detection of cosmic gamma-rays down to 30 GeV. This paper provides a detailed technical description of the CELESTE installation.

  1. Astrophysical Institute, Potsdam

    Science.gov (United States)

    Murdin, P.

    2000-11-01

    Built upon a tradition of almost 300 years, the Astrophysical Institute Potsdam (AIP) is in an historical sense the successor of one of the oldest astronomical observatories in Germany. It is the first institute in the world which incorporated the term `astrophysical' in its name, and is connected with distinguished scientists such as Karl Schwarzschild and Albert Einstein. The AIP constitutes on...

  2. Black hole astrophysics

    International Nuclear Information System (INIS)

    Blandford, R.D.; Thorne, K.S.

    1979-01-01

    Following an introductory section, the subject is discussed under the headings: on the character of research in black hole astrophysics; isolated holes produced by collapse of normal stars; black holes in binary systems; black holes in globular clusters; black holes in quasars and active galactic nuclei; primordial black holes; concluding remarks on the present state of research in black hole astrophysics. (U.K.)

  3. Search for tiny or transient sources in the Galaxy's central regions with H.E.S.S. - Application to the study of supernova W49B's remnant region

    International Nuclear Information System (INIS)

    Brun, F.

    2011-09-01

    H.E.S.S. (High Energy Stereoscopic System) is an array of four very-high energy (VHE) gamma-ray telescopes located in Namibia. These telescopes use the atmospheric Cherenkov imaging technique to detect gamma-rays between 100 GeV and a few tens of TeV. The H.E.S.S. cameras, each composed of 960 photomultiplier tubes and a fast electronics, need an accurate calibration of the shower to electronic signal conversion. A spurious capacitive coupling between the photomultiplier tubes and the data acquisition system (the common modes) was revealed and corrected during this thesis, resulting in data of better quality. H.E.S.S. is ideally located to observe the inner regions of the Galactic plane. Hence, the Galactic Plane Survey has been one of the primary goal since the beginning of the array operation in 2004 and led to unveiling the diversity of the VHE gamma-ray sources. This thesis presents the search for VHE gamma-ray sources in the inner regions of the Galactic plane using the most sensitive semi-analytical model based analysis currently available. A search for transient sources was also performed for these regions using powerful methods based on the time difference between consecutive events. These methods have been precisely characterized by simulation and didn't lead to the detection of significant variable sources. The very-high energy gamma-ray emission from the W49 region and the supernova remnant W49B in particular has been revealed during this thesis. The analysis of this region and the implications of this discovery are described in detail in this manuscript. (author)

  4. Plasma astrophysics

    CERN Document Server

    Kaplan, S A; ter Haar, D

    2013-01-01

    Plasma Astrophysics is a translation from the Russian language; the topics discussed are based on lectures given by V.N. Tsytovich at several universities. The book describes the physics of the various phenomena and their mathematical formulation connected with plasma astrophysics. This book also explains the theory of the interaction of fast particles plasma, their radiation activities, as well as the plasma behavior when exposed to a very strong magnetic field. The text describes the nature of collective plasma processes and of plasma turbulence. One author explains the method of elementary

  5. An invitation to astrophysics

    CERN Document Server

    Padmanabhan, Thanu

    2006-01-01

    This unique book provides a clear and lucid description of several aspects of astrophysics and cosmology in a language understandable to a physicist or beginner in astrophysics. It presents the key topics in all branches of astrophysics and cosmology in a simple and concise language. The emphasis is on currently active research areas and exciting new frontiers rather than on more pedantic topics. Many complicated results are introduced with simple, novel derivations which strengthen the conceptual understanding of the subject. The book also contains over one hundred exercises which will help s

  6. Particle Astrophysics after COBE- Blois 92- Summary Talk

    Science.gov (United States)

    Primack, J. R.

    The IV Rencontres de Blois, on Particle Astrophysics, held at the Ch\\^ateau de Blois, June 15-20, 1992, was a meeting well-timed for a reconsideration of the issues in particle astrophysics in the light of the COBE discovery of the cosmic microwave background (CMB) fluctuations. This is a summary of what I thought were the most interesting things discussed at Blois: (1) The near-success of Cold Dark Matter (CDM) in predicting the COBE fluctuation amplitude, which favors the hypothesis that structure formed in the universe through gravitational collapse. (2) The indications that $\\Omega\\approx1$ and that the power spectrum has a little more power on supercluster and larger scales than CDM. These are suggested by the IRAS and CfA redshift surveys and POTENT galaxy peculiar velocity analysis, and also by the COBE data. (3) The consequent demise of CDM and the rise of hybrid schemes such as Cold+Hot Dark Matter (C+HDM). (4) The possible implications for neutrino masses and mixings, and for cosmology, of the recent results on solar neutrinos. (5) The first discovery of TeV $\\gamma$ rays from an extragalactic source, which was announced at Blois. I also summarize here a number of the exciting ongoing and planned experiments and observations discussed at Blois: CERN experiments on $\

  7. Nuclear physics and astrophysics

    International Nuclear Information System (INIS)

    Schramm, D.N.; Olinto, A.V.

    1993-06-01

    The authors report on recent progress of research at the interface of nuclear physics and astrophysics. During the past year, the authors continued to work on Big Bang and stellar nucleosynthesis, the solar neutrino problem, the equation of state for dense matter, the quark-hadron phase transition, and the origin of gamma-ray bursts; and began studying the consequences of nuclear reaction rates in the presence of strong magnetic fields. They have shown that the primordial production of B and Be cannot explain recent detections of these elements in halo stars and have looked at spallation as the likely source of these elements. By looking at nucleosynthesis with inhomogeneous initial conditions, they concluded that the Universe must have been very smooth before nucleosynthesis. They have also constrained neutrino oscillations and primordial magnetic fields by Big Bang nucleosynthesis. On the solar neutrino problem, they have analyzed the implications of the SAGE and GALLEX experiments. They also showed that the presence of dibaryons in neutron stars depends weakly on uncertainties of nuclear equations of state. They have started to investigate the consequences of strong magnetic fields on nuclear reactions and implications for neutron star cooling and supernova nucleosynthesis

  8. White Paper on Nuclear Astrophysics and Low Energy Nuclear Physics - Part 1. Nuclear Astrophysics

    Energy Technology Data Exchange (ETDEWEB)

    Arcones, Almudena [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Escher, Jutta E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Others, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2016-04-04

    This white paper informs the nuclear astrophysics community and funding agencies about the scientific directions and priorities of the field and provides input from this community for the 2015 Nuclear Science Long Range Plan. It summarizes the outcome of the nuclear astrophysics town meeting that was held on August 21 - 23, 2014 in College Station at the campus of Texas A&M University in preparation of the NSAC Nuclear Science Long Range Plan. It also reflects the outcome of an earlier town meeting of the nuclear astrophysics community organized by the Joint Institute for Nuclear Astrophysics (JINA) on October 9 - 10, 2012 Detroit, Michigan, with the purpose of developing a vision for nuclear astrophysics in light of the recent NRC decadal surveys in nuclear physics (NP2010) and astronomy (ASTRO2010). The white paper is furthermore informed by the town meeting of the Association of Research at University Nuclear Accelerators (ARUNA) that took place at the University of Notre Dame on June 12 - 13, 2014. In summary we find that nuclear astrophysics is a modern and vibrant field addressing fundamental science questions at the intersection of nuclear physics and astrophysics. These questions relate to the origin of the elements, the nuclear engines that drive life and death of stars, and the properties of dense matter. A broad range of nuclear accelerator facilities, astronomical observatories, theory efforts, and computational capabilities are needed. With the developments outlined in this white paper, answers to long-standing key questions are well within reach in the coming decade.

  9. White paper on nuclear astrophysics and low energy nuclear physics Part 1: Nuclear astrophysics

    International Nuclear Information System (INIS)

    Arcones, Almudena; Bardayan, Dan W.

    2016-01-01

    This white paper informs the nuclear astrophysics community and funding agencies about the scientific directions and priorities of the field and provides input from this community for the 2015 Nuclear Science Long Range Plan. It also summarizes the outcome of the nuclear astrophysics town meeting that was held on August 21–23, 2014 in College Station at the campus of Texas A&M University in preparation of the NSAC Nuclear Science Long Range Plan. It also reflects the outcome of an earlier town meeting of the nuclear astrophysics community organized by the Joint Institute for Nuclear Astrophysics (JINA) on October 9–10, 2012 Detroit, Michigan, with the purpose of developing a vision for nuclear astrophysics in light of the recent NRC decadal surveys in nuclear physics (NP2010) and astronomy (ASTRO2010). Our white paper is informed informed by the town meeting of the Association of Research at University Nuclear Accelerators (ARUNA) that took place at the University of Notre Dame on June 12–13, 2014. In summary we find that nuclear astrophysics is a modern and vibrant field addressing fundamental science questions at the intersection of nuclear physics and astrophysics. These questions relate to the origin of the elements, the nuclear engines that drive life and death of stars, and the properties of dense matter. A broad range of nuclear accelerator facilities, astronomical observatories, theory efforts, and computational capabilities are needed. Answers to long standing key questions are well within reach in the coming decade because of the developments outlined in this white paper.

  10. Cosmic gamma ray detection and discovery potential with the AMS-2 spectrometer; Detection de rayons {gamma} cosmiques et potentiel de decouvertes avec le spectrometre AMS-02

    Energy Technology Data Exchange (ETDEWEB)

    Girard, L

    2004-12-15

    Yet designed to measure charged component of the cosmic rays, the foreseen Alpha Magnetic Spectrometer (AMS-02) could also release {gamma}-ray studies, in the energy range from GeV to TeV, using the tracker system, for {gamma}-rays converted in e{sup +}e{sup -} pair, and the electromagnetic calorimeter. In the first part of the thesis are described the calibrations and the performances of the engineering model of the calorimeter, obtained from the analysis of data taken during a test-beam performed at CERN in July 2002. In the second part of the thesis, the AMS-02 discovery potential for {gamma}-astrophysics is presented. While exposure maps of the {gamma}--sky are computed for one year of data taking with the {gamma}--detectors, the acceptance of the calorimeter is obtained from Monte-Carlo simulations. The AMS-02 potential is then estimated for signals from the Vela pulsar and for some supersymmetric signals from the Galactic Center. (author)

  11. Nuclear astrophysics: An application of nuclear physics

    International Nuclear Information System (INIS)

    Fueloep, Z.

    2005-01-01

    Nuclear astrophysics, a fruitful combination of nuclear physics and astrophysics can be viewed as a special application of nuclear physics where the study of nuclei and their reactions are motivated by astrophysical problems. Nuclear astrophysics is also a good example for the state of the art interdisciplinary research. The origin of elements studied by geologists is explored by astrophysicists using nuclear reaction rates provided by the nuclear physics community. Due to the high interest in the field two recent Nuclear Physics Divisional Conferences of the European Physical Society were devoted to nuclear astrophysics and a new conference series entitled 'Nuclear Physics in Astrophysics' has been established. Selected problems of nuclear astrophysics will be presented emphasizing the interplay between nuclear physics and astrophysics. As an example the role of 14 N(p,r) 15 O reaction rate in the determination of the age of globular clusters will be discussed in details

  12. Parametric Model for Astrophysical Proton-Proton Interactions and Applications

    Energy Technology Data Exchange (ETDEWEB)

    Karlsson, Niklas [KTH Royal Institute of Technology, Stockholm (Sweden)

    2007-01-01

    Observations of gamma-rays have been made from celestial sources such as active galaxies, gamma-ray bursts and supernova remnants as well as the Galactic ridge. The study of gamma rays can provide information about production mechanisms and cosmic-ray acceleration. In the high-energy regime, one of the dominant mechanisms for gamma-ray production is the decay of neutral pions produced in interactions of ultra-relativistic cosmic-ray nuclei and interstellar matter. Presented here is a parametric model for calculations of inclusive cross sections and transverse momentum distributions for secondary particles--gamma rays, e±, ve, $\\bar{v}$e, vμ and $\\bar{μ}$e--produced in proton-proton interactions. This parametric model is derived on the proton-proton interaction model proposed by Kamae et al.; it includes the diffraction dissociation process, Feynman-scaling violation and the logarithmically rising inelastic proton-proton cross section. To improve fidelity to experimental data for lower energies, two baryon resonance excitation processes were added; one representing the Δ(1232) and the other multiple resonances with masses around 1600 MeV/c2. The model predicts the power-law spectral index for all secondary particle to be about 0.05 lower in absolute value than that of the incident proton and their inclusive cross sections to be larger than those predicted by previous models based on the Feynman-scaling hypothesis. The applications of the presented model in astrophysics are plentiful. It has been implemented into the Galprop code to calculate the contribution due to pion decays in the Galactic plane. The model has also been used to estimate the cosmic-ray flux in the Large Magellanic Cloud based on HI, CO and gamma-ray observations. The transverse momentum distributions enable calculations when the proton distribution is anisotropic. It is shown that the gamma-ray spectrum and flux due to a

  13. Searching for gravitational waves associated with gamma-ray bursts int 2009-2010 LIGO-Virgo data

    International Nuclear Information System (INIS)

    Was, M.

    2011-01-01

    In this thesis we present the results of the search for gravitational wave bursts associated with gamma-ray bursts in the 2009-2010 data from the LIGO-Virgo gravitational wave interferometer network. The study of gamma-ray bursts progenitors, both from the gamma-ray emission and the gravitational wave emission point of view, yields the characteristic of the sought signal: polarization, time delays, etc... This knowledge allows the construction of a data analysis method which includes the astrophysical priors on joint gravitational wave and gamma-ray emission, and moreover which is robust to non-stationary transient noises, which are present in the data. The lack of detection in the analyzed data yields novel observational limits on the gamma-ray burst population. (author)

  14. First detection of very-high-energy gamma-ray emission from the extreme blazar PGC 2402248 with the MAGIC telescopes

    Science.gov (United States)

    Mirzoyan, Razmik

    2018-04-01

    The MAGIC collaboration reports the first detection of very-high-energy (VHE; E > 100 GeV) gamma-ray emission from PGC 2402248, also known as 2WHSP J073326.7+515354 (Chang et al. 2016, A & A, 598, A17) with coordinates R.A.: 07:33:26.7 h, Dec: +51:53:54.99 deg. The source is classified as an extreme high-energy peaked BL Lacertae object of unknown redshift, included in the 2WHSP catalog with a synchrotron peak located at 10^17.9 Hz. PGC 2402248 was observed with the MAGIC telescopes from 2018/01/23 to 2018/04/18 (MJD 58141-58226) for about 23 h. The preliminary analysis of these data resulted in the detection of PGC 2402248 with a statistical significance of more than 6 standard deviations.

  15. Calibration and simulation of a gamma array for DRAGON at ISAC

    CERN Document Server

    Gigliotti, D G; Hussein, A H

    2003-01-01

    A gamma ray detector has been built for the DRAGON facility at TRIUMF to detect the gamma ray emitted in astrophysically important proton and alpha radiative capture reactions. The gamma detector was designed to balance cost with maximum solid angle coverage and efficiency. To study the properties of the current design, GEANT simulations are being carried out and compared with prototype measurements using calibration sources and radioactive beams supplied by ISAC. Simulations will be compared with data allowing a realistic simulation to be produced. This modified simulation will then be used to provide efficiency predictions of the gamma array when an actual experiment's parameters are inputted. Using the simulated efficiency of the array, cross sections for radiative capture can be calculated from the measured gamma ray yields, for the individual reactions. The following will outline some initial results of background suppression of beam related experiments. Also shown, are some preliminary comparison of poi...

  16. Neutrino astrophysics

    International Nuclear Information System (INIS)

    Roulet, E.

    2001-01-01

    A general overview of neutrino physics and astrophysics is given, starting with a historical account of the development of our understanding of neutrinos and how they helped to unravel the structure of the Standard Model. We discuss why it is so important to establish if neutrinos are massive and introduce the main scenarios to provide them a mass. The present bounds and the positive indications in favor of non-zero neutrino masses are discussed, including the recent results on atmospheric and solar neutrinos. The major role that neutrinos play in astrophysics and cosmology is illustrated. (author)

  17. About cosmic gamma ray lines

    Science.gov (United States)

    Diehl, Roland

    2017-06-01

    Gamma ray lines from cosmic sources convey the action of nuclear reactions in cosmic sites and their impacts on astrophysical objects. Gamma rays at characteristic energies result from nuclear transitions following radioactive decays or high-energy collisions with excitation of nuclei. The gamma-ray line from the annihilation of positrons at 511 keV falls into the same energy window, although of different origin. We present here the concepts of cosmic gamma ray spectrometry and the corresponding instruments and missions, followed by a discussion of recent results and the challenges and open issues for the future. Among the lessons learned are the diffuse radioactive afterglow of massive-star nucleosynthesis in 26Al and 60Fe gamma rays, which is now being exploited towards the cycle of matter driven by massive stars and their supernovae; large interstellar cavities and superbubbles have been recognised to be of key importance here. Also, constraints on the complex processes making stars explode as either thermonuclear or core-collapse supernovae are being illuminated by gamma-ray lines, in this case from shortlived radioactivities from 56Ni and 44Ti decays. In particular, the three-dimensionality and asphericities that have recently been recognised as important are enlightened in different ways through such gamma-ray line spectroscopy. Finally, the distribution of positron annihilation gamma ray emission with its puzzling bulge-dominated intensity disctribution is measured through spatially-resolved spectra, which indicate that annihilation conditions may differ in different parts of our Galaxy. But it is now understood that a variety of sources may feed positrons into the interstellar medium, and their characteristics largely get lost during slowing down and propagation of positrons before annihilation; a recent microquasar flare was caught as an opportunity to see positrons annihilate at a source.

  18. International spring school observing the X-and gamma-ray sky

    International Nuclear Information System (INIS)

    Paul, J.; Longair, M.; Von Ballmoos, P.; Daigne, F.; Baring, M.; Gudel, M.; King, A.; Dotani, T.; Arnaud, M.; Gudel, M.; Malzac, J.; Servillat, M.; Soldi, S.; Corbel, S.; Beckmann, V.; Rodriguez, J.; Erlund, M.; Bodaghee, A.; Graham, J.; Ruiz, A.; Corbel, S.; Fabian, A.; Tagger, M.; Grenier, I.; Bernard, R.; Jackson, N.; Eckart, A.; Grenier, I.; Belloni, T.; Stella, L.; Vink, J.; KnodLseder, J.; Hermsen, W.; Ferrando, Ph.; Ibragimov, A.

    2006-01-01

    This school, dedicated to young researchers, will clarify our present knowledge of the X-ray sky and give the opportunity to learn about the observatories and tools which are available. The contributions have been organized into 3 issues: -) fundamental physics, -) X-ray and Gamma-ray instruments and analysis techniques, and -) astrophysical objects. This document gathers only the slides of the presentations

  19. International spring school observing the X-and gamma-ray sky

    Energy Technology Data Exchange (ETDEWEB)

    Paul, J; Longair, M; Von Ballmoos, P; Daigne, F; Baring, M; Gudel, M; King, A; Dotani, T; Arnaud, M; Gudel, M; Malzac, J; Servillat, M; Soldi, S; Corbel, S; Beckmann, V; Rodriguez, J; Erlund, M; Bodaghee, A; Graham, J; Ruiz, A; Corbel, S; Fabian, A; Tagger, M; Grenier, I; Bernard, R; Jackson, N; Eckart, A; Grenier, I; Belloni, T; Stella, L; Vink, J; KnodLseder, J; Hermsen, W; Ferrando, Ph; Ibragimov, A

    2006-07-01

    This school, dedicated to young researchers, will clarify our present knowledge of the X-ray sky and give the opportunity to learn about the observatories and tools which are available. The contributions have been organized into 3 issues: -) fundamental physics, -) X-ray and Gamma-ray instruments and analysis techniques, and -) astrophysical objects. This document gathers only the slides of the presentations.

  20. The B-10((p)over-right-arrow, gamma)C-11 reaction at astrophysically relevant energies

    NARCIS (Netherlands)

    Tonchev, AP; Nelson, SO; Sabourov, K; Crowley, BT; Joshi, K; Weller, HR; Kelley, JH; Prior, RM; Spraker, M; Kalantar-Nayestanaki, N

    2003-01-01

    The B-10(, gamma)C-11 reaction was studied by detecting the gamma-rays produced when 100, 130-, and 160-keV polarized protons were stopped in a thick B-10 target. Polarized and unpolarized incident beams were used to measure the cross section and vector analyzing power as a function of angle and

  1. Astrophysical life extinctions what killed the dinosaurs?

    CERN Document Server

    Dar, Arnon

    1999-01-01

    Geological records indicate that the exponential diversification of marine and continental life on Earth in the past 500 My was interrupted by many life extinctions. They also indicate that the major mass extinctions were correlated in time with large meteoritic impacts, gigantic volcanic eruptions, sea regressions and drastic changes in global climate. Some of these catastrophes coincided in time. The astrophysical life extinction mechanisms which were proposed so far, in particular, meteoritic impacts, nearby supernova explosions, passage through molecular or dark matter clouds, and Galactic gamma/cosmic ray bursts cannot explain the time coincidences between these catastrophes. However, recent observations suggest that many planetary-mass objects may be present in the outer solar system between the Kuiper belt and the Oort cloud. Gravitational perturbations may occasionally bring them into the inner solar system. Their passage near Earth could have generated gigantic tidal waves, large volcanic eruptions, ...

  2. INTEGRAL Upper Limits on Gamma-Ray Emission Associated with the Gravitational Wave Event GW150914

    DEFF Research Database (Denmark)

    Savchenko, V.; Ferrigno, C.; Mereghetti, S.

    2016-01-01

    Using observations of the INTErnational Gamma-Ray Astrophysics Laboratory (INTEGRAL), we place upper limits on the gamma-ray and hard X-ray prompt emission associated with the gravitational wave event GW150914, which was discovered by the LIGO/Virgo Collaboration. The omnidirectional view...... in the 75 keV-2 MeV energy range for typical spectral models. Our results constrain the ratio of the energy promptly released in gamma-rays in the direction of the observer to the gravitational wave energy Eγ/EGW ... of the gravitational wave source, based on the available predictions for prompt electromagnetic emission....

  3. Hydrodynamic Instability, Integrated Code, Laboratory Astrophysics, and Astrophysics

    Science.gov (United States)

    Takabe, Hideaki

    2016-10-01

    This is an article for the memorial lecture of Edward Teller Medal and is presented as memorial lecture at the IFSA03 conference held on September 12th, 2003, at Monterey, CA. The author focuses on his main contributions to fusion science and its extension to astrophysics in the field of theory and computation by picking up five topics. The first one is the anomalous resisitivity to hot electrons penetrating over-dense region through the ion wave turbulence driven by the return current compensating the current flow by the hot electrons. It is concluded that almost the same value of potential as the average kinetic energy of the hot electrons is realized to prevent the penetration of the hot electrons. The second is the ablative stabilization of Rayleigh-Taylor instability at ablation front and its dispersion relation so-called Takabe formula. This formula gave a principal guideline for stable target design. The author has developed an integrated code ILESTA (ID & 2D) for analyses and design of laser produced plasma including implosion dynamics. It is also applied to design high gain targets. The third is the development of the integrated code ILESTA. The forth is on Laboratory Astrophysics with intense lasers. This consists of two parts; one is review on its historical background and the other is on how we relate laser plasma to wide-ranging astrophysics and the purposes for promoting such research. In relation to one purpose, I gave a comment on anomalous transport of relativistic electrons in Fast Ignition laser fusion scheme. Finally, I briefly summarize recent activity in relation to application of the author's experience to the development of an integrated code for studying extreme phenomena in astrophysics.

  4. Pulsar observations with the MAGIC telescopes

    Energy Technology Data Exchange (ETDEWEB)

    Garcia, Jezabel R.; Dazzi, F.; Idec, W.; Moretti, E.; Schweizer, T. [Max-Planck-Institut fuer Physik, Munich (Germany); Bonnefoy, S.; Carreto-Fidalgo, D.; Lopez, M. [Universitad Compultense, Madrid (Spain); Galindo, D.; Zanin, R. [Universitat de Barcelona, ICC/IEEC-UB, Barcelona (Spain); Ona Wilhelmi, E. de [Institute for Space Sciences (CSIC/IEEC), Barcelona (Spain); Reichardt, I. [Istituto Nazionale di Fisica Nucleare (INFN), Padova (Italy); Saito, T. [Kyoto University, Hakubi Center (Japan); Collaboration: MAGIC-Collaboration

    2016-07-01

    MAGIC is a stereoscopic system of two IACTs, located at the ORM (Spain). Since 2008, MAGIC has played a big role in Pulsar physics due to the discovery of the first VHE gamma-ray emission from the Crab pulsar. Such a discovery was possible thanks to a revolutionary trigger technique used in the initial MAGIC mono system, the Sum-Trigger, that provided a 25 GeV energy threshold. The study of the Crab keeps providing numerous important results for the understanding of pulsar physics. The most recent ones are the bridge emission at VHE and the detection of the Crab pulsations at TeV energies. MAGIC has been also searching for new pulsars, providing recently interesting results about the Geminga pulsar and nebula. This talk reviews the essential MAGIC results about VHE pulsars and their implications for pulsar physics.Also we discuss the development of a new stereo trigger system, the Sum-Trigger-II, and the importance of the observation windows that this system opens for the study of VHE pulsars.

  5. Development of a Telescope for Medium-Energy Gamma-ray Astronomy

    Science.gov (United States)

    Sunter, Stan

    2012-01-01

    Since the launch of AGILE and FERMI, the scientific progress in high-energy (Eg greater than approximately 200 MeV) gamma-ray science has been, and will continue to be dramatic. Both of these telescopes cover a broad energy range from approximately 20 MeV to greater than 10 GeV. However, neither instrument is optimized for observations below approximately 200 MeV where many astrophysical objects exhibit unique, transitory behavior, such as spectral breaks, bursts, and flares. Hence, while significant progress from current observations is expected, there will nonetheless remain a significant sensitivity gap in the medium-energy (approximately 0.1-200 MeV) regime; the lower end of this range remains largely unexplored whereas the upper end will allow comparison with FERMI data. Tapping into this unexplored regime requires significant improvements in sensitivity. A major emphasis of modern detector development, with the goal of providing significant improvements in sensitivity in the medium-energy regime, focuses on high-resolution electron tracking. The Three-Dimensional Track Imager (3-DTI) technology being developed at GSFC provides high resolution tracking of the electron-positron pair from gamma-ray interactions from 5 to 200 MeV. The 3-DTI consists of a time projection chamber (TPC) and 2-D cross-strip microwell detector (MWD). The low-density and homogeneous design of the 3-DTI, offers unprecedented sensitivity by providing angular resolution near the kinematic limit. Electron tracking also enables measurement of gamma-ray polarization, a new tool to study astrophysical phenomenon. We describe the design, fabrication, and performance of a 30x30x30 cm3 3-DTI detector prototype of a medium-energy gamma-ray telescope.

  6. AGILE: A gamma-ray mission

    International Nuclear Information System (INIS)

    Tavani, M.; Caraveo, P.; Mereghetti, S.; Perotti, F.; Vercellone, S.; Barbiellini, G.; Budini, G.; Longo, F.; Prest, M.; Vallazza, E.; Cocco, V.; Morselli, A.; Picozza, P.; Pittori, C.; Costa, E.; Feroci, M.; Lapshov, I.; Morelli, E.; Rubini, A.; Soffitta, P.

    2000-01-01

    AGILE is an innovative, cost-effective gamma-ray mission selected by the Italian Space Agency for a Program of Small Scientific Missions. The AGILE gamma-ray imaging detector (GRID, made of a Silicon tracker and CsI Mini-Calorimeter) is designed to detect and image photons in the 30 MeV-50 GeV energy band with good sensitivity and very large field of view (FOV ∼3 sr). The X-ray detector, Super-AGILE, sensitive in the 10-40 keV band and integrated on top of the GRID gamma-ray tracker will provide imaging (1-3 arcmin) and moderate spectroscopy. For selected sky areas, AGILE might achieve a flux sensitivity (above 100 MeV) better than 5x10 -8 ph cm 2 s -1 at the completion of its scientific program. AGILE will operate as an Observatory open to the international community and is planned to be operational during the year 2002 for a nominal 2-year mission. It will be an ideal 'bridge' between EGRET and GLAST, and the only mission entirely dedicated to high-energy astrophysics above 30 MeV during that period

  7. astrophysical significance

    Directory of Open Access Journals (Sweden)

    Dartois E.

    2014-02-01

    Full Text Available Clathrate hydrates, ice inclusion compounds, are of major importance for the Earth’s permafrost regions and may control the stability of gases in many astrophysical bodies such as the planets, comets and possibly interstellar grains. Their physical behavior may provide a trapping mechanism to modify the absolute and relative composition of icy bodies that could be the source of late-time injection of gaseous species in planetary atmospheres or hot cores. In this study, we provide and discuss laboratory-recorded infrared signatures of clathrate hydrates in the near to mid-infrared and the implications for space-based astrophysical tele-detection in order to constrain their possible presence.

  8. New Worlds / New Horizons Science with an X-ray Astrophysics Probe

    Science.gov (United States)

    Smith, Randall K.; Bookbinder, Jay A.; Hornschemeier, Ann E.; Bandler, Simon; Brandt, W. N.; Hughes, John P.; McCammon, Dan; Matsumoto, Hironori; Mushotzky, Richard; Osten, Rachel A.; hide

    2014-01-01

    In 2013 NASA commenced a design study for an X-ray Astrophysics Probe to address the X-ray science goals and program prioritizations of the Decadal Survey New World New Horizons (NWNH) with a cost cap of approximately $1B. Both the NWNH report and 2011 NASA X-ray mission concept study found that high-resolution X-ray spectroscopy performed with an X-ray microcalorimeter would enable the most highly rated NWNH X-ray science. Here we highlight some potential science topics, namely: 1) a direct, strong-field test of General Relativity via the study of accretion onto black holes through relativistic broadened Fe lines and their reverberation in response to changing hard X-ray continuum, 2) understanding the evolution of galaxies and clusters by mapping temperatures, abundances and dynamics in hot gas, 3) revealing the physics of accretion onto stellar-mass black holes from companion stars and the equation of state of neutron stars through timing studies and time-resolved spectroscopy of X-ray binaries and 4) feedback from AGN and star formation shown in galaxy-scale winds and jets. In addition to these high-priority goals, an X-ray astrophysics probe would be a general-purpose observatory that will result in invaluable data for other NWNH topics such as stellar astrophysics, protostars and their impact on protoplanetary systems, X-ray spectroscopy of transient phenomena such as high-z gamma-ray bursts and tidal capture of stars by massive black holes, and searches for dark matter decay.

  9. Gamma-ray-line astronomy: the case of 26Al

    International Nuclear Information System (INIS)

    Prantzos, N.

    1986-07-01

    The recent detection of the 1.8 MeV line in the galactic plane, attributed to the decay of ∼ 3 Solar mass of radioactive 26 Al, brought closer together the disciplines of gamma-ray Astronomy and Nuclear Astrophysics. A review is presented here of the possible production mechanisms and sites of 26 Al in the Galaxy, with an emphasis on the role of massive, mass losing stars

  10. Space astronomy and astrophysics program by NASA

    Science.gov (United States)

    Hertz, Paul L.

    2014-07-01

    The National Aeronautics and Space Administration recently released the NASA Strategic Plan 20141, and the NASA Science Mission Directorate released the NASA 2014 Science Plan3. These strategic documents establish NASA's astrophysics strategic objectives to be (i) to discover how the universe works, (ii) to explore how it began and evolved, and (iii) to search for life on planets around other stars. The multidisciplinary nature of astrophysics makes it imperative to strive for a balanced science and technology portfolio, both in terms of science goals addressed and in missions to address these goals. NASA uses the prioritized recommendations and decision rules of the National Research Council's 2010 decadal survey in astronomy and astrophysics2 to set the priorities for its investments. The NASA Astrophysics Division has laid out its strategy for advancing the priorities of the decadal survey in its Astrophysics 2012 Implementation Plan4. With substantial input from the astrophysics community, the NASA Advisory Council's Astrophysics Subcommittee has developed an astrophysics visionary roadmap, Enduring Quests, Daring Visions5, to examine possible longer-term futures. The successful development of the James Webb Space Telescope leading to a 2018 launch is an Agency priority. One important goal of the Astrophysics Division is to begin a strategic mission, subject to the availability of funds, which follows from the 2010 decadal survey and is launched after the James Webb Space Telescope. NASA is studying a Wide Field Infrared Survey Telescope as its next large astrophysics mission. NASA is also planning to partner with other space agencies on their missions as well as increase the cadence of smaller Principal Investigator led, competitively selected Astrophysics Explorers missions.

  11. High Energy Astrophysics Tests of Lorentz Invariance and Quantum Gravity Models

    Science.gov (United States)

    Stecker, Floyd W.

    2012-01-01

    High energy astrophysics observations provide the best possibilities to detect a very small violation of Lorentz invariance such as may be related to the structure of space-time near the Planck scale of approx.10(exp -35) m. I will discuss the possible signatures of Lorentz invariance violation (LIV) that can be manifested by observing of the spectra, polarization, and timing of gamma-rays from active galactic nuclei and gamma-ray bursts. Other sensitive tests are provided by observations of the spectra of ultrahigh energy cosmic rays and neutrinos. Using the latest data from the Pierre Auger Observatory one can already derive an upper limit of 4.5 x 10(exp -23) on the fraction of LIV at a Lorentz factor of approx. 2 x 10(exp 11). This result has fundamental implications for quantum gravity models. I will also discuss the possibilities of using more sensitive space-based detection techniques to improve searches for LIV in the future. I will also discuss how the LIV formalism casts doubt on the OPERA superluminal neutrino claim.

  12. Gravity-mediated (or Composite) Dark Matter Confronts Astrophysical Data

    CERN Document Server

    Lee, Hyun Min; Sanz, Veronica

    2014-01-01

    We consider the astrophysical bounds on a new form of dark matter, the so called Gravity-mediated Dark Matter. In this scenario, dark matter communicates with us through a mediator sector composed of gravitational resonances, namely a new scalar (radion) and a massive spin-two resonance (massive graviton). We consider specific models motivated by natural electroweak symmetry breaking or weak-scale dark matter in the context of models in warped extra-dimensions and their composite duals. The main Dark Matter annihilation mechanism is due to the interactions of KK gravitons to gauge bosons that propagate in bulk. We impose the bounds on monochromatic or continuum photons from Fermi-LAT and HESS. We also explore scenarios in which the Fermi gamma-ray line could be a manifestation of Gravity-mediated Dark Matter.

  13. Instrument for observing transient cosmic gamma-ray sources for the ISEE-C Heliocentric spacecraft

    International Nuclear Information System (INIS)

    Evans, W.D.; Aiello, W.P.; Klebesadel, R.W.

    1977-12-01

    Satellite instrumentation that would serve as one element of a three-satellite network to provide precise directional information for the recently discovered cosmic gamma-ray bursts is described. The proposed network would be capable of determining source locations with uncertainties of less than one arc minute, sufficient for a meaningful optical and radio search. The association of the gamma bursts with a known type of astrophysical object provides the most direct method for establishing source distances and thus defining the overall energetics of the emission process

  14. Nuclear Astrophysics Experiments at CIAE

    International Nuclear Information System (INIS)

    Liu Weiping; Li Zhihong; Bai Xixiang; Lian Gang; Guo Bing; Zeng, Sheng; Yan Shengquan; Wang Baoxiang; Shu Nengchuan; Wu Kaisu; Chen Yongshou

    2005-01-01

    This paper describes nuclear astrophysical studies using the unstable ion beam facility GIRAFFE. We measured the angular distributions for some low energy reactions, such as 7 Be(d, n) 8 B, 11 C(d, n) 12 N, 8 Li(d, n) 9 Be and 8 Li(d, p) 9 Li in inverse kinematics, and indirectly derived the astrophysical S-factors or reaction rates of 7 Be(p, γ) 8 B, 11 C(p, γ) 12 N, 8 Li(n, γ) 9 Li at astrophysically relevant energies

  15. Multiwavelength Study of Gamma-Ray Bright Blazars

    Science.gov (United States)

    Morozova, Daria; Larionov, V. M.; Hagen-Thorn, V. A.; Jorstad, S. G.; Marscher, A. P.; Troitskii, I. S.

    2011-01-01

    We investigate total intensity radio images of 6 gamma-ray bright blazars (BL Lac, 3C 279, 3C 273, W Com, PKS 1510-089, and 3C 66A) and their optical and gamma-ray light curves to study connections between gamma-ray and optical brightness variations and changes in the parsec-scale radio structure. We use high-resolution maps obtained by the BU group at 43 GHz with the VLBA, optical light curves constructed by the St.Petersburg State U. (Russia) team using measurements with the 0.4 m telescope of St.Petersburg State U. (LX200) and the 0.7 m telescope of the Crimean Astrophysical Observatory (AZT-8), and gamma-ray light curves, which we have constructed with data provided by the Fermi Large Area Telescope. Over the period from August 2008 to November 2009, superluminal motion is found in all 6 objects with apparent speed ranging from 2c to 40c. The blazars with faster apparent speeds, 3C 273, 3C 279, PKS 1510-089, and 3C 66A, exhibit stronger variability of the gamma-ray emission. There is a tendency for sources with sharply peaked gamma-ray flares to have faster jet speed than sources with gamma-ray light curves with no sharp peaks. Gamma-ray light curves with sharply peaked gamma-ray flares possess a stronger gamma-ray/optical correlations. The research at St.Petersburg State U. was funded by the Minister of Education and Science of the Russian Federation (state contract N#P123). The research at BU was funded in part by NASA Fermi Guest Investigator grant NNX08AV65G and by NSF grant AST-0907893. The VLBA is an instrument of the National Radio Astronomy Observatory, a facility of the National Science Foundation operated under cooperative agreement by Associated Universities, Inc.

  16. A NOVEL APPROACH IN THE WEAKLY INTERACTING MASSIVE PARTICLE QUEST: CROSS-CORRELATION OF GAMMA-RAY ANISOTROPIES AND COSMIC SHEAR

    International Nuclear Information System (INIS)

    Camera, Stefano; Fornasa, Mattia; Fornengo, Nicolao; Regis, Marco

    2013-01-01

    Both cosmic shear and cosmological gamma-ray emission stem from the presence of dark matter (DM) in the universe: DM structures are responsible for the bending of light in the weak-lensing regime and those same objects can emit gamma rays, either because they host astrophysical sources (active galactic nuclei or star-forming galaxies) or directly by DM annihilations (or decays, depending on the properties of the DM particle). Such gamma rays should therefore exhibit strong correlation with the cosmic shear signal. In this Letter, we compute the cross-correlation angular power spectrum of cosmic shear and gamma rays produced by the annihilation/decay of weakly interacting massive particle DM, as well as by astrophysical sources. We show that this observable provides novel information on the composition of the extragalactic gamma-ray background (EGB), since the amplitude and shape of the cross-correlation signal strongly depend on which class of sources is responsible for the gamma-ray emission. If the DM contribution to the EGB is significant (at least in a definite energy range), although compatible with current observational bounds, its strong correlation with the cosmic shear makes such signal potentially detectable by combining Fermi Large Area Telescope data with forthcoming galaxy surveys, like the Dark Energy Survey and Euclid. At the same time, the same signal would demonstrate that the weak-lensing observables are indeed due to particle DM matter and not to possible modifications of general relativity.

  17. A Novel Approach in the Weakly Interacting Massive Particle Quest: Cross-correlation of Gamma-Ray Anisotropies and Cosmic Shear

    Science.gov (United States)

    Camera, Stefano; Fornasa, Mattia; Fornengo, Nicolao; Regis, Marco

    2013-07-01

    Both cosmic shear and cosmological gamma-ray emission stem from the presence of dark matter (DM) in the universe: DM structures are responsible for the bending of light in the weak-lensing regime and those same objects can emit gamma rays, either because they host astrophysical sources (active galactic nuclei or star-forming galaxies) or directly by DM annihilations (or decays, depending on the properties of the DM particle). Such gamma rays should therefore exhibit strong correlation with the cosmic shear signal. In this Letter, we compute the cross-correlation angular power spectrum of cosmic shear and gamma rays produced by the annihilation/decay of weakly interacting massive particle DM, as well as by astrophysical sources. We show that this observable provides novel information on the composition of the extragalactic gamma-ray background (EGB), since the amplitude and shape of the cross-correlation signal strongly depend on which class of sources is responsible for the gamma-ray emission. If the DM contribution to the EGB is significant (at least in a definite energy range), although compatible with current observational bounds, its strong correlation with the cosmic shear makes such signal potentially detectable by combining Fermi Large Area Telescope data with forthcoming galaxy surveys, like the Dark Energy Survey and Euclid. At the same time, the same signal would demonstrate that the weak-lensing observables are indeed due to particle DM matter and not to possible modifications of general relativity.

  18. A NOVEL APPROACH IN THE WEAKLY INTERACTING MASSIVE PARTICLE QUEST: CROSS-CORRELATION OF GAMMA-RAY ANISOTROPIES AND COSMIC SHEAR

    Energy Technology Data Exchange (ETDEWEB)

    Camera, Stefano [CENTRA, Instituto Superior Tecnico, Universidade Tecnica de Lisboa, Lisboa (Portugal); Fornasa, Mattia [School of Physics and Astronomy, University of Nottingham, Nottingham (United Kingdom); Fornengo, Nicolao; Regis, Marco [Dipartimento di Fisica, Universita di Torino and INFN, Torino (Italy)

    2013-07-01

    Both cosmic shear and cosmological gamma-ray emission stem from the presence of dark matter (DM) in the universe: DM structures are responsible for the bending of light in the weak-lensing regime and those same objects can emit gamma rays, either because they host astrophysical sources (active galactic nuclei or star-forming galaxies) or directly by DM annihilations (or decays, depending on the properties of the DM particle). Such gamma rays should therefore exhibit strong correlation with the cosmic shear signal. In this Letter, we compute the cross-correlation angular power spectrum of cosmic shear and gamma rays produced by the annihilation/decay of weakly interacting massive particle DM, as well as by astrophysical sources. We show that this observable provides novel information on the composition of the extragalactic gamma-ray background (EGB), since the amplitude and shape of the cross-correlation signal strongly depend on which class of sources is responsible for the gamma-ray emission. If the DM contribution to the EGB is significant (at least in a definite energy range), although compatible with current observational bounds, its strong correlation with the cosmic shear makes such signal potentially detectable by combining Fermi Large Area Telescope data with forthcoming galaxy surveys, like the Dark Energy Survey and Euclid. At the same time, the same signal would demonstrate that the weak-lensing observables are indeed due to particle DM matter and not to possible modifications of general relativity.

  19. Large-Scale Astrophysical Visualization on Smartphones

    Science.gov (United States)

    Becciani, U.; Massimino, P.; Costa, A.; Gheller, C.; Grillo, A.; Krokos, M.; Petta, C.

    2011-07-01

    Nowadays digital sky surveys and long-duration, high-resolution numerical simulations using high performance computing and grid systems produce multidimensional astrophysical datasets in the order of several Petabytes. Sharing visualizations of such datasets within communities and collaborating research groups is of paramount importance for disseminating results and advancing astrophysical research. Moreover educational and public outreach programs can benefit greatly from novel ways of presenting these datasets by promoting understanding of complex astrophysical processes, e.g., formation of stars and galaxies. We have previously developed VisIVO Server, a grid-enabled platform for high-performance large-scale astrophysical visualization. This article reviews the latest developments on VisIVO Web, a custom designed web portal wrapped around VisIVO Server, then introduces VisIVO Smartphone, a gateway connecting VisIVO Web and data repositories for mobile astrophysical visualization. We discuss current work and summarize future developments.

  20. Consequences of intense intermittent astrophysical radiation sources for terrestrial planets

    Science.gov (United States)

    Melott, Adrian

    2011-11-01

    Life on Earth has developed in the context of cosmic radiation backgrounds. This in turn can be a base for comparison with other potential life-bearing planets. Many kinds of strong radiation bursts are possible by astrophysical entities ranging from gamma-ray bursts at cosmological distances to the Sun itself. Many of these present potential hazards to the biosphere: on timescales long compared with human history, the probability of an event intense enough to disrupt life on the land surface or in the oceans becomes large. One of the mechanisms which comes into play even at moderate intensities is the ionization of the Earth's atmosphere, which leads through chemical changes (specifically, depletion of stratospheric ozone) to increased ultraviolet-B flux from the Sun reaching the surface. UVB is extremely hazardous to most life due to its strong absorption by the genetic material DNA and subsequent breaking of chemical bonds. We characterize intensities at the Earth and rates or upper limits on rates. We estimate how often a major extinction-level event is probable given the current state of knowledge. Moderate level events are dominated by the Sun, but the far more severe infrequent events are dominated by gamma-ray bursts and supernovae. So-called ``short-hard'' gamma-ray bursts are a substantial threat, comparable in magnitude to supernovae and greater than that of the higher-luminosity long bursts considered in most past work. Short bursts may come with little or no warning.

  1. Prospects for Cherenkov Telescope Array Observations of the Young Supernova Remnant RX J1713.7−3946

    Energy Technology Data Exchange (ETDEWEB)

    Acero, F. [CEA/IRFU/SAp, CEA Saclay, Bat 709, Orme des Merisiers, F-91191 Gif-sur-Yvette (France); Aloisio, R.; Amato, E. [Osservatorio Astrofisico di Arcetri, Largo E. Fermi, 5, I-50125 Firenze (Italy); Amans, J. [LUTH and GEPI, Observatoire de Paris, CNRS, PSL Research University, 5 place Jules Janssen, F-92190, Meudon (France); Antonelli, L. A. [INAF—Osservatorio Astronomico di Roma, Via di Frascati 33, I-00040, Monteporzio Catone (Italy); Aramo, C. [INFN Sezione di Napoli, Via Cintia, ed. G, I-80126 Napoli (Italy); Armstrong, T. [Department of Physics and Centre for Advanced Instrumentation, Durham University, South Road, Durham DH1 3LE (United Kingdom); Arqueros, F.; Barrio, J. A. [Grupo de Altas Energías, Universidad Complutense de Madrid., Av Complutense s/n, E-28040 Madrid (Spain); Asano, K. [Institute for Cosmic Ray Research, University of Tokyo, 5-1-5, Kashi-wanoha, Kashiwa, Chiba 277-8582 (Japan); Ashley, M. [School of Physics, University of New South Wales, Sydney NSW 2052 (Australia); Backes, M. [University of Namibia, Department of Physics, 340 Mandume Ndemufayo Ave., Pioneerspark Windhoek (Namibia); Balazs, C. [School of Physics and Astronomy, Monash University, Melbourne, Victoria 3800 (Australia); Balzer, A. [Astronomical Institute Anton Pannekoek, University of Amsterdam, Science Park 904 1098 XH Amsterdam (Netherlands); Bamba, A. [Department of Physics, Graduate School of Science, University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-0033 (Japan); Barkov, M. [Riken, Institute of Physical and Chemical Research, 2-1 Hirosawa, Wako, Saitama, 351-0198 (Japan); Benbow, W. [Harvard-Smithsonian Center for Astrophysics, 60 Garden St., Cambridge, MA 02180 (United States); Bernlöhr, K., E-mail: sano@a.phys.nagoya-u.ac.jp, E-mail: nakamori@sci.kj.yamagata-u.ac.jp [Max-Planck-Institut für Kernphysik, Saupfercheckweg 1, D-69117 Heidelberg (Germany); and others

    2017-05-10

    We perform simulations for future Cherenkov Telescope Array (CTA) observations of RX J1713.7−3946, a young supernova remnant (SNR) and one of the brightest sources ever discovered in very high energy (VHE) gamma rays. Special attention is paid to exploring possible spatial (anti)correlations of gamma rays with emission at other wavelengths, in particular X-rays and CO/H i emission. We present a series of simulated images of RX J1713.7−3946 for CTA based on a set of observationally motivated models for the gamma-ray emission. In these models, VHE gamma rays produced by high-energy electrons are assumed to trace the nonthermal X-ray emission observed by XMM-Newton , whereas those originating from relativistic protons delineate the local gas distributions. The local atomic and molecular gas distributions are deduced by the NANTEN team from CO and H i observations. Our primary goal is to show how one can distinguish the emission mechanism(s) of the gamma rays (i.e., hadronic versus leptonic, or a mixture of the two) through information provided by their spatial distribution, spectra, and time variation. This work is the first attempt to quantitatively evaluate the capabilities of CTA to achieve various proposed scientific goals by observing this important cosmic particle accelerator.

  2. Double layers and circuits in astrophysics

    International Nuclear Information System (INIS)

    Alfven, H.

    1986-05-01

    As the rate of energy release in a double layer with voltage DeltaV is P corresponding to IDeltaV, a double layer must be treated part of a circuit which delivers the current I. As neither double layer nor circuit can be derived from magnetofluid models of a plasma, such models are useless for treating energy transfer by menas of double layers. They must be replaced by particle models and circuit theory. A simple circuit is suggested which is applied to the energizing of auroroal particles, to solar flares, and to intergalactic double radio sources. Application to the heliospheric current systems leads to the prediction of two double layers on the sun's axis which may give radiations detectable from earth. Double layers in space should be classified as a new type of celestial object (one example is the double radio sources). It is tentatively suggested in X-ray and gamma-ray bursts may be due to exploding double layers (although annihilation is an alternative energy source). A study of how a number of the most used textbooks in astrophysics treat important concepts like double layers, critical velocity, pinch effects and circuits is made. It is found that students using these textbooks remain essentially ignorant of even the existence of these, in spite of the fact that some of them have been well known for half a centry (e.g., double layers, Langmuir, 1929: pinch effect, Bennet, 1934). The conclusion is that astrophysics is too important to be left in the hands of the astrophysicist. Earth bound and space telescope data must be treated by scientists who are familiar with laboratory and magnetospheric physics and circuit theory, and of course with modern plasma theory. At least by volume the universe consists to more than 99 percent of plasma, and electromagnetic forces are 10/sup39/ time stronger than gravitation

  3. Cosmic Ray Astrophysics using The High Altitude Water Cherenkov (HAWC Observatory in México

    Directory of Open Access Journals (Sweden)

    de la Fuente Eduardo

    2017-01-01

    Full Text Available The High-Altitude Water Cherenkov (HAWC TeV gamma–ray Observatory in México is ready to search and study gamma-ray emission regions, extremely high-energy cosmic-ray sources, and to identify transient phenomena. With a better Gamma/Hadron rejection method than other similar experiments, it will play a key role in triggering multi–wavelength and multi–messenger studies of active galaxies (AGN, gamma-ray bursts (GRB, supernova remnants (SNR, pulsar wind nebulae (PWN, Galactic Plane Sources, and Cosmic Ray Anisotropies. It has an instantaneous field-of-view of ∼2 str, equivalent to 15% of the whole sky and continuous operation (24 hours per day. The results obtained by HAWC–111 (111 detectors in operation were presented on the proceedings of the International Cosmic Ray Conference 2015 and in [1]. The results obtained by HAWC–300 (full operation are now under analysis and will be published in forthcoming papers starting in 2017 (see preliminary results on http://www.hawc-observatory.org/news/. Here we present the HAWC contributions on cosmic ray astrophysics via anisotropies studies, summarizing the HAWC detector and its upgrading by the installation of “outriggers”.

  4. An introduction to observational astrophysics

    CERN Document Server

    Gallaway, Mark

    2016-01-01

    Observational Astrophysics follows the general outline of an astrophysics undergraduate curriculum targeting practical observing information to what will be covered at the university level. This includes the basics of optics and coordinate systems to the technical details of CCD imaging, photometry, spectography and radio astronomy.  General enough to be used by students at a variety of institutions and advanced enough to be far more useful than observing guides targeted at amateurs, the author provides a comprehensive and up-to-date treatment of observational astrophysics at undergraduate level to be used with a university’s teaching telescope.  The practical approach takes the reader from basic first year techniques to those required for a final year project. Using this textbook as a resource, students can easily become conversant in the practical aspects of astrophysics in the field as opposed to the classroom.

  5. Nonlinear dynamics and astrophysics

    International Nuclear Information System (INIS)

    Vallejo, J. C.; Sanjuan, M. A. F.

    2000-01-01

    Concepts and techniques from Nonlinear Dynamics, also known as Chaos Theory, have been applied successfully to several astrophysical fields such as orbital motion, time series analysis or galactic dynamics, providing answers to old questions but also opening a few new ones. Some of these topics are described in this review article, showing the basis of Nonlinear Dynamics, and how it is applied in Astrophysics. (Author)

  6. A novel background reduction strategy for high level triggers and processing in gamma-ray Cherenkov detectors

    OpenAIRE

    Cabras, G.; De Angelis, A.; De Lotto, B.; De Maria, M. M.; De Sabata, F.; Mansutti, O.; Frailis, M.; Persic, M.; Bigongiari, C.; Doro, M.; Mariotti, M.; Peruzzo, L.; Saggion, A.; Scalzotto, V.; Paoletti, R.

    2008-01-01

    Gamma ray astronomy is now at the leading edge for studies related both to fundamental physics and astrophysics. The sensitivity of gamma detectors is limited by the huge amount of background, constituted by hadronic cosmic rays (typically two to three orders of magnitude more than the signal) and by the accidental background in the detectors. By using the information on the temporal evolution of the Cherenkov light, the background can be reduced. We will present here the results obtained wit...

  7. Laboratory Astrophysics Prize: Laboratory Astrophysics with Nuclei

    Science.gov (United States)

    Wiescher, Michael

    2018-06-01

    Nuclear astrophysics is concerned with nuclear reaction and decay processes from the Big Bang to the present star generation controlling the chemical evolution of our universe. Such nuclear reactions maintain stellar life, determine stellar evolution, and finally drive stellar explosion in the circle of stellar life. Laboratory nuclear astrophysics seeks to simulate and understand the underlying processes using a broad portfolio of nuclear instrumentation, from reactor to accelerator from stable to radioactive beams to map the broad spectrum of nucleosynthesis processes. This talk focuses on only two aspects of the broad field, the need of deep underground accelerator facilities in cosmic ray free environments in order to understand the nucleosynthesis in stars, and the need for high intensity radioactive beam facilities to recreate the conditions found in stellar explosions. Both concepts represent the two main frontiers of the field, which are being pursued in the US with the CASPAR accelerator at the Sanford Underground Research Facility in South Dakota and the FRIB facility at Michigan State University.

  8. Application of the Oslo method to high resolution gamma spectra

    Science.gov (United States)

    Simon, A.; Guttormsen, M.; Larsen, A. C.; Beausang, C. W.; Humby, P.

    2015-10-01

    Hauser-Feshbach statistical model is a widely used tool for calculation of the reaction cross section, in particular for astrophysical processes. The HF model requires as an input an optical potential, gamma-strength function (GSF) and level density (LD) to properly model the statistical properties of the nucleus. The Oslo method is a well established technique to extract GSFs and LDs from experimental data, typically used for gamma-spectra obtained with scintillation detectors. Here, the first application of the Oslo method to high-resolution data obtained using the Ge detectors of the STARLITER setup at TAMU is discussed. The GSFs and LDs extracted from (p,d) and (p,t) reactions on 152154 ,Sm targets will be presented.

  9. Nuclear astrophysics with radioactive beams

    International Nuclear Information System (INIS)

    Bertulani, C.A.; Gade, A.

    2010-01-01

    The quest to comprehend how nuclear processes influence astrophysical phenomena is driving experimental and theoretical research programs worldwide. One of the main goals in nuclear astrophysics is to understand how energy is generated in stars, how elements are synthesized in stellar events and what the nature of neutron stars is. New experimental capabilities, the availability of radioactive beams and increased computational power paired with new astronomical observations have advanced the present knowledge. This review summarizes the progress in the field of nuclear astrophysics with a focus on the role of indirect methods and reactions involving beams of rare isotopes.

  10. Nuclear reactions in astrophysics

    International Nuclear Information System (INIS)

    Arnould, M.; Rayet, M.

    1990-01-01

    At all times and at all astrophysical scales, nuclear reactions have played and continue to play a key role. This concerns the energetics as well as the production of nuclides (nucleosynthesis). After a brief review of the observed composition of various objects in the universe, and especially of the solar system, the basic ingredients that are required in order to build up models for the chemical evolution of galaxies are sketched. Special attention is paid to the evaluation of the stellar yields through an overview of the important burning episodes and nucleosynthetic processes that can develop in non-exploding or exploding stars. Emphasis is put on the remaining astrophysical and nuclear physics uncertainties that hamper a clear understanding of the observed characteristics, and especially compositions, of a large variety of astrophysical objects

  11. Ground-Level Ozone Following Astrophysical Ionizing Radiation Events: An Additional Biological Hazard?

    Science.gov (United States)

    Thomas, Brian C; Goracke, Byron D

    2016-01-01

    Astrophysical ionizing radiation events such as supernovae, gamma-ray bursts, and solar proton events have been recognized as a potential threat to life on Earth, primarily through depletion of stratospheric ozone and subsequent increase in solar UV radiation at Earth's surface and in the upper levels of the ocean. Other work has also considered the potential impact of nitric acid rainout, concluding that no significant threat is likely. Not yet studied to date is the potential impact of ozone produced in the lower atmosphere following an ionizing radiation event. Ozone is a known irritant to organisms on land and in water and therefore may be a significant additional hazard. Using previously completed atmospheric chemistry modeling, we examined the amount of ozone produced in the lower atmosphere for the case of a gamma-ray burst and found that the values are too small to pose a significant additional threat to the biosphere. These results may be extended to other ionizing radiation events, including supernovae and extreme solar proton events.

  12. Cyberinfrastructure for Computational Relativistic Astrophysics

    OpenAIRE

    Ott, Christian

    2012-01-01

    Poster presented at the NSF Office of Cyberinfrastructure CyberBridges CAREER PI workshop. This poster discusses the computational challenges involved in the modeling of complex relativistic astrophysical systems. The Einstein Toolkit is introduced. It is an open-source community infrastructure for numerical relativity and computational astrophysics.

  13. Laboratory astrophysics. Model experiments of astrophysics with large-scale lasers

    International Nuclear Information System (INIS)

    Takabe, Hideaki

    2012-01-01

    I would like to review the model experiment of astrophysics with high-power, large-scale lasers constructed mainly for laser nuclear fusion research. The four research directions of this new field named 'Laser Astrophysics' are described with four examples mainly promoted in our institute. The description is of magazine style so as to be easily understood by non-specialists. A new theory and its model experiment on the collisionless shock and particle acceleration observed in supernova remnants (SNRs) are explained in detail and its result and coming research direction are clarified. In addition, the vacuum breakdown experiment to be realized with the near future ultra-intense laser is also introduced. (author)

  14. The importance of CNO isotopes in astrophysics

    International Nuclear Information System (INIS)

    Audoze, J.

    1977-01-01

    The research into CNO isotopes in astrophysics includes many different subfields of astrophysics such as meteoretical studies, experimental and theoretical nuclear astrophysics, optical astronomy, radio astronomy, etc. The purpose of this paper is to give some overview of the topic and guideline among these different subfields. (G.T.H.)

  15. Gamma-Ray Bursts The Brightest Explosions in the Universe

    CERN Document Server

    Vedrenne, Gilbert

    2009-01-01

    Since their discovery was first announced in 1973, gamma-ray bursts (GRBs) have been among the most fascination objects in the universe. While the initial mystery has gone, the fascination continues, sustained by the close connection linking GRBs with some of the most fundamental topics in modern astrophysics and cosmology. Both authors have been active in GRB observations for over two decades and have produced an outstanding account on both the history and the perspectives of GRB research.

  16. Texas symposium on relativistic astrophysics, 9th, Munich, West Germany, December 14-19, 1978, proceedings

    International Nuclear Information System (INIS)

    Ehlers, J.; Perry, J.J.; Walker, M.

    1980-01-01

    Papers are presented on recent developments in relativistic astrophysics in the fields of extragalactic sources, galaxy formation and cosmology, gamma-ray astronomy, gravitation theory and fundamental interactions, supernovae and gravitational collapse, neutron stars, pulsars and supernova remnants and X-ray astronomy. Specific topics include the properties of BL Lac objects, the emission-line spectra of active galactic nuclei and quasars, current knowledge of the cosmic microwave background, the limits to observational verification in cosmology, the gravitational instability theory of galaxy formation and clustering, COS-B observations of Galactic high-energy gamma rays, isolated systems in general relativity and quantum gravity. Attention is also given to the evolution and explosion of massive stars, neutrino astronomy, pulsar radiation mechanisms, evidence of gravitational radiation from measurements of the binary pulsar PSR 1913+13, the X-ray spectra of accreting degenerate stars, and theoretical aspects of X-ray binaries

  17. Astrophysical opacity library

    International Nuclear Information System (INIS)

    Huebner, W.F.; Merts, A.L.; Magee, N.H. Jr.; Argo, M.F.

    1977-08-01

    The astrophysical elements opacity library includes equation of state data, various mean opacities, and 2000 values of the frequency-dependent extinction coefficients in equally spaced intervals u identical with hν/kT from 0 to 20 for 41 degeneracy parameters eta from -28 (nondegenerate) to 500 and 46 temperatures kT from 1 eV to 100 keV. Among available auxiliary quantities are the free electron density, mass density, and plasma cutoff frequency. A library-associated program can produce opacities for mixtures with up to 20 astrophysically abundant constituent elements at 4 levels of utility for the user

  18. Astrophysics Update 2

    CERN Document Server

    Mason, John W

    2006-01-01

    "Astrophysics Updates" is intended to serve the information needs of professional astronomers and postgraduate students about areas of astronomy, astrophysics and cosmology that are rich and active research spheres. Observational methods and the latest results of astronomical research are presented as well as their theoretical foundations and interrelations. The contributed commissioned articles are written by leading exponents in a format that will appeal to professional astronomers and astrophysicists who are interested in topics outside their own specific areas of research. This collection of timely reviews may also attract the interest of advanced amateur astronomers seeking scientifically rigorous coverage.

  19. Advances in instrumentation for nuclear astrophysics

    Directory of Open Access Journals (Sweden)

    S. D. Pain

    2014-04-01

    Full Text Available The study of the nuclear physics properties which govern energy generation and nucleosynthesis in the astrophysical phenomena we observe in the universe is crucial to understanding how these objects behave and how the chemical history of the universe evolved to its present state. The low cross sections and short nuclear lifetimes involved in many of these reactions make their experimental determination challenging, requiring developments in beams and instrumentation. A selection of developments in nuclear astrophysics instrumentation is discussed, using as examples projects involving the nuclear astrophysics group at Oak Ridge National Laboratory. These developments will be key to the instrumentation necessary to fully exploit nuclear astrophysics opportunities at the Facility for Rare Isotope Beams which is currently under construction.

  20. Numerical simulation in astrophysics

    International Nuclear Information System (INIS)

    Miyama, Shoken

    1985-01-01

    There have been many numerical simulations of hydrodynamical problems in astrophysics, e.g. processes of star formation, supernova explosion and formation of neutron stars, and general relativistic collapse of star to form black hole. The codes are made to be suitable for computing such problems. In astrophysical hydrodynamical problems, there are the characteristics: problems of self-gravity or external gravity acting, objects of scales very large or very short, objects changing by short period or long time scale, problems of magnetic force and/or centrifugal force acting. In this paper, we present one of methods of numerical simulations which may satisfy these requirements, so-called smoothed particle methods. We then introduce the methods briefly. Then, we show one of the applications of the methods to astrophysical problem (fragmentation and collapse of rotating isothermal cloud). (Mori, K.)

  1. The upgrade of the H.E.S.S. cameras

    Science.gov (United States)

    Giavitto, Gianluca; Ashton, Terry; Balzer, Arnim; Berge, David; Brun, Francois; Chaminade, Thomas; Delagnes, Eric; Fontaine, Gerard; Füßling, Matthias; Giebels, Berrie; Glicenstein, Jean-Francois; Gräber, Tobias; Hinton, Jim; Jahnke, Albert; Klepser, Stefan; Kossatz, Marko; Kretzschmann, Axel; Lefranc, Valentin; Leich, Holger; Lüdecke, Hartmut; Lypova, Iryna; Manigot, Pascal; Marandon, Vincent; Moulin, Emmanuel; Naurois, Mathieu de; Nayman, Patrick; Ohm, Stefan; Penno, Marek; Ross, Duncan; Salek, David; Schade, Markus; Schwab, Thomas; Simoni, Rachel; Stegmann, Christian; Steppa, Constantin; Thornhill, Julian; Toussnel, Francois

    2017-12-01

    The High Energy Stereoscopic System (HESS) is an array of imaging atmospheric Cherenkov telescopes (IACTs) located in the Khomas highland in Namibia. It was built to detect Very High Energy (VHE > 100 GeV) cosmic gamma rays. Since 2003, HESS has discovered the majority of the known astrophysical VHE gamma-ray sources, opening a new observational window on the extreme non-thermal processes at work in our universe. HESS consists of four 12-m diameter Cherenkov telescopes (CT1-4), which started data taking in 2002, and a larger 28-m telescope (CT5), built in 2012, which lowers the energy threshold of the array to 30 GeV . The cameras of CT1-4 are currently undergoing an extensive upgrade, with the goals of reducing their failure rate, reducing their readout dead time and improving the overall performance of the array. The entire camera electronics has been renewed from ground-up, as well as the power, ventilation and pneumatics systems, and the control and data acquisition software. Only the PMTs and their HV supplies have been kept from the original cameras. Novel technical solutions have been introduced, which will find their way into some of the Cherenkov cameras foreseen for the next-generation Cherenkov Telescope Array (CTA) observatory. In particular, the camera readout system is the first large-scale system based on the analog memory chip NECTAr, which was designed for CTA cameras. The camera control subsystems and the control software framework also pursue an innovative design, exploiting cutting-edge hardware and software solutions which excel in performance, robustness and flexibility. The CT1 camera has been upgraded in July 2015 and is currently taking data; CT2-4 have been upgraded in fall 2016. Together they will assure continuous operation of HESS at its full sensitivity until and possibly beyond the advent of CTA. This contribution describes the design, the testing and the in-lab and on-site performance of all components of the newly upgraded HESS

  2. Resonant elastic scattering, inelastic scattering and astrophysical reactions; Diffusion elastique resonante, diffusion inelastique et reactions astrophysiques

    Energy Technology Data Exchange (ETDEWEB)

    De Oliveira Santos, F. [Grand Accelerateur National d' Ions Lourds, UMR 6415, 14 - Caen (France)

    2007-07-01

    Nuclear reactions can occur at low kinetic energy. Low-energy reactions are characterized by a strong dependence on the structure of the compound nucleus. It turns out that it is possible to study the nuclear structure by measuring these reactions. In this course, three types of reactions are treated: Resonant Elastic Scattering (such as N{sup 14}(p,p)N{sup 14}), Inelastic Scattering (such as N{sup 14}(p,p')N{sup 14*}) and Astrophysical reactions (such as N{sup 14}(p,{gamma})O{sup 15}). (author)

  3. Naima: a Python package for inference of particle distribution properties from nonthermal spectra

    Science.gov (United States)

    Zabalza, V.

    2015-07-01

    The ultimate goal of the observation of nonthermal emission from astrophysical sources is to understand the underlying particle acceleration and evolution processes, and few tools are publicly available to infer the particle distribution properties from the observed photon spectra from X-ray to VHE gamma rays. Here I present naima, an open source Python package that provides models for nonthermal radiative emission from homogeneous distribution of relativistic electrons and protons. Contributions from synchrotron, inverse Compton, nonthermal bremsstrahlung, and neutral-pion decay can be computed for a series of functional shapes of the particle energy distributions, with the possibility of using user-defined particle distribution functions. In addition, naima provides a set of functions that allow to use these models to fit observed nonthermal spectra through an MCMC procedure, obtaining probability distribution functions for the particle distribution parameters. Here I present the models and methods available in naima and an example of their application to the understanding of a galactic nonthermal source. naima's documentation, including how to install the package, is available at http://naima.readthedocs.org.

  4. Artium mater in relativistic astrophysics : New perspectives for a European-Latin American PhD program

    Energy Technology Data Exchange (ETDEWEB)

    Chardonnet, Pascal [Coordinator IRAP PhD EMJD, Université de Nice 28, avenue Valrose 06103 Nice (France); LAPTh, Université de Savoie, CNRS, B.P. 110, Annecy-le-Vieux F-74941 (France); ICRANet, Piazza della Repubblica 10, 65122 Pescara (Italy); Department for Theoretical Nuclear Physics, National Research Nuclear University Moscow Engineering Physics Institute, MEPhI, Moscow (Russian Federation)

    2015-12-17

    Following the successful scientific space missions by the European Space Agency (ESA) and the European Southern Observatory (ESO) in Chile, as well as the high-energy particle activities at CERN in Genve, we have created a Ph.D. program dedicated to the formation of scientists in the field of relativistic astrophysics. The students of such a program will lead the theoretical developments of one of the most active fields of research, based on the above observational and experimental facilities. This program needs expertise in the most advanced topics of mathematical and theoretical physics, and in relativistic field theories. It requires the ability to model the observational data received from the above facilities, as well as all the basic knowledge in astronomy, astrophysics and cosmology. This activity is necessarily international, no single university can cover the broad expertises. From this, the proposed program of the IRAP Ph.D., in one of the youngest and most dynamical French universities, pole of research and teaching in the Euro-Mediterranean region (PRES): the University of Nice. It benefits from the presence of the astrophysics research institute of Observatoire de la Cte d’Azur involved in relativistic and non-photonic astrophysics. The participation of the Freie Universitaet Berlin, Oldenburg and Bremen Universities and of the Einstein Institute in Potsdam offers the possibility of teaching in relativistic field theories at the highest level. The University of Savoy offers the link to the particle physics at CERN. The activities at the University of Rome, at Stockholm University and at ICRANet offer teaching programs in all the fields of relativistic astrophysics, including cosmology, the physics of gravitational collapse, gamma-ray bursts, and black hole physics. Finally, the University of Ferrara will be present with lectures and researches in the topics they have pioneered such as x-ray astrophysics and observational cosmology. Through ICRANet

  5. Artium mater in relativistic astrophysics : New perspectives for a European-Latin American PhD program

    International Nuclear Information System (INIS)

    Chardonnet, Pascal

    2015-01-01

    Following the successful scientific space missions by the European Space Agency (ESA) and the European Southern Observatory (ESO) in Chile, as well as the high-energy particle activities at CERN in Genve, we have created a Ph.D. program dedicated to the formation of scientists in the field of relativistic astrophysics. The students of such a program will lead the theoretical developments of one of the most active fields of research, based on the above observational and experimental facilities. This program needs expertise in the most advanced topics of mathematical and theoretical physics, and in relativistic field theories. It requires the ability to model the observational data received from the above facilities, as well as all the basic knowledge in astronomy, astrophysics and cosmology. This activity is necessarily international, no single university can cover the broad expertises. From this, the proposed program of the IRAP Ph.D., in one of the youngest and most dynamical French universities, pole of research and teaching in the Euro-Mediterranean region (PRES): the University of Nice. It benefits from the presence of the astrophysics research institute of Observatoire de la Cte d’Azur involved in relativistic and non-photonic astrophysics. The participation of the Freie Universitaet Berlin, Oldenburg and Bremen Universities and of the Einstein Institute in Potsdam offers the possibility of teaching in relativistic field theories at the highest level. The University of Savoy offers the link to the particle physics at CERN. The activities at the University of Rome, at Stockholm University and at ICRANet offer teaching programs in all the fields of relativistic astrophysics, including cosmology, the physics of gravitational collapse, gamma-ray bursts, and black hole physics. Finally, the University of Ferrara will be present with lectures and researches in the topics they have pioneered such as x-ray astrophysics and observational cosmology. Through ICRANet

  6. Artium mater in relativistic astrophysics : New perspectives for a European-Latin American PhD program

    Science.gov (United States)

    Chardonnet, Pascal

    2015-12-01

    Following the successful scientific space missions by the European Space Agency (ESA) and the European Southern Observatory (ESO) in Chile, as well as the high-energy particle activities at CERN in Genve, we have created a Ph.D. program dedicated to the formation of scientists in the field of relativistic astrophysics. The students of such a program will lead the theoretical developments of one of the most active fields of research, based on the above observational and experimental facilities. This program needs expertise in the most advanced topics of mathematical and theoretical physics, and in relativistic field theories. It requires the ability to model the observational data received from the above facilities, as well as all the basic knowledge in astronomy, astrophysics and cosmology. This activity is necessarily international, no single university can cover the broad expertises. From this, the proposed program of the IRAP Ph.D., in one of the youngest and most dynamical French universities, pole of research and teaching in the Euro-Mediterranean region (PRES): the University of Nice. It benefits from the presence of the astrophysics research institute of Observatoire de la Cte d'Azur involved in relativistic and non-photonic astrophysics. The participation of the Freie Universitaet Berlin, Oldenburg and Bremen Universities and of the Einstein Institute in Potsdam offers the possibility of teaching in relativistic field theories at the highest level. The University of Savoy offers the link to the particle physics at CERN. The activities at the University of Rome, at Stockholm University and at ICRANet offer teaching programs in all the fields of relativistic astrophysics, including cosmology, the physics of gravitational collapse, gamma-ray bursts, and black hole physics. Finally, the University of Ferrara will be present with lectures and researches in the topics they have pioneered such as x-ray astrophysics and observational cosmology. Through ICRANet the

  7. International Olympiad on Astronomy and Astrophysics

    Science.gov (United States)

    Soonthornthum, B.; Kunjaya, C.

    2011-01-01

    The International Olympiad on Astronomy and Astrophysics, an annual astronomy and astrophysics competition for high school students, is described. Examples of problems and solutions from the competition are also given. (Contains 3 figures.)

  8. Computational Infrastructure for Nuclear Astrophysics

    International Nuclear Information System (INIS)

    Smith, Michael S.; Hix, W. Raphael; Bardayan, Daniel W.; Blackmon, Jeffery C.; Lingerfelt, Eric J.; Scott, Jason P.; Nesaraja, Caroline D.; Chae, Kyungyuk; Guidry, Michael W.; Koura, Hiroyuki; Meyer, Richard A.

    2006-01-01

    A Computational Infrastructure for Nuclear Astrophysics has been developed to streamline the inclusion of the latest nuclear physics data in astrophysics simulations. The infrastructure consists of a platform-independent suite of computer codes that is freely available online at nucastrodata.org. Features of, and future plans for, this software suite are given

  9. Modeling the astrophysical dynamical process with laser-plasmas

    International Nuclear Information System (INIS)

    Xia Jiangfan; Zhang Jun; Zhang Jie

    2001-01-01

    The use of the state-of-the-art laser facility makes it possible to create conditions of the same or similar to those in the astrophysical processes. The introduction of the astrophysics-relevant ideas in laser-plasma experiments is propitious to the understanding of the astrophysical phenomena. However, the great difference between the laser-produced plasmas and the astrophysical processes makes it awkward to model the latter by laser-plasma experiments. The author addresses the physical backgrounds for modeling the astrophysical plasmas by laser plasmas, connecting these two kinds of plasmas by scaling laws. Thus, allowing the creation of experimental test beds where observations and models can be quantitatively compared with laser-plasma data. Special attentions are paid on the possibilities of using home-made laser facilities to model astrophysical phenomena

  10. The Explorer program for astronomy and astrophysics

    International Nuclear Information System (INIS)

    Savage, B.D.; Becklin, E.E.; Cassinelli, J.P.; Dupree, A.K.; Elliot, J.L.; Hoffmann, W.F.; Hudson, H.S.; Jura, M.; Kurfess, J.; Murray, S.S.

    1986-01-01

    This report was prepared to provide NASA with a strategy for proceeding with Explorer-class programs for research in space astronomy and astrophysics. The role of Explorers in astronomy and astrophysics and their past accomplishments are discussed, as are current and future astronomy and astrophysics Explorers. Specific cost needs for an effective Explorer program are considered

  11. Study of astrophysically important resonant states in 26Si by the 28Si(4He,6He)26Si reaction

    Science.gov (United States)

    Kwon, Young Kwan; Lee, C. S.; Moon, J. Y.; Lee, J. H.; Kim, J. Y.; Kubono, S.; Iwasa, N.; Inafiki, K.; Yamaguchi, H.; He, J. J.; Saito, A.; Wakabayashi, Y.; Fukijawa, H.; Amadio, G.; Khiem, L. H.; Tanaka, M.; Chen, A.; Kato, S.

    PoS(NIC-IX)024 , b, H. Yamaguchia, J. J. Hea , A. Saitoa , Y. Wakabayashia, H. Fujikawaa, G. The emission of 1.809 MeV gamma-ray from the first excited state of 26 Mg followed by beta- decay of 26 Al in its ground state (denoted as 26 Alg.s. ) has been identified by gamma-ray telescopes such the Compton Gamma-Ray Observatory (CGRO) [1]. To resolve controversy over the pos- sible sources of the observational 1.809 MeV gamma-rays, one needs accurate knowledge of the production rate of 26 Al. The 25 Al(p,γ)26Si reaction which is the competition reaction for produc- tion of 26 Alg.s. is one of the important subjects to be investigated. In this work, the astrophysically important 26 Si states above the proton threshold were studied via the 28 Si(4 He,6 He)26 Si reaction. We have preformed an angular distribution measurement using the high resolution QDD spectro- graph (PA) at Center for Nuclear Study (CNS), University of Tokyo. The experimental results and data analysis will be presented.

  12. INTEGRAL Detection of the First Prompt Gamma-Ray Signal Coincident with the Gravitational-wave Event GW170817

    DEFF Research Database (Denmark)

    Savchenko, V.; Ferrigno, C.; Kuulkers, E.

    2017-01-01

    We report the INTernational Gamma-ray Astrophysics Laboratory (INTEGRAL) detection of the short gamma-ray burst GRB 170817A (discovered by Fermi-GBM) with a signal-to-noise ratio of 4.6, and, for the first time, its association with the gravitational waves (GWs) from binary neutron star (BNS......) merging event GW170817 detected by the LIGO and Virgo observatories. The significance of association between the gamma-ray burst observed by INTEGRAL and GW170817 is 3.2σ, while the association between the Fermi-GBM and INTEGRAL detections is 4.2σ. GRB 170817A was detected by the SPI-ACS instrument about...

  13. Colors and luminosities of the optical afterglows of the gamma-ray bursts

    Czech Academy of Sciences Publication Activity Database

    Šimon, Vojtěch; Hudec, René; Pizzichini, G.; Masetti, N.

    2001-01-01

    Roč. 377, č. 2 (2001), s. 450-461 ISSN 0004-6361 R&D Projects: GA AV ČR KSK1048102; GA MŠk ME 137; GA MŠk ME 002; GA ČR GA205/99/0145 Institutional research plan: CEZ:AV0Z1003909 Keywords : gamma rays * bursts * radiation mechanisms Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 2.790, year: 2000

  14. An Overview of the Current Understanding of Gamma-Ray Bursts in the Fermi Era

    Science.gov (United States)

    Bhat, P. N.; Guiriec, Sylvain

    2011-01-01

    Gamma-ray bursts are the most luminous explosions in the Universe, and their origin as well as mechanism are the focus of intense research and debate. More than three decades since their serendipitous discovery, followed by several breakthroughs from space-borne and ground-based observations, they remain one of the most interesting astrophysical phenomena yet to be completely understood. Since the launch of Fermi with its unprecedented energy band width spanning seven decades, the study of gamma-ray burst research has entered a new phase. Here we review the current theoretical understanding and observational highlights of gamma-ray burst astronomy and point out some of the potential promises of multi-wavelength observations in view of the upcoming ground based observational facilities .

  15. Gamma-ray lines from radiative dark matter decay

    International Nuclear Information System (INIS)

    Garny, Mathias; Ibarra, Alejandro; Tran, David; Weniger, Christoph

    2011-01-01

    The decay of dark matter particles which are coupled predominantly to charged leptons has been proposed as a possible origin of excess high-energy positrons and electrons observed by cosmic-ray telescopes PAMELA and Fermi LAT. Even though the dark matter itself is electrically neutral, the tree-level decay of dark matter into charged lepton pairs will generically induce radiative two-body decays of dark matter at the quantum level. Using an effective theory of leptophilic dark matter decay, we calculate the rates of radiative two-body decays for scalar and fermionic dark matter particles. Due to the absence of astrophysical sources of monochromatic gamma rays, the observation of a line in the diffuse gamma-ray spectrum would constitute a strong indication of a particle physics origin of these photons. We estimate the intensity of the gamma-ray line that may be present in the energy range of a few TeV if the dark matter decay interpretation of the leptonic cosmic-ray anomalies is correct and comment on observational prospects of present and future Imaging Cherenkov Telescopes, in particular the CTA

  16. TeV Particle Astrophysics 2010, Booklet of abstracts

    International Nuclear Information System (INIS)

    None, C.; Davide Ferella, A.; Pato, M.; Catena, R.; Salucci, P.; Rielage, K.; Kobayashi, K.; Degunda, U.; Estrada, J.; Yue, Q.; Benbow, W.; Maestro, P.; Berghaus, P.; Benzvi, S.; Gallant, Y.; Coniglione, R.; Frey, R.; Besson, D.; Odrowski, S.; Ernenwein, J.P.; Dios Zornosa, J. de; Colnard, C.; Cavalcante de Souza, J.; Fraija, N.; Cerdeno, D.; Moroi, T.; Kumar, J.; Slatyer, T.; Yaguna, C.; Thomson, G.; Tameda, Y.; Taylor, A.; Giacinti, G.; Calvez, A.; Kotera, K.; Shinozaki, K.; Aharonian, F.; Essey, W.; Ahlers, M.; Fargion, D.; Canadas, B.; Boehm, C.; Palomares-Ruiz, S.; Panci, P.; Sanchez-Conde, M.A.; Hensley, B.; Vivier, M.; Hooper, D.; Finkbeiner, D.; Dobler, G.; Malyshev, D.; Mertsch, P.; Giannios, D.; Dalton, M.; Casandijan, J.M.; Mukherjee, R.; Morlino, G.; Ando, S.; Gilmore, R.; Medina, C.; Weitzel, Q.; Caprioli, D.; Vovk, I.; Vincent, S.; Delahaye, T.; Lavalle, J.; Galli, S.; Crocker, R.; Catena, R.; Cholis, I.; Sandick, P.; Rydberg, C.E.; Hulss, J.P.; Danninger, M.; Tran, D.; Spolyar, D.; Belanger, G.; Ronga, F.; Montanino, D.; Fornasa, M.; Regoes, E.; Caprioli, D.; Morlino, G.; Ostapchenko, S.; Kawanaka, N.; Kalli, S.; Whitehorn, N.; Boutayeb, B.; Casanellas, J.; Lopes, I.

    2012-01-01

    The aim of the conference is to bring together theorists and experimentalists working in the fields of Particle Physics, Astrophysics and Cosmology, with a shared interest in physical processes at the TeV energy scale. After decades of theoretical speculation, the exploration of the TeV energy frontier has now in fact begun, with the results provided by ground-based and space-born observatories of gamma-rays (Fermi, HESS, Magic, Veritas, Cangaroo, Milagro), anti-matter (PAMELA, ATIC, HESS and soon AMS-02) and neutrinos (IceCube, Antares), with a large number of ongoing direct Dark Matter search experiments exploiting different detection techniques, and with the TeV particle accelerators Tevatron and the Large Hadron Collider. The physics underlying these experiments involves many intertwined issues, such as the nature of Dark Matter, Physics beyond the Standard Model, the origin of Cosmic Rays and the distribution of Dark and visible matter in the Universe. This document gathers only the abstracts of the papers. (authors)

  17. Line and continuum spectroscopy as diagnostic tools for gamma ray bursts

    International Nuclear Information System (INIS)

    Liang, E.P.

    1990-12-01

    We review the theoretical framework of both line and continuum spectra formation in gamma ray bursts. These include the cyclotron features at 10's of keV, redshifted annihilation features at ∼400 keV, as well as other potentially detectable nuclear transition lines, atomic x-ray lines, proton cyclotron lines and plasma oscillation lines. By combining the parameters derived from line and continuum modeling we can try to reconstruct the location, geometry and physical conditions of the burst emission region, thereby constraining and discriminating the astrophysical models. Hence spectroscopy with current and future generations of detectors should provide powerful diagnostic tools for gamma ray bursters. 48 refs., 10 figs., 4 tabs

  18. Electric Currents along Astrophysical Jets

    Directory of Open Access Journals (Sweden)

    Ioannis Contopoulos

    2017-10-01

    Full Text Available Astrophysical black holes and their surrounding accretion disks are believed to be threaded by grand design helical magnetic fields. There is strong theoretical evidence that the main driver of their winds and jets is the Lorentz force generated by these fields and their associated electric currents. Several researchers have reported direct evidence for large scale electric currents along astrophysical jets. Quite unexpectedly, their directions are not random as would have been the case if the magnetic field were generated by a magnetohydrodynamic dynamo. Instead, in all kpc-scale detections, the inferred electric currents are found to flow away from the galactic nucleus. This unexpected break of symmetry suggests that a battery mechanism is operating around the central black hole. In the present article, we summarize observational evidence for the existence of large scale electric currents and their associated grand design helical magnetic fields in kpc-scale astrophysical jets. We also present recent results of general relativistic radiation magnetohydrodynamic simulations which show the action of the Cosmic Battery in the vicinity of astrophysical black holes.

  19. Astrophysics at RIA (ARIA) Working Group

    International Nuclear Information System (INIS)

    Smith, Michael S.; Schatz, Hendrik; Timmes, Frank X.; Wiescher, Michael; Greife, Uwe

    2006-01-01

    The Astrophysics at RIA (ARIA) Working Group has been established to develop and promote the nuclear astrophysics research anticipated at the Rare Isotope Accelerator (RIA). RIA is a proposed next-generation nuclear science facility in the U.S. that will enable significant progress in studies of core collapse supernovae, thermonuclear supernovae, X-ray bursts, novae, and other astrophysical sites. Many of the topics addressed by the Working Group are relevant for the RIKEN RI Beam Factory, the planned GSI-Fair facility, and other advanced radioactive beam facilities

  20. VHE gamma-rays from radio pulsars and cataclysmic variables

    International Nuclear Information System (INIS)

    De Jager, O.C.; Brink, C.; Meintjies, P.J.; Nel, H.I.; North, A.R.; Raubenheimer, B.C.; Van der Walt, D.J.

    1990-01-01

    We present the results of observations (above 1 TeV) of radio pulsars and cataclysmic variables with the Potchefstroom air Cerenkov facility. We were able to confirm our previous detection of PSR 1509-58 and the final significance is 1.7x10 -5 . A DC enhancement at the 10 -3 significance level was seen from the L 4 Lagrange position in the PSR 1957+20 system. This result was confirmed by COS-B data. We were also able to detect the 5.4 ms pulsar PSR 1855+09 at a marginal significance level of 5%. However, the best and longest observation indicates non-uniformity at the 0.005 significance level. The TeV light curve resembles the radio light curve. The latter is also reminiscent of other millisecond pulsar observed above 1 TeV. The intermediate polar AEAQR (P = 33.08s) shows a period shift which is consistent with recent model predictions. However, the present significance of this results does not allow an unambiguous claim. (orig.)

  1. Study of aluminum emission spectra in astrophysical plasmas

    International Nuclear Information System (INIS)

    Jin Zhan; Zhang Jie

    2001-01-01

    High temperature, high density and strong magnetic fields in plasmas produced by ultra-high intensity and ultrashort laser pulses are similar to the main characteristics of astrophysical plasmas. This makes it possible to simulate come astrophysical processes at laboratories. The author presents the theoretic simulation of aluminum emission spectra in astrophysical plasmas. It can be concluded that using laser produced plasmas, the authors can obtain rich information on astrophysical spectroscopy, which is unobservable for astronomer

  2. Spectroscopic CZT detectors development for x- and gamma-ray imaging instruments

    Science.gov (United States)

    Quadrini, Egidio M.; Uslenghi, Michela; Alderighi, Monica; Casini, Fabio; D'Angelo, Sergio; Fiorini, Mauro; La Palombara, Nicola; Mancini, Marcello; Monti, Serena; Bazzano, Angela; Di Cosimo, Sergio; Frutti, Massimo; Natalucci, Lorenzo; Ubertini, Pietro; Guadalupi, Giuseppe M.; Sassi, Matteo; Negri, Barbara

    2007-09-01

    In the context of R&D studies financed by the Italian Space Agency (ASI), a feasibility study to evaluate the Italian Industry interest in medium-large scale production of enhanced CZT detectors has been performed by an Italian Consortium. The R&D investment aims at providing in-house source of high quality solid state spectrometers for Space Astrophysics applications. As a possible spin-off industrial applications to Gamma-ray devices for non-destructive inspections in medical, commercial and security fields have been considered by ASI. The short term programme mainly consists of developing proprietary procedures for 2-3" CZT crystals growth, including bonding and contact philosophy, and a newly designed low-power electronics readout chain. The prototype design and breadboarding is based on a fast signal AD conversion with the target in order to perform a new run for an already existing low-power (digital photon energy reconstruction with particular care for multiple events and polarimetry evaluations. Scientific requirement evaluations for Space Astrophysics Satellite applications have been carried out in parallel, targeted to contribute to the ESA Cosmic Vision 2015-2025 Announcement of Opportunity. Detailed accommodation studies are undergoing, as part of this programme, to size a "Large area arcsecond angular resolution Imager" for the Gamma Ray Imager satellite (Knödlseder et al., this conference).and a new Gamma-ray Wide Field Camera for the "EDGE" proposal (Piro et al., this conference). Finally, an extended market study for cost analysis evaluation in view of the foreseen massive detector production has been performed.

  3. Hydrodynamic instabilities in astrophysics and ICF

    International Nuclear Information System (INIS)

    Paul Drake, R.

    2005-01-01

    Inertial fusion systems and astrophysical systems both involve hydrodynamic effects, including sources of pressure, shock waves, rarefactions, and plasma flows. In the evolution of such systems, hydrodynamic instabilities naturally evolve. As a result, a fundamental understanding of hydrodynamic instabilities is necessary to understand their behavior. In addition, high-energy-density facilities designed for ICF purposes can be used to provide and experimental basis for understanding astrophysical processes. In this talk. I will discuss the instabilities that appear in astrophysics and ICF from the common perspective of the basic mechanisms at work. Examples will be taken from experiments aimed at ICF, from astrophysical systems, and from experiments using ICF systems to address issues in astrophysics. The high-energy-density research facilities of today can accelerate small but macroscopic amounts of material to velocities above 100 km/s, can heat such material to temperature above 100 eV, can produce pressures far above a million atmospheres (10''12 dybes/cm''2 or 0.1 TPascal), and can do experiments under these conditions that address basic physics issues. This enables on to devise experiments aimed directly at important process such as the Rayleigh Taylor instability at an ablating surface or at an embedded interface that is accelerating, the Richtmeyer Meshkov evolution of shocked interfaces, and the Kelvin-Helmholtz instability of shear flows. The talk will include examples of such phenomena from the laboratory and from astrophysics, and will discuss experiments to study them. (Author)

  4. Collisionless plasmas in astrophysics

    CERN Document Server

    Belmont, Gerard; Mottez, Fabrice; Pantellini, Filippo; Pelletier, Guy

    2013-01-01

    Collisionless Plasmas in Astrophysics examines the unique properties of media without collisions in plasma physics. Experts in this field, the authors present the first book to concentrate on collisionless conditions in plasmas, whether close or not to thermal equilibrium. Filling a void in scientific literature, Collisionless Plasmas in Astrophysics explains the possibilities of modeling such plasmas, using a fluid or a kinetic framework. It also addresses common misconceptions that even professionals may possess, on phenomena such as "collisionless (Landau) damping". Abundant illustrations

  5. Toward observational neutrino astrophysics

    International Nuclear Information System (INIS)

    Koshiba, M.

    1988-01-01

    It is true that: (1) The first observation of the neutrino burst from the supernova SN1987a by Kamiokande-II which was immediately confirmed by IBM; and (2) the first real-time, directional, and spectral observation of solar 8 B neutrinos also by Kamiokande-II could perhaps be considered as signalling the birth of observational astrophysics. The field, however, is still in its infancy and is crying out for tender loving care. Namely, while the construction of astronomy requires the time and the direction of the signal and that of astrophysics requires, in addition to the spectral information, the observations of (1) could not give the directional information and the results of both (1) and (2) are still suffering from the meager statistics. How do we remedy this situation to let this new born science of observational neutrino astrophysics grow healthy. This is what the author addresses in this talk. 15 refs., 8 figs

  6. EBL Inhomogeneity and Hard-Spectrum Gamma-Ray Sources

    Energy Technology Data Exchange (ETDEWEB)

    Abdalla, Hassan; Böttcher, Markus [Centre for Space Research, North-West University, Potchefstroom 2520 (South Africa)

    2017-02-01

    The unexpectedly hard very-high-energy (VHE; E > 100 GeV) γ -ray spectra of a few distant blazars have been interpreted as evidence of a reduction of the γγ opacity of the universe due to the interaction of VHE γ -rays with the extragalactic background light (EBL) compared to the expectation from current knowledge of the density and cosmological evolution of the EBL. One of the suggested solutions to this problem involves the inhomogeneity of the EBL. In this paper, we study the effects of such inhomogeneity on the energy density of the EBL (which then also becomes anisotropic) and the resulting γγ opacity. Specifically, we investigate the effects of cosmic voids along the line of sight to a distant blazar. We find that the effect of such voids on the γγ opacity, for any realistic void size, is only of the order of ≲1% and much smaller than expected from a simple linear scaling of the γγ opacity with the line-of-sight galaxy underdensity due to a cosmic void.

  7. Radiative capture reaction {sup 7}Be(p,{gamma}){sup 8}B in the continuum shell model

    Energy Technology Data Exchange (ETDEWEB)

    Bennaceur, K; Ploszajczak, M [Grand Accelerateur National d` Ions Lourds (GANIL), Caen (France); Nowacki, F [Grand Accelerateur National d` Ions Lourds (GANIL), Caen (France); [Lab. de Physique Theorique Strasbourg, Strasbourg (France); Okolowicz, J [Grand Accelerateur National d` Ions Lourds (GANIL), Caen (France); [Inst. of Nuclear Physics, Krakow (Poland)

    1998-06-01

    We present here the first application of realistic shell model (SM) including coupling between many-particle (quasi-)bound states and the continuum of one-particle scattering states to the calculation of the total capture cross section and the astrophysical factor in the reaction {sup 7}Be(p,{gamma}){sup 8}B. (orig.)

  8. Study on the optimization of the water Cherenkov detector array of the LHAASO project for surveying VHE gamma ray sources

    Science.gov (United States)

    Li, Hui-Cai; Chen, Ming-Jun; Jia, Huan-Yu; Gao, Bo; Wu, Han-Rong; Yao, Zhi-Guo; Yuo, Xiao-Hao; Zhou, Bin; Zhu, Feng-Rong

    2014-01-01

    It is prpopsed that a water Cherenkov detector array, LHAASO-WCDA, is to be built at Shangri-la, Yunnan Province, China. As one of the major components of the LHAASO project, the main purpose of it is to survey the northern sky for gamma ray sources in the energy range of 100 GeV-30 TeV. In order to design the water Cherenkov array efficiently to economize the budget, a Monte Carlo simulation is carried out. With the help of the simulation, the cost performance of different configurations of the array are obtained and compared with each other, serving as a guide for the more detailed design of the experiment in the next step.

  9. Study on the optimization of the water Cherenkov detector array of the LHAASO project for surveying VHE gamma ray sources

    International Nuclear Information System (INIS)

    Li Huicai; Chen Mingjun; Gao Bo; Wu Hanrong; Yao Zhiguo; Zhou Bin; Jia Huanyu; Zhu Fengrong; You Xiaohao

    2014-01-01

    It is proposed that a water Cherenkov detector array, LHAASO-WCDA, is to be built at Shangri-la, Yunnan Province, China. As one of the major components of the LHAASO project, the main purpose of it is to survey the northern sky for gamma ray sources in the energy range of 100 GeV-30 TeV. In order to design the water Cherenkov array efficiently to economize the budget, a Monte Carlo simulation is carried out. With the help of the simulation, the cost performance of different configurations of the array are obtained and compared with each other, serving as a guide for the more detailed design of the experiment in the next step. (authors)

  10. Theoretical astrophysics an introduction

    CERN Document Server

    Bartelmann, Matthias

    2013-01-01

    A concise yet comprehensive introduction to the central theoretical concepts of modern astrophysics, presenting hydrodynamics, radiation, and stellar dynamics all in one textbook. Adopting a modular structure, the author illustrates a small number of fundamental physical methods and principles, which are sufficient to describe and understand a wide range of seemingly very diverse astrophysical phenomena and processes. For example, the formulae that define the macroscopic behavior of stellar systems are all derived in the same way from the microscopic distribution function. This function it

  11. $\\beta$3$p$-spectroscopy and proton-$\\gamma$ width determination in the decay of $^{31}$Ar

    CERN Multimedia

    We propose to perform a detailed study of the $\\beta$-decay of the dripline nucleus $^{31}$Ar. This will allow a detailed study of the $\\beta$-delayed 3$p$-decay as well as provide important information on the resonances of $^{30}$S and $^{29}$P, in particular the ratio between the $p$- and $\\gamma$- partial widths relevant for astrophysics.

  12. Observational astrophysics

    CERN Document Server

    Léna, Pierre; Lebrun, François; Mignard, François; Pelat, Didier

    2012-01-01

    This is the updated, widely revised, restructured and expanded third edition of Léna et al.'s successful work Observational Astrophysics. It presents a synthesis on tools and methods of observational astrophysics of the early 21st century. Written specifically for astrophysicists and graduate students, this textbook focuses on fundamental and sometimes practical limitations on the ultimate performance that an astronomical system may reach, rather than presenting particular systems in detail. In little more than a decade there has been extraordinary progress in imaging and detection technologies, in the fields of adaptive optics, optical interferometry, in the sub-millimetre waveband, observation of neutrinos, discovery of exoplanets, to name but a few examples. The work deals with ground-based and space-based astronomy and their respective fields. And it also presents the ambitious concepts behind space missions aimed for the next decades. Avoiding particulars, it covers the whole of the electromagnetic spec...

  13. Deep H.E.S.S. observations of the supernova remnant RX J0852.0-4622

    Science.gov (United States)

    Sushch, Iurii; Paz Arribas, Manuel; Komin, Nukri; Schwanke, Ullrich

    2016-06-01

    The largest TeV source, RX J0852.0-4622 (Vela Jr.), is one of the few supernova remnants (SNRs) with well resolved shell-like morphology at very-high-energy (VHE; E>100 GeV) gamma-rays. Strong non-thermal emission across the electromagnetic spectrum from radio to VHE gamma-rays, young age and proximity of the remnant makes it one of the prime objects for the study of particle acceleration aiming to test the paradigm of SNRs being sources of Galactic cosmic rays. Here we present deep H.E.S.S. observations of RX J0852.0-4622 with roughly doubled exposure comparing to previously published results. Improved statistics together with new analysis techniques result in a firm determination of the cut-off in the gamma-ray spectrum and allow the spatially resolved spectroscopy studies. A smooth connection of the H.E.S.S. spectrum to the spectrum at GeV energies as reported by Fermi/LAT provides an exciting opportunity to recover the present-time parent particle population in both leptonic and hadronic scenarios directly from the gamma-ray data alone. These new observations provide us a deeper insight and better understanding of the physical processes in SNRs.

  14. Balloon observation of gamma-ray burst

    International Nuclear Information System (INIS)

    Nishimura, Jun; Fujii, Masami; Yamagami, Takamasa; Oda, Minoru; Ogawara, Yoshiaki

    1978-01-01

    Cosmic gamma-ray burst is an interesting high energy astrophysical phenomenon, but the burst mechanism has not been well understood. Since 1975, long duration balloon flight has been conducted to search for gamma-ray bursts and to determine the source locations. A rotating cross-modulation collimator was employed to determine the locations of sources, and four NaI(Tl) scintillation counters were employed to detect hard X-ray with energy from 20 to 200 keV. The balloon light was performed at altitude of 8.3 mb from September 28, 1977, and the observation time of 79 hours was achieved. In this experiment, the monitor counter was not mounted. The count increase was observed at 16 h 22 m 31 s JST on October 1, 1977. The event disappeared after 1 sec. The total flux is estimated to be 1.6 x 10 -6 erg/cm 2 sec at the top of the atmosphere. When this event was observed, the solar-terrestrial environment was also quiet. Thus, this event was attributed to a small gamma-ray burst. Unfortunately, the duration of the burst was so short that the position of the burst source was not able to be determined. (Yoshimori, M.)

  15. Geneva University

    CERN Multimedia

    2009-01-01

    Ecole de physique - Département de physique nucléaire et corspusculaire 24, Quai Ernest-Ansermet 1211 GENEVE 4 Tél: (022) 379 62 73 - Fax: (022) 379 69 92 Wednesday 25 February 2009 PARTICLE PHYSICS SEMINAR at 17:00 – Stückelberg Auditorium Physics insights from recent HESS AGN observations by Dr. Francesca Volpe, Max-Planck-Institute for Nuclear Physics, Heidelberg The extragalactic sources are still the most powerful, variable and brightest objects in the VHE gamma-ray sky. The improved sensitivity of the new generation of ground-based instruments have increased the VHE emitting population, providing information about cosmology and giving new clues about particle acceleration mechanisms at play in active galactic nuclei. Emphasis will be put on the contribution of the H.E.S.S. experiment to the temporal variability of extragalactic gamma-ray sources, including an update on the most recent detections and on the giant flares from PKS 2155-304. Information : http://dpnc.unige.ch/seminaire/annonce.htmlOr...

  16. Geneva University

    CERN Multimedia

    2009-01-01

    École de physique - Département de physique nucléaire et corspusculaire 24, quai Ernest-Ansermet 1211 GENÈVE 4 Tél: (022) 379 62 73 - Fax: (022) 379 69 92 Wednesday 25 February 2009 PARTICLE PHYSICS SEMINAR at 17:00 – Stückelberg Auditorium Physics insights from recent HESS AGN observations by Dr. Francesca Volpe / Max-Planck-Institute for Nuclear Physics, Heidelberg The extragalactic sources are still the most powerful, variable and brightest objects in the VHE gamma-ray sky. The improved sensitivity of the new generation of ground-based instruments have increased the VHE emitting population, providing information about cosmology and giving new clues about particle acceleration mechanisms at play in active galactic nuclei. Emphasis will be put on the contribution of the H.E.S.S. experiment to the temporal variability of extragalactic gamma-ray sources, including an update on the most recent detections and on the giant flares from PKS 2155-304. Information: http://d...

  17. Nuclear physics in astrophysics. Part 2. Abstracts

    International Nuclear Information System (INIS)

    Gyuerky, Gy.; Fueloep, Zs.

    2005-01-01

    The proceedings of the 20. International Nuclear Physics Divisional Conference of the European Physical Society covers a wide range of topics in nuclear astrophysics. The topics addressed are big bang nucleosynthesis, stellar nucleosynthesis, measurements and nuclear data for astrophysics, nuclear structure far from stability, neutrino physics, and rare-ion-beam facilities and experiments. The perspectives of nuclear physics and astrophysics are also overviewed. 77 items are indexed separately for the INIS database. (K.A.)

  18. Very high-energy gamma-ray signature of ultrahigh-energy cosmic-ray acceleration in Centaurus A

    Science.gov (United States)

    Joshi, Jagdish C.; Miranda, Luis Salvador; Razzaque, Soebur; Yang, Lili

    2018-04-01

    The association of at least a dozen ultrahigh-energy cosmic-ray (UHECR) events with energy ≳ 55 EeV detected by the Pierre Auger Observatory (PAO) from the direction of Centaurus-A, the nearest radio galaxy, supports the scenario of UHECR acceleration in the jets of radio galaxies. In this work, we model radio to very high energy (VHE,≳ 100 GeV) γ-ray emission from Cen A, including GeV hardness detected by Fermi-LAT and TeV emission detected by HESS. We consider two scenarios: (i) Two zone synchrotron self-Compton (SSC) and external-Compton (EC) models, (ii) Two zone SSC, EC and photo-hadronic emission from cosmic ray interactions. The GeV hardness observed by Fermi-LAT can be explained using these two scenarios, where zone 2 EC emission is very important. Hadronic emission in scenario (ii) can explain VHE data with the same spectral slope as obtained through fitting UHECRs from Cen A. The peak luminosity in cosmic ray proton at 1 TeV, to explain the VHE γ-ray data is ≈2.5 × 1046 erg/s. The bolometric luminosity in cosmic ray protons is consistent with the luminosity required to explain the origin of 13 UHECR signal events that are correlated with Cen A.

  19. Magnetohydrodynamic models of astrophysical jets

    International Nuclear Information System (INIS)

    Beskin, Vasily S

    2010-01-01

    In this review, analytical results obtained for a wide class of stationary axisymmetric flows in the vicinity of compact astrophysical objects are analyzed, with an emphasis on quantitative predictions for specific sources. Recent years have witnessed a great increase in understanding the formation and properties of astrophysical jets. This is due not only to new observations but also to advances in analytical theory which has produced fairly simple relations, and to what can undoubtedly be called a breakthrough in numerical simulation which has enabled confirmation of theoretical predictions. Of course, we are still very far from fully understanding the physical processes occurring in compact sources. Nevertheless, the progress made raises hopes for near-future test observations that can give insight into the physical processes occurring in active astrophysical objects. (reviews of topical problems)

  20. The MAGIC telescope for gamma-ray astronomy above 30 GeV

    Science.gov (United States)

    Moralejo, A.; MAGIC Collaboration

    The MAGIC telescope is presently at its commissioning phase at the Roque de los Muchachos Observatory (ORM) on the island of La Palma. MAGIC will become the largest ground-based gamma ray telescope in the world, being sensitive to photons of energies as low as 30 GeV. The spectral range between 10 and 300 GeV remains to date mostly unexplored. Observations in this region of the spectrum are expected to provide key data for the understanding of a wide variety of astrophysical phenomena belonging to the so-called ``non thermal Universe'', like the processes in the nuclei of active galaxies, the radiation mechanisms of pulsars and supernova remnants, and the enigmatic gamma-ray bursts. And overview of the telescope and its Physics goals is presented.

  1. Development of a Gamma Spectrometer using a Large NaI Scintillator and SiPMs

    International Nuclear Information System (INIS)

    Kim, Chankyu; Yoo, Hyunjun; Kim, Yewon and others

    2014-01-01

    A typical scintillation gamma spectrometer is composed of a NaI(Tl) scintillation crystal and a PM tube. From last years, a Silicon Photomultiplier (SiPM) is being developed and expanding its application area as a substitute of PM tube due to its advantages like low operating voltage, small volume, and cheap production cost, MR compatibility. This approach could make gamma spectrometer smaller, cheaper, easier to use, and these advantage are quite suitable to original purpose of scintillation gamma spectrometer. Gamma spectrometry and gamma spectrometer is used to analyze gamma source in nuclear science, geochemistry, and astrophysics. In this research, gamma spectrometer which uses SiPMs instead of PM tube is proposed. The proposed gamma spectrometer has advantages of low cost, small volume, low operation voltage; but it has disadvantages of performances. To reduce this loss in performances, a light guide of effective structure is required. (Material, reflection type, tapering angle) For design of the light guide, DETECT simulation was performed. And through DETECT simulation, the characteristics of light guide could be prospected. Actual light guide was manufactured on the basis of this simulation result. Using the light guide, gamma spectrometer system was composed and tested. In the test result, gamma spectrometer using SiPM shows degraded energy resolution. The reason of this degradation is being analyzed and the test system is under modification

  2. Relativistic astrophysics

    CERN Document Server

    Price, R H

    1993-01-01

    Work reported in the workshop on relativistic astrophysics spanned a wide varicy of topics. Two specific areas seemed of particular interest. Much attention was focussed on gravitational wave sources, especially on the waveforms they produce, and progress was reported in theoretical and observational aspects of accretion disks.

  3. DIAPHANE: A portable radiation transport library for astrophysical applications

    Science.gov (United States)

    Reed, Darren S.; Dykes, Tim; Cabezón, Rubén; Gheller, Claudio; Mayer, Lucio

    2018-05-01

    One of the most computationally demanding aspects of the hydrodynamical modelingof Astrophysical phenomena is the transport of energy by radiation or relativistic particles. Physical processes involving energy transport are ubiquitous and of capital importance in many scenarios ranging from planet formation to cosmic structure evolution, including explosive events like core collapse supernova or gamma-ray bursts. Moreover, the ability to model and hence understand these processes has often been limited by the approximations and incompleteness in the treatment of radiation and relativistic particles. The DIAPHANE project has focused on developing a portable and scalable library that handles the transport of radiation and particles (in particular neutrinos) independently of the underlying hydrodynamic code. In this work, we present the computational framework and the functionalities of the first version of the DIAPHANE library, which has been successfully ported to three different smoothed-particle hydrodynamic codes, GADGET2, GASOLINE and SPHYNX. We also present validation of different modules solving the equations of radiation and neutrino transport using different numerical schemes.

  4. XXII SLAC summer institute on particle physics: Proceedings. Particle physics, astrophysics and cosmology

    Energy Technology Data Exchange (ETDEWEB)

    Chan, J; DePorcel, L [eds.

    1996-02-01

    The seven-day school portion of the Institute revolved around the question of dark matter: where is it and what is it? Reviews were given of microlensing searches for baryonic dark matter, of dark matter candidates in the form of neutrinos and exotic particles, and of low-noise detection techniques used to search for the latter. The history of the universe, from the Big Bang to the role of dark matter in the formation of large-scale structure, was also covered. Other lecture series described the astrophysics that might be done with x-ray timing experiments and through the detection of gravitational radiation. As in past years, the lectures each morning were followed by stimulating afternoon discussion sessions, in which students could pursue with the lecturers the topics that most interested them. The Institute concluded with a three-day topical conference covering recent developments in theory and experiment. Highlights from the astrophysical and cosmological arenas included observations of anisotropy in the cosmic microwave background, and of the mysterious gamma-ray bursters. From terrestrial accelerators came tantalizing hints of the top quark and marked improvements in precision electroweak measurements, among many other results. Selected papers are indexed separately for inclusion in the Energy Science and Technology Database.

  5. XXII SLAC summer institute on particle physics: Proceedings. Particle physics, astrophysics and cosmology

    International Nuclear Information System (INIS)

    Chan, J.; DePorcel, L.

    1996-02-01

    The seven-day school portion of the Institute revolved around the question of dark matter: where is it and what is it? Reviews were given of microlensing searches for baryonic dark matter, of dark matter candidates in the form of neutrinos and exotic particles, and of low-noise detection techniques used to search for the latter. The history of the universe, from the Big Bang to the role of dark matter in the formation of large-scale structure, was also covered. Other lecture series described the astrophysics that might be done with x-ray timing experiments and through the detection of gravitational radiation. As in past years, the lectures each morning were followed by stimulating afternoon discussion sessions, in which students could pursue with the lecturers the topics that most interested them. The Institute concluded with a three-day topical conference covering recent developments in theory and experiment. Highlights from the astrophysical and cosmological arenas included observations of anisotropy in the cosmic microwave background, and of the mysterious gamma-ray bursters. From terrestrial accelerators came tantalizing hints of the top quark and marked improvements in precision electroweak measurements, among many other results. Selected papers are indexed separately for inclusion in the Energy Science and Technology Database

  6. Analogue Hawking radiation from astrophysical black-hole accretion

    International Nuclear Information System (INIS)

    Das, Tapas K

    2004-01-01

    We show that spherical accretion onto astrophysical black holes can be considered as a natural example of an analogue system. We provide, for the first time, an exact analytical scheme for calculating the analogue Hawking temperature and surface gravity for general relativistic accretion onto astrophysical black holes. Our calculation may bridge the gap between the theory of transonic astrophysical accretion and the theory of analogue Hawking radiation. We show that the domination of the analogue Hawking temperature over the actual Hawking temperature may be a real astrophysical phenomenon, though observational tests of this fact will at best be difficult and at worst might prove to be impossible. We also discuss the possibilities of the emergence of analogue white holes around astrophysical black holes. Our calculation is general enough to accommodate accreting black holes with any mass

  7. Recent progress on astrophysical opacity

    International Nuclear Information System (INIS)

    Rogers, F.J.; Iglesias, C.A.

    1992-08-01

    Improvements in the calculation of the opacity of astrophysical plasmas has helped to resolve several long-standing puzzles in the modeling of variable stars. The most significant opacity enhancements over the Los Alamos Astrophysical Library (LAOL) are due to improvements in the equation of state and atomic physics. Comparison with experiment has corroborated the predicted large opacity increases due to transitions in M-shell iron. We give a summary of recent developments

  8. Astrophysical fluid dynamics

    Science.gov (United States)

    Ogilvie, Gordon I.

    2016-06-01

    > These lecture notes and example problems are based on a course given at the University of Cambridge in Part III of the Mathematical Tripos. Fluid dynamics is involved in a very wide range of astrophysical phenomena, such as the formation and internal dynamics of stars and giant planets, the workings of jets and accretion discs around stars and black holes and the dynamics of the expanding Universe. Effects that can be important in astrophysical fluids include compressibility, self-gravitation and the dynamical influence of the magnetic field that is `frozen in' to a highly conducting plasma. The basic models introduced and applied in this course are Newtonian gas dynamics and magnetohydrodynamics (MHD) for an ideal compressible fluid. The mathematical structure of the governing equations and the associated conservation laws are explored in some detail because of their importance for both analytical and numerical methods of solution, as well as for physical interpretation. Linear and nonlinear waves, including shocks and other discontinuities, are discussed. The spherical blast wave resulting from a supernova, and involving a strong shock, is a classic problem that can be solved analytically. Steady solutions with spherical or axial symmetry reveal the physics of winds and jets from stars and discs. The linearized equations determine the oscillation modes of astrophysical bodies, as well as their stability and their response to tidal forcing.

  9. Introduction to Nuclear Astrophysics

    International Nuclear Information System (INIS)

    Iliadis, Christian

    2010-01-01

    In the first lecture of this volume, we will present the basic fundamental ideas regarding nuclear processes occurring in stars. We start from stellar observations, will then elaborate on some important quantum-mechanical phenomena governing nuclear reactions, continue with how nuclear reactions proceed in a hot stellar plasma and, finally, we will provide an overview of stellar burning stages. At the end, the current knowledge regarding the origin of the elements is briefly summarized. This lecture is directed towards the student of nuclear astrophysics. Our intention is to present seemingly unrelated phenomena of nuclear physics and astrophysics in a coherent framework.

  10. Astrophysics and the exploration of the universe; L'astrophysique et l'exploration de l'Univers

    Energy Technology Data Exchange (ETDEWEB)

    Turck-Chieze, S.; Garcia, R.A.; Brun, A.S.; Minier, V.; Andre, Ph.; Motte, F.; Mathis, St.; Foglizzo, Th.; Decourchelle, A.; Ballet, J.; Chaty, S.; Corbel, St.; Rodriguez, J.; Brahic, A.; Charnoz, S.; Ferrari, C.; Lagage, P.O.; Masset, F.; Pantin, E.; Sauvage, M.; Galliano, F.; Goldwurm, A.; Ballet, J.; Decourchelle, A.; Grenier, I.; Daddi, E.; Elbaz, D.; Bournaud, F.; Yvon, D.; Arnaud, M.; Teyssier, R.; Lehoucq, R.; Palanque-Delabrouille, N.; Lehoucq, R.; Cirelli, M.; Bonvin, C.; Mansoulie, B.; Ruhlmann-Kleider, V.; Refregier, A.; Brax, Ph.; Lavignac, St.; Starck, J.L.; Talvard, M.; Sauvage, M.; Cara, Ch.; Lagage, P.O.; Ferrari, C.; Rodriguez, L.; Sauvageot, J.L.; Lebrun, F.; Grenier, I.; Glicenstein, J.F.; Gerbier, G.

    2009-07-01

    This special issue of Clefs CEA journal is entirely devoted to astrophysics and to the exploration and probing of the Universe. A first part of this dossier, described here, makes a status of our present day knowledge about stars, planets, galaxies, the Universe structure and dark matter. Content: 1 - Stars seed the Universe: What does the Sun tell us?, Probing stellar interiors, From the Sun to the stars, A tour of stellar nurseries, How heavy elements arise, How supernovae explode, Supernova remnants, High-energy objects - sources for astonishment, Focus: A Probing the Universe across the entire light spectrum; 2 - Planets: a dance of small bodies, swirling around up to the finale of their birth: How our world was born, The rings of Saturn: a magnificent research laboratory, Planetary cocoons; 3 - Galaxies: a richly paradoxical evolution: The active life of galaxies, A mysterious black hole, Elucidating the cosmic ray acceleration mechanism, Seeking out the great ancestors, The formation of galaxies: a story of paradoxes, The morphogenesis of galaxies; 4 - The Universe, a homogeneous 'soup' that has turned into a hierarchical structure: The grand thermal history of the Universe, The cosmic web, The formation of the structures of the Universe: the interplay of models, Does the Universe have a shape? Is it finite, or infinite?; 5 - Odyssey across the dark side of the Universe: The puzzle of dark matter, Astrophysics and the observation of dark matter, The theory of dark matter, Could dark matter be generated some day at LHC? A Universe dominated by dark energy, Astrophysics and the observation of dark energy, Theories of dark energy, The matter-antimatter asymmetry of the Universe; 6 - Journey into the lights of the Universe: Microwave - ESA Planck Surveyor, Submillimeter and infrared - ArTeMis, Herschel Space Observatory, VLT-VISIR, Cassini-CIRS, Visible - SoHo-GOLF, X-ray - XMM-Newton, Gamma ray - INTEGRAL, Fermi Gamma-Ray Space Telescope, HESS

  11. FOREWORD: Nuclear Physics in Astrophysics V

    Science.gov (United States)

    Auerbach, Naftali; Hass, Michael; Paul, Michael

    2012-02-01

    of neutrinos, such as double-beta decay and neutrino mixing were well represented at the conference. One of the central problems in modern cosmology and astrophysics is the search for dark matter. Several talks dealt with this subject and with methods to detect dark matter. Another intriguing and rather novel subject that was discussed at the meeting was time variation of fundamental physical constants. Two speakers have examined the sensitivity of Big-Bang Nucleosynthesis to the variation of the values of the fundamental constants. The role of some specific nuclei (such as Ni 56) in cosmology was pointed out. Many of the presentations at the conference described experimental studies of reactions relevant to nucleosynthesis at various stages of cosmic evolution. As reflected in the conference, these activities are widespread, encompassing many laboratories. Rare Isotope Beam (RIB) facilities are in the forefront of these studies. To understand the various processes of nucleosynthesis one has to have a good theory of nuclei far from the stability line. A number of presentations dealt with the description of such exotic nuclei. It is clear from the presentations that the future of experimental nuclear astrophysics looks promising as existing experimental facilities are being upgraded and new facilities are being built. X-Ray and Gamma-Ray Bursts and cosmic explosions were the subject of several talks. A discussion of various experiments attempting to measure time-reversal violation was the subject of one lecture. The solution of the puzzle as to why the universe is asymmetric with respect to matter-antimatter requires knowledge of the limit of time-reversal conservation. The late John Bahcall was a great astrophysicist and a supporter of the conference series 'Nuclear physics in Astrophysics'. On the last day of the conference, following a talk by Neta Bahcall from Princeton University on dark matter in the Universe, a short commemoration for John was held. Detailed

  12. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Indian Institute of Astrophysics, Koramangala, Bangalore 560 034, India. Kavli Institute for Astronomy & Astrophysics, Peking University, Beijing 100871, China. National Research Council of Canada, Herzberg Institute of Astrophysics, 5071 West Saanich Road, Victoria, British Columbia, Canada. Thirty Meter Project Office, ...

  13. Half-lives of ground and isomeric states in {sup 97}Cd and the astrophysical origin of {sup 96}Ru

    Energy Technology Data Exchange (ETDEWEB)

    Lorusso, G., E-mail: lorusso@ribf.riken.j [National Superconducting Cyclotron Laboratory, Michigan State University, East Lansing, MI 48824 (United States); Joint Institute for Nuclear Astrophysics, Michigan State University, East Lansing, MI 48824 (United States); Department of Physics and Astronomy, Michigan State University, East Lansing, MI 48824 (United States); Becerril, A.; Amthor, A. [National Superconducting Cyclotron Laboratory, Michigan State University, East Lansing, MI 48824 (United States); Joint Institute for Nuclear Astrophysics, Michigan State University, East Lansing, MI 48824 (United States); Department of Physics and Astronomy, Michigan State University, East Lansing, MI 48824 (United States); Baumann, T.; Bazin, D. [National Superconducting Cyclotron Laboratory, Michigan State University, East Lansing, MI 48824 (United States); Berryman, J.S. [National Superconducting Cyclotron Laboratory, Michigan State University, East Lansing, MI 48824 (United States); Department of Chemistry, Michigan State University, East Lansing, MI 48824 (United States); Brown, B.A. [National Superconducting Cyclotron Laboratory, Michigan State University, East Lansing, MI 48824 (United States); Joint Institute for Nuclear Astrophysics, Michigan State University, East Lansing, MI 48824 (United States); Department of Physics and Astronomy, Michigan State University, East Lansing, MI 48824 (United States); Cyburt, R.H. [National Superconducting Cyclotron Laboratory, Michigan State University, East Lansing, MI 48824 (United States); Joint Institute for Nuclear Astrophysics, Michigan State University, East Lansing, MI 48824 (United States); Crawford, H.L. [National Superconducting Cyclotron Laboratory, Michigan State University, East Lansing, MI 48824 (United States); Department of Chemistry, Michigan State University, East Lansing, MI 48824 (United States)

    2011-05-09

    First experimental evidence for a high-spin isomer (25/2{sup +}) in {sup 97}Cd, a waiting point in the astrophysical rapid proton capture process, is presented. The data were obtained in {beta}-decay studies at NSCL using the new RF Fragment Separator system and detecting {beta}-delayed protons and {beta}-delayed {gamma} rays. Decays from ground and isomeric states were disentangled, and proton emission branches were determined for the first time. We find half-lives of 1.10(8) s and 3.8(2) s, and {beta}-delayed proton emission branches of 12(2)% and 25(4)% were deduced for the ground and isomeric states, respectively. With these results, the nuclear data needed to determine an rp-process contribution to the unknown origin of solar {sup 96}Ru are in place. When the new data are included in astrophysical rp-process calculations, one finds that an rp-process origin of {sup 96}Ru is unlikely.

  14. Astrophysics with small satellites in Scandinavia

    DEFF Research Database (Denmark)

    Lund, Niels

    2003-01-01

    The small-satellites activities in the Scandinavian countries are briefly surveyed with emphasis on astrophysics research. (C) 2002 COSPAR. Published by Elsevier Science Ltd. All rights reserved.......The small-satellites activities in the Scandinavian countries are briefly surveyed with emphasis on astrophysics research. (C) 2002 COSPAR. Published by Elsevier Science Ltd. All rights reserved....

  15. Computational Laboratory Astrophysics to Enable Transport Modeling of Protons and Hydrogen in Stellar Winds, the ISM, and other Astrophysical Environments

    Science.gov (United States)

    Schultz, David

    As recognized prominently by the APRA program, interpretation of NASA astrophysical mission observations requires significant products of laboratory astrophysics, for example, spectral lines and transition probabilities, electron-, proton-, or heavy-particle collision data. Availability of these data underpin robust and validated models of astrophysical emissions and absorptions, energy, momentum, and particle transport, dynamics, and reactions. Therefore, measured or computationally derived, analyzed, and readily available laboratory astrophysics data significantly enhances the scientific return on NASA missions such as HST, Spitzer, and JWST. In the present work a comprehensive set of data will be developed for the ubiquitous proton-hydrogen and hydrogen-hydrogen collisions in astrophysical environments including ISM shocks, supernova remnants and bubbles, HI clouds, young stellar objects, and winds within stellar spheres, covering the necessary wide range of energy- and charge-changing channels, collision energies, and most relevant scattering parameters. In addition, building on preliminary work, a transport and reaction simulation will be developed incorporating the elastic and inelastic collision data collected and produced. The work will build upon significant previous efforts of the principal investigators and collaborators, will result in a comprehensive data set required for modeling these environments and interpreting NASA astrophysical mission observations, and will benefit from feedback from collaborators who are active users of the work proposed.

  16. An introduction to astrophysical hydrodynamics

    CERN Document Server

    Shore, Steven N

    1992-01-01

    This book is an introduction to astrophysical hydrodynamics for both astronomy and physics students. It provides a comprehensive and unified view of the general problems associated with fluids in a cosmic context, with a discussion of fluid dynamics and plasma physics. It is the only book on hydrodynamics that addresses the astrophysical context. Researchers and students will find this work to be an exceptional reference. Contents include chapters on irrotational and rotational flows, turbulence, magnetohydrodynamics, and instabilities.

  17. Astrophysics at nTOF facility

    International Nuclear Information System (INIS)

    Tagliente, G.; Colonna, N.; Maronne, S.; Terlizzi, R.; Abondanno, U.; Fujii, K.; Milazzo, P.M.; Moreau, C.; Belloni, F.; Aerts, G.; Berthoumieux, E.; Andriamonje, S.; Dridi, W.; Gunsing, F.; Pancin, J.; Perrot, L.; Alvarez, H.; Duran, I.; Paradela, C.; Alvarez-Velarde, F.; Cano-Ott, D.; Embid-Segura, M.; Guerrero, C.; Martinez, T.; Villamarin, D.; Vincente, M.C.; Gonzalez-Romero, E.; Andrzejewski, J.; Marganiec, J.; Assimakopoulos, P.; Karamanis, D.; Audouin, L.; Dillman, I.; Heil, M.; Kappeler, F.; Mosconi, M.; Plag, R.; Voss, F.; Walter, S.; Wissak, K.; Badurek, G.; Jericha, E.; Leeb, H.; Oberhummer, H.; Pigni, M.T.; Baumann, P.; David, S.; Kerveno, M.; Rudolf, G.; Lukic, S.; Becvar, F.; Krticka, M.; Bisterzo, S.; Ferrant, L.; Gallino, R.; Calvino, F.; Poch, A.; Pretel, C.; Calviani, M.; Gramegna, F.; Mastinu, P.; Capote, R.; Mengoni, A.; Capote, R.; Lozano, M.; Quesada, J.; Carrapico, C.; Salgado, J.; Santos, C.; Tavora, L.; Vaz, P.; Cennini, P.; Chiaveri, E.; Dahlfors, M.; Kadi, Y.; Sarchiapone, L.; Vlachoudis, V.; Wendler, H.; Chepel, V.; Ferreira-Marques, R.; Goncalves, I.; Lindote, A.; Lopes, I.; Neves, F.; Couture, A.; Cox, J.; O'Brien, S.; Wiescher, M.; Dominga-Pardo, C.; Tain, J.L.; Eleftheriadis, C.; Lamboudis, C.; Savvidis, I.; Stephan, C.; Tassan-Got, L.; Furman, W.; Haas, B.; Haight, R.; Reifarth, R.; Igashira, M.; Koehler, P.; Massimi, C.; Vannini, G.; Papadopoulos, C.; Pavlik, A.; Pavlopoulos, P.; Plomen, A.; Rullhusen, P.; Rauscher, T.; Rubbia, C.; Ventura, A.

    2009-01-01

    The neutron time of flight (n T OF) facility at CERN is a neutron spallation source, its white neutron energy spectrum ranges from thermal to several GeV, covering the full energy range of interest for nuclear astrophysics, in particular for measurements of the neutron capture cross-section required in s-process nucleosynthesis. This contribution gives an overview on the astrophysical program made at n T OF facility, the results and the implications will be considered.

  18. Gravitational wave: gamma-ray burst connections.

    Science.gov (United States)

    Hough, Jim

    2007-05-15

    After 35 years of experimental research, we are rapidly approaching the point at which gravitational waves (GWs) from astrophysical sources may be directly detected by the long-baseline detectors LIGO (USA), GEO 600 (Germany/UK), VIRGO (Italy/France) and TAMA 300 (Japan), which are now in or coming into operation.A promising source of GWs is the coalescence of compact binary systems, events which are now believed to be the origin of short gamma-ray bursts (GRBs). In this paper, a brief review of the state of the art in detector development and exploitation will be given, with particular relevance to a search for signals associated with GRBs, and plans for the future will be discussed.

  19. Point source search techniques in ultra high energy gamma ray astronomy

    International Nuclear Information System (INIS)

    Alexandreas, D.E.; Biller, S.; Dion, G.M.; Lu, X.Q.; Yodh, G.B.; Berley, D.; Goodman, J.A.; Haines, T.J.; Hoffman, C.M.; Horch, E.; Sinnis, C.; Zhang, W.

    1993-01-01

    Searches for point astrophysical sources of ultra high energy (UHE) gamma rays are plagued by large numbers of background events from isotropic cosmic rays. Some of the methods that have been used to estimate the expected number of background events coming from the direction of a possible source are found to contain biases. Search techniques that avoid this problem are described. There is also a discussion of how to optimize the sensitivity of a search to emission from a point source. (orig.)

  20. 2004 ASTRONOMY & ASTROPHYSICS

    Indian Academy of Sciences (India)

    user

    This publication of the Academy on Astronomy and Astrophysics is unique in ... bring out position papers on societal issues where science plays a major ..... funding agencies, the Astronomical Society of ..... orbit very close to the parent star.

  1. 78 FR 2293 - NASA Advisory Council; Science Committee; Astrophysics Subcommittee; Meeting

    Science.gov (United States)

    2013-01-10

    ... Committee; Astrophysics Subcommittee; Meeting AGENCY: National Aeronautics and Space Administration. ACTION... amended, the National Aeronautics and Space Administration (NASA) announces a meeting of the Astrophysics... meeting includes the following topics: --Astrophysics Division Update --NASA Astrophysics Roadmapping It...

  2. 78 FR 66384 - NASA Advisory Council; Science Committee; Astrophysics Subcommittee; Meeting

    Science.gov (United States)

    2013-11-05

    ... Committee; Astrophysics Subcommittee; Meeting AGENCY: National Aeronautics and Space Administration. ACTION... amended, the National Aeronautics and Space Administration (NASA) announces a meeting of the Astrophysics...: --Astrophysics Division Update --Presentation of Astrophysics Roadmap --Reports from Program Analysis Groups...

  3. 75 FR 51116 - NASA Advisory Council; Science Committee; Astrophysics Subcommittee; Meeting

    Science.gov (United States)

    2010-08-18

    ... Committee; Astrophysics Subcommittee; Meeting AGENCY: National Aeronautics and Space Administration. ACTION... amended, the National Aeronautics and Space Administration (NASA) announces a meeting of the Astrophysics... topics: --Astrophysics Division Update --2010 Astronomy and Astrophysics Decadal Survey --Update on...

  4. White Paper on Nuclear Astrophysics

    OpenAIRE

    Arcones, Almudena; Bardayan, Dan W.; Beers, Timothy C.; Berstein, Lee A.; Blackmon, Jeffrey C.; Messer, Bronson; Brown, B. Alex; Brown, Edward F.; Brune, Carl R.; Champagne, Art E.; Chieffi, Alessandro; Couture, Aaron J.; Danielewicz, Pawel; Diehl, Roland; El-Eid, Mounib

    2016-01-01

    This white paper informs the nuclear astrophysics community and funding agencies about the scientific directions and priorities of the field and provides input from this community for the 2015 Nuclear Science Long Range Plan. It summarizes the outcome of the nuclear astrophysics town meeting that was held on August 21-23, 2014 in College Station at the campus of Texas A&M University in preparation of the NSAC Nuclear Science Long Range Plan. It also reflects the outcome of an earlier town mee...

  5. 75 FR 2893 - NASA Advisory Council; Science Committee; Astrophysics Subcommittee; Meeting

    Science.gov (United States)

    2010-01-19

    ... Committee; Astrophysics Subcommittee; Meeting AGENCY: National Aeronautics and Space Administration. ACTION... of the Astrophysics Subcommittee of the NASA Advisory Council (NAC). This Subcommittee reports to the... following topics: --Astrophysics Division Update --Updates on Select Astrophysics Missions --Discussion of...

  6. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy. Anjan A. Sen. Articles written in Journal of Astrophysics and Astronomy. Volume 37 Issue 4 December 2016 pp 33 Review. Cosmology and Astrophysics using the Post-Reionization HI · Tapomoy Guha Sarkar Anjan A. Sen · More Details Abstract Fulltext PDF.

  7. The path to improved reaction rates for astrophysics

    International Nuclear Information System (INIS)

    Rauscher, T.

    2011-01-01

    This review focuses on nuclear reactions in astrophysics and, more specifically, on reactions with light ions (nucleons and α particles) proceeding via the strong interaction. It is intended to present the basic definitions essential for studies in nuclear astrophysics, to point out the differences between nuclear reactions taking place in stars and in a terrestrial laboratory, and to illustrate some of the challenges to be faced in theoretical and experimental studies of those reactions. The discussion revolves around the relevant quantities for astrophysics, which are the astrophysical reaction rates. The sensitivity of the reaction rates to the uncertainties in the prediction of various nuclear properties is explored and some guidelines for experimentalists are also provided. (author)

  8. Astrophysics a very short introduction

    CERN Document Server

    Binney, James

    2016-01-01

    Astrophysics is the physics of the stars, and more widely the physics of the Universe. It enables us to understand the structure and evolution of planetary systems, stars, galaxies, interstellar gas, and the cosmos as a whole. In this Very Short Introduction, the leading astrophysicist James Binney shows how the field of astrophysics has expanded rapidly in the past century, with vast quantities of data gathered by telescopes exploiting all parts of the electromagnetic spectrum, combined with the rapid advance of computing power, which has allowed increasingly effective mathematical modelling. He illustrates how the application of fundamental principles of physics - the consideration of energy and mass, and momentum - and the two pillars of relativity and quantum mechanics, has provided insights into phenomena ranging from rapidly spinning millisecond pulsars to the collision of giant spiral galaxies. This is a clear, rigorous introduction to astrophysics for those keen to cut their teeth on a conceptual trea...

  9. A novel background reduction strategy for high level triggers and processing in gamma-ray Cherenkov detectors

    International Nuclear Information System (INIS)

    Cabras, G.; De Angelis, A.; De Lotto, B.; De Maria, M. M.; De Sabata, F.; Mansutti, O.; Frailis, M.; Persic, M.; Bigongiari, C.; Doro, M.; Mariotti, M.; Peruzzo, L.; Saggion, A.; Scalzotto, V.; Paoletti, R.; Scribano, A.; Turini, N.; Moralejo, A.; Tescaro, D.

    2008-01-01

    Gamma ray astronomy is now at the leading edge for studies related both to fundamental physics and astrophysics. The sensitivity of gamma detectors is limited by the huge amount of background, constituted by hadronic cosmic rays (typically two to three orders of magnitude more than the signal) and by the accidental background in the detectors. By using the information on the temporal evolution of the Cherenkov light, the background can be reduced. We will present here the results obtained within the MAGIC experiment using a new technique for the reduction of the background. Particle showers produced by gamma rays show a different temporal distribution with respect to showers produced by hadrons; the background due to accidental counts shows no dependence on time. Such novel strategy can increase the sensitivity of present instruments

  10. Light speed variation from gamma ray burst GRB 160509A

    Directory of Open Access Journals (Sweden)

    Haowei Xu

    2016-09-01

    Full Text Available It is postulated in Einstein's relativity that the speed of light in vacuum is a constant for all observers. However, the effect of quantum gravity could bring an energy dependence of light speed. Even a tiny speed variation, when amplified by the cosmological distance, may be revealed by the observed time lags between photons with different energies from astrophysical sources. From the newly detected long gamma ray burst GRB 160509A, we find evidence to support the prediction for a linear form modification of light speed in cosmological space.

  11. Light speed variation from gamma ray burst GRB 160509A

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Haowei [School of Physics, State Key Laboratory of Nuclear Physics and Technology, Peking University, Beijing 100871 (China); Ma, Bo-Qiang, E-mail: mabq@pku.edu.cn [School of Physics, State Key Laboratory of Nuclear Physics and Technology, Peking University, Beijing 100871 (China); Collaborative Innovation Center of Quantum Matter, Beijing (China); Center for High Energy Physics, Peking University, Beijing 100871 (China); Center for History and Philosophy of Science, Peking University, Beijing 100871 (China)

    2016-09-10

    It is postulated in Einstein's relativity that the speed of light in vacuum is a constant for all observers. However, the effect of quantum gravity could bring an energy dependence of light speed. Even a tiny speed variation, when amplified by the cosmological distance, may be revealed by the observed time lags between photons with different energies from astrophysical sources. From the newly detected long gamma ray burst GRB 160509A, we find evidence to support the prediction for a linear form modification of light speed in cosmological space.

  12. Stacked search for time shifted high energy neutrinos from gamma ray bursts with the Antares neutrino telescope

    Energy Technology Data Exchange (ETDEWEB)

    Adrian-Martinez, S.; Ardid, M.; Felis, I.; Martinez-Mora, J.A.; Saldana, M. [Universitat Politecnica de Valencia, Institut d' Investigacio per a la Gestio Integrada de les Zones Costaneres (IGIC), Gandia (Spain); Albert, A.; Drouhin, D.; Racca, C. [GRPHE-Institut Universitaire de Technologie de Colmar, 34 rue du Grillenbreit, BP 50568, Colmar (France); Andre, M. [Technical University of Catalonia, Laboratory of Applied Bioacoustics, Vilanova i la Geltru, Barcelona (Spain); Anghinolfi, M. [INFN-Sezione di Genova, Genoa (Italy); Anton, G.; Eberl, T.; Enzenhoefer, A.; Fehn, K.; Folger, F.; Geisselsoeder, S.; Geyer, K.; Gleixner, A.; Graf, K.; Hallmann, S.; Hoessl, J.; Hofestaedt, J.; James, C.W.; Kalekin, O.; Katz, U.; Kiessling, D.; Lahmann, R.; Richter, R.; Roensch, K.; Schmid, J.; Schnabel, J.; Seitz, T.; Sieger, C.; Tselengidou, M.; Wagner, S. [Friedrich-Alexander-Universitaet Erlangen-Nuernberg, Erlangen Centre for Astroparticle Physics, Erlangen (Germany); Aubert, J.J.; Bertin, V.; Brunner, J.; Busto, J.; Carr, J.; Costantini, H.; Coyle, P.; Dornic, D.; Mathieu, A.; Vallee, C. [CPPM, Aix-Marseille Universite, CNRS/IN2P3, Marseille (France); Baret, B.; Barrios-Marti, J.; Hernandez-Rey, J.J.; Sanchez-Losa, A.; Toennis, C.; Zornoza, J.D.; Zuniga, J. [CSIC-Universitat de Valencia, IFIC-Instituto de Fisica Corpuscular, Edificios Investigacion de Paterna, Paterna, Valencia (Spain); Basa, S.; Marcelin, M.; Nezri, E. [Pole de l' Etoile Site de Chateau-Gombert, LAM-Laboratoire d' Astrophysique de Marseille, Marseille Cedex 13 (France); Biagi, S.; Coniglione, R.; Distefano, C.; Piattelli, P.; Riccobene, G.; Sapienza, P.; Trovato, A. [INFN-Laboratori Nazionali del Sud (LNS), Catania (Italy); Bormuth, R.; Jong, M. de; Samtleben, D.F.E. [Nikhef, Science Park, Amsterdam (Netherlands); Universiteit Leiden, Leids Instituut voor Onderzoek in Natuurkunde, Leiden (Netherlands); Bouwhuis, M.C.; Heijboer, A.J.; Michael, T.; Steijger, J.J.M.; Visser, E. [Nikhef, Science Park, Amsterdam (Netherlands); Bruijn, R. [Nikhef, Science Park, Amsterdam (Netherlands); Universiteit van Amsterdam, Instituut voor Hoge-Energie Fysica, Amsterdam (Netherlands); Capone, A.; De Bonis, G.; Fermani, P.; Perrina, C. [INFN-Sezione di Roma, Rome (Italy); Dipartimento di Fisica dell' Universita La Sapienza, Rome (Italy); Caramete, L.; Pavalas, G.E.; Popa, V. [Institute for Space Sciences, Bucharest, Magurele (Romania); Chiarusi, T. [INFN-Sezione di Bologna, Bologna (Italy); Circella, M. [INFN-Sezione di Bari, Bari (Italy); Creusot, A.; Galata, S.; Gracia-Ruiz, R.; Van Elewyck, V. [APC, Universite Paris Diderot, CNRS/IN2P3, CEA/IRFU, Observatoire de Paris, Sorbonne Paris Cite, Paris (France); Dekeyser, I.; Lefevre, D.; Tamburini, C. [Aix-Marseille University, Mediterranean Institute of Oceanography (MIO), Marseille Cedex 9 (France); Universite du Sud Toulon-Var, CNRS-INSU/IRD UM 110, La Garde Cedex (France); Deschamps, A.; Hello, Y. [Geoazur, Universite Nice Sophia-Antipolis, CNRS/INSU, IRD, Observatoire de la Cote d' Azur, Sophia Antipolis (France); Donzaud, C. [APC, Universite Paris Diderot, CNRS/IN2P3, CEA/IRFU, Observatoire de Paris, Sorbonne Paris Cite, Paris (France); Universite Paris-Sud, Orsay Cedex (France); Dumas, A.; Gay, P. [Clermont Universite, Universite Blaise Pascal, CNRS/IN2P3, Laboratoire de Physique Corpusculaire, BP 10448, Clermont-Ferrand (France); Elsaesser, D.; Kadler, M.; Kreter, M.; Mueller, C. [Universitaet Wuerzburg, Institut fuer Theoretische Physik und Astrophysik, Wuerzburg (Germany); Fusco, L.A.; Margiotta, A.; Pellegrino, C.; Spurio, M. [INFN-Sezione di Bologna, Bologna (Italy); Dipartimento di Fisica dell' Universita, Bologna (Italy); Giordano, V. [INFN-Sezione di Catania, Catania (Italy); Haren, H. van [Royal Netherlands Institute for Sea Research (NIOZ), ' t Horntje, Texel (Netherlands); Hugon, C.; Taiuti, M. [INFN-Sezione di Genova, Genoa (Italy); Dipartimento di Fisica dell' Universita, Genoa (Italy); Kooijman, P. [Nikhef, Science Park, Amsterdam (Netherlands); Universiteit Utrecht, Faculteit Betawetenschappen, Utrecht (Netherlands); Universiteit van Amsterdam, Instituut voor Hoge-Energie Fysica, Amsterdam (Netherlands); Kouchner, A. [APC, Universite Paris Diderot, CNRS/IN2P3, CEA/IRFU, Observatoire de Paris, Sorbonne Paris Cite, Paris (France); Institut Universitaire de France, Paris (France); Kreykenbohm, I.; Wilms, J. [Universitaet Erlangen-Nuernberg, Dr. Remeis-Sternwarte and ECAP, Bamberg (Germany); Kulikovskiy, V. [INFN-Laboratori Nazionali del Sud (LNS), Catania (Italy); Moscow State University, Skobeltsyn Institute of Nuclear Physics, Moscow (Russian Federation); Leonora, E. [INFN-Sezione di Catania, Catania (Italy); Dipartimento di Fisica ed Astronomia dell' Universita, Catania (Italy); Loucatos, S. [APC, Universite Paris Diderot, CNRS/IN2P3, CEA/IRFU, Observatoire de Paris, Sorbonne Paris Cite, Paris (France); CEA Saclay, Direction des Sciences de la Matiere, Institut de recherche sur les lois fondamentales de l' Univers, Service de Physique des Particules, Gif-sur-Yvette Cedex (France); Marinelli, A. [INFN-Sezione di Pisa, Pisa (Italy); Dipartimento di Fisica dell' Universita, Pisa (Italy); Migliozzi, P. [INFN-Sezione di Napoli, Naples (IT); Moussa, A. [University Mohammed I, Laboratory of Physics of Matter and Radiations, Oujda (MA); Pradier, T. [Universite de Strasbourg et CNRS/IN2P3, IPHC-Institut Pluridisciplinaire Hubert Curien, 23 rue du Loess, BP 28, Strasbourg Cedex 2 (FR); Sanguineti, M. [Dipartimento di Fisica dell' Universita, Genoa (IT); Schuessler, F.; Stolarczyk, T.; Vallage, B. [CEA Saclay, Direction des Sciences de la Matiere, Institut de recherche sur les lois fondamentales de l' Univers, Service de Physique des Particules, Gif-sur-Yvette Cedex (FR); Vivolo, D. [INFN-Sezione di Napoli, Naples (IT); Dipartimento di Fisica dell' Universita Federico II di Napoli, Naples (IT)

    2017-01-15

    A search for high-energy neutrino emission correlated with gamma-ray bursts outside the electromagnetic prompt-emission time window is presented. Using a stacking approach of the time delays between reported gamma-ray burst alerts and spatially coincident muon-neutrino signatures, data from the Antares neutrino telescope recorded between 2007 and 2012 are analysed. One year of public data from the IceCube detector between 2008 and 2009 have been also investigated. The respective timing profiles are scanned for statistically significant accumulations within 40 days of the Gamma Ray Burst, as expected from Lorentz Invariance Violation effects and some astrophysical models. No significant excess over the expected accidental coincidence rate could be found in either of the two data sets. The average strength of the neutrino signal is found to be fainter than one detectable neutrino signal per hundred gamma-ray bursts in the Antares data at 90% confidence level. (orig.)

  13. Stacked search for time shifted high energy neutrinos from gamma ray bursts with the Antares neutrino telescope

    International Nuclear Information System (INIS)

    Adrian-Martinez, S.; Ardid, M.; Felis, I.; Martinez-Mora, J.A.; Saldana, M.; Albert, A.; Drouhin, D.; Racca, C.; Andre, M.; Anghinolfi, M.; Anton, G.; Eberl, T.; Enzenhoefer, A.; Fehn, K.; Folger, F.; Geisselsoeder, S.; Geyer, K.; Gleixner, A.; Graf, K.; Hallmann, S.; Hoessl, J.; Hofestaedt, J.; James, C.W.; Kalekin, O.; Katz, U.; Kiessling, D.; Lahmann, R.; Richter, R.; Roensch, K.; Schmid, J.; Schnabel, J.; Seitz, T.; Sieger, C.; Tselengidou, M.; Wagner, S.; Aubert, J.J.; Bertin, V.; Brunner, J.; Busto, J.; Carr, J.; Costantini, H.; Coyle, P.; Dornic, D.; Mathieu, A.; Vallee, C.; Baret, B.; Barrios-Marti, J.; Hernandez-Rey, J.J.; Sanchez-Losa, A.; Toennis, C.; Zornoza, J.D.; Zuniga, J.; Basa, S.; Marcelin, M.; Nezri, E.; Biagi, S.; Coniglione, R.; Distefano, C.; Piattelli, P.; Riccobene, G.; Sapienza, P.; Trovato, A.; Bormuth, R.; Jong, M. de; Samtleben, D.F.E.; Bouwhuis, M.C.; Heijboer, A.J.; Michael, T.; Steijger, J.J.M.; Visser, E.; Bruijn, R.; Capone, A.; De Bonis, G.; Fermani, P.; Perrina, C.; Caramete, L.; Pavalas, G.E.; Popa, V.; Chiarusi, T.; Circella, M.; Creusot, A.; Galata, S.; Gracia-Ruiz, R.; Van Elewyck, V.; Dekeyser, I.; Lefevre, D.; Tamburini, C.; Deschamps, A.; Hello, Y.; Donzaud, C.; Dumas, A.; Gay, P.; Elsaesser, D.; Kadler, M.; Kreter, M.; Mueller, C.; Fusco, L.A.; Margiotta, A.; Pellegrino, C.; Spurio, M.; Giordano, V.; Haren, H. van; Hugon, C.; Taiuti, M.; Kooijman, P.; Kouchner, A.; Kreykenbohm, I.; Wilms, J.; Kulikovskiy, V.; Leonora, E.; Loucatos, S.; Marinelli, A.; Migliozzi, P.; Moussa, A.; Pradier, T.; Sanguineti, M.; Schuessler, F.; Stolarczyk, T.; Vallage, B.; Vivolo, D.

    2017-01-01

    A search for high-energy neutrino emission correlated with gamma-ray bursts outside the electromagnetic prompt-emission time window is presented. Using a stacking approach of the time delays between reported gamma-ray burst alerts and spatially coincident muon-neutrino signatures, data from the Antares neutrino telescope recorded between 2007 and 2012 are analysed. One year of public data from the IceCube detector between 2008 and 2009 have been also investigated. The respective timing profiles are scanned for statistically significant accumulations within 40 days of the Gamma Ray Burst, as expected from Lorentz Invariance Violation effects and some astrophysical models. No significant excess over the expected accidental coincidence rate could be found in either of the two data sets. The average strength of the neutrino signal is found to be fainter than one detectable neutrino signal per hundred gamma-ray bursts in the Antares data at 90% confidence level. (orig.)

  14. NASA Astrophysics Funds Strategic Technology Development

    Science.gov (United States)

    Seery, Bernard D.; Ganel, Opher; Pham, Bruce

    2016-01-01

    The COR and PCOS Program Offices (POs) reside at the NASA Goddard Space Flight Center (GSFC), serving as the NASA Astrophysics Division's implementation arm for matters relating to the two programs. One aspect of the PO's activities is managing the COR and PCOS Strategic Astrophysics Technology (SAT) program, helping mature technologies to enable and enhance future astrophysics missions. For example, the SAT program is expected to fund key technology developments needed to close gaps identified by Science and Technology Definition Teams (STDTs) planned to study several large mission concept studies in preparation for the 2020 Decadal Survey.The POs are guided by the National Research Council's "New Worlds, New Horizons in Astronomy and Astrophysics" Decadal Survey report, NASA's Astrophysics Implementation Plan, and the visionary Astrophysics Roadmap, "Enduring Quests, Daring Visions." Strategic goals include dark energy, gravitational waves, and X-ray observatories. Future missions pursuing these goals include, e.g., US participation in ESA's Euclid, Athena, and L3 missions; Inflation probe; and a large UV/Optical/IR (LUVOIR) telescope.To date, 65 COR and 71 PCOS SAT proposals have been received, of which 15 COR and 22 PCOS projects were funded. Notable successes include maturation of a new far-IR detector, later adopted by the SOFIA HAWC instrument; maturation of the H4RG near-IR detector, adopted by WFIRST; development of an antenna-coupled transition-edge superconducting bolometer, a technology deployed by BICEP2/BICEP3/Keck to measure polarization in the CMB signal; advanced UV reflective coatings implemented on the optics of GOLD and ICON, two heliophysics Explorers; and finally, the REXIS instrument on OSIRIS-REx is incorporating CCDs with directly deposited optical blocking filters developed by another SAT-funded project.We discuss our technology development process, with community input and strategic prioritization informing calls for SAT proposals and

  15. Transport processes in space physics and astrophysics

    CERN Document Server

    Zank, Gary P

    2014-01-01

    Transport Processes in Space Physics and Astrophysics' is aimed at graduate level students to provide the necessary mathematical and physics background to understand the transport of gases, charged particle gases, energetic charged particles, turbulence, and radiation in an astrophysical and space physics context. Subjects emphasized in the work include collisional and collisionless processes in gases (neutral or plasma), analogous processes in turbulence fields and radiation fields, and allows for a simplified treatment of the statistical description of the system. A systematic study that addresses the common tools at a graduate level allows students to progress to a point where they can begin their research in a variety of fields within space physics and astrophysics. This book is for graduate students who expect to complete their research in an area of plasma space physics or plasma astrophysics. By providing a broad synthesis in several areas of transport theory and modeling, the work also benefits resear...

  16. Astrophysics in a nutshell

    CERN Document Server

    Maoz, Dan

    2016-01-01

    Winner of the American Astronomical Society's Chambliss Award, Astrophysics in a Nutshell has become the text of choice in astrophysics courses for science majors at top universities in North America and beyond. In this expanded and fully updated second edition, the book gets even better, with a new chapter on extrasolar planets; a greatly expanded chapter on the interstellar medium; fully updated facts and figures on all subjects, from the observed properties of white dwarfs to the latest results from precision cosmology; and additional instructive problem sets. Throughout, the text features the same focused, concise style and emphasis on physics intuition that have made the book a favorite of students and teachers.

  17. High Time Resolution Astrophysics

    CERN Document Server

    Phelan, Don; Shearer, Andrew

    2008-01-01

    High Time Resolution Astrophysics (HTRA) is an important new window to the universe and a vital tool in understanding a range of phenomena from diverse objects and radiative processes. This importance is demonstrated in this volume with the description of a number of topics in astrophysics, including quantum optics, cataclysmic variables, pulsars, X-ray binaries and stellar pulsations to name a few. Underlining this science foundation, technological developments in both instrumentation and detectors are described. These instruments and detectors combined cover a wide range of timescales and can measure fluxes, spectra and polarisation. These advances make it possible for HTRA to make a big contribution to our understanding of the Universe in the next decade.

  18. An Ordinary Short Gamma-Ray Burst with Extraordinary Implications: Fermi -GBM Detection of GRB 170817A

    Energy Technology Data Exchange (ETDEWEB)

    Goldstein, A.; Roberts, O. J.; Connaughton, V. [Science and Technology Institute, Universities Space Research Association, Huntsville, AL 35805 (United States); Veres, P.; Briggs, M. S.; Hamburg, R.; Preece, R. D.; Poolakkil, S. [Center for Space Plasma and Aeronomic Research, University of Alabama in Huntsville, 320 Sparkman Drive, Huntsville, AL 35899 (United States); Burns, E.; Racusin, J.; Canton, T. Dal [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Kocevski, D.; Wilson-Hodge, C. A.; Hui, C. M.; Littenberg, T. [Astrophysics Office, ST12, NASA/Marshall Space Flight Center, Huntsville, AL 35812 (United States); Kienlin, A. von [Max-Planck-Institut für extraterrestrische Physik, Giessenbachstrasse 1, D-85748 Garching (Germany); Christensen, N.; Broida, J. [Physics and Astronomy, Carleton College, MN 55057 (United States); Siellez, K. [Center for Relativistic Astrophysics and School of Physics, Georgia Institute of Technology, Atlanta, GA 30332 (United States); Blackburn, L., E-mail: Adam.M.Goldstein@nasa.gov [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); and others

    2017-10-20

    On 2017 August 17 at 12:41:06 UTC the Fermi Gamma-ray Burst Monitor (GBM) detected and triggered on the short gamma-ray burst (GRB) 170817A. Approximately 1.7 s prior to this GRB, the Laser Interferometer Gravitational-wave Observatory triggered on a binary compact merger candidate associated with the GRB. This is the first unambiguous coincident observation of gravitational waves and electromagnetic radiation from a single astrophysical source and marks the start of gravitational-wave multi-messenger astronomy. We report the GBM observations and analysis of this ordinary short GRB, which extraordinarily confirms that at least some short GRBs are produced by binary compact mergers.

  19. fter the Dark Ages: When Galaxies Were Young (The Universe at 2Astrophysics Conference. Proceedings

    International Nuclear Information System (INIS)

    Holt, S.S.; Smith, E.P.

    1999-01-01

    These proceedings represent papers presented at the 9th Astrophysics Conference held in College Park, Maryland, USA, in October, 1998. The topic chosen for this conference was ''The Universe at 2< z<5: After the Dark Ages, When Galaxies Were Young.'' Various aspects of cosmology including the cosmic microwave background, quasars, galactic bulges, dark matter, primordial protostellar clouds, galaxy evolution and mergers were discussed. Gamma ray bursts formed a special topic of discussion at the Conference. There were 61 papers presented at the conference,out of which 3 have been abstracted for the Energy,Science and Technology database

  20. The gamma-ray arc-minute imaging system (GRATIS) - Mechanical design and expected performance

    International Nuclear Information System (INIS)

    Seiffert, M.; Lubin, P.; Hailey, C.J.; Ziock, K.P.; Harrison, F.A.

    1989-01-01

    A balloon experiment, GRATIS, is being constructed which will perform the first arcmin imaging of cosmic sources in the 30 - 200 keV energy band. Observations conducted with GRATIS can provide data relevant to several key problems in high energy astrophysics, including the physical processes responsible for the high energy tail observed in the soft gamma-ray spectra of clusters of galaxies and the origin of both the diffuse and point-source components of the gamma-ray emission from the Galactic Center. This paper discusses the scientific motivations in detail, outlines the experiment, discusses several aspects of the design and construction of hardware components, gives an overview of the stabilized platform, and shows the expected performance and sensitivity. 16 refs

  1. Exploring the Extreme Universe with the Fermi Gamma-Ray Space Telescope

    Science.gov (United States)

    Thompson, David J.; Digel, Seth W.; Racusin, Judith L.

    2012-01-01

    In ways similar to experiments in nuclear and particle physics, high-energy astrophysics usesgamma rays and energetic charged particles toprobe processes that involve large energy transfers.Since its launch in 2008, the international Fermi Gamma-Ray Space Telescope has been exploringnatural particle accelerators and the interactionsof high-energy particles in the universe. Withsources ranging from thunderstorms on Earth to galaxies and exploding stars in distant parts of the cosmos, the telescopes subjects of study are almostas diverse as were those of the scientist whose name it bears.

  2. Advances in astronomy and astrophysics

    CERN Document Server

    Kopal, Zdenek

    1962-01-01

    Advances in Astronomy and Astrophysics, Volume 1 brings together numerous research works on different aspects of astronomy and astrophysics. This book is divided into five chapters and begins with an observational summary of the shock-wave theory of novae. The subsequent chapter provides the properties and problems of T tauri stars and related objects. These topics are followed by discussions on the structure and origin of meteorites and cosmic dust, as well as the models for evaluation of mass distribution in oblate stellar systems. The final chapter describes the methods of polarization mea

  3. Advances in astronomy and astrophysics

    CERN Document Server

    Kopal, Zdenek

    1963-01-01

    Advances in Astronomy and Astrophysics, Volume 2 brings together numerous research works on different aspects of astronomy and astrophysics. This volume is composed of six chapters and begins with a summary of observational record on twilight extensions of the Venus cusps. The next chapter deals with the common and related properties of binary stars, with emphasis on the evaluation of their cataclysmic variables. Cataclysmic variables refer to an object in one of three classes: dwarf nova, nova, or supernova. These topics are followed by discussions on the eclipse phenomena and the eclipses i

  4. Advances in astronomy and astrophysics

    CERN Document Server

    Kopal, Zdenek

    1966-01-01

    Advances in Astronomy and Astrophysics, Volume 4 brings together numerous research works on different aspects of astronomy and astrophysics. This volume is composed of five chapters, and starts with a description of objective prism and its application in space observations. The next chapter deals with the possibilities of deriving reliable models of the figure, density distribution, and gravity field of the Moon based on data obtained through Earth-bound telescopes. These topics are followed by a discussion on the ideal partially relativistic, partially degenerate gas in an exact manner. A ch

  5. Advances in astronomy and astrophysics

    CERN Document Server

    Kopal, Zdenek

    1968-01-01

    Advances in Astronomy and Astrophysics, Volume 6 brings together numerous research works on different aspects of astronomy and astrophysics. This volume is composed of five chapters, and starts with the description of improved methods for analyzing and classifying families of periodic orbits in a conservative dynamical system with two degrees of freedom. The next chapter describes the variation of fractional luminosity of distorted components of close binary systems in the course of their revolution, or the accompanying changes in radial velocity. This topic is followed by discussions on vari

  6. Nuclear astrophysics data at ORNL

    International Nuclear Information System (INIS)

    Smith, M.S.; Blackmon, J.C.

    1998-01-01

    There is a new program of evaluation and dissemination of nuclear data of critical importance for nuclear astrophysics within the Physics Division of Oak Ridge National Laboratory. Recent activities include determining the rates of the important 14 O(α,p) 17 F and 17 F(p,γ) 18 Ne reactions, disseminating the Caughlan and Fowler reaction rate compilation on the World Wide Web, and evaluating the 17 O(p,α) 14 N reaction rate. These projects, which are closely coupled to current ORNL nuclear astrophysics research, are briefly discussed along with future plans

  7. Nuclear Data for Astrophysics Research: A New Online Paradigm

    International Nuclear Information System (INIS)

    Smith, Michael Scott

    2011-01-01

    Our knowledge of a wide range of astrophysical processes depends crucially on nuclear physics data. While new nuclear information is being generated at an ever-increasing rate, the methods to process this information into astrophysical simulations have changed little over the decades and cannot keep pace. Working online, 'cloud computing', may be the methodology breakthrough needed to ensure that the latest nuclear data quickly gets into astrophysics codes. The successes of the first utilization of cloud computing for nuclear astrophysics will be described. The advantages of cloud computing for the broader nuclear data community are also discussed.

  8. Astrophysical black holes

    CERN Document Server

    Gorini, Vittorio; Moschella, Ugo; Treves, Aldo; Colpi, Monica

    2016-01-01

    Based on graduate school lectures in contemporary relativity and gravitational physics, this book gives a complete and unified picture of the present status of theoretical and observational properties of astrophysical black holes. The chapters are written by internationally recognized specialists. They cover general theoretical aspects of black hole astrophysics, the theory of accretion and ejection of gas and jets, stellar-sized black holes observed in the Milky Way, the formation and evolution of supermassive black holes in galactic centers and quasars as well as their influence on the dynamics in galactic nuclei. The final chapter addresses analytical relativity of black holes supporting theoretical understanding of the coalescence of black holes as well as being of great relevance in identifying gravitational wave signals. With its introductory chapters the book is aimed at advanced graduate and post-graduate students, but it will also be useful for specialists.

  9. The agile alert system for gamma-ray transients

    Energy Technology Data Exchange (ETDEWEB)

    Bulgarelli, A.; Trifoglio, M.; Gianotti, F.; Fioretti, V. [INAF/IASF-Bologna, Via Gobetti 101, I-40129 Bologna (Italy); Tavani, M.; Argan, A.; Trois, A.; Scalise, E. [INAF/IASF-Roma, Via del Fosso del Cavaliere 100, I-00133 Roma (Italy); Parmiggiani, N.; Beneventano, D. [University of Modena and Reggio Emilia, Dipartimento di Science e Metodi dell' Ingegneria (Italy); Chen, A. W. [INAF/IASF-Milano, Via E. Bassini 15, I-20133 Milano (Italy); Vercellone, S. [School of Physics, University of the Witwatersrand, Johannesburg Wits 2050 (South Africa); Pittori, C.; Verrecchia, F.; Lucarelli, F.; Santolamazza, P.; Fanari, G.; Giommi, P. [INAF/IASF-Palermo, Via U. La Malfa 153, I-90146 Palermo (Italy); Longo, F. [ASI-ASDC, Via G. Galilei, I-00044 Frascati (Roma) (Italy); Pellizzoni, A. [INFN Trieste, I-34127 Trieste (Italy); and others

    2014-01-20

    In recent years, a new generation of space missions has offered great opportunities for discovery in high-energy astrophysics. In this article we focus on the scientific operations of the Gamma-Ray Imaging Detector (GRID) on board the AGILE space mission. AGILE-GRID, sensitive in the energy range of 30 MeV-30 GeV, has detected many γ-ray transients of both galactic and extragalactic origin. This work presents the AGILE innovative approach to fast γ-ray transient detection, which is a challenging task and a crucial part of the AGILE scientific program. The goals are to describe (1) the AGILE Gamma-Ray Alert System, (2) a new algorithm for blind search identification of transients within a short processing time, (3) the AGILE procedure for γ-ray transient alert management, and (4) the likelihood of ratio tests that are necessary to evaluate the post-trial statistical significance of the results. Special algorithms and an optimized sequence of tasks are necessary to reach our goal. Data are automatically analyzed at every orbital downlink by an alert pipeline operating on different timescales. As proper flux thresholds are exceeded, alerts are automatically generated and sent as SMS messages to cellular telephones, via e-mail, and via push notifications from an application for smartphones and tablets. These alerts are crosschecked with the results of two pipelines, and a manual analysis is performed. Being a small scientific-class mission, AGILE is characterized by optimization of both scientific analysis and ground-segment resources. The system is capable of generating alerts within two to three hours of a data downlink, an unprecedented reaction time in γ-ray astrophysics.

  10. The agile alert system for gamma-ray transients

    International Nuclear Information System (INIS)

    Bulgarelli, A.; Trifoglio, M.; Gianotti, F.; Fioretti, V.; Tavani, M.; Argan, A.; Trois, A.; Scalise, E.; Parmiggiani, N.; Beneventano, D.; Chen, A. W.; Vercellone, S.; Pittori, C.; Verrecchia, F.; Lucarelli, F.; Santolamazza, P.; Fanari, G.; Giommi, P.; Longo, F.; Pellizzoni, A.

    2014-01-01

    In recent years, a new generation of space missions has offered great opportunities for discovery in high-energy astrophysics. In this article we focus on the scientific operations of the Gamma-Ray Imaging Detector (GRID) on board the AGILE space mission. AGILE-GRID, sensitive in the energy range of 30 MeV-30 GeV, has detected many γ-ray transients of both galactic and extragalactic origin. This work presents the AGILE innovative approach to fast γ-ray transient detection, which is a challenging task and a crucial part of the AGILE scientific program. The goals are to describe (1) the AGILE Gamma-Ray Alert System, (2) a new algorithm for blind search identification of transients within a short processing time, (3) the AGILE procedure for γ-ray transient alert management, and (4) the likelihood of ratio tests that are necessary to evaluate the post-trial statistical significance of the results. Special algorithms and an optimized sequence of tasks are necessary to reach our goal. Data are automatically analyzed at every orbital downlink by an alert pipeline operating on different timescales. As proper flux thresholds are exceeded, alerts are automatically generated and sent as SMS messages to cellular telephones, via e-mail, and via push notifications from an application for smartphones and tablets. These alerts are crosschecked with the results of two pipelines, and a manual analysis is performed. Being a small scientific-class mission, AGILE is characterized by optimization of both scientific analysis and ground-segment resources. The system is capable of generating alerts within two to three hours of a data downlink, an unprecedented reaction time in γ-ray astrophysics.

  11. The AGILE Alert System for Gamma-Ray Transients

    Science.gov (United States)

    Bulgarelli, A.; Trifoglio, M.; Gianotti, F.; Tavani, M.; Parmiggiani, N.; Fioretti, V.; Chen, A. W.; Vercellone, S.; Pittori, C.; Verrecchia, F.; Lucarelli, F.; Santolamazza, P.; Fanari, G.; Giommi, P.; Beneventano, D.; Argan, A.; Trois, A.; Scalise, E.; Longo, F.; Pellizzoni, A.; Pucella, G.; Colafrancesco, S.; Conforti, V.; Tempesta, P.; Cerone, M.; Sabatini, P.; Annoni, G.; Valentini, G.; Salotti, L.

    2014-01-01

    In recent years, a new generation of space missions has offered great opportunities for discovery in high-energy astrophysics. In this article we focus on the scientific operations of the Gamma-Ray Imaging Detector (GRID) on board the AGILE space mission. AGILE-GRID, sensitive in the energy range of 30 MeV-30 GeV, has detected many γ-ray transients of both galactic and extragalactic origin. This work presents the AGILE innovative approach to fast γ-ray transient detection, which is a challenging task and a crucial part of the AGILE scientific program. The goals are to describe (1) the AGILE Gamma-Ray Alert System, (2) a new algorithm for blind search identification of transients within a short processing time, (3) the AGILE procedure for γ-ray transient alert management, and (4) the likelihood of ratio tests that are necessary to evaluate the post-trial statistical significance of the results. Special algorithms and an optimized sequence of tasks are necessary to reach our goal. Data are automatically analyzed at every orbital downlink by an alert pipeline operating on different timescales. As proper flux thresholds are exceeded, alerts are automatically generated and sent as SMS messages to cellular telephones, via e-mail, and via push notifications from an application for smartphones and tablets. These alerts are crosschecked with the results of two pipelines, and a manual analysis is performed. Being a small scientific-class mission, AGILE is characterized by optimization of both scientific analysis and ground-segment resources. The system is capable of generating alerts within two to three hours of a data downlink, an unprecedented reaction time in γ-ray astrophysics.

  12. Constraints on particle acceleration in SS433/W50 from MAGIC and H.E.S.S. observations

    OpenAIRE

    Ahnen, M. L.; Ansoldi, S.; Bednarek, W.; Paiano, S.; Palacio, J.; Paneque, D.; Paoletti, R.; Paredes, J. M.; Paredes-Fortuny, X.; Pedaletti, G.; Peresano, M.; Perri, L.; Persic, M.; Bernardini, E.; Prada Moroni, P. G.

    2018-01-01

    Context. The large jet kinetic power and non-thermal processes occurring in the microquasar SS 433 make this source a good candidate for a very high-energy (VHE) gamma-ray emitter. Gamma-ray fluxes above the sensitivity limits of current Cherenkov telescopes have been predicted for both the central X-ray binary system and the interaction regions of SS 433 jets with the surrounding W50 nebula. Non-thermal emission at lower energies has been previously reported, indicating that efficient partic...

  13. Gamma-ray astrophysics

    International Nuclear Information System (INIS)

    Fichtel, C.E.

    1977-01-01

    The most striking feature of the celestial sphere when viewed in the frequency range of γ-rays is the emission from the galactic plane, which is particularly intense in the galactic longitudinal region from 300 0 to 50 0 . The longitudinal and latitudinal distributions are generally correlated with galactic structural features and when studied in detail suggest a non-uniform distribution of cosmic rays in the galaxy. Several point γ-ray sources have now been observed, including four radio pulsars. This last result is particularly striking since only one radio pulsar has been seen at either optical or X-ray frequencies. Nuclear γ-ray lines have been seen from the Sun during a large solar flare and future satellite experiments are planned to search for γ-ray lines from supernovae and their remnants. A general apparently diffuse flux of γ-rays has also been seen whose energy spectrum has interesting implications; however, in view of the possible contribution of point sources and the observation of galactic features such as Gould's belt, its interpretation must await γ-ray experiments with finer spatial and energy resolution, as well as greater sensitivity. (Auth.)

  14. The emission of Gamma Ray Bursts as a test-bed for modified gravity

    Directory of Open Access Journals (Sweden)

    S. Capozziello

    2015-11-01

    Full Text Available The extreme physical conditions of Gamma Ray Bursts can constitute a useful observational laboratory to test theories of gravity where very high curvature regimes are involved. Here we propose a sort of curvature engine capable, in principle, of explaining the huge energy emission of Gamma Ray Bursts. Specifically, we investigate the emission of radiation by charged particles non-minimally coupled to the gravitational background where higher order curvature invariants are present. The coupling gives rise to an additional force inducing a non-geodesic motion of particles. This fact allows a strong emission of radiation by gravitationally accelerated particles. As we will show with some specific model, the energy emission is of the same order of magnitude of that characterizing the Gamma Ray Burst physics. Alternatively, strong curvature regimes can be considered as a natural mechanism for the generation of highly energetic astrophysical events. Possible applications to cosmology are discussed.

  15. Correction factors for {gamma}-ray relative intensities in the {sup 66}Ga radioisotope

    Energy Technology Data Exchange (ETDEWEB)

    Schmid, G.J. [Duke Univ., Durham, NC (United States)]|[Triangle Universities Nuclear Lab., Durham, NC (United States); Chasteler, R.M. [Duke Univ., Durham, NC (United States)]|[Triangle Universities Nuclear Lab., Durham, NC (United States); Laymon, C.M. [Duke Univ., Durham, NC (United States)]|[Triangle Universities Nuclear Lab., Durham, NC (United States); Weller, H.R. [Duke Univ., Durham, NC (United States)]|[Triangle Universities Nuclear Lab., Durham, NC (United States); Moore, E.F. [Triangle Universities Nuclear Lab., Durham, NC (United States)]|[North Carolina State Univ., Raleigh, NC (United States); Bybee, C.R. [Triangle Universities Nuclear Lab., Durham, NC (United States)]|[North Carolina State Univ., Raleigh, NC (United States); Drake, J.M. [Triangle Universities Nuclear Lab., Durham, NC (United States)]|[North Carolina State Univ., Raleigh, NC (United States); Tilley, D.R. [Triangle Universities Nuclear Lab., Durham, NC (United States)]|[North Carolina State Univ., Raleigh, NC (United States); Vavrina, G. [Triangle Universities Nuclear Lab., Durham, NC (United States)]|[North Carolina State Univ., Raleigh, NC (United States); Wallace, P.M. [Triangle Universities Nuclear Lab., Durham, NC (United States)]|[North Carolina State Univ., Raleigh, NC (United States)

    1996-09-16

    We present here strong evidence that recently published values for the relative intensities of {gamma}-ray lines in the {sup 66}Ga({beta}{sup +}+EC){sup 66}Zn decay are incorrect at the higher energies ({proportional_to}30% too low at 4.8 MeV). In particular, we find that our current results are consistent with a set of correction factors which were first suggested 20 years ago, but have gone largely ignored until now. Our validation of these little known correction factors will have bearing on experiments which use the {sup 66}Ga radioisotope to extrapolate absolute detector efficiencies to higher energies. In particular, we discuss the conclusions of a recent D(p, {gamma}){sup 3}He experiment which will be strongly affected by our current results. The astrophysical S-factor data derived from this D(p, {gamma}){sup 3}He experiment are now seen to be systematically too low by {proportional_to}30%. (orig.).

  16. The (n, $\\gamma$) reaction in the s-process branching point $^{59}$Ni

    CERN Multimedia

    We propose to measure the $^{59}$Ni(n,$\\gamma$)$^{56}$Fe cross section at the neutron time of flight (n TOF) facility with a dedicated chemical vapor deposition (CVD) diamond detector. The (n, ) reaction in the radioactive $^{59}$Ni is of relevance in nuclear astrophysics as it can be seen as a rst branching point in the astrophysical s-process. Its relevance in nuclear technology is especially related to material embrittlement in stainless steel. There is a strong discrepancy between available experimental data and the evaluated nuclear data les for this isotope. The aim of the measurement is to clarify this disagreement. The clear energy separation of the reaction products of neutron induced reactions in $^{59}$Ni makes it a very suitable candidate for a rst cross section measurement with the CVD diamond detector, which should serve in the future for similar measurements at n_TOF.

  17. Particle Physics & Astrophysics (PPA)

    Data.gov (United States)

    Federal Laboratory Consortium — Scientists at SLAC's Particle Physics and Astrophysics develop and utilize unique instruments from underground to outer space to explore the ultimate laws of nature...

  18. Constraints on decaying dark matter from the extragalactic gamma-ray background

    International Nuclear Information System (INIS)

    Ando, Shin'ichiro

    2015-02-01

    If dark matter is unstable and the mass is within GeV-TeV regime, its decays produce high-energy photons that give contribution to the extragalactic gamma-ray background (EGRB). We constrain dark matter decay by analyzing the 50-month EGRB data measured with Fermi satellite, for different decay channels motivated with several supersymmetric scenarios featuring R-parity violation. We adopt the latest astrophysical models for various source classes such as active galactic nuclei and star-forming galaxies, and take associated uncertainties properly into account. The lower limits for the lifetime are very stringent for a wide range of dark matter mass, excluding the lifetime shorter than 10 28 s for mass between a few hundred GeV and ∝1TeV, e.g., for b anti b decay channel. Furthermore, most dark matter models that explain the anomalous positron excess are also excluded. These constraints are robust, being little dependent on astrophysical uncertainties, unlike other probes such as Galactic positrons or anti-protons.

  19. Fourteen Years of Education and Public Outreach for the Swift Gamma-ray Burst Explorer Mission

    OpenAIRE

    Cominsky, Lynn; McLin, Kevin; Simonnet, Aurore; Team, the Swift E/PO

    2014-01-01

    The Sonoma State University (SSU) Education and Public Outreach (E/PO) group leads the Swift Education and Public Outreach program. For Swift, we have previously implemented broad efforts that have contributed to NASA's Science Mission Directorate E/PO portfolio across many outcome areas. Our current focus is on highly-leveraged and demonstrably successful activities, including the wide-reaching Astrophysics Educator Ambassador program, and our popular websites: Epo's Chronicles and the Gamma...

  20. Long-term monitoring of blazars - the DWARF network

    Science.gov (United States)

    Backes, Michael; Biland, Adrian; Boller, Andrea; Braun, Isabel; Bretz, Thomas; Commichau, Sebastian; Commichau, Volker; Dorner, Daniela; von Gunten, Hanspeter; Gendotti, Adamo; Grimm, Oliver; Hildebrand, Dorothée; Horisberger, Urs; Krähenbühl, Thomas; Kranich, Daniel; Lustermann, Werner; Mannheim, Karl; Neise, Dominik; Pauss, Felicitas; Renker, Dieter; Rhode, Wolfgang; Rissi, Michael; Rollke, Sebastian; Röser, Ulf; Stark, Luisa Sabrina; Stucki, Jean-Pierre; Viertel, Gert; Vogler, Patrick; Weitzel, Quirin

    The variability of the very high energy (VHE) emission from blazars seems to be connected with the feeding and propagation of relativistic jets and with their origin in supermassive black hole binaries. The key to understanding their properties is measuring well-sampled gamma-ray lightcurves, revealing the typical source behavior unbiased by prior knowledge from other wavebands. Using ground-based gamma-ray observatories with exposures limited by dark-time, a global network of several telescopes is needed to carry out fulltime measurements. Obviously, such observations are time-consuming and, therefore, cannot be carried out with the present state of the art instruments. The DWARF telescope on the Canary Island of La Palma is dedicated to monitoring observations. It is currently being set up, employing a costefficient and robotic design. Part of this project is the future construction of a distributed network of small telescopes. The physical motivation of VHE long-term monitoring will be outlined in detail and the perspective for a network for 24/7 observations will be presented.

  1. Trojin horse method for indirect measurement of astrophysic S factor

    International Nuclear Information System (INIS)

    Fu Yuanyong; Zhou Shuhua; Li Chengbo; Wen Qungang

    2014-01-01

    The nuclear reaction rates in the astrophysical environment are indispensable input parameters in different astrophysics theories, and play important roles in understanding the astrophysical nuclear synthesis and the evolution of the universe. However, at the astrophysical temperature, the nuclear reactions proceed at very low energies. Due to the Coulomb barrier the reaction cross sections are very small, so that the direct measurement is almost impossible. The Trojin horse theory provides a useful method to measure indirectly the low energy two body cross sections by measuring the suitable three body reactions. Some approximations are applied in the theory to get convenient formula. This paper introduces the Trojin horse theory and its application in astrophysics nuclear reactions. (authors)

  2. Astrophysics today

    International Nuclear Information System (INIS)

    Cameron, A.G.W.

    1984-01-01

    Examining recent history, current trends, and future possibilities, the author reports the frontiers of research on the solar system, stars, galactic physics, and cosmological physics. The book discusses the great discoveries in astronomy and astrophysics and examines the circumstances in which they occurred. It discusses the physics of white dwarfs, the inflationary universe, the extinction of dinosaurs, black hole, cosmological models, and much more

  3. Astrophysics of Red Supergiants

    Science.gov (United States)

    Levesque, Emily M.

    2017-12-01

    'Astrophysics of Red Supergiants' is the first book of its kind devoted to our current knowledge of red supergiant stars, a key evolutionary phase that is critical to our larger understanding of massive stars. It provides a comprehensive overview of the fundamental physical properties of red supergiants, their evolution, and their extragalactic and cosmological applications. It serves as a reference for researchers from a broad range of fields (including stellar astrophysics, supernovae, and high-redshift galaxies) who are interested in red supergiants as extreme stages of stellar evolution, dust producers, supernova progenitors, extragalactic metallicity indicators, members of massive binaries and mergers, or simply as compelling objects in their own right. The book is accessible to a range of experience levels, from graduate students up to senior researchers.

  4. Nuclear reactions in astrophysics

    International Nuclear Information System (INIS)

    Cardenas, M.

    1976-01-01

    It is revised the nuclear reactions which present an interest in astrophysics regarding the explanation of some problems such as the relative quantity of the elements, the structure and evolution of the stars. The principal object of the study is the determination of the experimental possibilities in the field of astrophysics, of an accelerator Van de Graaff's 700 KeV type. Two hundred nuclear reactions approximately, were found, and nothing or very little has been done in the intervals of energy which are of interest. Since the bombardment energies and the involved sections are low in some cases, there are real possibilities, for the largest number of stars to obtain important statistical data with the above mentioned accelerator, taking some necessary precautions. (author)

  5. High energy astrophysics

    International Nuclear Information System (INIS)

    Shklorsky, I.S.

    1979-01-01

    A selected list of articles of accessible recent review articles and conference reports, wherein up-to-date summaries of various topics in the field of high energy astrophysics can be found, is presented. A special report outlines work done in the Soviet Union in this area. (Auth.)

  6. Laboratory Astrophysics Division of The AAS (LAD)

    Science.gov (United States)

    Salama, Farid; Drake, R. P.; Federman, S. R.; Haxton, W. C.; Savin, D. W.

    2012-10-01

    The purpose of the Laboratory Astrophysics Division (LAD) is to advance our understanding of the Universe through the promotion of fundamental theoretical and experimental research into the underlying processes that drive the Cosmos. LAD represents all areas of astrophysics and planetary sciences. The first new AAS Division in more than 30 years, the LAD traces its history back to the recommendation from the scientific community via the White Paper from the 2006 NASA-sponsored Laboratory Astrophysics Workshop. This recommendation was endorsed by the Astronomy and Astrophysics Advisory Committee (AAAC), which advises the National Science Foundation (NSF), the National Aeronautics and Space Administration (NASA), and the U.S. Department of Energy (DOE) on selected issues within the fields of astronomy and astrophysics that are of mutual interest and concern to the agencies. In January 2007, at the 209th AAS meeting, the AAS Council set up a Steering Committee to formulate Bylaws for a Working Group on Laboratory Astrophysics (WGLA). The AAS Council formally established the WGLA with a five-year mandate in May 2007, at the 210th AAS meeting. From 2008 through 2012, the WGLA annually sponsored Meetings in-a-Meeting at the AAS Summer Meetings. In May 2011, at the 218th AAS meeting, the AAS Council voted to convert the WGLA, at the end of its mandate, into a Division of the AAS and requested draft Bylaws from the Steering Committee. In January 2012, at the 219th AAS Meeting, the AAS Council formally approved the Bylaws and the creation of the LAD. The inaugural gathering and the first business meeting of the LAD were held at the 220th AAS meeting in Anchorage in June 2012. You can learn more about LAD by visiting its website at http://lad.aas.org/ and by subscribing to its mailing list.

  7. Laboratory Astrophysics Division of the AAS (LAD)

    Science.gov (United States)

    Salama, Farid; Drake, R. P.; Federman, S. R.; Haxton, W. C.; Savin, D. W.

    2012-01-01

    The purpose of the Laboratory Astrophysics Division (LAD) is to advance our understanding of the Universe through the promotion of fundamental theoretical and experimental research into the underlying processes that drive the Cosmos. LAD represents all areas of astrophysics and planetary sciences. The first new AAS Division in more than 30 years, the LAD traces its history back to the recommendation from the scientific community via the White Paper from the 2006 NASA-sponsored Laboratory Astrophysics Workshop. This recommendation was endorsed by the Astronomy and Astrophysics Advisory Committee (AAAC), which advises the National Science Foundation (NSF), the National Aeronautics and Space Administration (NASA), and the U.S. Department of Energy (DOE) on selected issues within the fields of astronomy and astrophysics that are of mutual interest and concern to the agencies. In January 2007, at the 209th AAS meeting, the AAS Council set up a Steering Committee to formulate Bylaws for a Working Group on Laboratory Astrophysics (WGLA). The AAS Council formally established the WGLA with a five-year mandate in May 2007, at the 210th AAS meeting. From 2008 through 2012, the WGLA annually sponsored Meetings in-a-Meeting at the AAS Summer Meetings. In May 2011, at the 218th AAS meeting, the AAS Council voted to convert the WGLA, at the end of its mandate, into a Division of the AAS and requested draft Bylaws from the Steering Committee. In January 2012, at the 219th AAS Meeting, the AAS Council formally approved the Bylaws and the creation of the LAD. The inaugural gathering and the first business meeting of the LAD were held at the 220th AAS meeting in Anchorage in June 2012. You can learn more about LAD by visiting its website at http://lad.aas.org/ and by subscribing to its mailing list.

  8. Plasma Astrophysics, part II Reconnection and Flares

    CERN Document Server

    Somov, Boris V

    2007-01-01

    This well-illustrated monograph is devoted to classic fundamentals, current practice, and perspectives of modern plasma astrophysics. The first part is unique in covering all the basic principles and practical tools required for understanding and working in plasma astrophysics. The second part presents the physics of magnetic reconnection and flares of electromagnetic origin in space plasmas within the solar system; single and double stars, relativistic objects, accretion disks, and their coronae are also covered. This book is designed mainly for professional researchers in astrophysics. However, it will also be interesting and useful to graduate students in space sciences, geophysics, as well as advanced students in applied physics and mathematics seeking a unified view of plasma physics and fluid mechanics.

  9. Plasma Astrophysics, Part I Fundamentals and Practice

    CERN Document Server

    Somov, Boris V

    2006-01-01

    This well-illustrated monograph is devoted to classic fundamentals, current practice, and perspectives of modern plasma astrophysics. The first part is unique in covering all the basic principles and practical tools required for understanding and working in plasma astrophysics. The second part presents the physics of magnetic reconnection and flares of electromagnetic origin in space plasmas within the solar system; single and double stars, relativistic objects, accretion disks, and their coronae are also covered. This book is designed mainly for professional researchers in astrophysics. However, it will also be interesting and useful to graduate students in space sciences, geophysics, as well as advanced students in applied physics and mathematics seeking a unified view of plasma physics and fluid mechanics.

  10. Astrophysical observations: lensing and eclipsing Einstein's theories.

    Science.gov (United States)

    Bennett, Charles L

    2005-02-11

    Albert Einstein postulated the equivalence of energy and mass, developed the theory of special relativity, explained the photoelectric effect, and described Brownian motion in five papers, all published in 1905, 100 years ago. With these papers, Einstein provided the framework for understanding modern astrophysical phenomena. Conversely, astrophysical observations provide one of the most effective means for testing Einstein's theories. Here, I review astrophysical advances precipitated by Einstein's insights, including gravitational redshifts, gravitational lensing, gravitational waves, the Lense-Thirring effect, and modern cosmology. A complete understanding of cosmology, from the earliest moments to the ultimate fate of the universe, will require developments in physics beyond Einstein, to a unified theory of gravity and quantum physics.

  11. Doppler tomography in fusion plasmas and astrophysics

    DEFF Research Database (Denmark)

    Salewski, Mirko; Geiger, B.; Heidbrink, W. W.

    2015-01-01

    Doppler tomography is a well-known method in astrophysics to image the accretion flow, often in the shape of thin discs, in compact binary stars. As accretion discs rotate, all emitted line radiation is Doppler-shifted. In fast-ion Dα (FIDA) spectroscopy measurements in magnetically confined plasma......, the Dα-photons are likewise Doppler-shifted ultimately due to gyration of the fast ions. In either case, spectra of Doppler-shifted line emission are sensitive to the velocity distribution of the emitters. Astrophysical Doppler tomography has lead to images of accretion discs of binaries revealing bright...... and limits, analogies and differences in astrophysical and fusion plasma Doppler tomography and what can be learned by comparison of these applications....

  12. Nuclear astrophysics away from stability

    International Nuclear Information System (INIS)

    Mathews, G.J.; Howard, W.M.; Takahashi, K.; Ward, R.A.

    1985-08-01

    Explosive astrophysical environments invariably lead to the production of nuclei away from stability. An understanding of the dynamics and nucleosynthesis in such environments is inextricably coupled to an understanding of the properties of the synthesized nuclei. In this talk a review is presented of the basic explosive nucleosynthesis mechanisms (s-process, r-process, n-process, p-process, and rp-process). Specific stellar model calculations are discussed and a summary of the pertinent nuclear data is presented. Possible experiments and nuclear-model calculations are suggested that could facilitate a better understanding of the astrophysical scenarios. 39 refs., 4 figs

  13. Topics in Nuclear Astrophysics

    International Nuclear Information System (INIS)

    Chung, K.C.

    1982-01-01

    Some topics in nuclear astrophysics are discussed, e.g.: highly evolved stellar cores, stellar evolution (through the temperature analysis of stellar surface), nucleosynthesis and finally the solar neutrino problem. (L.C.) [pt

  14. Highlights of modern astrophysics: Concepts and controversies

    International Nuclear Information System (INIS)

    Shapiro, S.L.; Teukolsky, V.

    1986-01-01

    In this book, physicists and astronomers review issues in astrophysics. The book stresses accomplishments of observational and theoretical work, and demonstrates how to reveal information about stars and galaxies by applying the basic principles of physics. It pinpoints conflicting views and findings on important topics and indicates possibilities for future research in the field of modern astrophysics

  15. Fullerenes, PAHs, Amino Acids and High Energy Astrophysics

    Directory of Open Access Journals (Sweden)

    Susana Iglesias-Groth

    2014-12-01

    Full Text Available We present theoretical, observational and laboratory work on the spectral properties of fullerenes and hydrogenated fullerenes. Fullerenes in its various forms (individual, endohedral, hydrogenated, etc. can contribute to the UV bump in the extinction curves measured in many lines of sight of the Galaxy. They can also produce a large number of absorption features in the optical and near infrared which could be associated with diffuse interstellar bands. We summarise recent laboratory work on the spectral characterisation of fullerenes and hydrogenated fullerenes (for a range of temperatures. The recent detection of mid-IR bands of fullerenes in various astrophysical environments (planetary nebulae, reflection nebulae provide additional evidence for a link between fullerene families and diffuse interstellar bands. We describe recent observational work on near IR bands of C60+ in a protoplanetary nebula which support fullerene formation during the post-AGB phase. We also report on the survival of fullerenes to irradiation by high energy particles and gamma photons and laboratory work to explore the chemical  reactions that take place when fullerenes are exposed to this radiations in the presence of water, ammonia and other molecules as a potential path to form amino acids.

  16. Very high energy gamma ray astrophysics: Progress report for period May 1, 1986-February 15, 1987

    International Nuclear Information System (INIS)

    Lamb, R.C.; Lewis, D.A.

    1987-02-01

    Highlights of research are noted. These include new electronics, noise and gain analysis, tests of imaging, new sources of gamma radiation observed, development of a 37-element mini camera, computer capabilities, and new detector capabilities

  17. Cosmological and astrophysical neutrino mass measurements

    DEFF Research Database (Denmark)

    Abazajian, K.N.; Calabrese, E.; Cooray, A.

    2011-01-01

    Cosmological and astrophysical measurements provide powerful constraints on neutrino masses complementary to those from accelerators and reactors. Here we provide a guide to these different probes, for each explaining its physical basis, underlying assumptions, current and future reach.......Cosmological and astrophysical measurements provide powerful constraints on neutrino masses complementary to those from accelerators and reactors. Here we provide a guide to these different probes, for each explaining its physical basis, underlying assumptions, current and future reach....

  18. Anisotropy of the cosmic gamma-ray background from dark matter annihilation

    International Nuclear Information System (INIS)

    Ando, Shin'ichiro; Komatsu, Eiichiro

    2006-01-01

    High-energy photons from pair annihilation of dark matter particles contribute to the cosmic gamma-ray background (CGB) observed in a wide energy range. Since dark matter particles are weakly interacting, annihilation can happen only in high density regions such as dark matter halos. The precise shape of the energy spectrum of CGB depends on the nature of dark matter particles--their mass and annihilation cross section, as well as the cosmological evolution of dark matter halos. In order to discriminate between the signals from dark matter annihilation and other astrophysical sources, however, the information from the energy spectrum of CGB may not be sufficient. We show that dark matter annihilation not only contributes to the mean CGB intensity, but also produces a characteristic anisotropy, which provides a powerful tool for testing the origins of the observed CGB. We develop the formalism based on a halo model approach to analytically calculate the three-dimensional power spectrum of dark matter clumping, which determines the power spectrum of annihilation signals. We show that the expected sensitivity of future gamma-ray detectors such as the Gamma Ray Large Area Space Telescope (GLAST) should allow us to measure the angular power spectrum of CGB anisotropy, if dark matter particles are supersymmetric neutralinos and they account for most of the observed mean intensity of CGB in GeV region. On the other hand, if dark matter has a relatively small mass, on the order of 20 MeV, and accounts for most of the CGB in MeV region, then the future Advanced Compton Telescope (ACT) should be able to measure the angular power spectrum in MeV region. As the intensity of photons from annihilation is proportional to the density squared, we show that the predicted shape of the angular power spectrum of gamma rays from dark matter annihilation is different from that due to other astrophysical sources such as blazars and supernovae, whose intensity is linearly proportional to

  19. The Astrophysical Multimessenger Observatory Network (AMON)

    Science.gov (United States)

    Smith. M. W. E.; Fox, D. B.; Cowen, D. F.; Meszaros, P.; Tesic, G.; Fixelle, J.; Bartos, I.; Sommers, P.; Ashtekar, Abhay; Babu, G. Jogesh; hide

    2013-01-01

    We summarize the science opportunity, design elements, current and projected partner observatories, and anticipated science returns of the Astrophysical Multimessenger Observatory Network (AMON). AMON will link multiple current and future high-energy, multimessenger, and follow-up observatories together into a single network, enabling near real-time coincidence searches for multimessenger astrophysical transients and their electromagnetic counterparts. Candidate and high-confidence multimessenger transient events will be identified, characterized, and distributed as AMON alerts within the network and to interested external observers, leading to follow-up observations across the electromagnetic spectrum. In this way, AMON aims to evoke the discovery of multimessenger transients from within observatory subthreshold data streams and facilitate the exploitation of these transients for purposes of astronomy and fundamental physics. As a central hub of global multimessenger science, AMON will also enable cross-collaboration analyses of archival datasets in search of rare or exotic astrophysical phenomena.

  20. Astrophysical disks Collective and Stochastic Phenomena

    CERN Document Server

    Fridman, Alexei M; Kovalenko, Ilya G

    2006-01-01

    The book deals with collective and stochastic processes in astrophysical discs involving theory, observations, and the results of modelling. Among others, it examines the spiral-vortex structure in galactic and accretion disks , stochastic and ordered structures in the developed turbulence. It also describes sources of turbulence in the accretion disks, internal structure of disk in the vicinity of a black hole, numerical modelling of Be envelopes in binaries, gaseous disks in spiral galaxies with shock waves formation, observation of accretion disks in a binary system and mass distribution of luminous matter in disk galaxies. The editors adaptly brought together collective and stochastic phenomena in the modern field of astrophysical discs, their formation, structure, and evolution involving the methodology to deal with, the results of observation and modelling, thereby advancing the study in this important branch of astrophysics and benefiting Professional Researchers, Lecturers, and Graduate Students.

  1. Stellar astrophysics

    International Nuclear Information System (INIS)

    1987-01-01

    A number of studies in the field of steller astrophysics were undertaken by the South African Astronomical Observatory in 1986. These studies included; evolutionary effects on the surface abundances of an early-type supergiant; hydrogen deficient stars; t tauri stars; rotational modulation and flares on RS CVn and BY Dra stars; carbon and heavy element stars, and slow variability and circumstellar shells of red variable stars. 4 figs

  2. Applications for X-ray detectors in astrophysics

    International Nuclear Information System (INIS)

    Remillard, R.A.

    2003-01-01

    Full text: Position-sensitive X-Ray detectors continue to playa central role in high-energy astrophysics. The current science goals are reviewed with emphasis on requirements in terms of camera performance. Wide-field imaging techniques, including coded mask cameras, are an essential part of space programs because of the transient nature of high-priority targets, e.g. eruptions from black-hole binaries and cosmic explosions such as gamma ray bursts. Pointing X-ray telescopes are being planned with a wide range of photon energies and with collection designs that include both mirrors and coded masks. Requirements for high spectral resolution and high time resolution are driven by diverse types of X-ray sources such as msec pulsars, quasars with emission-line profiles shaped by general relativity, and X-ray binaries that exhibit quasi-periodic oscillations in the range of 40-1300 Hz. Many laboratories and universities are involved in space-qualification of new detector technologies, e.g. CZT cameras, X-ray calorimeters, new types of CCDs, and GEM detectors. Even X-ray interferometry is on the horizon of NASA's science roadmap. The difficulties in advancing new technologies for space science applications require careful coordinations between industry and science groups in order to solve science problems while minimizing risk

  3. Solar, Stellar and Galactic Connections between Particle Physics and Astrophysics

    CERN Document Server

    Carraminana, Alberto

    2007-01-01

    This book collects extended and specialized reviews on topics linking astrophysics and particle physics at a level intermediate between a graduate student and a young researcher. The book includes also three reviews on observational techniques used in forefront astrophysics and short articles on research performed in Latin America. The reviews, updated and written by specialized researchers, describe the state of the art in the related research topics. This book is a valuable complement not only for research but also for lecturers in specialized course of high energy astrophysics, cosmic ray astrophysics and particle physics.

  4. Search for neutrino emission from gamma-ray flaring blazars with the ANTARES telescope

    OpenAIRE

    Adrián-Martínez, S.; Al Samarai, Imen; Albert, A.; André, Michel; Anghinolfi, M.; Anton, G.; Anvar, S.; Ardid, M.; Astraatmadja, T.; Aubert, J.-J.; Baret, B.; Basa, S.; Bertin, V.; Biagi, S.; Bigongiari, C.

    2011-01-01

    The ANTARES telescope is well-suited to detect neutrinos produced in astrophysical transient sources as it can observe a full hemisphere of the sky at all times with a high duty cycle. Radio-loud active galactic nuclei with jets pointing almost directly towards the observer, the so-called blazars, are particularly attractive potential neutrino point sources. The all-sky monitor LAT on board the Fermi satellite probes the variability of any given gamma-ray bright blazar in the sky on time scal...

  5. Statistics and Informatics in Space Astrophysics

    Science.gov (United States)

    Feigelson, E.

    2017-12-01

    The interest in statistical and computational methodology has seen rapid growth in space-based astrophysics, parallel to the growth seen in Earth remote sensing. There is widespread agreement that scientific interpretation of the cosmic microwave background, discovery of exoplanets, and classifying multiwavelength surveys is too complex to be accomplished with traditional techniques. NASA operates several well-functioning Science Archive Research Centers providing 0.5 PBy datasets to the research community. These databases are integrated with full-text journal articles in the NASA Astrophysics Data System (200K pageviews/day). Data products use interoperable formats and protocols established by the International Virtual Observatory Alliance. NASA supercomputers also support complex astrophysical models of systems such as accretion disks and planet formation. Academic researcher interest in methodology has significantly grown in areas such as Bayesian inference and machine learning, and statistical research is underway to treat problems such as irregularly spaced time series and astrophysical model uncertainties. Several scholarly societies have created interest groups in astrostatistics and astroinformatics. Improvements are needed on several fronts. Community education in advanced methodology is not sufficiently rapid to meet the research needs. Statistical procedures within NASA science analysis software are sometimes not optimal, and pipeline development may not use modern software engineering techniques. NASA offers few grant opportunities supporting research in astroinformatics and astrostatistics.

  6. Balance in the NASA Astrophysics Program

    Science.gov (United States)

    Elvis, Martin

    2017-08-01

    The Decadal studies are usually instructed to come up with a “balanced program” for the coming decade of astrophysics initiatives, both on the ground and in space. The meaning of “balance” is left up to the Decadal panels. One meaning is that there should be a diversity of mission costs in the portfolio. Another that there should be a diversity of science questions addressed. A third is that there should be a diversity of signals (across electromagnetic wavebands, and of non-em carriers). It is timely for the astronomy community to debate the meaning of balance in the NASA astrophysics program as the “Statement of Task” (SoT) that defines the goals and process of the 2020 Astrophysics Decadal review are now being formulated.Here I propose some ways in which the Astro2020 SoT could be made more specific in order to make balance more evident and so avoid the tendency for a single science question, and a single mission to answer that question, to dominate the program. As an example of an alternative ambitious approach, I present a proof-of-principle program of 6, mostly “probe-class” missions, that would fit the nominal funding profile for the 2025-2035 NASA Astrophysics Program, while being more diverse in ambitious science goals and in wavelength coverage.

  7. Spectroscopics database for warm Xenon and Iron in Astrophysics and Laboratory Astrophysics conditions

    Science.gov (United States)

    Busquet, Michel; Klapisch, Marcel; Bar-Shalom, Avi; Oreg, Josse

    2010-11-01

    The main contribution to spectral properties of astrophysics mixtures come often from Iron. On the other hand, in the so-called domain of ``Laboratory Astrophysics,'' where astrophysics phenomena are scaled down to the laboratory, Xenon (and Argon) are commonly used gases. At so called ``warm'' temperatures (T=5-50eV), L-shell Iron and M-shell Xenon present a very large number of spectral lines, originating from billions of levels. More often than not, Local Thermodynamical Equilibrium is assumed, leading to noticeable simplification of the computation. Nevertheless, complex and powerful atomic structure codes are required. We take benefit of powerful statistics and numerics, included in our atomic structure codes, STA[1] and HULLAC[2], to generate the required spectra. Recent improvements in both fields (statistics, numerics and convergence control) allow obtaining large databases (ro x T grid of > 200x200 points, and > 10000 frequencies) for temperature down to a few eV. We plan to port these improvements in the NLTE code SCROLL[3]. [1] A.Bar-Shalom, et al, Phys. Rev. A 40, 3183 (1989) [2] M.Busquet,et al, J.Phys. IV France 133, 973-975 (2006); A.Bar-Shalom, M.Klapisch, J.Oreg, J.Oreg, JQSRT 71, 169, (2001) [3] A.Bar-Shalom, et al, Phys. Rev. E 56, R70 (1997)

  8. Nuclear astrophysics at DRAGON

    International Nuclear Information System (INIS)

    Hager, U.

    2014-01-01

    The DRAGON recoil separator is located at the ISAC facility at TRIUMF, Vancouver. It is designed to measure radiative alpha and proton capture reactions of astrophysical importance. Over the last years, the DRAGON collaboration has measured several reactions using both radioactive and high-intensity stable beams. For example, the 160(a, g) cross section was recently measured. The reaction plays a role in steady-state helium burning in massive stars, where it follows the 12C(a, g) reaction. At astrophysically relevant energies, the reaction proceeds exclusively via direct capture, resulting in a low rate. In this measurement, the unique capabilities of DRAGON enabled determination not only of the total reaction rates, but also of decay branching ratios. In addition, results from other recent measurements will be presented

  9. Topics in High-Energy Astrophysics: X-ray Time Lags and Gamma-ray Flares

    Science.gov (United States)

    Kroon, John J.

    2016-03-01

    The Universe is host to a wide variety of high-energy processes that convert gravitational potential energy or rest-mass energy into non-thermal radiation such as bremsstrahlung and synchrotron. Prevailing models of X-ray emission from accreting Black Hole Binaries (BHBs) struggle to simultaneously fit the quiescent X-ray spectrum and the transients which result in the phenomenon known as X-ray time lags. And similarly, classical models of diffusive shock acceleration in pulsar wind nebulae fail to explain the extreme particle acceleration in very short timescales as is inferred from recent gamma-ray flares from the Crab nebula. In this dissertation, I develop new exact analytic models to shed light on these intriguing processes. I take a fresh look at the formation of X-ray time lags in compact sources using a new mathematical approach in which I obtain the exact Green's function solution. The resulting Green's function allows one to explore a variety of injection scenarios, including both monochromatic and broadband (bremsstrahlung) seed photon injection. I obtain the exact solution for the dependence of the time lags on the Fourier frequency, for both homogeneous and inhomogeneous clouds. The model can successfully reproduce both the observed time lags and the quiescent X-ray spectrum using a single set of coronal parameters. I show that the implied coronal radii in the new model are significantly smaller than those obtained in the Monte Carlo simulations, hence greatly reducing the coronal heating problem. Recent bright gamma-ray flares from the Crab nebula observed by AGILE and Fermi reaching GeV energies and lasting several days challenge the contemporary model for particle acceleration in pulsar wind nebulae, specifically the diffusive shock acceleration model. Simulations indicate electron/positron pairs in the Crab nebula pulsar wind must be accelerated up to PeV energies in the presence of ambient magnetic fields with strength B ~100 microG. No

  10. The H.E.S.S. Galactic plane survey

    Science.gov (United States)

    H. E. S. S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Benkhali, F. Ait; Angüner, E. O.; Arakawa, M.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Tjus, J. Becker; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bonnefoy, S.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Büchele, M.; Bulik, T.; Capasso, M.; Carrigan, S.; Caroff, S.; Carosi, A.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Colafrancesco, S.; Condon, B.; Conrad, J.; Davids, I. D.; Decock, J.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dutson, K.; Dyks, J.; Edwards, T.; Egberts, K.; Eger, P.; Emery, G.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Garrigoux, T.; Gast, H.; Gaté, F.; Giavitto, G.; Giebels, B.; Glawion, D.; Glicenstein, J. F.; Gottschall, D.; Grondin, M.-H.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holch, T. L.; Holler, M.; Horns, D.; Ivascenko, A.; Iwasaki, H.; Jacholkowska, A.; Jamrozy, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katsuragawa, M.; Katz, U.; Kerszberg, D.; Khangulyan, D.; Khélifi, B.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Marandon, V.; Malyshev, D.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Nakashima, S.; de Naurois, M.; Ndiyavala, H.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Paz Arribas, M.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poireau, V.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Rauth, R.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Rieger, F.; Rinchiuso, L.; Romoli, C.; Rowell, G.; Rudak, B.; Rulten, C. B.; Safi-Harb, S.; Sahakian, V.; Saito, S.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schandri, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seglar-Arroyo, M.; Settimo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Shiningayamwe, K.; Simoni, R.; Sol, H.; Spanier, F.; Spir-Jacob, M.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Steppa, C.; Sushch, I.; Takahashi, T.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tsirou, M.; Tsuji, N.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Zorn, J.; Żywucka, N.

    2018-04-01

    We present the results of the most comprehensive survey of the Galactic plane in very high-energy (VHE) γ-rays, including a public release of Galactic sky maps, a catalog of VHE sources, and the discovery of 16 new sources of VHE γ-rays. The High Energy Spectroscopic System (H.E.S.S.) Galactic plane survey (HGPS) was a decade-long observation program carried out by the H.E.S.S. I array of Cherenkov telescopes in Namibia from 2004 to 2013. The observations amount to nearly 2700 h of quality-selected data, covering the Galactic plane at longitudes from ℓ = 250° to 65° and latitudes |b|≤ 3°. In addition to the unprecedented spatial coverage, the HGPS also features a relatively high angular resolution (0.08° ≈ 5 arcmin mean point spread function 68% containment radius), sensitivity (≲1.5% Crab flux for point-like sources), and energy range (0.2-100 TeV). We constructed a catalog of VHE γ-ray sources from the HGPS data set with a systematic procedure for both source detection and characterization of morphology and spectrum. We present this likelihood-based method in detail, including the introduction of a model component to account for unresolved, large-scale emission along the Galactic plane. In total, the resulting HGPS catalog contains 78 VHE sources, of which 14 are not reanalyzed here, for example, due to their complex morphology, namely shell-like sources and the Galactic center region. Where possible, we provide a firm identification of the VHE source or plausible associations with sources in other astronomical catalogs. We also studied the characteristics of the VHE sources with source parameter distributions. 16 new sources were previously unknown or unpublished, and we individually discuss their identifications or possible associations. We firmly identified 31 sources as pulsar wind nebulae (PWNe), supernova remnants (SNRs), composite SNRs, or gamma-ray binaries. Among the 47 sources not yet identified, most of them (36) have possible

  11. Physical-chemical processes of astrophysical interest: nitrogen chemistry

    International Nuclear Information System (INIS)

    Loison, Jean-Christophe; Hickson, Kevin; Hily-Blant, Pierre; Faure, Alexandre; Vuitton, Veronique; Bacmann, A.; Maret, Sebastien; Legal, Romane; Rist, Claire; Roncero, Octavio; Larregaray, Pascal; Hochlaf, Majdi; Senent, M. L.; Capron, Michael; Biennier, Ludovic; Carles, Sophie; Bourgalais, Jeremy; Le Picard, Sebastien; Cordier, Daniel; Guillemin, Jean-Claude; Trolez, Yann; Bertin, M.; Poderoso, H.A.M.; Michaut, X.; Jeseck, P.; Philippe, L.; Fillion, J.H.; Fayolle, E.C.; Linnartz, H.; Romanzin, C.; Oeberg, K.I.; Roueff, Evelyne; Pagani, Laurent; Padovani, Marco; Wakelam, Veronique; Honvault, Beatrice; Zvereva-Loete, Natalia; Ouk, Chanda-Malis; Scribano, Yohann; Hartmann, J.M.; Pineau des Forets, Guillaume; Hernandez, Mario; Lique, Francois; Kalugina, Yulia N.; Stoecklin, T.; Hochlaf, M.; Crespos, C.; Larregaray, P.; Martin-Gondre, L.; Petuya, R.; Quintas Sanchez, E.L.; Zanchet, Alexandre; Rodriguez-Lazcano, Yamilet; Mate, Belen

    2013-06-01

    This document contains the programme and abstracts of contributions to a workshop on nitrogen chemistry within an astrophysical perspective. These contributions have been presented in sessions: Introduction (opening lecture, experimental approaches to molecular astrophysics, theoretical approaches to astrophysics, observations in molecular astrophysics), Physical-chemical theory of the gas phase (time-dependent approach in elementary activity, statistic approach in elementary activity in the case of the N+H_2 reaction, potential energy surfaces for inelastic and reactive collisions, collision rate for N_2H"+, ortho/para selection rules in the chemistry of nitrogen hydrides, cyanides/iso-cyanides excitation in the ISM, CN excitation, radiative association with N_2H as new interstellar anion, ro-vibratory excitation of HCN) Laboratory astrophysics (measurement of reaction products in the CRESUSOL project, reactivity of the CN- anion, N_2 photo-desorption in ices, CRESU study of nitrogen chemistry, chemistry of nitrogen complex molecules), Observations and chemistry of astrophysical media (the problem of interstellar nitrogen fractioning, abundance of N_2 in proto-stellar cores, HNC in Titan atmosphere and nitrogen-related mechanisms in hot Jupiters, HCN and HNC in dark clouds or how theoretical modelling helps in interpreting observations, nitrogen chemistry in cold clouds, deuteration of nitrogen hydrides, nitrogen in interstellar ices, biochemical molecules on Titan, coupling between excitation and chemistry, radiative transfer of nitrogen hydrides, ortho/para chemistry of nitrogen hydrides), Physical-chemical theory of gas-grain interactions (nitrogen reactivity on surfaces, IR spectra of ices of NH_3 and NH_3/N_2 mixtures)

  12. Massive magnetic monopoles in cosmology and astrophysics

    International Nuclear Information System (INIS)

    Kolb, E.W.

    1984-01-01

    The astrophysical and cosmological consequences of magnetic monopoles are discussed. The production of monopoles during phase transition in the early universe is addressed, and proposals which have been made to alleviate the monopole problem are summarized. Astrophysical limits on galactic magnetic monopoles are discussed along with experimental efforts to detect monopoles. Finally, monopole-induced proton decay is addressed. 48 references

  13. Astrophysical tests for the Novello-De Lorenci-Luciane theory of gravity

    International Nuclear Information System (INIS)

    Mosquera Cuesta, H.J.

    2001-01-01

    The Novello-DeLorenci-Luciane (NDL) field theory of gravitation predicts that gravitational waves (GWs) follow geodesics of a modified (effective) geometry with a speed lower than the velocity of light. The theory also demonstrates that GWs exhibit the phenomenon of birefringence, formerly believed to be exclusive of electromagnetic waves. Here prospective astrophysical tests of these predictions are proposed. I point out that future measurements of gravitational waves in coincidence with a non-gravitational process such as a neutrino burst (and likely a burst of gamma-rays) may prove useful to discriminate among all the existing theories of gravity. It is also stressed that microlensing of gravitational waves emitted by known galactic sources (i.e., pulsars) in the bulge, lensed by either the Galaxy's central black hole (Sgr A*) or a MACHO object adrift among the Milky Way's stars, may provide a clean test of the birefringence phenomenon implied by the NDL gravity theory. (author)

  14. EDGE: Explorer of diffuse emission and gamma-ray burst explosions

    DEFF Research Database (Denmark)

    Den Herder, J.W.; Hermsen, W.; Hoevers, H.

    2007-01-01

    cluster formation, down to the very low redshift Universe, when between a third and one half of the baryons are expected to reside in cosmic filaments undergoing gravitational collapse by dark matter (the so-called warm hot intragalactic medium). In addition EDGE, with its unprecedented capabilities......How structures of various scales formed and evolved from the early Universe up to present time is a fundamental question of astrophysics. EDGE1 will trace the cosmic history of the baryons from the early generations of massive stars by Gamma-Ray Burst (GRB) explosions, through the period of galaxy...

  15. EDGE: Explorer of diffuse emission and gamma-ray burst explosions

    DEFF Research Database (Denmark)

    Piro, L; den Herder, J W; Ohashi, T

    2009-01-01

    , through the period of galaxy cluster formation, down to the very low redshift Universe, when between a third and one half of the baryons are expected to reside in cosmic filaments undergoing gravitational collapse by dark matter (the so-called warm hot intragalactic medium). In addition EDGE, with its......How structures of various scales formed and evolved from the early Universe up to present time is a fundamental question of astrophysical cosmology. EDGE (Piro et al., 2007) will trace the cosmic history of the baryons from the early generations of massive stars by Gamma-Ray Burst (GRB) explosions...

  16. Neutrino emission from gamma-ray burst fireballs, revised.

    Science.gov (United States)

    Hümmer, Svenja; Baerwald, Philipp; Winter, Walter

    2012-06-08

    We review the neutrino flux from gamma-ray bursts, which is estimated from gamma-ray observations and used for the interpretation of recent IceCube data, from a particle physics perspective. We numerically calculate the neutrino flux for the same astrophysical assumptions as the analytical fireball neutrino model, including the dominant pion and kaon production modes, flavor mixing, and magnetic field effects on the secondary muons, pions, and kaons. We demonstrate that taking into account the full energy dependencies of all spectra, the normalization of the expected neutrino flux reduces by about one order of magnitude and the spectrum shifts to higher energies, where we can pin down the exact origin of the discrepancies by the recomputation of the analytical models. We also reproduce the IceCube-40 analysis for exactly the same bursts and same assumptions and illustrate the impact of uncertainties. We conclude that the baryonic loading of the fireballs, which is an important control parameter for the emission of cosmic rays, can be constrained significantly with the full-scale experiment after about ten years.

  17. Rounding Up the Astrophysical Weeds

    Science.gov (United States)

    McMillan, James P.

    2016-09-01

    New instruments used for astronomy such as ALMA, Herschel, and SOFIA have greatly increased the quality of available astrophysical data. These improved data contain spectral lines and features which are not accounted for in the quantum mechanical (QM) catalogs. A class of molecules has been identified as being particularly problematic, the so-called "weeds". These molecules have numerous transitions, of non-trivial intensity, which are difficult to model due to highly perturbed low lying vibrational states. The inability to properly describe the complete contribution of these weeds to the astrophysical data has led directly to the misidentification of other target molecules. Ohio State's Microwave Laboratory has developed an alternative approach to this problem. Rather than relying on complex QM calculations, we have developed a temperature dependent approach to laboratory based terahertz spectroscopy. We have developed a set of simple packages, in addition to traditional line list catalogs, that enable astronomers to successfully remove the weed signals from their data. This dissertation will detail my laboratory work and analysis of three keys weeds: methanol, methyl formate and methyl cyanide. Also, discussed will be the analytical technique I used to apply these laboratory results to astrophysical data.

  18. Advanced LIGO: sources and astrophysics

    International Nuclear Information System (INIS)

    Creighton, Teviet

    2003-01-01

    Second-generation detectors in LIGO will take us from the discovery phase of gravitational-wave observations to the phase of true gravitational-wave astrophysics, with hundreds or thousands of potential sources. This paper surveys the most likely and interesting potential sources for Advanced LIGO, and the astrophysical processes that each one will probe. I conclude that binary inspiral signals are expected, while continuous signals from pulsars are plausible but not guaranteed. Other sources, such as core-collapse bursts, cosmic strings and primordial stochastic backgrounds, are speculative sources for Advanced LIGO, but also potentially the most interesting, since they push the limits of our theoretical knowledge

  19. Astrophysical Russian Dolls

    OpenAIRE

    Loeb, Abraham; Imara, Nia

    2017-01-01

    Are there examples of "astrophysical Russian dolls," and what could we learn from their similarities? In this article, we list a few such examples, including disks, filaments, and clusters. We suggest that forging connections across disciplinary borders enhances our perception of beauty, while simultaneously leading to a more comprehensive understanding of the Universe.

  20. Nuclear Data and Reaction Rate Databases in Nuclear Astrophysics

    Science.gov (United States)

    Lippuner, Jonas

    2018-06-01

    Astrophysical simulations and models require a large variety of micro-physics data, such as equation of state tables, atomic opacities, properties of nuclei, and nuclear reaction rates. Some of the required data is experimentally accessible, but the extreme conditions present in many astrophysical scenarios cannot be reproduced in the laboratory and thus theoretical models are needed to supplement the empirical data. Collecting data from various sources and making them available as a database in a unified format is a formidable task. I will provide an overview of the data requirements in astrophysics with an emphasis on nuclear astrophysics. I will then discuss some of the existing databases, the science they enable, and their limitations. Finally, I will offer some thoughts on how to design a useful database.

  1. 75 FR 13597 - NASA Advisory Council; Science Committee; Astrophysics Subcommittee; Meeting

    Science.gov (United States)

    2010-03-22

    ... Committee; Astrophysics Subcommittee; Meeting AGENCY: National Aeronautics and Space Administration. ACTION... of the Astrophysics Subcommittee of the NASA Advisory Council (NAC). This Subcommittee reports to the...: The agenda for the meeting includes the following topics: --Astrophysics Division Update. --Kepler...

  2. 76 FR 5405 - NASA Advisory Council; Science Committee; Astrophysics Subcommittee; Meeting

    Science.gov (United States)

    2011-01-31

    ... Committee; Astrophysics Subcommittee; Meeting AGENCY: National Aeronautics and Space Administration. ACTION... amended, the National Aeronautics and Space Administration (NASA) announces a meeting of the Astrophysics... contacting Marian Norris. The agenda for the meeting includes the following topics: --Astrophysics Division...

  3. 77 FR 4370 - NASA Advisory Council; Science Committee; Astrophysics Subcommittee; Meeting

    Science.gov (United States)

    2012-01-27

    ... Committee; Astrophysics Subcommittee; Meeting AGENCY: National Aeronautics and Space Administration. ACTION... amended, the National Aeronautics and Space Administration (NASA) announces a meeting of the Astrophysics... topics: --Astrophysics Division Update --Update on Balloons Return to Flight Changes --James Webb Space...

  4. 77 FR 38090 - NASA Advisory Council; Science Committee; Astrophysics Subcommittee; Meeting

    Science.gov (United States)

    2012-06-26

    ... Committee; Astrophysics Subcommittee; Meeting AGENCY: National Aeronautics and Space Administration. ACTION... amended, the National Aeronautics and Space Administration (NASA) announces a meeting of the Astrophysics...: --Astrophysics Division Update --James Webb Space Telescope Update --Wide-Field Infrared Survey Telescope Report...

  5. Building better optical model potentials for nuclear astrophysics applications

    International Nuclear Information System (INIS)

    Bauge, Eric; Dupuis, Marc

    2004-01-01

    In nuclear astrophysics, optical model potentials play an important role, both in the nucleosynthesis models, and in the interpretation of astrophysics related nuclear physics measurements. The challenge of nuclear astrophysics resides in the fact that it involves many nuclei far from the stability line, implying than very few (if any) experimental results are available for these nuclei. The answer to this challenge is a heavy reliance on microscopic optical models with solid microscopic physics foundations that can predict the relevant physical quantities with good accuracy. This use of microscopic information limits the likelihood of the model failing spectacularly (except if some essential physics was omitted in the modeling) when extrapolating away from the stability line, in opposition to phenomenological models which are only suited for interpolation between measured data points and not for extrapolating towards unexplored areas of the chart of the nuclides.We will show how these microscopic optical models are built, how they link to our present knowledge of nuclear structure, and how they affect predictions of nuclear astrophysics models and the interpretation of some key nuclear physics measurements for astrophysics

  6. 76 FR 7882 - Astronomy and Astrophysics Advisory Committee; Notice of Meeting

    Science.gov (United States)

    2011-02-11

    ... NATIONAL SCIENCE FOUNDATION Astronomy and Astrophysics Advisory Committee; Notice of Meeting In... Foundation announces the following meeting: Name: Astronomy and Astrophysics Advisory Committee ( 13883... of astronomy and astrophysics that are of mutual interest and concern to the agencies. Agenda: To...

  7. 78 FR 2450 - Astronomy and Astrophysics Advisory Committee; Notice of Meeting

    Science.gov (United States)

    2013-01-11

    ... NATIONAL SCIENCE FOUNDATION Astronomy and Astrophysics Advisory Committee; Notice of Meeting In... Foundation announces the following meeting: Name: Astronomy and Astrophysics Advisory Committee ( 13883...) on issues within the field of astronomy and astrophysics that are of mutual interest and concern to...

  8. 77 FR 8288 - Astronomy and Astrophysics Advisory Committee; Notice of Meeting

    Science.gov (United States)

    2012-02-14

    ... NATIONAL SCIENCE FOUNDATION Astronomy and Astrophysics Advisory Committee; Notice of Meeting In... Foundation announces the following meeting: Name: Astronomy and Astrophysics Advisory Committee ( 13883... of astronomy and astrophysics that are of mutual interest and concern to the agencies. Agenda: To...

  9. 78 FR 20356 - NASA Advisory Council; Science Committee; Astrophysics Subcommittee; Meeting

    Science.gov (United States)

    2013-04-04

    ... Committee; Astrophysics Subcommittee; Meeting AGENCY: National Aeronautics and Space Administration. ACTION... amended, the National Aeronautics and Space Administration (NASA) announces a meeting of the Astrophysics... password [email protected] The agenda for the meeting includes the following topics: --Astrophysics Division...

  10. Astrophysical relevance of γ transition energies

    International Nuclear Information System (INIS)

    Rauscher, Thomas

    2008-01-01

    The relevant γ energy range is explicitly identified where additional γ strength must be located to have an impact on astrophysically relevant reactions. It is shown that folding the energy dependences of the transmission coefficients and the level density leads to maximal contributions for γ energies of 2≤E γ ≤4 unless quantum selection rules allow isolated states to contribute. Under this condition, electric dipole transitions dominate. These findings allow us to more accurately judge the relevance of modifications of the γ strength for astrophysics

  11. Astronomy and astrophysics in the new millennium: Panel reports

    National Research Council Canada - National Science Library

    Astronomy and Astrophysics Survey Committee, Board on Physics and Astronomy, Space Studies Board, National Research Council

    2001-01-01

    In preparing the report, Astronomy and Astrophysics in the New Millenium , the AASC made use of a series of panel reports that address various aspects of ground- and space-based astronomy and astrophysic...

  12. 76 FR 14106 - NASA Advisory Council; Science Committee; Astrophysics Subcommittee; Meeting

    Science.gov (United States)

    2011-03-15

    ... Committee; Astrophysics Subcommittee; Meeting AGENCY: National Aeronautics and Space Administration. ACTION... amended, the National Aeronautics and Space Administration (NASA) announces a meeting of the Astrophysics...: --Astrophysics Division Update. It is imperative that the meeting be held on these dates to accommodate the...

  13. Excitation of compound states in the subsystems as indirect tool in nuclear astrophysics

    Directory of Open Access Journals (Sweden)

    Tribble R.E.

    2010-03-01

    Full Text Available Astrophysical reactions proceeding through compound states represent one of the crucial part of nuclear astrophysics. However, due to the presence of the Coulomb barrier, it is often very difficult or even impossible to obtain the astrophysical S (E factor from measurements in the laboratory at astrophysically relevant energies. The Trojan Horse method (THM provides a unique tool to obtain the information about resonant astrophysical reactions at astrophysically relevant energies. Here the theory and application of the THM for the resonant reactions is addressed.

  14. 3rd Session of the Sant Cugat Forum on Astrophysics

    CERN Document Server

    Gravitational wave astrophysics

    2015-01-01

    This book offers review chapters written by invited speakers of the 3rd Session of the Sant Cugat Forum on Astrophysics — Gravitational Waves Astrophysics. All chapters have been peer reviewed. The book goes beyond normal conference proceedings in that it provides a wide panorama of the astrophysics of gravitational waves and serves as a reference work for researchers in the field.

  15. TARGET: A multi-channel digitizer chip for very-high-energy gamma-ray telescopes

    Energy Technology Data Exchange (ETDEWEB)

    Bechtol, K.; Funk, S.; /Stanford U., HEPL /KIPAC, Menlo Park; Okumura, A.; /JAXA, Sagamihara /Stanford U., HEPL /KIPAC, Menlo Park; Ruckman, L.; /Hawaii U.; Simons, A.; Tajima, H.; Vandenbroucke, J.; /Stanford U., HEPL /KIPAC, Menlo Park; Varner, G.; /Hawaii U.

    2011-08-11

    The next-generation very-high-energy (VHE) gamma-ray observatory, the Cherenkov Telescope Array, will feature dozens of imaging atmospheric Cherenkov telescopes (IACTs), each with thousands of pixels of photosensors. To be affordable and reliable, reading out such a mega-channel array requires event recording technology that is highly integrated and modular, with a low cost per channel. We present the design and performance of a chip targeted to this application: the TeV Array Readout with GSa/s sampling and Event Trigger (TARGET). This application-specific integrated circuit (ASIC) has 16 parallel input channels, a 4096-sample buffer for each channel, adjustable input termination, self-trigger functionality, and tight window-selected readout. We report the performance of TARGET in terms of sampling frequency, power consumption, dynamic range, current-mode gain, analog bandwidth, and cross talk. The large number of channels per chip allows a low cost per channel ($10 to $20 including front-end and back-end electronics but not including photosensors) to be achieved with a TARGET-based IACT readout system. In addition to basic performance parameters of the TARGET chip itself, we present a camera module prototype as well as a second-generation chip (TARGET 2), both of which have been produced.

  16. Development of the Advanced Energetic Pair Telescope (AdEPT) for Medium-Energy Gamma-Ray Astronomy

    Science.gov (United States)

    Hunter, Stanley D.; Bloser, Peter F.; Dion, Michael P.; McConnell, Mark L.; deNolfo, Georgia A.; Son, Seunghee; Ryan, James M.; Stecker, Floyd W.

    2011-01-01

    Progress in high-energy gamma-ray science has been dramatic since the launch of INTEGRAL, AGILE and FERMI. These instruments, however, are not optimized for observations in the medium-energy (approx.0.3< E(sub gamma)< approx.200 MeV) regime where many astrophysical objects exhibit unique, transitory behavior, such as spectral breaks, bursts, and flares. We outline some of the major science goals of a medium-energy mission. These science goals are best achieved with a combination of two telescopes, a Compton telescope and a pair telescope, optimized to provide significant improvements in angular resolution and sensitivity. In this paper we describe the design of the Advanced Energetic Pair Telescope (AdEPT) based on the Three-Dimensional Track Imager (3-DTI) detector. This technology achieves excellent, medium-energy sensitivity, angular resolution near the kinematic limit, and gamma-ray polarization sensitivity, by high resolution 3-D electron tracking. We describe the performance of a 30x30x30 cm3 prototype of the AdEPT instrument.

  17. Astronomical optical interferometry, II: Astrophysical results

    Directory of Open Access Journals (Sweden)

    Jankov S.

    2011-01-01

    Full Text Available Optical interferometry is entering a new age with several ground- based long-baseline observatories now making observations of unprecedented spatial resolution. Based on a great leap forward in the quality and quantity of interferometric data, the astrophysical applications are not limited anymore to classical subjects, such as determination of fundamental properties of stars; namely, their effective temperatures, radii, luminosities and masses, but the present rapid development in this field allowed to move to a situation where optical interferometry is a general tool in studies of many astrophysical phenomena. Particularly, the advent of long-baseline interferometers making use of very large pupils has opened the way to faint objects science and first results on extragalactic objects have made it a reality. The first decade of XXI century is also remarkable for aperture synthesis in the visual and near-infrared wavelength regimes, which provided image reconstructions from stellar surfaces to Active Galactic Nuclei. Here I review the numerous astrophysical results obtained up to date, except for binary and multiple stars milliarcsecond astrometry, which should be a subject of an independent detailed review, taking into account its importance and expected results at microarcsecond precision level. To the results obtained with currently available interferometers, I associate the adopted instrumental settings in order to provide a guide for potential users concerning the appropriate instruments which can be used to obtain the desired astrophysical information.

  18. Shape: A 3D Modeling Tool for Astrophysics.

    Science.gov (United States)

    Steffen, Wolfgang; Koning, Nicholas; Wenger, Stephan; Morisset, Christophe; Magnor, Marcus

    2011-04-01

    We present a flexible interactive 3D morpho-kinematical modeling application for astrophysics. Compared to other systems, our application reduces the restrictions on the physical assumptions, data type, and amount that is required for a reconstruction of an object's morphology. It is one of the first publicly available tools to apply interactive graphics to astrophysical modeling. The tool allows astrophysicists to provide a priori knowledge about the object by interactively defining 3D structural elements. By direct comparison of model prediction with observational data, model parameters can then be automatically optimized to fit the observation. The tool has already been successfully used in a number of astrophysical research projects.

  19. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Since 1977, papers in Astrophysics and Astronomy appeared as a special section in Pramana. ... The journal publishes original research papers on all aspects of astrophysics and ... Articles are also visible in Web of Science immediately.

  20. Preface: Eighth European Summer School on Experimental Nuclear Astrophysics

    International Nuclear Information System (INIS)

    Claudio, Spitaleri; Livio, Lamia; Gianluca, Pizzone Rosario

    2016-01-01

    predict the existence of different stellar environments which could produce the observed isotopic abundances, and the nuclear processes which must occur in these stars. This is also valid for elements heavier than iron production, when fusion reactions are of negligible importance and the main nucleosynthetic path goes through p-process, r-process, and s-process. Many of the nuclides generated in the huge explosion triggered by the last burnings in the life of a massive star are unstable. Then in order to understand what is going on in Supernovae explosions, Gamma-ray bursts, Novae it was pointed out that the physics of radioactive beams should be explored. Many group of physicists have then taken the opportunities offered by the world-wide developments of radioactive ion beams facilities to start to investigate such environments. In this field also the weak interaction processes are important and in some cases, like type II Supernovae, dominant. Additional nucleosynthetic paths, such as the i-processes were also introduced in one specific lecture. In order to better understand our Universe, a precise knowledge of nuclear inputs for nuclear astrophysics is therefore needed. They influence sensitively the nucleosynthesis of the elements in the early stages of the universe and in all the objects formed thereafter and control the associate energy generation, neutrino luminosity and stellar evolution. Thus a good knowledge of reaction rates is essential to understand this broad picture. Studies at the energies typical of nuclear astrophysics for charged particle induced reactions (few keV - 1 MeV) are severely hampered by the low signal-to-noise ratio, essentially due to the tiny cross sections that have to be measured (as low as picobarn in some cases). The best experimental solutions to this main problem will be discussed in this book and presented in their details. The pilot project, LUNA, i.e. a 50 keV accelerator installed in the Laboratori Nazionali del Gran Sasso has

  1. PULSED VERY HIGH ENERGY γ-RAY EMISSION CONSTRAINTS FOR PSR B1951+32 FROM STACEE OBSERVATIONS

    International Nuclear Information System (INIS)

    Zweerink, J.; Ball, J.; Carson, J. E.; Jarvis, A.; Ong, R. A.; Kildea, J.; Hanna, D. S.; Lindner, T.; Mueller, C.; Ragan, K.; Covault, C. E.; Driscoll, D. D.; Fortin, P.; Mukherjee, R.; Gingrich, D. M.; Williams, D. A.

    2009-01-01

    The Solar Tower Atmospheric Cherenkov Effect Experiment (STACEE) is a ground-based telescope that uses the wave-front-sampling technique to detect very high energy (VHE) gamma rays. STACEE's sensitivity in the energy range near 100 GeV permits useful observations of pulsars with the potential to discriminate between various proposed mechanisms for pulsed gamma-ray emission. Based on the 11.3 hr of data taken during the 2005 and 2006 observing seasons, we derive an upper limit on the pulsed gamma-ray emission from PSR B1951+32 of -11 photons cm -2 s -1 above an energy threshold of 117 GeV.

  2. Nuclear astrophysics and nuclei far from stability

    International Nuclear Information System (INIS)

    Schatz, H.

    2003-01-01

    Unstable nuclei play a critical role in a number of astrophysical scenarios and are important for our understanding of the origin of the elements. Among the most important scenarios are the r-process (Supernovae), Novae, X-ray bursters, and Superbursters. For these astrophysical events I review the open questions, recent developments in astronomy, and how nuclear physics, in particular experiments with radioactive beams, needs to contribute to find the answers. (orig.)

  3. Technology Development for a Neutrino Astrophysical Observatory

    International Nuclear Information System (INIS)

    Chaloupka, V.; Cole, T.; Crawford, H.J.; He, Y.D.; Jackson, S.; Kleinfelder, S.; Lai, K.W.; Learned, J.; Ling, J.; Liu, D.; Lowder, D.; Moorhead, M.; Morookian, J.M.; Nygren, D.R.; Price, P.B.; Richards, A.; Shapiro, G.; Shen, B.; Smoot, George F.; Stokstad, R.G.; VanDalen, G.; Wilkes, J.; Wright, F.; Young, K.

    1996-01-01

    We propose a set of technology developments relevant to the design of an optimized Cerenkov detector for the study of neutrino interactions of astrophysical interest. Emphasis is placed on signal processing innovations that enhance significantly the quality of primary data. These technical advances, combined with field experience from a follow-on test deployment, are intended to provide a basis for the engineering design for a kilometer-scale Neutrino Astrophysical Observatory

  4. Extended gamma-ray sources around pulsars constrain the origin of the positron flux at Earth

    OpenAIRE

    Abeysekara, A. U.; Albert, A.; Alfaro, R.; Alvarez, C.; Álvarez, J. D.; Arceo, R.; Arteaga-Velázquez, J. C.; Rojas, D. Avila; Solares, H. A. Ayala; Barber, A. S.; Bautista-Elivar, N.; Becerril, A.; Belmont-Moreno, E.; BenZvi, S. Y.; Berley, D.

    2017-01-01

    The unexpectedly high flux of cosmic ray positrons detected at Earth may originate from nearby astrophysical sources, dark matter, or unknown processes of cosmic-ray secondary production. We report the detection, using the HighAltitude Water Cherenkov Observatory (HAWC), of extended tera-electron volt gamma-ray emission coincident with the locations of two nearby middle-aged pulsars (Geminga and PSR B0656+14). The HAWC observations demonstrate that these pulsars are indeed local sources of ac...

  5. Advances in astronomy and astrophysics 9

    CERN Document Server

    Kopal, Zdenek

    1972-01-01

    Advances in Astronomy and Astrophysics, Volume 9 covers reviews on the advances in astronomy and astrophysics. The book presents reviews on the Roche model and its applications to close binary systems. The text then describes the part played by lunar eclipses in the evolution of astronomy; the classical theory of lunar eclipses; deviations from geometrical theory; and the methods of photometric observations of eclipses. The problems of other phenomena related in one way or another to lunar eclipses are also considered. The book further tackles the infrared observation on the eclipsed moon, as

  6. Spherical Panoramas for Astrophysical Data Visualization

    Science.gov (United States)

    Kent, Brian R.

    2017-05-01

    Data immersion has advantages in astrophysical visualization. Complex multi-dimensional data and phase spaces can be explored in a seamless and interactive viewing environment. Putting the user in the data is a first step toward immersive data analysis. We present a technique for creating 360° spherical panoramas with astrophysical data. The three-dimensional software package Blender and the Google Spatial Media module are used together to immerse users in data exploration. Several examples employing these methods exhibit how the technique works using different types of astronomical data.

  7. Long-term studies of Markarian 421 from 2007 to 2009

    Energy Technology Data Exchange (ETDEWEB)

    Schroeder, Sonja; Overkemping, Ann-Kristin [TU Dortmund, Dortmund (Germany); Manganaro, Marina [IAC La Laguna, Teneriffa (Spain); Tescaro, Diego [INFN, Padova (Italy); Collaboration: MAGIC-Collaboration

    2016-07-01

    The MAGIC experiment consists of two Imaging Air shower Cherenkov Telescopes to detect and study gamma-rays from galactic and extragalactic sources. Blazars are a special type of extragalactic sources hosting an Active Galactic Nucleus (AGN) with a jet directed towards earth. The AGN Mrk 421 is one of the strongest and brightest known blazars suitable for very high-energy (VHE) observations. This talk gives an overview over long-term variability and correlation studies of the blazar Mrk 421. For this study a VHE dataset collected by MAGIC-I covering the extensive timespan from February 2007 to June 2009 was examined together with data of different wavelengths from other telescopes. These kind of studies could allow for an increase of knowledge about the possible emission processes inside Mrk 421.

  8. On Gamma-Ray Bursts

    CERN Document Server

    Ruffini, Remo; Bianco, Carlo Luciano; Caito, Letizia; Chardonnet, Pascal; Cherubini, Christian; Dainotti, Maria Giovanna; Fraschetti, Federico; Geralico, Andrea; Guida, Roberto; Patricelli, Barbara; Rotondo, Michael; Hernandez, Jorge Armando Rueda; Vereshchagin, Gregory; Xue, She-Sheng

    2008-01-01

    (Shortened) We show by example how the uncoding of Gamma-Ray Bursts (GRBs) offers unprecedented possibilities to foster new knowledge in fundamental physics and in astrophysics. After recalling some of the classic work on vacuum polarization in uniform electric fields by Klein, Sauter, Heisenberg, Euler and Schwinger, we summarize some of the efforts to observe these effects in heavy ions and high energy ion collisions. We then turn to the theory of vacuum polarization around a Kerr-Newman black hole, leading to the extraction of the blackholic energy, to the concept of dyadosphere and dyadotorus, and to the creation of an electron-positron-photon plasma. We then present a new theoretical approach encompassing the physics of neutron stars and heavy nuclei. It is shown that configurations of nuclear matter in bulk with global charge neutrality can exist on macroscopic scales and with electric fields close to the critical value near their surfaces. These configurations may represent an initial condition for the...

  9. High-energy Emission from Nonrelativistic Radiative Shocks: Application to Gamma-Ray Novae

    Science.gov (United States)

    Vurm, Indrek; Metzger, Brian D.

    2018-01-01

    The observation of GeV gamma-rays from novae by Fermi/LAT demonstrates that the nonrelativistic radiative shocks in these systems can accelerate particles to energies of at least ∼10 GeV. The low-energy extension of the same nonthermal particle distribution inevitably gives rise to emission in the hard X-ray band. Above ≳ 10 {keV}, this radiation can escape the system without significant absorption/attenuation, and can potentially be detected by NuSTAR. We present theoretical models for hard X-ray and gamma-ray emission from radiative shocks in both leptonic and hadronic scenarios, accounting for the rapid evolution of the downstream properties due to the fast cooling of thermal plasma. We find that due to strong Coulomb losses, only a fraction of {10}-4{--}{10}-3 of the gamma-ray luminosity is radiated in the NuSTAR band; nevertheless, this emission could be detectable simultaneously with the LAT emission in bright gamma-ray novae with a ∼50 ks exposure. The spectral slope in hard X-rays is α ≈ 0 for typical nova parameters, thus serving as a testable prediction of the model. Our work demonstrates how combined hard X-ray and gamma-ray observations can be used to constrain properties of the nova outflow (velocity, density, and mass outflow rate) and particle acceleration at the shock. A very low X-ray to gamma-ray luminosity ratio ({L}{{X}}/{L}γ ≲ 5× {10}-4) would disfavor leptonic models for the gamma-ray emission. Our model can also be applied to other astrophysical environments with radiative shocks, including SNe IIn and colliding winds in massive star binaries.

  10. Nuclear information needs for the astrophysical s-process

    Energy Technology Data Exchange (ETDEWEB)

    Mathews, G.J.; Howard, W.M.; Takahashi, K.; Ward, R.A.

    1986-01-01

    The astrophysical s-process is a sequence of neutron-capture and beta-decay reactions on a slow time scale compared to beta-decay lifetimes near the line of stability. This detailed sequence of neutron capture, continuum and bound-state beta decay, positron decay, and electron-capture reactions that comprise the s-process has been studied for a broad range of astrophysical environments. The results are then compared with the solar-system abundancies of heavy elements to determine the range of physical conditions responsible for their nucleosynthesis. The nuclear data needs are extensive but have begun to be precise enough to allow for a consistent interpretation of the astrophysical site for the s-process.

  11. Nuclear information needs for the astrophysical s-process

    Energy Technology Data Exchange (ETDEWEB)

    Mathews, G.J.; Howard, W.M.; Takahashi, K.; Ward, R.A.

    1985-05-01

    The astrophysical s-process is a sequence of neutron-capture and beta-decay reactions on a slow time scale compared to beta-decay lifetimes near the line of stability. We systematically study this detailed sequence of neutron capture, continuum and bound-state beta decay, positron decay, and electron-capture reactions that comprise the s-process for a broad range of astrophysical environments. Our results are then compared with the solar-system abundances of heavy elements to determine the range of physical conditions responsible for their nucleosynthesis. The nuclear data needs are extensive but have begun to be precise enough to allow for a consistent interpretation of the astrophysical site for the s-process.

  12. Constraining decaying dark matter with FERMI-LAT gamma rays

    International Nuclear Information System (INIS)

    Maccione, L.

    2011-01-01

    High energy electron sand positrons from decaying dark matter can produce a significant flux of gamma rays by inverse Compton of low energy photons in the interstellar radiation field. This possibility is inevitably related with the dark matter interpretation of the observed PAMELA and FERMI excesses. We will describe a simple and universal method to constrain dark matter models which produce electrons and positrons in their decay by using the FERMI-LAT gamma-ray observations in the energy range between 0.5 GeV and 300 GeV, by exploiting universal response functions that, once convolved with a specific dark matter model, produce the desired constraint. The response functions contain all the astrophysical inputs. Here is discussed the uncertainties in the determination of the response functions and apply them to place constraints on some specific dark matter decay models that can well fit the positron and electron fluxes observed by PAMELA and FERMI LAT, also taking into account prompt radiation from the dark matter decay. With the available data decaying dark matter can not be excluded as source of the PAMELA positron excess.

  13. The Jet Experiments in Nuclear Structure and Astrophysics (JENSA) gas jet target

    International Nuclear Information System (INIS)

    Chipps, K.A.; Greife, U.; Bardayan, D.W.; Blackmon, J.C.; Kontos, A.; Linhardt, L.E.; Matos, M.; Pain, S.D.; Pittman, S.T.; Sachs, A.; Schatz, H.; Schmitt, K.T.; Smith, M.S.; Thompson, P.

    2014-01-01

    New radioactive ion beam (RIB) facilities will push further away from stability and enable the next generation of nuclear physics experiments. Of great importance to the future of RIB physics are scattering, transfer, and capture reaction measurements of rare, exotic, and unstable nuclei on light targets such as hydrogen and helium. These measurements require targets that are dense, highly localized, and pure. Targets must also accommodate the use of large area silicon detector arrays, high-efficiency gamma arrays, and heavy ion detector systems to efficiently measure the reaction products. To address these issues, the Jet Experiments in Nuclear Structure and Astrophysics (JENSA) Collaboration has designed, built, and characterized a supersonic gas jet target, capable of providing gas areal densities on par with commonly used solid targets within a region of a few millimeters diameter. Densities of over 5×10 18 atoms/cm 2 of helium have been achieved, making the JENSA gas jet target the most dense helium jet achieved so far

  14. White Paper on the Status and Future of Ground-based Gamma-Ray Astronomy - Extragalactic Science Working Group

    Science.gov (United States)

    Krawczynski, H.; Coppi, P.; Dermer, C.; Dwek, E.; Georganopoulos, M.; Horan, D.; Jones, T.; Krennrich, F.; Mukherjee, R.; Perlman, E.; Vassiliev, V.

    2007-04-01

    In fall 2006, the Division of Astrophysics of the American Physical Society requested a white paper about the status and future of ground based gamma-ray astronomy. The white paper will largely be written in the year 2007. Interested scientists are invited to join the science working groups. In this contribution, we will report on some preliminary results of the extragalactic science working group. We will discuss the potential of future ground based gamma-ray experiments to elucidate how supermassive black holes accrete matter, form jets, and accelerate particles, and to study in detail the acceleration and propagation of cosmic rays in extragalactic systems like infrared galaxies and galaxy clusters. Furthermore, we discuss avenues to constrain the spectrum of the extragalactic infrared to optical background radiation, and to measure the extragalactic magnetic fields based on gamma-ray observations. Eventually, we discuss the potential of ground based experiments for conducting gamma-ray source surveys. More information about the white paper can be found at: http://cherenkov.physics.iastate.edu/wp/

  15. Experimental study of the {sup 22}Ne(p,{gamma}){sup 23}Na reaction and its implications for novae scenarios

    Energy Technology Data Exchange (ETDEWEB)

    Menzel, Marie-Luise

    2013-08-01

    The {sup 22}Ne(p,{gamma}){sup 23}Na reaction belongs to the catalytic neon-sodium cycle and has an important role in the explosive hydrogen burning. The neon-sodium cycle takes place at temperatures of T = 0.1 - 0.5 GK and is assumed to occur in different astrophysical systems: e.g. in novae, in super novae of type Ia and during the shell-burning of red giant branch stars. The implications of {sup 22}Ne(p,{gamma}){sup 23}Na and the neon-sodium cycle in a nova scenario have been studied by using the nuclear network code libnucnet at GSI in Darmstadt. A nova is an outburst of matter in a binary system consisting of a white dwarf and a red giant star. It is therefore a representative phenomenon for explosive hydrogen burning. For the calculation of the nucleosynthesis during the nova outburst, the code libnucnet requires the initial mass composition of the novae partners, the temperature and density profiles of the nova explosion and the thermonuclear reaction rates of the participating reactions. In the following, the code determined the flow and the final atomic abundance in the neon-sodium cycle during the entire nova process. Additionally, the influence of the temperature profile of the novae outburst as well as the thermonuclear reaction rate of the {sup 22}Ne(p,{gamma}){sup 23}Na reaction on the final atomic abundance in the outburst has been studied. A characteristic measure for the reactions in astrophysical environments is the thermonuclear reaction rate. The reaction rate of {sup 22}Ne(p,{gamma}){sup 23}Na has still strong uncertainties in the temperature range of T = 0.03 - 0.3 GK. These uncertainties are based on insufficient upper limits of the resonance strengths as well as the possible existence of tentative states that are populated in the energy range of E{sup lab}{sub p} = 30 - 300 keV. The research presented in this thesis is dedicated to the experimental study of the {sup 22}Ne(p,{gamma}){sup 23}Na reaction for an improved determination of the

  16. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy. Sagar Sethi. Articles written in Journal of Astrophysics and Astronomy. Volume 37 Issue 4 December 2016 pp 41 Review. Tracking Galaxy Evolution Through Low-Frequency Radio Continuum Observations using SKA and Citizen-Science Research using ...

  17. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy. Sravani Vaddi. Articles written in Journal of Astrophysics and Astronomy. Volume 37 Issue 4 December 2016 pp 41 Review. Tracking Galaxy Evolution Through Low-Frequency Radio Continuum Observations using SKA and Citizen-Science Research using ...

  18. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy. Abudusaimaitijiang Yisikandeer. Articles written in Journal of Astrophysics and Astronomy. Volume 37 Issue 3 September 2016 pp 22 Research Article. Velocity Distributions of Runaway Stars Produced by Supernovae in the Galaxy · Abudusaimaitijiang Yisikandeer ...

  19. Advances in astronomy and astrophysics 7

    CERN Document Server

    Kopal, Zdenek

    2013-01-01

    Advances in Astronomy and Astrophysics, Volume 7 covers reviews about the advances in astronomy and astrophysics. The book presents reviews on the scattering of electrons by diatomic molecules and on Babcock's theory of the 22-year solar cycle and the latitude drift of the sunspot zone. The text then describes reviews on the structures of the terrestrial planets (Earth, Venus, Mars, Mercury) and on type III solar radio bursts. The compact and dispersed cosmic matter is also considered with regard to the search for new cosmic objects and phenomena and on the nature of the ref shift from compact

  20. On the saturation of astrophysical dynamos

    DEFF Research Database (Denmark)

    Dorch, Bertil; Archontis, Vasilis

    2004-01-01

    In the context of astrophysical dynamos we illustrate that the no-cosines flow, with zero mean helicity, can drive fast dynamo action and we study the dynamo's mode of operation during both the linear and non-linear saturation regimes. It turns out that in addition to a high growth rate in the li......In the context of astrophysical dynamos we illustrate that the no-cosines flow, with zero mean helicity, can drive fast dynamo action and we study the dynamo's mode of operation during both the linear and non-linear saturation regimes. It turns out that in addition to a high growth rate...

  1. Ultra high energy gamma rays and observations with CYGNUS/MILAGRO

    International Nuclear Information System (INIS)

    Weeks, D.D.; Yodh, G.B.

    1992-01-01

    This talk discusses high-energy observations of the Crab pulsar/nebula and the pulsar in the X-ray binary, Hercules X-1, and makes the case for continued observations with ground-based γ-ray detectors. The CYGNUS Air Shower Array has a wide field of view on monitors several astrophysical γ-ray sources at the same time, many of which are prime objects observed by the Compton Gamma Ray Observatory (GRO) and air Cerenkov telescopes. This array and the future MILAGRO Water Cerenkov Detector can perform observations that are simultaneous with similar experiments to provide confirmation of emission, and can measure source spectra at a range of high energies previously unexplored

  2. Spherical harmonics analysis of Fermi gamma-ray data and the Galactic dark matter halo

    International Nuclear Information System (INIS)

    Malyshev, Dmitry; Bovy, Jo; Cholis, Ilias

    2011-01-01

    We argue that the decomposition of gamma-ray maps in spherical harmonics is a sensitive tool to study dark matter (DM) annihilation or decay in the main Galactic halo of the Milky Way. Using the spherical harmonic decomposition in a window excluding the Galactic plane, we show for 1 yr of Fermi data that adding a spherical template (such as a line-of-sight DM annihilation profile) to an astrophysical background significantly reduces χ 2 of the fit to the data. In some energy bins the significance of this DM fraction is above three sigma. This can be viewed as a hint of a DM annihilation signal, although astrophysical sources cannot be ruled out at this moment. We use the derived DM fraction as a conservative upper limit on the DM annihilation signal. In the case of bb annihilation channel the limits are about a factor of 2 less constraining than the limits from dwarf galaxies. The uncertainty of our method is dominated by systematics related to modeling the astrophysical background. We show that with 1 yr of Fermi data the statistical sensitivity would be sufficient to detect DM annihilation with thermal freeze-out cross section for masses below 100 GeV.

  3. 77 FR 54615 - Astronomy and Astrophysics Advisory Committee #13883; Notice of Meeting

    Science.gov (United States)

    2012-09-05

    ... NATIONAL SCIENCE FOUNDATION Astronomy and Astrophysics Advisory Committee 13883; Notice of Meeting... Science Foundation announces the following Astronomy and Astrophysics Advisory Committee ( 13883) meeting... on issues within the field of astronomy and astrophysics that are of mutual interest and concern to...

  4. 78 FR 61400 - Astronomy and Astrophysics Advisory Committee #13883; Notice of Meeting

    Science.gov (United States)

    2013-10-03

    ... NATIONAL SCIENCE FOUNDATION Astronomy and Astrophysics Advisory Committee 13883; Notice of Meeting... Science Foundation announces the following Astronomy and Astrophysics Advisory Committee ( 13883) meeting...) on issues within the field of astronomy and astrophysics that are of mutual interest and concern to...

  5. 78 FR 22346 - Astronomy and Astrophysics Advisory Committee #13883; Notice of Meeting

    Science.gov (United States)

    2013-04-15

    ... NATIONAL SCIENCE FOUNDATION Astronomy and Astrophysics Advisory Committee 13883; Notice of Meeting... Science Foundation announces the following meeting: Name: Astronomy and Astrophysics Advisory Committee... of astronomy and astrophysics that are of mutual interest and concern to the agencies. Agenda: To...

  6. 75 FR 7295 - Astronomy and Astrophysics Advisory Committee #13883; Notice of Meeting

    Science.gov (United States)

    2010-02-18

    ... NATIONAL SCIENCE FOUNDATION Astronomy and Astrophysics Advisory Committee 13883; Notice of Meeting... Science Foundation announces the following meeting: Name: Astronomy and Astrophysics Advisory Committee... within the field of astronomy and astrophysics that are of mutual interest and concern to the agencies...

  7. 78 FR 11685 - Astronomy and Astrophysics Advisory Committee #13883; Notice of Meeting

    Science.gov (United States)

    2013-02-19

    ... NATIONAL SCIENCE FOUNDATION Astronomy and Astrophysics Advisory Committee 13883; Notice of Meeting... Science Foundation announces the following meeting: Name: Astronomy and Astrophysics Advisory Committee... of astronomy and astrophysics that are of mutual interest and concern to the agencies. Agenda: To...

  8. 77 FR 22614 - Astronomy and Astrophysics Advisory Committee #13883; Notice of Meeting

    Science.gov (United States)

    2012-04-16

    ... NATIONAL SCIENCE FOUNDATION Astronomy and Astrophysics Advisory Committee 13883; Notice of Meeting... Science Foundation announces the following meeting: Name: Astronomy and Astrophysics Advisory Committee... of astronomy and astrophysics that are of mutual interest and concern to the agencies. Agenda: To...

  9. 76 FR 5214 - Astronomy and Astrophysics Advisory Committee #13883; Notice of Meeting

    Science.gov (United States)

    2011-01-28

    ... NATIONAL SCIENCE FOUNDATION Astronomy and Astrophysics Advisory Committee 13883; Notice of Meeting... Science Foundation announces the following Astronomy and Astrophysics Advisory Committee ( 13883) meeting... within the field of astronomy and astrophysics that are of mutual interest and concern to the agencies...

  10. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy. Gerard Vauclair. Articles written in Journal of Astrophysics and Astronomy. Volume 21 Issue 3-4 September-December 2000 pp 319-322 Session VII – Magnetoconvection & Stellar Activity. The Space Stellar Photometry Mission COROT: Asteroseismology and Search ...

  11. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy. Abhishek Shukla. Articles written in Journal of Astrophysics and Astronomy. Volume 38 Issue 1 March 2017 pp 7 Research Article. Benford's Distribution in Extrasolar World: Do the Exoplanets Follow Benford's Distribution? Abhishek Shukla Ankit Kumar Pandey ...

  12. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy. Siddhartha Bhattacharyya. Articles written in Journal of Astrophysics and Astronomy. Volume 37 Issue 4 December 2016 pp 37 Review. Fast Transients with the Square Kilometre Array and its Pathfinders: An Indian Perspective · Yashwant Gupta Poonam Chandra ...

  13. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... Home; Journals; Journal of Astrophysics and Astronomy. Stefano Ciroi. Articles written in Journal of Astrophysics and Astronomy. Volume 36 Issue 4 December 2015 pp 447-455 Review. Optical Counterparts of Undetermined Type -Ray Active Galactic Nuclei with Blazar-Like Spectral Energy Distributions.

  14. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy. Annie Baglin. Articles written in Journal of Astrophysics and Astronomy. Volume 21 Issue 3-4 September-December 2000 pp 319-322 Session VII – Magnetoconvection & Stellar Activity. The Space Stellar Photometry Mission COROT: Asteroseismology and Search ...

  15. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy. Corot team. Articles written in Journal of Astrophysics and Astronomy. Volume 21 Issue 3-4 September-December 2000 pp 319-322 Session VII – Magnetoconvection & Stellar Activity. The Space Stellar Photometry Mission COROT: Asteroseismology and Search for ...

  16. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy. Jordan Vannitsen. Articles written in Journal of Astrophysics and Astronomy. Volume 38 Issue 4 December 2017 pp 70 Research Article. A Satellite Data Analysis and CubeSat Instrument Simulator Tool for Simultaneous Multi-spacecraft Measurements of Solar ...

  17. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy. Ankit Kumar Pandey. Articles written in Journal of Astrophysics and Astronomy. Volume 38 Issue 1 March 2017 pp 7 Research Article. Benford's Distribution in Extrasolar World: Do the Exoplanets Follow Benford's Distribution? Abhishek Shukla Ankit Kumar Pandey ...

  18. Gamma-Rays from Galactic Compact Sources

    Science.gov (United States)

    Kaaret, Philip

    2007-04-01

    Recent discoveries have revealed many sources of TeV photons in our Mikly Way galaxy powered by compact objects, either neutron stars or black holes. These objects must be powerful particle accelerators, some with peak energies of at least 100 TeV, and may be neutrino, as well as photon, sources. Future TeV observations will enable us to address key questions concerning particle acceleration by compact objects including the fraction of energy which accreting black holes channel into relativstic jet production, whether the compact object jets are leptonic or hadronic, and the mechanism by which pulsar winds accelerate relativistic particles. We report on work done related to compact Galactic objects in preparation of a White Paper on the status and future of ground-based gamma-ray astronomy requested by the Division of Astrophysics of the American Physical Society.

  19. Trojan Horse Method: recent applications in nuclear astrophysics

    International Nuclear Information System (INIS)

    Spitaleri, C.; Cherubini, S.; La Cognata, M.; Lamia, L.; Mukhamedzhanov, A.; Pizzone, R.G.; Romano, S.; Sergi, M.L.; Tumino, A.

    2010-01-01

    The Trojan Horse Method (THM) is a powerful indirect technique to extract the bare nucleus cross section (or equivalently the bare nucleus astrophysical factor) for astrophysically relevant reactions. The theory has been discussed in many works in relation to the different types of reactions studied. Here we present the methodology to select the quasi free mechanism in order to extract this important parameter.

  20. Trojan Horse Method: recent applications in nuclear astrophysics

    Energy Technology Data Exchange (ETDEWEB)

    Spitaleri, C.; Cherubini, S.; La Cognata, M.; Lamia, L. [Istituto Nazionale di Fisica Nucleare - Laboratori Nazionali del Sud, Catania (Italy); Dipartimento di Metodologie Chimiche e Fisiche per l' Ingegneria, Universita di Catania (Italy); Mukhamedzhanov, A. [Cyclotron Institute, Texas A and M University, College Station, Texas (United States); Pizzone, R.G.; Romano, S.; Sergi, M.L. [Istituto Nazionale di Fisica Nucleare - Laboratori Nazionali del Sud, Catania (Italy); Dipartimento di Metodologie Chimiche e Fisiche per l' Ingegneria, Universita di Catania (Italy); Tumino, A. [Istituto Nazionale di Fisica Nucleare - Laboratori Nazionali del Sud, Catania (Italy); Universita degli Studi di Enna ' Kore' , Enna (Italy)

    2010-03-01

    The Trojan Horse Method (THM) is a powerful indirect technique to extract the bare nucleus cross section (or equivalently the bare nucleus astrophysical factor) for astrophysically relevant reactions. The theory has been discussed in many works in relation to the different types of reactions studied. Here we present the methodology to select the quasi free mechanism in order to extract this important parameter.