VHE and UHE gamma ray astronomy: transients and sources
International Nuclear Information System (INIS)
Fegan, D.J.
1987-01-01
The transient and sporadic nature of a number of Cosmic gamma ray sources is examined in relation to VHE (10 11 to 10 14 eV) observations of pulsars and X-ray binary systems. Transients are not all that common but when they occur they generally produce emission of sufficient intensity and duration to obtain statistically significant effects which are gradually helping to establish a source catalog. A brief review is also made of the staus of UHE (>10 14 eV) gamma ray astronomy
Discovery of the hard spectrum VHE γ-ray source HESS J1641-463
International Nuclear Information System (INIS)
Abramowski, A.; Ait Benkhali, F.
2014-10-01
This letter reports the discovery of a remarkably hard spectrum source, HESS J1641.463, by the High Energy Stereoscopic System (H.E.S.S.) in the very high energy (VHE) domain. HESS J1641.463 remained unnoticed by the usual analysis techniques due to confusion with the bright nearby source HESS J1640.465. It emerged at a significance level of 8.5 standard deviations after restricting the analysis to events with energies above 4 TeV. It shows a moderate flux level of φ (E>1 TeV)=(3.64 ± 0.44 stat ± 0.73 sys ) x 10 -13 cm -2 s -1 , corresponding to 1.8% of the Crab Nebula flux above the same energy, and a hard spectrum with a photon index of Γ=2.07±0.11 stat ±0.20 sys . It is a point-like source, although an extension up to a Gaussian width of σ=3 arcmin cannot be discounted due to uncertainties in the H.E.S.S. point-spread function. The VHE γ-ray flux of HESS J1641.463 is found to be constant over the observed period when checking time binnings from the year-by-year to the 28 minute exposure timescales. HESS J1641.463 is positionally coincident with the radio supernova remnant SNR G338.5+0.1. No X-ray candidate stands out as a clear association; however, Chandra and XMM-Newton data reveal some potential weak counterparts. Various VHE γ-ray production scenarios are discussed. If the emission from HESS J1641.463 is produced by cosmic ray protons colliding with the ambient gas, then their spectrum must extend close to 1 PeV. This object may represent a source population contributing significantly to the galactic cosmic ray flux around the knee.
DISCOVERY OF THE HARD SPECTRUM VHE γ-RAY SOURCE HESS J1641–463
Energy Technology Data Exchange (ETDEWEB)
Abramowski, A. [Institut für Experimentalphysik, Universität Hamburg, Luruper Chaussee 149, D-22761 Hamburg (Germany); Aharonian, F.; Ait Benkhali, F.; Bernlöhr, K. [Max-Planck-Institut für Kernphysik, PO Box 103980, D-69029 Heidelberg (Germany); Akhperjanian, A. G. [National Academy of Sciences of the Republic of Armenia, Marshall Baghramian Avenue, 24, 0019 Yerevan, Republic of Armenia (Armenia); Angüner, E. O.; Birsin, E. [Institut für Physik, Humboldt-Universität zu Berlin, Newtonstr. 15, D-12489 Berlin (Germany); Backes, M. [Department of Physics, University of Namibia, Private Bag 13301, Windhoek (Namibia); Balenderan, S. [Department of Physics, University of Durham, South Road, Durham DH1 3LE (United Kingdom); Balzer, A. [GRAPPA, Anton Pannekoek Institute for Astronomy, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Barnacka, A. [Obserwatorium Astronomiczne, Uniwersytet Jagielloński, ul. Orla 171, 30-244 Kraków (Poland); Becherini, Y. [Department of Physics and Electrical Engineering, Linnaeus University, 351 95 Växjö (Sweden); Becker Tjus, J. [Institut für Theoretische Physik, Lehrstuhl IV: Weltraum und Astrophysik, Ruhr-Universität Bochum, D-44780 Bochum (Germany); Berge, D. [GRAPPA, Anton Pannekoek Institute for Astronomy and Institute of High-Energy Physics, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Bernhard, S. [Institut für Astro- und Teilchenphysik, Leopold-Franzens-Universität Innsbruck, A-6020 Innsbruck (Austria); Biteau, J. [Laboratoire Leprince-Ringuet, Ecole Polytechnique, CNRS/IN2P3, F-91128 Palaiseau (France); Böttcher, M. [Centre for Space Research, North-West University, Potchefstroom 2520 (South Africa); Boisson, C., E-mail: sabrina.casanova@ifj.edu.pl, E-mail: sabrina.casanova@mpi-hd.mpg.de [LUTH, Observatoire de Paris, CNRS, Université Paris Diderot, 5 Place Jules Janssen, F-92190 Meudon (France); Collaboration: H.E.S.S. Collaboration; and others
2014-10-10
This Letter reports the discovery of a remarkably hard spectrum source, HESS J1641–463, by the High Energy Stereoscopic System (H.E.S.S.) in the very high energy (VHE) domain. HESS J1641–463 remained unnoticed by the usual analysis techniques due to confusion with the bright nearby source HESS J1640–465. It emerged at a significance level of 8.5 standard deviations after restricting the analysis to events with energies above 4 TeV. It shows a moderate flux level of φ(E>1 TeV) = (3.64 ± 0.44{sub stat} ± 0.73{sub sys}) × 10{sup –13} cm{sup –2} s{sup –1}, corresponding to 1.8% of the Crab Nebula flux above the same energy, and a hard spectrum with a photon index of Γ = 2.07 ± 0.11{sub stat} ± 0.20{sub sys}. It is a point-like source, although an extension up to a Gaussian width of σ = 3 arcmin cannot be discounted due to uncertainties in the H.E.S.S. point-spread function. The VHE γ-ray flux of HESS J1641–463 is found to be constant over the observed period when checking time binnings from the year-by-year to the 28 minute exposure timescales. HESS J1641–463 is positionally coincident with the radio supernova remnant SNR G338.5+0.1. No X-ray candidate stands out as a clear association; however, Chandra and XMM-Newton data reveal some potential weak counterparts. Various VHE γ-ray production scenarios are discussed. If the emission from HESS J1641–463 is produced by cosmic ray protons colliding with the ambient gas, then their spectrum must extend close to 1 PeV. This object may represent a source population contributing significantly to the galactic cosmic ray flux around the knee.
Extended VHE γ-ray emission towards SGR1806-20, LBV 1806-20, and stellar cluster Cl* 1806-20
H.E.S.S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Akhperjanian, A. G.; Angüner, E. O.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Birsin, E.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Bulik, T.; Capasso, M.; Carr, J.; Casanova, S.; Chakraborty, N.; Chalme-Calvet, R.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Chrétien, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Couturier, C.; Cui, Y.; Davids, I. D.; Degrange, B.; Deil, C.; deWilt, P.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dubus, G.; Dutson, K.; Dyks, J.; Dyrda, M.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gajdus, M.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Grudzińska, M.; Hadasch, D.; Hahn, J.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hervet, O.; Hillert, A.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holler, M.; Horns, D.; Ivascenko, A.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jogler, T.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katz, U.; Kerszberg, D.; Khélifi, B.; Kieffer, M.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krayzel, F.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; Lypova, I.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Menzler, U.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Morå, K.; Moulin, E.; Murach, T.; de Naurois, M.; Niederwanger, F.; Niemiec, J.; Oakes, L.; Odaka, H.; Öttl, S.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Paz Arribas, M.; Pekeur, N. W.; Pelletier, G.; Petrucci, P.-O.; Peyaud, B.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Reimer, A.; Reimer, O.; Renaud, M.; de Reyes, R.; Rieger, F.; Romoli, C.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Stycz, K.; Sushch, I.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tluczykont, M.; Trichard, C.; Tuffs, R.; van der Walt, J.; van Eldik, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zabalza, V.; Zaborov, D.; Zacharias, M.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Żywucka, N.
2018-04-01
Using the High Energy Spectroscopic System (H.E.S.S.) telescopes we have discovered a steady and extended very high-energy (VHE) γ-ray source towards the luminous blue variable candidate LBV 1806-20, massive stellar cluster Cl* 1806-20, and magnetar SGR 1806-20. The new VHE source, HESS J1808-204, was detected at a statistical significance of >6σ (post-trial) with a photon flux normalisation (2.9 ± 0.4stat ± 0.5sys) × 10-13 ph cm-2 s-1 TeV-1 at 1 TeV and a power-law photon index of 2.3 ± 0.2stat ± 0.3sys. The luminosity of this source (0.2 to 10 TeV; scaled to distance d = 8.7 kpc) is LVHE 1.6 × 1034(d/8.7 kpc)2 erg s-1. The VHE γ-ray emission is extended and is well fit by a single Gaussian with statistical standard deviation of 0.095° ± 0.015°. This extension is similar to that of the synchrotron radio nebula G10.0-0.3, which is thought to be powered by LBV 1806-20. The VHE γ-ray luminosity could be provided by the stellar wind luminosity of LBV 1806-20 by itself and/or the massive star members of Cl* 1806-20. Alternatively, magnetic dissipation (e.g. via reconnection) from SGR 1806-20 can potentially account for the VHE luminosity. The origin and hadronic and/or leptonic nature of the accelerated particles responsible for HESS J1808-204 is not yet clear. If associated with SGR 1806-20, the potentially young age of the magnetar (650 yr) can be used to infer the transport limits of these particles to match the VHE source size. This discovery provides new interest in the potential for high-energy particle acceleration from magnetars, massive stars, and/or stellar clusters.
Early warning for VHE gamma-ray flares with the ARGO-YBJ detector
Energy Technology Data Exchange (ETDEWEB)
Bartoli, B. [Dipartimento di Fisica dell' Universita di Napoli ' Federico II' , Complesso Universitario di Monte Sant' Angelo, via Cinthia, 80126 Napoli (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Napoli, Complesso Universitario di Monte Sant' Angelo, via Cinthia, 80126 Napoli (Italy); Bernardini, P. [Dipartimento di Fisica dell' Universita del Salento, via per Arnesano, 73100 Lecce (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Lecce, via per Arnesano, 73100 Lecce (Italy); Bi, X.J. [Key Laboratory of Particle Astrophysics, Institute of High Energy Physics, Chinese Academy of Sciences, P.O. Box 918, 100049 Beijing (China); Bleve, C. [Dipartimento di Fisica dell' Universita del Salento, via per Arnesano, 73100 Lecce (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Lecce, via per Arnesano, 73100 Lecce (Italy); Bolognino, I. [Dipartimento di Fisica Nucleare e Teorica dell' Universita di Pavia, via Bassi 6, 27100 Pavia (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Pavia, via Bassi 6, 27100 Pavia (Italy); Branchini, P.; Budano, A. [Istituto Nazionale di Fisica Nucleare, Sezione di Roma Tre, via della Vasca Navale 84, 00146 Roma (Italy); Calabrese Melcarne, A.K. [Istituto Nazionale di Fisica Nucleare - CNAF, Viale Berti-Pichat 6/2, 40127 Bologna (Italy); Camarri, P. [Dipartimento di Fisica dell' Universita di Roma ' Tor Vergata' , via della Ricerca Scientifica 1, 00133 Roma (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Roma Tor Vergata, via della Ricerca Scientifica 1, 00133 Roma (Italy); Cao, Z. [Key Laboratory of Particle Astrophysics, Institute of High Energy Physics, Chinese Academy of Sciences, P.O. Box 918, 100049 Beijing (China); and others
2011-12-11
Detecting and monitoring emissions from flaring gamma-ray sources in the very-high-energy (VHE, > 100 GeV) band is a very important topic in gamma-ray astronomy. The ARGO-YBJ detector is characterized by a high duty cycle and a wide field of view. Therefore, it is particularly capable of detecting flares from extragalactic objects. Based on fast reconstruction and analysis, real-time monitoring of 33 selected VHE extragalactic sources is implemented. Flares exceeding a specific threshold are reported timely, hence enabling the follow-up observation of these objects using more sensitive detectors, such as Cherenkov telescopes.
Detection of VHE gamma-ray emission from the vicinity of PSR B1706-44 with H.E.S.S.
Energy Technology Data Exchange (ETDEWEB)
Chaves, Ryan C.G.; Ona Wilhelmi, Emma de [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Terrier, Regis [APC, CNRS, Univ. Paris-7 (France); Stegmann, Christian [Universitaet Erlangen-Nuernberg, Erlangen (Germany). Physikalisches Institut; Khelifi, Bruno [LLR, Ecole Polytechnique, CNRS/IN2P3, Palaiseau (France); Jager, Okkie C. de [Unit for Space Physics, North-West Univ., Potchefstroom (South Africa)
2010-07-01
The gamma-ray pulsar PSR B1706-44 and the adjacent supernova remnant (SNR) candidate G343.1-2.3 were observed by H.E.S.S. during a dedicated observational campaign in 2007. A new source of very-high-energy (VHE;E>100 GeV) gamma-ray emission, HESS J1708-443, was discovered with its centroid at RA(J2000.0)=17 h 8 m 10 s and Dec (J2000.0)=-44 d 21{sup '} ({+-}3{sup '} statistical error on each axis). The VHE gamma-ray source is significantly more extended than the H.E.S.S. point-spread function and has an intrinsic Gaussian width of 0.29 {+-}0.04 . Its energy spectrum can be described by a power law with a photon index=2.0{+-}0.1 (stat){+-}0.2 (syst). The integral flux measured between 1 and 10 TeV is {proportional_to}17% of the Crab Nebula flux in the same energy range. The possible associations with the energetic PSR B1706-44, also recently detected in the GeV domain with Fermi/LAT and AGILE, and SNR G343.1-2.3 are discussed.
Detection of variable VHE γ-ray emission from the extra-galactic γ-ray binary LMC P3
HESS Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Angüner, E. O.; Arakawa, M.; Armand, C.; Arrieta, M.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bonnefoy, S.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Büchele, M.; Bulik, T.; Capasso, M.; Caroff, S.; Carosi, A.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Colafrancesco, S.; Condon, B.; Conrad, J.; Davids, I. D.; Decock, J.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Donath, A.; Drury, L. O.'C.; Dyks, J.; Edwards, T.; Egberts, K.; Emery, G.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Funk, S.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Garrigoux, T.; Gaté, F.; Giavitto, G.; Glawion, D.; Glicenstein, J. F.; Gottschall, D.; Grondin, M.-H.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holch, T. L.; Holler, M.; Horns, D.; Ivascenko, A.; Iwasaki, H.; Jacholkowska, A.; Jamrozy, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katsuragawa, M.; Katz, U.; Kerszberg, D.; Khangulyan, D.; Khélifi, B.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lefaucheur, J.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Malyshev, D.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Nakashima, S.; de Naurois, M.; Ndiyavala, H.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poireau, V.; Prokhorov, D. A.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Rauth, R.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Rieger, F.; Rinchiuso, L.; Romoli, C.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Saito, S.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seglar-Arroyo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Shiningayamwe, K.; Simoni, R.; Sol, H.; Spanier, F.; Spir-Jacob, M.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Steppa, C.; Sushch, I.; Takahashi, T.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tsirou, M.; Tsuji, N.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Zorn, J.; Żywucka, N.
2018-03-01
Context. Recently, the high-energy (HE, 0.1-100 GeV) γ-ray emission from the object LMC P3 in the Large Magellanic Cloud (LMC) has been discovered to be modulated with a 10.3-day period, making it the first extra-galactic γ-ray binary. Aim. This work aims at the detection of very-high-energy (VHE, >100 GeV) γ-ray emission and the search for modulation of the VHE signal with the orbital period of the binary system. Methods: LMC P3 has been observed with the High Energy Stereoscopic System (H.E.S.S.); the acceptance-corrected exposure time is 100 h. The data set has been folded with the known orbital period of the system in order to test for variability of the emission. Results: VHE γ-ray emission is detected with a statistical significance of 6.4 σ. The data clearly show variability which is phase-locked to the orbital period of the system. Periodicity cannot be deduced from the H.E.S.S. data set alone. The orbit-averaged luminosity in the 1-10 TeV energy range is (1.4 ± 0.2) × 1035 erg s-1. A luminosity of (5 ± 1) × 1035 erg s-1 is reached during 20% of the orbit. HE and VHE γ-ray emissions are anti-correlated. LMC P3 is the most luminous γ-ray binary known so far.
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHE867 (Link to dictyBase) - G02701 DDB0204977 Contig-U14789-1... - (Link to Original site) VHE867F 383 - - - - - - Show VHE867 Library VH (Link to library) Clone ID VHE867 (Link to dict...yBase) Atlas ID - NBRP ID G02701 dictyBase ID DDB0204977 Link to Contig Contig-U14789-1 Original site URL http://dict...one) Salmo salar clone ssal-rgb2-599-16... 116 2e-25 DQ363469_1( DQ363469 |pid:none) Ict...m_ : 1.00 40.0 %: cytoplasmic 36.0 %: nuclear 12.0 %: cytoskeletal 8.0 %: mitochondrial 4.0 %: peroxisomal >> predict
Discovery of a point-like very-high-energy gamma-ray source in Monoceros
International Nuclear Information System (INIS)
Aharonian, F.A.; Benbow, W.; Berge, D.; Bernlohr, K.; Bolz, O.; Braun, I.; Buhler, R.; Carrigan, S.; Costamante, L.; Domainko, W.; Egberts, K.; Forster, A.; Funk, S.; Hauser, D.; Hermann, G.; Hinton, J.A.; Hofmann, W.; Hoppe, S.; Khelifi, B.; Kosack, K.; Masterson, C.; Panter, M.; Rowell, G.; van Eldik, C.; Volk, H.J.; Akhperjanian, A.G.; Sahakian, V.; Bazer-Bachi, A.R.; Borrel, V.; Marcowith, A.; Olive, J.P.; Beilicke, M.; Cornils, R.; Heinzelmann, G.; Raue, M.; Ripken, J.; Bernlohr, K.; Funk, Seb.; Fussling, M.; Kerschhaggl, M.; Lohse, T.; Schlenker, S.; Schwanke, U.; Boisson, C.; Martin, J.M.; Sol, H.; Brion, E.; Glicenstein, J.F.; Goret, P.; Moulin, E.; Rolland, L.
2007-01-01
Aims. The complex Monoceros Loop SNR/Rosette Nebula region contains several potential sources of very-high-energy (VHE) γ-ray emission and two as yet unidentified high-energy EGRET sources. Sensitive VHE observations are required to probe acceleration processes in this region. Methods. The HESS telescope array has been used to search for very high-energy gamma-ray sources in this region. CO data from the NANTEN telescope were used to map the molecular clouds in the region, which could act as target material for γ-ray production via hadronic interactions. Results. We announce the discovery of a new γ-ray source, HESS J0632+057, located close to the rim of the Monoceros SNR. This source is unresolved by HESS and has no clear counterpart at other wavelengths but is possibly associated with the weak X-ray source 1RXS J063258.3+054857, the Be-star MWC148 and/or the lower energy γ-ray source 3EGJ0634+0521. No evidence for an associated molecular cloud was found in the CO data. (authors)
International Nuclear Information System (INIS)
Sushch, Iurii
2012-01-01
Recently, imaging atmospheric Cherenkov telescopes (IACTs) have discovered numerous new sources representing various source classes in the very high energy (VHE; E>100 GeV) sky. This work presents studies of representatives of three types of Galactic VHE emitters: the Supernova remnants (SNRs) G1.9+0.3 and G330.2+1.0, the pulsar wind nebula (PWN) HESS J1303.631 and the binary system PSR B1259.63/LS 2883. The analysis of the H.E.S.S. data and the broadband emission modeling are presented. G1.9+0.3 and G330.2+1.0 are synchrotron-dominated SNRs whose non-thermal X-ray emission implies that intensive particle acceleration occurs at their shock fronts. This makes them promising candidates for the detection at VHEs. They were observed by the High Energy Stereoscopic System (H.E.S.S.) yielding no signs of significant VHE γ-ray emission from either SNR. The 99% confidence level upper limits on the TeV flux were determined. For an assumed spectral index of 2.5 the obtained upper limits are F G1.9 (>260 GeV) -13 cm -2 s -1 for G1.9+0.3 and F G330 (>380 GeV) -12 cm -2 s -1 for G330.2+1.0. Upper limits on the VHE emission provide constraints on the interior magnetic field in the context of a leptonic scenario and on the interstellar medium (ISM) density and cosmic-ray (CR) efficiency in a hadronic scenario. Lower limits on the interior magnetic fields were estimated at 15 μG for G1.9+0.3 and 14 μG for G330.2+1.0. In the case of the hadronic scenario, the H.E.S.S. upper limits are two orders of magnitude greater than the flux prediction. Obtained upper limits on the ISM densities are compatible with other estimates of the densities (from the thermal X-ray emission for G330.2+1.0 and from the expansion rate for G1.9+0.3). The CR efficiency cannot be constrained with the current H.E.S.S. upper limits. HESS J1303-631 is an initially unidentified H.E.S.S. source which was recently identified as a PWN associated with the pulsar PSR J1301-6305. The broadband emission of the source
Energy Technology Data Exchange (ETDEWEB)
Sushch, Iurii
2012-10-19
Recently, imaging atmospheric Cherenkov telescopes (IACTs) have discovered numerous new sources representing various source classes in the very high energy (VHE; E>100 GeV) sky. This work presents studies of representatives of three types of Galactic VHE emitters: the Supernova remnants (SNRs) G1.9+0.3 and G330.2+1.0, the pulsar wind nebula (PWN) HESS J1303.631 and the binary system PSR B1259.63/LS 2883. The analysis of the H.E.S.S. data and the broadband emission modeling are presented. G1.9+0.3 and G330.2+1.0 are synchrotron-dominated SNRs whose non-thermal X-ray emission implies that intensive particle acceleration occurs at their shock fronts. This makes them promising candidates for the detection at VHEs. They were observed by the High Energy Stereoscopic System (H.E.S.S.) yielding no signs of significant VHE {gamma}-ray emission from either SNR. The 99% confidence level upper limits on the TeV flux were determined. For an assumed spectral index of 2.5 the obtained upper limits are F{sub G1.9}(>260 GeV)<4.6 x 10{sup -13} cm{sup -2}s{sup -1} for G1.9+0.3 and F{sub G330}(>380 GeV)<1.6 x 10{sup -12} cm{sup -2}s{sup -1} for G330.2+1.0. Upper limits on the VHE emission provide constraints on the interior magnetic field in the context of a leptonic scenario and on the interstellar medium (ISM) density and cosmic-ray (CR) efficiency in a hadronic scenario. Lower limits on the interior magnetic fields were estimated at 15 {mu}G for G1.9+0.3 and 14 {mu}G for G330.2+1.0. In the case of the hadronic scenario, the H.E.S.S. upper limits are two orders of magnitude greater than the flux prediction. Obtained upper limits on the ISM densities are compatible with other estimates of the densities (from the thermal X-ray emission for G330.2+1.0 and from the expansion rate for G1.9+0.3). The CR efficiency cannot be constrained with the current H.E.S.S. upper limits. HESS J1303-631 is an initially unidentified H.E.S.S. source which was recently identified as a PWN associated with
International Nuclear Information System (INIS)
Fuessling, Matthias
2012-01-01
This work reports on the search for pulsed and steady very-high energy (VHE) gamma-ray emission in the energy range extending from 100 GeV up to 100 TeV from the direction of three pulsars with the High Energy Stereoscopic System (H.E.S.S.). Pulsed gamma-ray radiation from pulsars with energies beyond 100 GeV was found thus far only for the young and energetic Crab pulsar. A special class of pulsar wind nebulae (PWNe) is associated with composite supernova remnants (SNRs) where the PWN is centered in an expanding SNR shell. In the first part of this thesis, the results on the search for pulsed and steady VHE gamma-ray emission from the two millisecond pulsars, PSR J0437-4715 and PSR J1824-2452, are presented. Parts of the observations were conducted in a special trigger setup (the topological trigger with convergent pointing) to reduce the energy threshold of the instrument. No signal of pulsed or steady emission is found and upper limits on the pulsed and steady gamma-ray flux are derived. The upper limits on the pulsed gamma-ray flux are compared to existing model predictions and, in the case of PSR J1824-2452, allow the range of possible viewing geometries in some models to be constrained. In the second part of this work, results on the search for pulsed and steady VHE gamma-ray emission from the direction of the composite SNR Kes 75 are presented. The PWN in the center of Kes 75 is powered by a very young and powerful pulsar, PSR J1846-0258, that has an exceptionally high magnetic field. While no hint for pulsed emission is found, steady VHE gamma-ray emission is detected with a statistical significance of 10 sigma from a point-like source. The VHE gamma-ray emission is spatially coincident with the PWN and the SNR shell. Both are discussed as a possible origin for the observed emission. The pulsar of Kes 75 would be the youngest pulsar known to date to power a VHE PWN.
Very high-energy gamma rays from gamma-ray bursts.
Chadwick, Paula M
2007-05-15
Very high-energy (VHE) gamma-ray astronomy has undergone a transformation in the last few years, with telescopes of unprecedented sensitivity having greatly expanded the source catalogue. Such progress makes the detection of a gamma-ray burst at the highest energies much more likely than previously. This paper describes the facilities currently operating and their chances for detecting gamma-ray bursts, and reviews predictions for VHE gamma-ray emission from gamma-ray bursts. Results to date are summarized.
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHE138 (Link to dictyBase) - - - Contig-U15767-1 VHE138P (Link... to Original site) VHE138F 569 VHE138Z 621 VHE138P 1170 - - Show VHE138 Library VH (Link to library) Clone ID VHE138 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...FVDNQAGDSXSAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQGF NDVSYP--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICT...rsi*i**fkllpn*rtrf q*ckls--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTPVDCG ANDEDKCKTWSCDPTKGG
Observations of VHE γ-Ray Sources with the MAGIC Telescope
Bartko, H.
2008-10-01
The MAGIC telescope with its 17m diameter mirror is today the largest operating single-dish Imaging Air Cherenkov Telescope (IACT). It is located on the Canary Island La Palma, at an altitude of 2200m above sea level, as part of the Roque de los Muchachos European Northern Observatory. The MAGIC telescope detects celestial very high energy γ-radiation in the energy band between about 50 GeV and 10 TeV. Since Autumn of 2004 MAGIC has been taking data routinely, observing various objects like supernova remnants (SNRs), γ-ray binaries, Pulsars, Active Galactic Nuclei (AGN) and Gamma-ray Bursts (GRB). We briefly describe the observational strategy, the procedure implemented for the data analysis, and discuss the results for individual sources. An outlook to the construction of the second MAGIC telescope is given.
VHE Gamma-ray Supernova Remnants
Energy Technology Data Exchange (ETDEWEB)
Funk, Stefan; /KIPAC, Menlo Park
2007-01-22
Increasing observational evidence gathered especially in X-rays and {gamma}-rays during the course of the last few years support the notion that Supernova remnants (SNRs) are Galactic particle accelerators up to energies close to the ''knee'' in the energy spectrum of Cosmic rays. This review summarizes the current status of {gamma}-ray observations of SNRs. Shell-type as well as plerionic type SNRs are addressed and prospect for observations of these two source classes with the upcoming GLAST satellite in the energy regime above 100 MeV are given.
Characterising the VHE diffuse emission in the central 200 parsecs of our Galaxy with H.E.S.S.
H.E.S.S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Akhperjanian, A. G.; Andersson, T.; Angüner, E. O.; Arakawa, M.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bonnefoy, S.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Büchele, M.; Bulik, T.; Capasso, M.; Carr, J.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Coffaro, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Cui, Y.; Davids, I. D.; Decock, J.; Degrange, B.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dutson, K.; Dyks, J.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holch, T. L.; Holler, M.; Horns, D.; Ivascenko, A.; Iwasaki, H.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jogler, T.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katsuragawa, M.; Katz, U.; Kerszberg, D.; Khangulyan, D.; Khélifi, B.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Nakashima, S.; de Naurois, M.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Rauth, R.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Richter, S.; Rieger, F.; Romoli, C.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Saito, S.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seglar-Arroyo, M.; Settimo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stycz, K.; Sushch, I.; Takahashi, T.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tsuji, N.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Żywucka, N.
2018-04-01
entire CMZ. Finally, we report the discovery of a VHE γ-ray source near the GC radio arc and argue that it is produced by the pulsar wind nebula candidate G0.13-0.11.
TeV γ-ray observations of the young synchrotron-dominated SNRs G1.9+0.3 and G330.2+1.0 with H.E.S.S.
H.E.S.S. Collaboration; Abramowski, A.; Aharonian, F.; Benkhali, F. Ait; Akhperjanian, A. G.; Angüner, E.; Anton, G.; Balenderan, S.; Balzer, A.; Barnacka, A.; Becherini, Y.; Becker Tjus, J.; Bernlöhr, K.; Birsin, E.; Bissaldi, E.; Biteau, J.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bordas, P.; Brucker, J.; Brun, F.; Brun, P.; Bulik, T.; Carrigan, S.; Casanova, S.; Cerruti, M.; Chadwick, P. M.; Chalme-Calvet, R.; Chaves, R. C. G.; Cheesebrough, A.; Chrétien, M.; Colafrancesco, S.; Cologna, G.; Conrad, J.; Couturier, C.; Cui, Y.; Dalton, M.; Daniel, M. K.; Davids, I. D.; Degrange, B.; Deil, C.; deWilt, P.; Dickinson, H. J.; Djannati-Ataï, A.; Domainko, W.; O'C. Drury, L.; Dubus, G.; Dutson, K.; Dyks, J.; Dyrda, M.; Edwards, T.; Egberts, K.; Eger, P.; Espigat, P.; Farnier, C.; Fegan, S.; Feinstein, F.; Fernandes, M. V.; Fernandez, D.; Fiasson, A.; Fontaine, G.; Förster, A.; Füßling, M.; Gajdus, M.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Grondin, M.-H.; Grudzińska, M.; Häffner, S.; Hahn, J.; Harris, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hervet, O.; Hillert, A.; Hinton, J. A.; Hofmann, W.; Hofverberg, P.; Holler, M.; Horns, D.; Jacholkowska, A.; Jahn, C.; Jamrozy, M.; Janiak, M.; Jankowsky, F.; Jung, I.; Kastendieck, M. A.; Katarzyński, K.; Katz, U.; Kaufmann, S.; Khélifi, B.; Kieffer, M.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kneiske, T.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Krayzel, F.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lefaucheur, J.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Lennarz, D.; Lohse, T.; Lopatin, A.; Lu, C.-C.; Marandon, V.; Marcowith, A.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; McComb, T. J. L.; Méhault, J.; Meintjes, P. J.; Menzler, U.; Meyer, M.; Moderski, R.; Mohamed, M.; Moulin, E.; Murach, T.; Naumann, C. L.; de Naurois, M.; Niemiec, J.; Nolan, S. J.; Oakes, L.; Ohm, S.; Wilhelmi, E. de Oña; Opitz, B.; Ostrowski, M.; Oya, I.; Panter, M.; Parsons, R. D.; Arribas, M. Paz; Pekeur, N. W.; Pelletier, G.; Perez, J.; Petrucci, P.-O.; Peyaud, B.; Pita, S.; Poon, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Raue, M.; Reimer, A.; Reimer, O.; Renaud, M.; Reyes, R. de los; Rieger, F.; Rob, L.; Romoli, C.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Sanchez, D. A.; Santangelo, A.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwarzburg, S.; Schwemmer, S.; Sol, H.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Stycz, K.; Sushch, I.; Szostek, A.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tluczykont, M.; Trichard, C.; Valerius, K.; van Eldik, C.; van Soelen, B.; Vasileiadis, G.; Venter, C.; Viana, A.; Vincent, P.; Völk, H. J.; Volpe, F.; Vorster, M.; Vuillaume, T.; Wagner, S. J.; Wagner, P.; Ward, M.; Weidinger, M.; Weitzel, Q.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Zabalza, V.; Zacharias, M.; Zajczyk, A.; Zdziarski, A. A.; Zech, A.; Zechlin, H.-S.
2014-06-01
The non-thermal nature of the X-ray emission from the shell-type supernova remnants (SNRs) G1.9+0.3 and G330.2+1.0 is an indication of intense particle acceleration in the shock fronts of both objects. This suggests that the SNRs are prime candidates for very-high-energy (VHE; E > 0.1 TeV) γ-ray observations. G1.9+0.3, recently established as the youngest known SNR in the Galaxy, also offers a unique opportunity to study the earliest stages of SNR evolution in the VHE domain. The purpose of this work is to probe the level of VHE γ-ray emission from both SNRs and use this to constrain their physical properties. Observations were conducted with the H.E.S.S. (High Energy Stereoscopic System) Cherenkov Telescope Array over a more than six-year period spanning 2004-2010. The obtained data have effective livetimes of 67 h for G1.9+0.3 and 16 h for G330.2+1.0. The data are analysed in the context of the multiwavelength observations currently available and in the framework of both leptonic and hadronic particle acceleration scenarios. No significant γ-ray signal from G1.9+0.3 or G330.2+1.0 was detected. Upper limits (99 per cent confidence level) to the TeV flux from G1.9+0.3 and G330.2+1.0 for the assumed spectral index Γ = 2.5 were set at 5.6 × 10-13 cm-2 s-1 above 0.26 TeV and 3.2 × 10-12 cm-2 s-1 above 0.38 TeV, respectively. In a one-zone leptonic scenario, these upper limits imply lower limits on the interior magnetic field to BG1.9 ≳ 12 μG for G1.9+0.3 and to BG330 ≳ 8 μG for G330.2+1.0. In a hadronic scenario, the low ambient densities and the large distances to the SNRs result in very low predicted fluxes, for which the H.E.S.S. upper limits are not constraining.
Energy Technology Data Exchange (ETDEWEB)
Fernandes, Milton Virgilio
2014-09-15
In this thesis, high-energy (HE; E>0.1 GeV) and very-high-energy (VHE; E>0.1 TeV) γ-ray data were investigated to probe Galactic stellar clusters (SCs) and star-forming regions (SFRs) as sites of hadronic Galactic cosmic-ray (GCR) acceleration. In principle, massive SCs and SFRs could accelerate GCRs at the shock front of the collective SC wind fed by the individual high-mass stars. The subsequently produced VHE γ rays would be measured with imaging air-Cherenkov telescopes (IACTs). A couple of the Galactic VHE γ-ray sources, including those potentially produced by SCs, fill a large fraction of the field-of-view (FoV) and require additional observations of source-free regions to determine the dominant background for a spectral reconstruction. A new method of reconstructing spectra for such extended sources without the need of further observations is developed: the Template Background Spectrum (TBS). This methods is based on a method to generate skymaps, which determines background in parameter space. The idea is the creation of a look-up of the background normalisation in energy, zenith angle, and angular separation and to account for possible systematics. The results obtained with TBS and state-of-the-art background-estimation methods on H.E.S.S. data are in good agreement. With TBS even those sources could be reconstructed that normally would need further observations. Therefore, TBS is the third method to reconstruct VHE γ-ray spectra, but the first one to not need additional observations in the analysis of extended sources. The discovery of the largest VHE γ-ray source HESSJ1646-458 (2.2 in size) towards the SC Westerlund 1 (Wd1) can be plausibly explained by the SC-wind scenario. But owing to its size, other alternative counterparts to the TeV emission (pulsar, binary system, magnetar) were found in the FoV. Therefore, an association of HESSJ1646-458 with the SC is favoured, but cannot be confirmed. The SC Pismis 22 is located in the centre of the
International Nuclear Information System (INIS)
Fernandes, Milton Virgilio
2014-09-01
In this thesis, high-energy (HE; E>0.1 GeV) and very-high-energy (VHE; E>0.1 TeV) γ-ray data were investigated to probe Galactic stellar clusters (SCs) and star-forming regions (SFRs) as sites of hadronic Galactic cosmic-ray (GCR) acceleration. In principle, massive SCs and SFRs could accelerate GCRs at the shock front of the collective SC wind fed by the individual high-mass stars. The subsequently produced VHE γ rays would be measured with imaging air-Cherenkov telescopes (IACTs). A couple of the Galactic VHE γ-ray sources, including those potentially produced by SCs, fill a large fraction of the field-of-view (FoV) and require additional observations of source-free regions to determine the dominant background for a spectral reconstruction. A new method of reconstructing spectra for such extended sources without the need of further observations is developed: the Template Background Spectrum (TBS). This methods is based on a method to generate skymaps, which determines background in parameter space. The idea is the creation of a look-up of the background normalisation in energy, zenith angle, and angular separation and to account for possible systematics. The results obtained with TBS and state-of-the-art background-estimation methods on H.E.S.S. data are in good agreement. With TBS even those sources could be reconstructed that normally would need further observations. Therefore, TBS is the third method to reconstruct VHE γ-ray spectra, but the first one to not need additional observations in the analysis of extended sources. The discovery of the largest VHE γ-ray source HESSJ1646-458 (2.2 in size) towards the SC Westerlund 1 (Wd1) can be plausibly explained by the SC-wind scenario. But owing to its size, other alternative counterparts to the TeV emission (pulsar, binary system, magnetar) were found in the FoV. Therefore, an association of HESSJ1646-458 with the SC is favoured, but cannot be confirmed. The SC Pismis 22 is located in the centre of the
H.E.S.S. Collaboration; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Barres de Almeida, U.; Bazer-Bachi, A. R.; Becherini, Y.; Behera, B.; Benbow, W.; Bernlöhr, K.; Bochow, A.; Boisson, C.; Bolmont, J.; Borrel, V.; Brucker, J.; Brun, F.; Brun, P.; Bühler, R.; Bulik, T.; Büsching, I.; Boutelier, T.; Chadwick, P. M.; Charbonnier, A.; Chaves, R. C. G.; Cheesebrough, A.; Chounet, L.-M.; Clapson, A. C.; Coignet, G.; Costamante, L.; Dalton, M.; Daniel, M. K.; Davids, I. D.; Degrange, B.; Deil, C.; Dickinson, H. J.; Djannati-Ataï, A.; Domainko, W.; O'C. Drury, L.; Dubois, F.; Dubus, G.; Dyks, J.; Dyrda, M.; Egberts, K.; Eger, P.; Espigat, P.; Fallon, L.; Farnier, C.; Fegan, S.; Feinstein, F.; Fiasson, A.; Förster, A.; Fontaine, G.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Gérard, L.; Gerbig, D.; Giebels, B.; Glicenstein, J. F.; Glück, B.; Goret, P.; Göring, D.; Hauser, M.; Heinz, S.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hoffmann, A.; Hofmann, W.; Hofverberg, P.; Holleran, M.; Hoppe, S.; Horns, D.; Jacholkowska, A.; de Jager, O. C.; Jahn, C.; Jung, I.; Katarzyński, K.; Katz, U.; Kaufmann, S.; Kerschhaggl, M.; Khangulyan, D.; Khélifi, B.; Keogh, D.; Klochkov, D.; Kluźniak, W.; Kneiske, T.; Komin, Nu.; Kosack, K.; Kossakowski, R.; Lamanna, G.; Lenain, J.-P.; Lohse, T.; Marandon, V.; Martineau-Huynh, O.; Marcowith, A.; Masbou, J.; Maurin, D.; McComb, T. J. L.; Medina, M. C.; Méhault, J.; Moderski, R.; Moulin, E.; Naumann-Godo, M.; de Naurois, M.; Nedbal, D.; Nekrassov, D.; Nicholas, B.; Niemiec, J.; Nolan, S. J.; Ohm, S.; Olive, J.-F.; de Oña Wilhelmi, E.; Orford, K. J.; Ostrowski, M.; Panter, M.; Paz Arribas, M.; Pedaletti, G.; Pelletier, G.; Petrucci, P.-O.; Pita, S.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raubenheimer, B. C.; Raue, M.; Rayner, S. M.; Renaud, M.; Rieger, F.; Ripken, J.; Rob, L.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Ruppel, J.; Sahakian, V.; Santangelo, A.; Schlickeiser, R.; Schöck, F. M.; Schwanke, U.; Schwarzburg, S.; Schwemmer, S.; Shalchi, A.; Sikora, M.; Skilton, J. L.; Sol, H.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Superina, G.; Szostek, A.; Tam, P. H.; Tavernet, J.-P.; Terrier, R.; Tibolla, O.; Tluczykont, M.; van Eldik, C.; Vasileiadis, G.; Venter, C.; Venter, L.; Vialle, J. P.; Vincent, P.; Vivier, M.; Völk, H. J.; Volpe, F.; Wagner, S. J.; Ward, M.; Zdziarski, A. A.; Zech, A.
2010-02-01
Aims: Our aim is to study the very high energy (VHE; E>100 GeV) γ-ray emission from BL Lac objects and the evolution in time of their broad-band spectral energy distribution (SED). Methods: VHE observations of the high-frequency peaked BL Lac object PKS 2005-489 were made with the High Energy Stereoscopic System (HESS) from 2004 through 2007. Three simultaneous multi-wavelength campaigns at lower energies were performed during the HESS data taking, consisting of several individual pointings with the XMM-Newton and RXTE satellites. Results: A strong VHE signal, ~17σ total, from PKS 2005-489 was detected during the four years of HESS observations (90.3 h live time). The integral flux above the average analysis threshold of 400 GeV is ~3% of the flux observed from the Crab Nebula and varies weakly on time scales from days to years. The average VHE spectrum measured from ~300 GeV to ~5 TeV is characterized by a power law with a photon index, Γ = 3.20± 0.16_stat± 0.10_syst. At X-ray energies the flux is observed to vary by more than an order of magnitude between 2004 and 2005. Strong changes in the X-ray spectrum (ΔΓX ≈ 0.7) are also observed, which appear to be mirrored in the VHE band. Conclusions: The SED of PKS 2005-489, constructed for the first time with contemporaneous data on both humps, shows significant evolution. The large flux variations in the X-ray band, coupled with weak or no variations in the VHE band and a similar spectral behavior, suggest the emergence of a new, separate, harder emission component in September 2005. Supported by CAPES Foundation, Ministry of Education of Brazil.Now at Harvard-Smithsonian Center for Astrophysics, Cambridge, USA.Now at W.W. Hansen Experimental Physics Laboratory & Kavli Institute for Particle Astrophysics and Cosmology, Stanford University, Stanford, USA.
Ground-based VHE γ ray astronomy with air Cherenkov imaging telescopes
International Nuclear Information System (INIS)
Mirzoyan, R.
2000-01-01
The history of astronomy has been one of the scientific discovery following immediately the introduction of new technology. In this report, we will review shortly the basic development of the atmospheric air Cherenkov light detection technique, particularly the imaging telescope technique, which in the last years led to the firm establishment of a new branch in experimental astronomy, namely ground-based very high-energy (VHE) γ ray astronomy. Milestones in the technology and in the analysis of imaging technique will be discussed. The design of the 17 m diameter MAGIC Telescope, being currently under construction, is based on the development of new technologies for all its major parts and sets new standards in the performance of the ground-based γ detectors. MAGIC is one of the next major steps in the development of the technique being the first instrument that will allow one to carry out measurements also in the not yet investigated energy gap i.e. between 10 and 300 GeV
Detecting new γ-ray sources based on multi-frequency data the case of 1WHSPJ031423.9+061956
Arsioli, Bruno; Chang, Yu Ling
2015-12-01
We use the Fermi Science Tools in an attempt to unveil faint γ-ray blazars that may be above the threshold for detectability with Fermi-LAT and are not identified by automated methods. Our search for new sources in the 100MeV-300GeV band is mainly driven by the 1/2WHSP catalogs, which list high synchrotron peaked blazars expected to be emitters of VHE photons. Here we present the γ-ray detection of 1WHSP J031423.9+061956, modelling its high energy spectrum as a power law. We describe an example where multi-frequency selection, performed at much lower energies (from radio to X-ray), helps to pin-point a high energy source. The 1/2WHSP catalogs are built with the aim of providing a list of TeV targets for the VHE arrays of Cherenkov telescopes. Moreover, these catalogs provide useful seeds for identifying new high energy sources within the raw-data from Fermi. With the aid of multi-frequency data, we can explore the very high energy domain in greater details, improving the description of the γ-ray sky.
Magnetic absorption of VHE photons in the magnetosphere of the Crab pulsar
Bogovalov, S. V.; Contopoulos, I.; Prosekin, A.; Tronin, I.; Aharonian, F. A.
2018-05-01
The detection of the pulsed ˜1 TeV gamma-ray emission from the Crab pulsar reported by MAGIC and VERITAS collaborations demands a substantial revision of existing models of particle acceleration in the pulsar magnetosphere. In this regard model independent restrictions on the possible production site of the very high energy (VHE) photons become an important issue. In this paper, we consider limitations imposed by the process of conversion of VHE gamma-rays into e± pairs in the magnetic field of the pulsar magnetosphere. Photons with energies exceeding 1 TeV are effectively absorbed even at large distances from the surface of the neutron star. Our calculations of magnetic absorption in the force-free magnetosphere show that the twisting of the magnetic field due to the pulsar rotation makes the magnetosphere more transparent compared to the dipole magnetosphere. The gamma-ray absorption appears stronger for photons emitted in the direction of rotation than in the opposite direction. There is a small angular cone inside which the magnetosphere is relatively transparent and photons with energy 1.5 TeV can escape from distances beyond 0.1 light cylinder radius (Rlc). The emission surface from where photons can be emitted in the observer's direction further restricts the sites of VHE gamma-ray production. For the observation angle 57° relative to the Crab pulsar axis of rotation and the orthogonal rotation, the emission surface in the open field line region is located as close as 0.4 Rlc from the stellar surface for a dipole magnetic field, and 0.1 Rlc for a force-free magnetic field.
Shell-type SNRs as sources of cosmic rays
Sinitsyna, V. G.; Andreeva, M. S.; Balygin, K. A.; Borisov, S. S.; Ivanov, I. A.; Kirichenko, A. M.; Klimov, A. I.; Kozhukhova, I. P.; Mirzafatikhov, R. M.; Moseiko, N. I.; Ostashev, I. E.; Palamarchuk, A. I.; Sinitsyna, V. Y.; Volokh, I. G.
2017-06-01
Investigations of VHE gamma-ray sources by any methods, including mirror Cherenkov telescopes, touch on the problem of the cosmic ray origin and, accordingly, the role of the Galaxy in their generation. SHALON observations have yielded results on Galactic supernova remnants (SNR) of different ages. Among them are: the shell-type SNRs Tycho's SNR (1572y), Cas A (1680y), IC 443 (age ˜ (3 ÷ 30) × 103 y), Cygni SNR (age ˜ (5 ÷ 7) × 103 y), G166.0 + 4.3 (age ˜ 24 × 103 y) and the classical nova GK Per (Nova 1901). Observation results are presented for each of the SNRs with spectral energy distributions by SHALON in comparison with other experiment data and images by SHALON together with data from X-rays by Chandra and radio-data by CGPS. The collected experimental data have confirmed the prediction of the theory about the hadronic generation mechanism of very high energy 800 GeV-100 TeV gamma-rays in Tycho's SNR, Cas A and IC443. For the first time, unique data on GK Per (Nova1901) TeV gamma-ray emission were obtained with the SHALON experiment. The X-ray data shows that the nova remnant of GK Per could be a younger remnant that will resemble older SNRs like IC 443 which interact with molecular clouds. GK Per is supposed to be a candidate for TeV gamma-ray emission due to accelerated particles in the reverse shock region.
Very high energy gamma ray astronomy from Hanle
International Nuclear Information System (INIS)
Chitnis, Varsha R.
2015-01-01
Over a past decade very high energy (VHE) gamma ray astronomy has emerged as a major astronomical discipline. In India, we have a long tradition of experiments in this field. Few years ago, multi-institutional Himalayan Gamma Ray Observatory (HiGRO) collaboration was formed to set up VHE gamma rays experiments at Hanle, a high altitude location in Himalayas. HAGAR, the first phase of this collaboration is operational since 2008. HAGAR has successfully detected VHE gamma ray emission from some of the extragalactic objects like Mrk 421, Mrk 501 as well as galactic sources including Crab nebula/pulsar. Details of HAGAR telescope system and results obtained will be discussed. HiGRO is now gearing up for the next phase, i.e. 21 m diameter MACE telescope, which is being installed at Hanle at present. Details of MACE telescope system and future plans will be discussed. (author)
A Very High Energy Gamma-Ray Spectrum of 1ES 2344+514
Schroedter, M.; Badran, H. M.; Buckley, J. H.; Gordo, J. Bussons; Carter-Lewis, D. A.; Duke, C.; Fegan, D. J.; Fegan, S. F.; Finley, J. P.; Gillanders, G. H.; Grube, J.; Horan, D.; Kenny, G. E.; Kertzman, M.; Kosack, K.
2005-01-01
The BL Lacertae (BL Lac) object 1ES 2344+514 (1ES 2344), at a redshift of 0.044, was discovered as a source of very high energy (VHE) gamma rays by the Whipple Collaboration in 1995 \\citep{2344Catanese98}. This detection was recently confirmed by the HEGRA Collaboration \\citep{2344Hegra03}. As is typical for high-frequency peaked blazars, the VHE gamma-ray emission is highly variable. On the night of 20 December, 1995, a gamma-ray flare of 5.3-sigma significance was detected, the brightest ou...
EBL Inhomogeneity and Hard-Spectrum Gamma-Ray Sources
Energy Technology Data Exchange (ETDEWEB)
Abdalla, Hassan; Böttcher, Markus [Centre for Space Research, North-West University, Potchefstroom 2520 (South Africa)
2017-02-01
The unexpectedly hard very-high-energy (VHE; E > 100 GeV) γ -ray spectra of a few distant blazars have been interpreted as evidence of a reduction of the γγ opacity of the universe due to the interaction of VHE γ -rays with the extragalactic background light (EBL) compared to the expectation from current knowledge of the density and cosmological evolution of the EBL. One of the suggested solutions to this problem involves the inhomogeneity of the EBL. In this paper, we study the effects of such inhomogeneity on the energy density of the EBL (which then also becomes anisotropic) and the resulting γγ opacity. Specifically, we investigate the effects of cosmic voids along the line of sight to a distant blazar. We find that the effect of such voids on the γγ opacity, for any realistic void size, is only of the order of ≲1% and much smaller than expected from a simple linear scaling of the γγ opacity with the line-of-sight galaxy underdensity due to a cosmic void.
Event-sequence time series analysis in ground-based gamma-ray astronomy
International Nuclear Information System (INIS)
Barres de Almeida, U.; Chadwick, P.; Daniel, M.; Nolan, S.; McComb, L.
2008-01-01
The recent, extreme episodes of variability detected from Blazars by the leading atmospheric Cerenkov experiments motivate the development and application of specialized statistical techniques that enable the study of this rich data set to its furthest extent. The identification of the shortest variability timescales supported by the data and the actual variability structure observed in the light curves of these sources are some of the fundamental aspects being studied, that answers can bring new developments on the understanding of the physics of these objects and on the mechanisms of production of VHE gamma-rays in the Universe. Some of our efforts in studying the time variability of VHE sources involve the application of dynamic programming algorithms to the problem of detecting change-points in a Poisson sequence. In this particular paper we concentrate on the more primary issue of the applicability of counting statistics to the analysis of time-series on VHE gamma-ray astronomy.
Discovery of TeV gamma-ray emission from the pulsar wind nebula 3C 58 by MAGIC
Directory of Open Access Journals (Sweden)
López-Coto Rubén
2016-01-01
Full Text Available The pulsar wind nebula (PWN 3C 58 is one of the historical very-high-energy (VHE; E>100 GeV gamma-ray source candidates. It has been compared to the Crab Nebula due to their morphological similarities. This object was detected by Fermi-LAT with a spectrum extending beyond 100 GeV. We analyzed 81 hours of 3C 58 data taken with the MAGIC telescopes and we detected VHE gamma-ray emission for the first time at TeV energies with a significance of 5.7 sigma and an integral flux of 0.65% C.U. above 1 TeV. According to our results 3C 58 is the least luminous PWN ever detected at VHE and the one with the lowest flux at VHE to date. We compare our results with the expectations of time-dependent models in which electrons up-scatter photon fields. The best representation favors a distance to the PWN of 2 kpc and Far Infrared (FIR comparable to CMB photon fields. Hadronic contribution from the hosting supernova remnant (SNR requires unrealistic energy budget given the density of the medium, disfavoring cosmic ray acceleration in the SNR as origin of the VHE gamma-ray emission.
Using Deep Learning for Gamma Ray Source Detection at the First G-APD Cherenkov Telescope (FACT)
Bieker, Jacob
2018-06-01
Finding gamma-ray sources is of paramount importance for Imaging Air Cherenkov Telescopes (IACT). This study looks at using deep neural networks on data from the First G-APD Cherenkov Telescope (FACT) as a proof-of-concept of finding gamma-ray sources with deep learning for the upcoming Cherenkov Telescope Array (CTA). In this study, FACT’s individual photon level observation data from the last 5 years was used with convolutional neural networks to determine if one or more sources were present. The neural networks used various architectures to determine which architectures were most successful in finding sources. Neural networks offer a promising method for finding faint and extended gamma-ray sources for IACTs. With further improvement and modifications, they offer a compelling method for source detection for the next generation of IACTs.
A detailed study of the supernova remnant RCW 86 in TeV {gamma}-rays
Energy Technology Data Exchange (ETDEWEB)
Heinz, Sebastian
2012-03-29
A detailed study of the supernova remnant RCW 86 is presented. RCW 86 encountered a shell-like structure in radio, X-rays and optical, whereas in the discovery paper of RCW 86 in the very high energy regime the structure could not be confirmed. In this thesis for the first time the shell was resolved in the very high energy gamma rays. The shell width was determined to be 0.125 {+-}0.014 , the radius to be 0.194 {+-} 0.016 and the center to be -62.433 {+-}0.014 in declination and 220.734 {+-}0.016 in rectascension. The spectral analysis was performed for the whole SNR and for the south-east part, which is more pronounced in X-rays separately. But the results were comparable within errors. Additionally a power-law with an exponential cut off described the spectra best with the parameters: an spectral index of 1.50{+-}0.28, a cut-off energy of (2.69{+-}0.99 TeV) and an integral flux above 1 TeV of (6.51{+-}2.69) . 10{sup -12} cm{sup -2}s{sup -1}. The study of the correlation of the X-ray and VHE {gamma}-ray data of RCW 86 was hampered by the poor angular resolution of the VHE data. Therefore detailed studies of the Richardson-Lucy deconvolution algorithm have been performed. The outcome is, that deconvolution techniques are applicable to strong VHE {gamma}-ray sources and that fine structure well below the angular resolution can be studied. The application to RX J1713-3946, the brightest SNR in the VHE regime, has shown, that the correlation coefficient of the X-ray data and the VHE data of is stable down to 0.01 and has a value of 0.85. On the other side the significance of the data set is not sufficient in the case of RCW 86 to apply the deconvolution technique.
THE 2010 VERY HIGH ENERGY {gamma}-RAY FLARE AND 10 YEARS OF MULTI-WAVELENGTH OBSERVATIONS OF M 87
Energy Technology Data Exchange (ETDEWEB)
Abramowski, A. [Institut fuer Experimentalphysik, Universitaet Hamburg, Luruper Chaussee 149, D 22761 Hamburg (Germany); Acero, F. [Laboratoire Univers et Particules de Montpellier, Universite Montpellier 2, CNRS/IN2P3, CC 72, Place Eugene Bataillon, F-34095 Montpellier Cedex 5 (France); Aharonian, F.; Bernloehr, K.; Bochow, A. [Max-Planck-Institut fuer Kernphysik, P.O. Box 103980, D 69029 Heidelberg (Germany); Akhperjanian, A. G. [National Academy of Sciences of the Republic of Armenia, 24 Marshall Baghramian Avenue, 0019 Yerevan (Armenia); Anton, G.; Balzer, A. [Physikalisches Institut, Universitaet Erlangen-Nuernberg, Erwin-Rommel-Str. 1, D 91058 Erlangen (Germany); Barnacka, A. [Nicolaus Copernicus Astronomical Center, ul. Bartycka 18, 00-716 Warsaw (Poland); Barres de Almeida, U. [Department of Physics, University of Durham, South Road, Durham DH1 3LE (United Kingdom); Becherini, Y. [Astroparticule et Cosmologie (APC), CNRS, Universite Paris 7 Denis Diderot, 10, rue Alice Domon et Leonie Duquet, F-75205 Paris Cedex 13 (France); Becker, J. [Institut fuer Theoretische Physik, Lehrstuhl IV: Weltraum und Astrophysik, Ruhr-Universitaet Bochum, D 44780 Bochum (Germany); Behera, B. [Landessternwarte, Universitaet Heidelberg, Koenigstuhl, D 69117 Heidelberg (Germany); Birsin, E. [Institut fuer Physik, Humboldt-Universitaet zu Berlin, Newtonstr. 15, D 12489 Berlin (Germany); Biteau, J. [Laboratoire Leprince-Ringuet, Ecole Polytechnique, CNRS/IN2P3, F-91128 Palaiseau (France); Boisson, C. [LUTH, Observatoire de Paris, CNRS, Universite Paris Diderot, 5 Place Jules Janssen, 92190 Meudon (France); Bolmont, J. [LPNHE, Universite Pierre et Marie Curie Paris 6, Universite Denis Diderot Paris 7, CNRS/IN2P3, 4 Place Jussieu, F-75252, Paris Cedex 5 (France); Bordas, P., E-mail: martin.raue@desy.de [Institut fuer Astronomie und Astrophysik, Universitaet Tuebingen, Sand 1, D 72076 Tuebingen (Germany); Collaboration: H.E.S.S. Collaboration; MAGIC Collaboration; VERITAS Collaboration; and others
2012-02-20
The giant radio galaxy M 87 with its proximity (16 Mpc), famous jet, and very massive black hole ((3 - 6) Multiplication-Sign 10{sup 9} M{sub Sun }) provides a unique opportunity to investigate the origin of very high energy (VHE; E > 100 GeV) {gamma}-ray emission generated in relativistic outflows and the surroundings of supermassive black holes. M 87 has been established as a VHE {gamma}-ray emitter since 2006. The VHE {gamma}-ray emission displays strong variability on timescales as short as a day. In this paper, results from a joint VHE monitoring campaign on M 87 by the MAGIC and VERITAS instruments in 2010 are reported. During the campaign, a flare at VHE was detected triggering further observations at VHE (H.E.S.S.), X-rays (Chandra), and radio (43 GHz Very Long Baseline Array, VLBA). The excellent sampling of the VHE {gamma}-ray light curve enables one to derive a precise temporal characterization of the flare: the single, isolated flare is well described by a two-sided exponential function with significantly different flux rise and decay times of {tau}{sup rise}{sub d} = (1.69 {+-} 0.30) days and {tau}{sup decay}{sub d} = (0.611 {+-} 0.080) days, respectively. While the overall variability pattern of the 2010 flare appears somewhat different from that of previous VHE flares in 2005 and 2008, they share very similar timescales ({approx}day), peak fluxes ({Phi}{sub >0.35TeV} {approx_equal} (1-3) Multiplication-Sign 10{sup -11} photons cm{sup -2} s{sup -1}), and VHE spectra. VLBA radio observations of 43 GHz of the inner jet regions indicate no enhanced flux in 2010 in contrast to observations in 2008, where an increase of the radio flux of the innermost core regions coincided with a VHE flare. On the other hand, Chandra X-ray observations taken {approx}3 days after the peak of the VHE {gamma}-ray emission reveal an enhanced flux from the core (flux increased by factor {approx}2; variability timescale <2 days). The long-term (2001-2010) multi-wavelength (MWL
Lopez-Coto, Ruben
2015-07-01
The history of astronomy is as ancient as the reach of our written records. All the human civilizations have been interested in the study and interpretation of the night sky and its objects and phenomena. These observations were performed with the naked eye until the beginning of the 17th century, when Galileo Galilei started to use an instrument recently developed called telescope. Since then, the range of accessible wavelengths has been increasing, with a burst in the 20th century with the developing of instruments to observe them: antennas (radio and submillimeter), telescopes (optical, IR) and satellites (UV, X-rays and soft gamma rays). The last wavelength range accessed was the Very-High-Energy (VHE) gamma rays. At this range fluxes are so low that it is not possible to use space-based instruments with typical collection areas of O(1) m2. We must resort to the imaging atmospheric Cherenkov technique, which is based on the detection of the flashes of Cherenkov light that VHE gamma rays produce when they interact with the Earth's atmosphere. The field is very young, with the first source discovered in 1989 by the pioneering Whipple telescope. It is very dynamic with more than 150 sources detected to date, most of them by MAGIC, HESS and VERITAS, that make up the current generation of instruments. Finally, the field is also very promising, with the preparation of a next generation of imaging atmospheric Cherenkov telescopes: CTA, that is expected to start full operation in 2020. The work presented in this thesis comprises my efforts to take the ground-based γ-ray astronomy one step forward. Part I of the thesis is an introduction to the non- thermal universe, the imaging atmospheric Cherenkov technique and the Imaging Atmospheric Cherenkov Telescopes (IACTs) MAGIC and CTA. Part II deals with several ways to reduce the trigger threshold of IACTs. This includes the simula- tion, characterization and test of an analog trigger especially designed to achieve the
Energy Technology Data Exchange (ETDEWEB)
Kerschhaggl, Matthias
2010-04-06
PSR B1259-63/SS2883 is a binary system where a 48 ms pulsar orbits a massive Be star with a period of 3.4 years. The system exhibits variable, non-thermal radiation around periastron on the highly eccentric orbit (e=0.87) visible from radio to very high energies (VHE; E>100 GeV). When being detected in TeV {gamma}-rays with the High Energy Stereoscopic System (H.E.S.S.) in 2004 it became known as the first variable galactic VHE source. This thesis presents VHE data from PSR B1259-63 as taken during the years 2005, 2006 and before as well as shortly after the 2007 periastron passage. These data extend the knowledge of the lightcurve of this object to all phases of the binary orbit. The lightcurve constrains physical mechanisms present in this TeV source. Observations of VHE {gamma}-rays with the H.E.S.S. telescope array using the Imaging Atmospheric Cherenkov Technique were performed. The H.E.S.S. instrument features an angular resolution of < 0.1 and an energy resolution of < 20%. Gamma-ray events in an energy range of 0.5-70 TeV were recorded. From these data, energy spectra and lightcurve with a monthly time sampling were extracted. VHE {gamma}-ray emission from PSRB1259-63 was detected with an overall significance of 9.5 standard deviations using 55 h of exposure, obtained from April to August 2007. The monthly flux of -rays during the observation period was measured, yielding VHE lightcurve data for the early pre-periastron phase of the system for the first time. No spectral variability was found on timescales of months. The spectrum is described by a power law with a photon index of {gamma}=2.8{+-}0.2{sub stat}{+-}0.2{sub sys} and flux normalisation {phi}{sub 0}=(1.1{+-}0.1{sub stat}{+-}0.2{sub sys}) x 10{sup -12} TeV{sup -1}cm{sup -2}s{sup -1}. PSR B1259-63 was also monitored in 2005 and 2006, far from periastron passage, comprising 8.9 h and 7.5 h of exposure, respectively. No significant excess of {gamma}-rays is seen in those observations. PSR B1259-63 has
Energy Technology Data Exchange (ETDEWEB)
Kerschhaggl, Matthias
2010-04-06
PSR B1259-63/SS2883 is a binary system where a 48 ms pulsar orbits a massive Be star with a period of 3.4 years. The system exhibits variable, non-thermal radiation around periastron on the highly eccentric orbit (e=0.87) visible from radio to very high energies (VHE; E>100 GeV). When being detected in TeV {gamma}-rays with the High Energy Stereoscopic System (H.E.S.S.) in 2004 it became known as the first variable galactic VHE source. This thesis presents VHE data from PSR B1259-63 as taken during the years 2005, 2006 and before as well as shortly after the 2007 periastron passage. These data extend the knowledge of the lightcurve of this object to all phases of the binary orbit. The lightcurve constrains physical mechanisms present in this TeV source. Observations of VHE {gamma}-rays with the H.E.S.S. telescope array using the Imaging Atmospheric Cherenkov Technique were performed. The H.E.S.S. instrument features an angular resolution of < 0.1 and an energy resolution of < 20%. Gamma-ray events in an energy range of 0.5-70 TeV were recorded. From these data, energy spectra and lightcurve with a monthly time sampling were extracted. VHE {gamma}-ray emission from PSRB1259-63 was detected with an overall significance of 9.5 standard deviations using 55 h of exposure, obtained from April to August 2007. The monthly flux of -rays during the observation period was measured, yielding VHE lightcurve data for the early pre-periastron phase of the system for the first time. No spectral variability was found on timescales of months. The spectrum is described by a power law with a photon index of {gamma}=2.8{+-}0.2{sub stat}{+-}0.2{sub sys} and flux normalisation {phi}{sub 0}=(1.1{+-}0.1{sub stat}{+-}0.2{sub sys}) x 10{sup -12} TeV{sup -1}cm{sup -2}s{sup -1}. PSR B1259-63 was also monitored in 2005 and 2006, far from periastron passage, comprising 8.9 h and 7.5 h of exposure, respectively. No significant excess of {gamma}-rays is seen in those observations. PSR B1259-63 has
Energy Technology Data Exchange (ETDEWEB)
Hillert, Andreas
2014-07-24
The H.E.S.S. experiment, with its high sensitivity and large field-of-view, is an ideal instrument to survey the Milky Way in VHE γ-rays. An accurate reconstruction of the γ-ray direction as well as a strong reduction of the hadronic background is essential for the analysis of the data. In this work a reconstruction algorithm is developed that applies a fit of pixel amplitudes to an expected image obtained from a Gamma Ray Air Shower Parameterisation (GRASP). This parameterisation was obtained using Monte Carlo air shower simulations by parameterising the angular Cherenkov photon distribution with suitable analytical functions. Furthermore, it provides new classifying variables to differentiate γ-ray induced air showers from hadronic ones. The reconstruction of air shower parameters is achieved by a maximum likelihood fit and improves the angular resolution by 20-30% with respect to traditional image moment analysis methods. In combination with a MVA-based background rejection method using these new classifying variables the sensitivity can be improved by about 70%. An analysis of the Pulsar Wind Nebula MSH 15-5-2 and investigation of its morphology and spectral properties show an indication of energy dependent morphology in VHE γ-rays.
International Nuclear Information System (INIS)
Kerschhaggl, Matthias
2010-01-01
PSR B1259-63/SS2883 is a binary system where a 48 ms pulsar orbits a massive Be star with a period of 3.4 years. The system exhibits variable, non-thermal radiation around periastron on the highly eccentric orbit (e=0.87) visible from radio to very high energies (VHE; E>100 GeV). When being detected in TeV γ-rays with the High Energy Stereoscopic System (H.E.S.S.) in 2004 it became known as the first variable galactic VHE source. This thesis presents VHE data from PSR B1259-63 as taken during the years 2005, 2006 and before as well as shortly after the 2007 periastron passage. These data extend the knowledge of the lightcurve of this object to all phases of the binary orbit. The lightcurve constrains physical mechanisms present in this TeV source. Observations of VHE γ-rays with the H.E.S.S. telescope array using the Imaging Atmospheric Cherenkov Technique were performed. The H.E.S.S. instrument features an angular resolution of stat ±0.2 sys and flux normalisation Φ 0 =(1.1±0.1 stat ±0.2 sys ) x 10 -12 TeV -1 cm -2 s -1 . PSR B1259-63 was also monitored in 2005 and 2006, far from periastron passage, comprising 8.9 h and 7.5 h of exposure, respectively. No significant excess of γ-rays is seen in those observations. PSR B1259-63 has been re-confirmed as a variable TeV γ-ray emitter. The firm detection of VHE photons emitted at a true anomaly θ∼0.35 of the pulsar orbit, i.e. already ∝50 days prior to the periastron passage, disfavors the stellar disc target scenario as a primary emission mechanism, based on current knowledge about the companion star's disc inclination, extension, and density profile. In a phenomenological study indirect evidence that PSR B1259-63 could in fact be a periodical VHE emitter is presented using the TeV data discussed in this work. While the TeV energy flux level seems to be only dependent on the binary separation this behavior is not seen in X-rays. Moreover, model calculations based on inverse compton (IC) scattering of
Systematic search for very-high-energy gamma-ray emission from bow shocks of runaway stars
H.E.S.S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Akhperjanian, A. G.; Andersson, T.; Angüner, E. O.; Arakawa, M.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Büchele, M.; Bulik, T.; Capasso, M.; Carr, J.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chalme-Calvet, R.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Chrétien, M.; Coffaro, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Cui, Y.; Davids, I. D.; Decock, J.; Degrange, B.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dutson, K.; Dyks, J.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gajdus, M.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hervet, O.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holler, M.; Horns, D.; Ivascenko, A.; Iwasaki, H.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jogler, T.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katsuragawa, M.; Katz, U.; Kerszberg, D.; Khangulyan, D.; Khélifi, B.; Kieffer, M.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Nakashima, S.; de Naurois, M.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Öttl, S.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Richter, S.; Rieger, F.; Romoli, C.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Saito, S.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seglar-Arroyo, M.; Settimo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stycz, K.; Sushch, I.; Takahashi, T.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tsuji, N.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zabalza, V.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Żywucka, N.
2018-04-01
Context. Runaway stars form bow shocks by ploughing through the interstellar medium at supersonic speeds and are promising sources of non-thermal emission of photons. One of these objects has been found to emit non-thermal radiation in the radio band. This triggered the development of theoretical models predicting non-thermal photons from radio up to very-high-energy (VHE, E ≥ 0.1 TeV) gamma rays. Subsequently, one bow shock was also detected in X-ray observations. However, the data did not allow discrimination between a hot thermal and a non-thermal origin. Further observations of different candidates at X-ray energies showed no evidence for emission at the position of the bow shocks either. A systematic search in the Fermi-LAT energy regime resulted in flux upper limits for 27 candidates listed in the E-BOSS catalogue. Aim. Here we perform the first systematic search for VHE gamma-ray emission from bow shocks of runaway stars. Methods: Using all available archival H.E.S.S. data we search for very-high-energy gamma-ray emission at the positions of bow shock candidates listed in the second E-BOSS catalogue release. Out of the 73 bow shock candidates in this catalogue, 32 have been observed with H.E.S.S. Results: None of the observed 32 bow shock candidates in this population study show significant emission in the H.E.S.S. energy range. Therefore, flux upper limits are calculated in five energy bins and the fraction of the kinetic wind power that is converted into VHE gamma rays is constrained. Conclusions: Emission from stellar bow shocks is not detected in the energy range between 0.14 and 18 TeV.The resulting upper limits constrain the level of VHE gamma-ray emission from these objects down to 0.1-1% of the kinetic wind energy.
Effect of stars in the field of view of the VHE gamma-ray atmospheric Cherenkov telescope
International Nuclear Information System (INIS)
Badran, H.M.
2004-01-01
Very high energy gamma-ray astronomy in the energy range above 100 GeV has made dramatic progress through the development of imaging atmospheric Cherenkov telescopes (lACTs). The technique has been pivotal in the establishing the existence of a number of discrete gamma-ray sources. Normally due to the presence of stars in the field of view (FOV), a number of photomultiplier tubes (pmts) in the camera has to be turned off. This may have the effect of distorting some images that happens to be in that part of the camera. This may in turn affect the gamma-ray sensitivity of the telescope. The present study aims to shade some light on this possible effect. Experimental data on the extragalactic gamma-ray source Mrk 421 measured using the 10-m Whipple IACT were used for this purpose because of its relative dark FOV compared with other sources; e.g. the Crab nebula. To simulate the presence of star(s) in the FOV, the analysis program selects randomly a number of clusters of pmts to be turned off in the software. The pmts in each cluster have to be adjacent to each other (neighbors) and the selected clusters have to be separated from each other. The significance of the detected signal and the gamma-ray rate were then determined and compared with the original results. Clusters of 2, 3 and 4 pmts were used. The number of clusters was increased up to 12 clusters at various distances from the center of the FOV
Very high-energy gamma-ray signature of ultrahigh-energy cosmic-ray acceleration in Centaurus A
Joshi, Jagdish C.; Miranda, Luis Salvador; Razzaque, Soebur; Yang, Lili
2018-04-01
The association of at least a dozen ultrahigh-energy cosmic-ray (UHECR) events with energy ≳ 55 EeV detected by the Pierre Auger Observatory (PAO) from the direction of Centaurus-A, the nearest radio galaxy, supports the scenario of UHECR acceleration in the jets of radio galaxies. In this work, we model radio to very high energy (VHE,≳ 100 GeV) γ-ray emission from Cen A, including GeV hardness detected by Fermi-LAT and TeV emission detected by HESS. We consider two scenarios: (i) Two zone synchrotron self-Compton (SSC) and external-Compton (EC) models, (ii) Two zone SSC, EC and photo-hadronic emission from cosmic ray interactions. The GeV hardness observed by Fermi-LAT can be explained using these two scenarios, where zone 2 EC emission is very important. Hadronic emission in scenario (ii) can explain VHE data with the same spectral slope as obtained through fitting UHECRs from Cen A. The peak luminosity in cosmic ray proton at 1 TeV, to explain the VHE γ-ray data is ≈2.5 × 1046 erg/s. The bolometric luminosity in cosmic ray protons is consistent with the luminosity required to explain the origin of 13 UHECR signal events that are correlated with Cen A.
IceCube constraints on fast-spinning pulsars as high-energy neutrino sources
Energy Technology Data Exchange (ETDEWEB)
Fang, Ke [Department of Astronomy, University of Maryland, College Park, MD, 20742 (United States); Kotera, Kumiko [Institut d' Astrophysique de Paris, UMR 7095 – CNRS, Université Pierre $ and $ Marie Curie, 98 bis boulevard Arago, 75014, Paris (France); Murase, Kohta [Department of Physics, Department of Astronomy and Astrophysics, Center for Particle and Gravitational Astrophysics, The Pennsylvania State University, PA 16802 (United States); Olinto, Angela V., E-mail: kefang@umd.edu, E-mail: kotera@iap.fr, E-mail: murase@psu.edu, E-mail: olinto@kicp.uchicago.edu [Department of Astronomy and Astrophysics, Kavli Institute for Cosmological Physics, University of Chicago, Chicago, IL 60637 (United States)
2016-04-01
Relativistic winds of fast-spinning pulsars have been proposed as a potential site for cosmic-ray acceleration from very high energies (VHE) to ultrahigh energies (UHE). We re-examine conditions for high-energy neutrino production, considering the interaction of accelerated particles with baryons of the expanding supernova ejecta and the radiation fields in the wind nebula. We make use of the current IceCube sensitivity in diffusive high-energy neutrino background, in order to constrain the parameter space of the most extreme neutron stars as sources of VHE and UHE cosmic rays. We demonstrate that the current non-observation of 10{sup 18} eV neutrinos put stringent constraints on the pulsar scenario. For a given model, birthrates, ejecta mass and acceleration efficiency of the magnetar sources can be constrained. When we assume a proton cosmic ray composition and spherical supernovae ejecta, we find that the IceCube limits almost exclude their significant contribution to the observed UHE cosmic-ray flux. Furthermore, we consider scenarios where a fraction of cosmic rays can escape from jet-like structures piercing the ejecta, without significant interactions. Such scenarios would enable the production of UHE cosmic rays and help remove the tension between their EeV neutrino production and the observational data.
Directory of Open Access Journals (Sweden)
André Luiz Bortoliero
2006-04-01
Full Text Available A cross-sectional study was carried out among 996 volunteer blood donors enrolled from May 1999 to December 1999 to determine the seroprevalence of hepatitis E virus (HEV infection among volunteer blood donors of the Regional Blood Bank of Londrina, State of Paraná, Brazil, and to evaluate whether the rate of seroprevalence of IgG anti-HEV antibodies is associated with sociodemographic variables and with seropositivity for hepatitis A virus (HAV infection. All participants answered the questionnaire regarding the sociodemographic characterisitcs. Serum samples were tested for IgG antibodies to HEV (anti-HEV by an enzyme linked immunoassay (ELISA. All serum samples positive for anti-HEV IgG and 237 serum samples negative for anti-HEV were also assayed for IgG anti-HAV antibodies by ELISA. Anti-HEV IgG was confirmed in 23/996 samples, resulting in a seroprevalence of 2.3% for HEV infection, similar to previous results obtained in developed countries. No significant association was found between the presence of anti-HEV IgG antibodies and the sociodemographic variables including gender, age, educational level, rural or urban areas, source of water, and sewer system (p > 0.05. Also, no association with seropositivity for anti-HAV IgG antibodies was observed (p > 0.05. Although this study revealed a low seroprevalence of HEV infection in the population evaluated, the results showed that this virus is circulating among the population from Londrina, South Brazil, and point out the need of further studies to define the clinical and epidemiological importance of HEV infection and to identify additional risk factors involved in the epidemiology and pathogenesis of this infection in this population.Os objetivos do estudo foram determinar a soroprevalência da infecção pelo vírus da hepatite E (VHE em candidatos a doadores de sangue voluntários do Hemocentro Regional de Londrina, Paraná, e avaliar se essa soroprevalência está associada com vari
Point X-ray sources in the SNR G 315.4-2.30 (MSH 14-63, RCW 86)
Gvaramadze, V. V.; Vikhlinin, A. A.
2003-04-01
We report the results of a search for a point X-ray source (stellar remnant) in the southwest protrusion of the supernova remnant G 315.4-2.30 (MSH 14-63, RCW 86) using the archival data of the Chandra X-ray Observatory. The search was motivated by a hypothesis that G 315.4-2.30 is the result of an off-centered cavity supernova explosion of a moving massive star, which ended its evolution just near the edge of the main-sequence wind-driven bubble. This hypothesis implies that the southwest protrusion in G 315.4-2.30 is the remainder of a pre-existing bow shock-like structure created by the interaction of the supernova progenitor's wind with the interstellar medium and that the actual location of the supernova blast center is near the center of this hemispherical structure. We have discovered two point X-ray sources in the ``proper" place. One of the sources has an optical counterpart with the photographic magnitude 13.38+/-0.40, while the spectrum of the source can be fitted with an optically thin plasma model. We interpret this source as a foreground active star of late spectral type. The second source has no optical counterpart to a limiting magnitude ~ 21. The spectrum of this source can be fitted almost equally well with several simple models (power law: photon index =1.87; two-temperature blackbody: kT1 =0.11 keV, R1 =2.34 km and kT2 =0.71 keV, R2 =0.06 km; blackbody plus power law: kT =0.07 keV, photon index =2.3). We interpret this source as a candidate stellar remnant (neutron star), while the photon index and non-thermal luminosity of the source (almost the same as those of the Vela pulsar and the recently discovered pulsar PSR J 0205+6449 in the supernova remnant 3C 58) suggest that it can be a young ``ordinary" pulsar.
Steady-state emission of blazars at very high energies
International Nuclear Information System (INIS)
Hoehne-Moench, Daniel
2010-01-01
One key scientific program of the MAGIC telescope project is the discovery and detection of blazars. They constitute the most prominent extragalactic source class in the very high energy (VHE) γ-ray regime with 29 out of 34 known objects. Therefore a major part of the available observation time was spent in the last years on high-frequency peaked blazars. The selection criteria were chosen to increase the detection probability. As the X-ray flux is believed to be correlated to the VHE γ-ray flux, only X-ray selected sources with a flux F X >2 μJy at 1 keV were considered. To avoid strong attenuation of the -rays in the extragalactic infrared background, the redshift was restricted to values between z X-γ between the X-ray range at 1 keV and the VHE γ-ray regime at 200 GeV were calculated. The majority of objects show a spectral behaviour as expected from the source class of HBLs: The energy output in the VHE regime is in general lower than in X-rays. For the stacked blazar sample the broad-band spectral index was calculated to α X-γ =1.09, confirming the result found for the individual objects. Another evidence for the revelation of the baseline emission is the broad-band spectral energy distribution (SED) comprising archival as well as contemporaneous multi-wavelength data from the radio to the VHE band. The SEDs of known VHE γ-ray sources in low flux states matches well the SED of the stacked blazar sample. (orig.)
The missing GeV γ-ray binary: searching for HESS J0632+057 with Fermi-LAT
Caliandro, G.A.; Hill, A.B.; Torres, D.F.; Hadasch, D.; Ray, P.; Abdo, A.; Hessels, J.W.T.; Ridolfi, A.; Possenti, A.; Burgay, M.; Rea, N.; Tam, P.H.T.; Dubois, R.; Dubus, G.; Glanzman, T.; Jogler, T.
2013-01-01
The very high energy (VHE; >100 GeV) source HESS J0632+057 has been recently confirmed as a γ-ray binary, a subclass of the high-mass X-ray binary population, through the detection of an orbital period of 321 d. We performed a deep search for the emission of HESS J0632+057 in the GeV energy range
THE 2010 VERY HIGH ENERGY gamma-RAY FLARE AND 10 YEARS OF MULTI-WAVELENGTH OBSERVATIONS OF M 87
Abramowski, A.; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Balzer, A.; Barnacka, A.; de Almeida, U. Barres; Becherini, Y.; Becker, J.; Behera, B.; Bernloehr, K.; Birsin, E.; Biteau, J.; Bochow, A.
2012-01-01
The giant radio galaxy M 87 with its proximity (16 Mpc), famous jet, and very massive black hole ((3-6) x 10(9) M-circle dot) provides a unique opportunity to investigate the origin of very high energy (VHE; E > 100 GeV) gamma-ray emission generated in relativistic outflows and the surroundings of supermassive black holes. M 87 has been established as a VHE gamma-ray emitter since 2006. The VHE gamma-ray emission displays strong variability on timescales as short as a day. In this paper, resu...
Exploring the extreme gamma-ray sky with HESS
International Nuclear Information System (INIS)
Sol, Helene
2006-01-01
The international HESS experiment. High Energy Stereoscopic System, fully operational since January 2004, is opening a new era for extreme gamma-ray astronomy. Located in Namibia, it is now the most sensitive detector for cosmic sources of very high energy (VHE) gamma-rays, in the tera-electron-volt (TeV) range. In July 2005, it had already more than double the number of sources detected at such energies, with the discovery of several active galactic nuclei (AGN), supernova remnants and plerions, a binary pulsar system, a microquasar candidate, and a sample of yet unidentified sources. HESS has also provide for the first time gamma-ray images of extended sources with the first astrophysical jet resolved in gamma-rays, and the first mapping of a shell supernova remnant, which proves the efficiency of in situ acceleration of particles up to 100 TeV and beyond
TEV GAMMA-RAY OBSERVATIONS OF THE GALACTIC CENTER RIDGE BY VERITAS
Energy Technology Data Exchange (ETDEWEB)
Archer, A.; Buckley, J. H.; Bugaev, V. [Department of Physics, Washington University, St. Louis, MO 63130 (United States); Benbow, W.; Cerruti, M. [Fred Lawrence Whipple Observatory, Harvard-Smithsonian Center for Astrophysics, Amado, AZ 85645 (United States); Bird, R.; Collins-Hughes, E. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Buchovecky, M. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Byrum, K. [Argonne National Laboratory, 9700 S. Cass Avenue, Argonne, IL 60439 (United States); Cardenzana, J. V; Eisch, J. D. [Department of Physics and Astronomy, Iowa State University, Ames, IA 50011 (United States); Chen, X. [Institute of Physics and Astronomy, University of Potsdam, D-14476 Potsdam-Golm (Germany); Ciupik, L. [Astronomy Department, Adler Planetarium and Astronomy Museum, Chicago, IL 60605 (United States); Connolly, M. P. [School of Physics, National University of Ireland Galway, University Road, Galway (Ireland); Falcone, A. [Department of Astronomy and Astrophysics, 525 Davey Lab, Pennsylvania State University, University Park, PA 16802 (United States); Feng, Q.; Finley, J. P. [Department of Physics and Astronomy, Purdue University, West Lafayette, IN 47907 (United States); Fleischhack, H. [DESY, Platanenallee 6, D-15738 Zeuthen (Germany); Flinders, A. [Department of Physics and Astronomy, University of Utah, Salt Lake City, UT 84112 (United States); Fortson, L., E-mail: asmith44@umd.edu [School of Physics and Astronomy, University of Minnesota, Minneapolis, MN 55455 (United States); and others
2016-04-20
The Galactic Center ridge has been observed extensively in the past by both GeV and TeV gamma-ray instruments revealing a wealth of structure, including a diffuse component and the point sources G0.9+0.1 (a composite supernova remnant) and Sgr A* (believed to be associated with the supermassive black hole located at the center of our Galaxy). Previous very high energy (VHE) gamma-ray observations with the H.E.S.S. experiment have also detected an extended TeV gamma-ray component along the Galactic plane in the >300 GeV gamma-ray regime. Here we report on observations of the Galactic Center ridge from 2010 to 2014 by the VERITAS telescope array in the >2 TeV energy range. From these observations we (1) provide improved measurements of the differential energy spectrum for Sgr A* in the >2 TeV gamma-ray regime, (2) provide a detection in the >2 TeV gamma-ray emission from the composite SNR G0.9+0.1 and an improved determination of its multi-TeV gamma-ray energy spectrum, and (3) report on the detection of VER J1746-289, a localized enhancement of >2 TeV gamma-ray emission along the Galactic plane.
A SEARCH FOR VERY HIGH ENERGY GAMMA RAYS FROM THE MISSING LINK BINARY PULSAR J1023+0038 WITH VERITAS
Energy Technology Data Exchange (ETDEWEB)
Aliu, E. [Department of Physics and Astronomy, Barnard College, Columbia University, NY 10027 (United States); Archambault, S. [Physics Department, McGill University, Montreal, QC H3A 2T8 (Canada); Archer, A.; Buckley, J. H.; Bugaev, V. [Department of Physics, Washington University, St. Louis, MO 63130 (United States); Benbow, W.; Cerruti, M. [Fred Lawrence Whipple Observatory, Harvard-Smithsonian Center for Astrophysics, Amado, AZ 85645 (United States); Bird, R. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Biteau, J. [Santa Cruz Institute for Particle Physics and Department of Physics, University of California, Santa Cruz, CA 95064 (United States); Buchovecky, M. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Byrum, K. [Argonne National Laboratory, 9700 S. Cass Avenue, Argonne, IL 60439 (United States); Cardenzana, J. V; Dickinson, H. J.; Eisch, J. D. [Department of Physics and Astronomy, Iowa State University, Ames, IA 50011 (United States); Chen, X. [Institute of Physics and Astronomy, University of Potsdam, D-14476 Potsdam-Golm (Germany); Ciupik, L. [Astronomy Department, Adler Planetarium and Astronomy Museum, Chicago, IL 60605 (United States); Connolly, M. P. [School of Physics, National University of Ireland Galway, University Road, Galway (Ireland); Cui, W.; Feng, Q. [Department of Physics and Astronomy, Purdue University, West Lafayette, IN 47907 (United States); Falcone, A., E-mail: ester.aliu.fuste@gmail.com, E-mail: gtrichards@gatech.edu, E-mail: masha.chernyakova@dcu.ie, E-mail: malloryr@gmail.com [Department of Astronomy and Astrophysics, 525 Davey Lab, Pennsylvania State University, University Park, PA 16802 (United States); and others
2016-11-10
The binary millisecond radio pulsar PSR J1023+0038 exhibits many characteristics similar to the gamma-ray binary system PSR B1259–63/LS 2883, making it an ideal candidate for the study of high-energy nonthermal emission. It has been the subject of multiwavelength campaigns following the disappearance of the pulsed radio emission in 2013 June, which revealed the appearance of an accretion disk around the neutron star. We present the results of very high energy (VHE) gamma-ray observations carried out by the Very Energetic Radiation Imaging Telescope Array System before and after this change of state. Searches for steady and pulsed emission of both data sets yield no significant gamma-ray signal above 100 GeV, and upper limits are given for both a steady and pulsed gamma-ray flux. These upper limits are used to constrain the magnetic field strength in the shock region of the PSR J1023+0038 system. Assuming that VHE gamma rays are produced via an inverse Compton mechanism in the shock region, we constrain the shock magnetic field to be greater than ∼2 G before the disappearance of the radio pulsar and greater than ∼10 G afterward.
Patricelli, B.; Stamerra, A.; Razzano, M.; Pian, E.; Cella, G.
2018-05-01
The merger of binary neutron star (BNS) systems are predicted to be progenitors of short gamma-ray bursts (GRBs); the definitive probe of this association came with the recent detection of gravitational waves (GWs) from a BNS merger by Advanced LIGO and Advanced Virgo (GW170817), in coincidence with the short GRB 170817A observed by Fermi-GBM and INTEGRAL. Short GRBs are also expected to emit very-high energy (VHE, > 10S0 GeV) photons and VHE electromagnetic (EM) upper limits have been set with observations performed by ground-based gamma-ray detectors and during the intense EM follow-up campaign associated with GW170817/GRB 170817A. In the next years, the searches for VHE EM counterparts will become more effective thanks to the Cherenkov Telescope Array (CTA): this instrument will be fundamental for the EM follow-up of transient GW events at VHE, owing to its unprecedented sensitivity, rapid response (few tens of seconds) and capability to monitor large sky areas via survey-mode operation. We present a comprehensive study on the prospects for joint GW and VHE EM observations of merging BNSs with Advanced LIGO, Advanced Virgo and CTA, based on detailed simulations of the multi-messenger emission and detection. We propose a new observational strategy optimized on the prior assumptions about the EM emission. The method can be further generalized to include other electromagnetic emission models. According to this study CTA will cover most of the region of the GW skymap for the intermediate and most energetic on-axis GRBs associated to the GW event. We estimate the expected joint GW and VHE EM detection rates and we found this rate goes from 0.08 up to 0.5 events per year for the most energetic EM sources.
International Nuclear Information System (INIS)
Brun, F.
2011-09-01
H.E.S.S. (High Energy Stereoscopic System) is an array of four very-high energy (VHE) gamma-ray telescopes located in Namibia. These telescopes use the atmospheric Cherenkov imaging technique to detect gamma-rays between 100 GeV and a few tens of TeV. The H.E.S.S. cameras, each composed of 960 photomultiplier tubes and a fast electronics, need an accurate calibration of the shower to electronic signal conversion. A spurious capacitive coupling between the photomultiplier tubes and the data acquisition system (the common modes) was revealed and corrected during this thesis, resulting in data of better quality. H.E.S.S. is ideally located to observe the inner regions of the Galactic plane. Hence, the Galactic Plane Survey has been one of the primary goal since the beginning of the array operation in 2004 and led to unveiling the diversity of the VHE gamma-ray sources. This thesis presents the search for VHE gamma-ray sources in the inner regions of the Galactic plane using the most sensitive semi-analytical model based analysis currently available. A search for transient sources was also performed for these regions using powerful methods based on the time difference between consecutive events. These methods have been precisely characterized by simulation and didn't lead to the detection of significant variable sources. The very-high energy gamma-ray emission from the W49 region and the supernova remnant W49B in particular has been revealed during this thesis. The analysis of this region and the implications of this discovery are described in detail in this manuscript. (author)
Attenuation of VHE Gamma Rays by the Milky Way Interstellar Radiation Field
Energy Technology Data Exchange (ETDEWEB)
Moskalenko, Igor V.; /Stanford U., HEPL; Porter, Troy A.; /Louisiana State U.; Strong, Andrew W.; /Garching, Max Planck Inst., MPE
2006-04-19
The attenuation of very high energy gamma rays by pair production on the Galactic interstellar radiation field has long been thought of as negligible. However, a new calculation of the interstellar radiation field consistent with multi-wavelength observations by DIRBE and FIRAS indicates that the energy density of the Galactic interstellar radiation field is higher, particularly in the Galactic center, than previously thought. We have made a calculation of the attenuation of very high energy gamma rays in the Galaxy using this new interstellar radiation field which takes into account its nonuniform spatial and angular distributions. We find that the maximum attenuation occurs around 100 TeV at the level of about 25% for sources located at the Galactic center, and is important for both Galactic and extragalactic sources.
Constraints on a Proton Synchrotron Origin of VHE Gamma Rays from the Extended Jet of AP Librae
Energy Technology Data Exchange (ETDEWEB)
Basumallick, Partha Pratim; Gupta, Nayantara, E-mail: basuparth314@gmail.com [Raman Research Institute, C. V. Raman Avenue, Sadashivanagar, Bangalore 560080 (India)
2017-07-20
The multiwavelength photon spectrum from the BL Lac object AP Librae extends from radio to TeV gamma rays. The X-ray to very high-energy gamma-ray emission from the extended jet of this source has been modeled with inverse Compton (IC) scattering of relativistic electrons off the cosmic microwave background (CMB) photons. The IC/CMB model requires the kpc-scale extended jet to be highly collimated with a bulk Lorentz factor close to 10. Here we discuss the possibility of a proton synchrotron origin of X-rays and gamma rays from the extended jet with a bulk Lorentz factor of 3. This scenario requires an extreme proton energy of 3.98 × 10{sup 21} eV and a high magnetic field of 1 mG of the extended jet with jet power ∼5 × 10{sup 48} erg s{sup −1} in particles and the magnetic field (which is more than 100 times the Eddington luminosity of AP Librae) to explain the very high-energy gamma-ray emission. Moreover, we have shown that X-ray emission from the extended jets of 3C 273 and PKS 0637-752 could be possible by proton synchrotron emission with jet power comparable to the Eddington luminosities.
SPECTRAL ANALYSIS AND INTERPRETATION OF THE {gamma}-RAY EMISSION FROM THE STARBURST GALAXY NGC 253
Energy Technology Data Exchange (ETDEWEB)
Abramowski, A. [Institut fuer Experimentalphysik, Universitaet Hamburg, Luruper Chaussee 149, D-22761 Hamburg (Germany); Acero, F. [Laboratoire Univers et Particules de Montpellier, Universite Montpellier 2, CNRS/IN2P3, CC 72, Place Eugene Bataillon, F-34095 Montpellier Cedex 5 (France); Aharonian, F.; Bernloehr, K.; Bochow, A. [Max-Planck-Institut fuer Kernphysik, P.O. Box 103980, D-69029 Heidelberg (Germany); Akhperjanian, A. G. [National Academy of Sciences of the Republic of Armenia, Yerevan (Armenia); Anton, G.; Balzer, A.; Brucker, J. [Physikalisches Institut, Universitaet Erlangen-Nuernberg, Erwin-Rommel-Str. 1, D-91058 Erlangen (Germany); Barnacka, A. [Nicolaus Copernicus Astronomical Center, ul. Bartycka 18, 00-716 Warsaw (Poland); Becherini, Y. [APC, AstroParticule et Cosmologie, Universite Paris Diderot, CNRS/IN2P3, CEA/lrfu, Observatoire de Paris, Sorbonne Paris Cite, 10, rue Alice Domon et Leonie Duquet, F-75205 Paris Cedex 13 (France); Becker, J. [Institut fuer Theoretische Physik, Lehrstuhl IV: Weltraum und Astrophysik, Ruhr-Universitaet Bochum, D-44780 Bochum (Germany); Birsin, E. [Institut fuer Physik, Humboldt-Universitaet zu Berlin, Newtonstr. 15, D-12489 Berlin (Germany); Biteau, J.; Brun, F. [Laboratoire Leprince-Ringuet, Ecole Polytechnique, CNRS/IN2P3, F-91128 Palaiseau (France); Boisson, C. [LUTH, Observatoire de Paris, CNRS, Universite Paris Diderot, 5 Place Jules Janssen, F-92190 Meudon (France); Bolmont, J. [LPNHE, Universite Pierre et Marie Curie Paris 6, Universite Denis Diderot Paris 7, CNRS/IN2P3, 4 Place Jussieu, F-75252, Paris Cedex 5 (France); Bordas, P. [Institut fuer Astronomie und Astrophysik, Universitaet Tuebingen, Sand 1, D-72076 Tuebingen (Germany); Brun, P. [CEA Saclay, DSM/IRFU, F-91191 Gif-Sur-Yvette Cedex (France); Bulik, T., E-mail: stefan.ohm@le.ac.uk [Astronomical Observatory, The University of Warsaw, Al. Ujazdowskie 4, 00-478 Warsaw (Poland); Collaboration: H.E.S.S. Collaboration; and others
2012-10-01
Very high energy (VHE; E {>=} 100 GeV) and high-energy (HE; 100 MeV {<=} E {<=} 100 GeV) data from {gamma}-ray observations performed with the H.E.S.S. telescope array and the Fermi-LAT instrument, respectively, are analyzed in order to investigate the non-thermal processes in the starburst galaxy NGC 253. The VHE {gamma}-ray data can be described by a power law in energy with differential photon index {Gamma} = 2.14 {+-} 0.18{sub stat} {+-} 0.30{sub sys} and differential flux normalization at 1 TeV of F{sub 0} = (9.6 {+-} 1.5{sub stat}(+ 5.7, -2.9){sub sys}) Multiplication-Sign 10{sup -14} TeV{sup -1} cm{sup -2} s{sup -1}. A power-law fit to the differential HE {gamma}-ray spectrum reveals a photon index of {Gamma} 2.24 {+-} 0.14{sub stat} {+-} 0.03{sub sys} and an integral flux between 200 MeV and 200 GeV of F(0.2-200 GeV) = (4.9 {+-} 1.0{sub stat} {+-} 0.3{sub sys}) Multiplication-Sign 10{sup -9} cm{sup -2} s{sup -1}. No evidence for a spectral break or turnover is found over the dynamic range of both the LAT instrument and the H.E.S.S. experiment: a combined fit of a power law to the HE and VHE {gamma}-ray data results in a differential photon index {Gamma} = 2.34 {+-} 0.03 with a p-value of 30%. The {gamma}-ray observations indicate that at least about 20% of the energy of the cosmic rays (CRs) capable of producing hadronic interactions is channeled into pion production. The smooth alignment between the spectra in the HE and VHE {gamma}-ray domain suggests that the same transport processes dominate in the entire energy range. Advection is most likely responsible for charged particle removal from the starburst nucleus from GeV to multiple TeV energies. In a hadronic scenario for the {gamma}-ray production, the single overall power-law spectrum observed would therefore correspond to the mean energy spectrum produced by the ensemble of CR sources in the starburst region.
Secondary-source energy-dispersive x-ray spectrometer
International Nuclear Information System (INIS)
Larsen, R.P.; Tisue, G.T.
1975-01-01
A secondary-source energy-dispersive x-ray spectrometer has been built and tested. In this instrument the primary source of x rays is a tungsten-target tube powered by a high-voltage (75 kV), a high-power (3.7 kW) generator from a wavelength spectrometer (G.E. XRD-6). The primary polychromatic x rays irradiate an elemental foil, the secondary source. Its characteristic essentially monochromatic x rays are used to irradiate the sample. Fluorescent x rays from the sample are detected and resolved by a lithium-drifted silicon detector, multichannel-analyzer system. The design of the instrument provides a convenient means for changing the secondary, and hence, the energy of the excitation radiation
Energy Technology Data Exchange (ETDEWEB)
Aliu, E. [Department of Physics and Astronomy, Barnard College, Columbia University, NY 10027 (United States); Archambault, S. [Physics Department, McGill University, Montreal, QC H3A 2T8 (Canada); Arlen, T. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Aune, T.; Bouvier, A. [Santa Cruz Institute for Particle Physics and Department of Physics, University of California, Santa Cruz, CA 95064 (United States); Beilicke, M.; Buckley, J. H.; Bugaev, V.; Dickherber, R. [Department of Physics, Washington University, St. Louis, MO 63130 (United States); Benbow, W. [Fred Lawrence Whipple Observatory, Harvard-Smithsonian Center for Astrophysics, Amado, AZ 85645 (United States); Byrum, K. [Argonne National Laboratory, 9700 S. Cass Avenue, Argonne, IL 60439 (United States); Cesarini, A.; Connolly, M. P. [School of Physics, National University of Ireland Galway, University Road, Galway (Ireland); Ciupik, L. [Astronomy Department, Adler Planetarium and Astronomy Museum, Chicago, IL 60605 (United States); Collins-Hughes, E. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Cui, W. [Department of Physics, Purdue University, West Lafayette, IN 47907 (United States); Duke, C. [Department of Physics, Grinnell College, Grinnell, IA 50112-1690 (United States); Dumm, J. [School of Physics and Astronomy, University of Minnesota, Minneapolis, MN 55455 (United States); Falcone, A. [Department of Astronomy and Astrophysics, 525 Davey Lab, Pennsylvania State University, University Park, PA 16802 (United States); Federici, S., E-mail: schroedter@veritas.sao.arizona.edu, E-mail: mccann@kicp.uchicago.edu, E-mail: nepomuk.otte@gmail.com [DESY, Platanenallee 6, 15738 Zeuthen (Germany); and others
2012-12-01
We present the results of a joint observational campaign between the Green Bank radio telescope and the VERITAS gamma-ray telescope, which searched for a correlation between the emission of very-high-energy (VHE) gamma rays (E {sub {gamma}} > 150 GeV) and giant radio pulses (GRPs) from the Crab pulsar at 8.9 GHz. A total of 15,366 GRPs were recorded during 11.6 hr of simultaneous observations, which were made across four nights in 2008 December and in 2009 November and December. We searched for an enhancement of the pulsed gamma-ray emission within time windows placed around the arrival time of the GRP events. In total, eight different time windows with durations ranging from 0.033 ms to 72 s were positioned at three different locations relative to the GRP to search for enhanced gamma-ray emission which lagged, led, or was concurrent with, the GRP event. Furthermore, we performed separate searches on main pulse GRPs and interpulse GRPs and on the most energetic GRPs in our data sample. No significant enhancement of pulsed VHE emission was found in any of the preformed searches. We set upper limits of 5-10 times the average VHE flux of the Crab pulsar on the flux simultaneous with interpulse GRPs on single-rotation-period timescales. On {approx}8 s timescales around interpulse GRPs, we set an upper limit of 2-3 times the average VHE flux. Within the framework of recent models for pulsed VHE emission from the Crab pulsar, the expected VHE-GRP emission correlations are below the derived limits.
Aliu, E.; Archambault, S.; Arlen, T.; Aune, T.; Beilicke, M.; Benbow, W.; Bouvier, A.; Buckley, J. H.; Bugaev, V.; Byrum, K.;
2012-01-01
We present the results of a joint observational campaign between the Green Bank radio telescope and the VERITAS gamma-ray telescope, which searched for a correlation between the emission of very-high-energy (VHE) gamma rays ( E(sub Gamma) > 150 GeV) and giant radio pulses (GRPs) from the Crab pulsar at 8.9 GHz. A total of 15,366 GRPs were recorded during 11.6 hr of simultaneous observations, which were made across four nights in 2008 December and in 2009 November and December. We searched for an enhancement of the pulsed gamma-ray emission within time windows placed around the arrival time of the GRP events. In total, eight different time windows with durations ranging from 0.033 ms to 72 s were positioned at three different locations relative to the GRP to search for enhanced gamma-ray emission which lagged, led, or was concurrent with, the GRP event. Furthermore, we performed separate searches on main pulse GRPs and interpulse GRPs and on the most energetic GRPs in our data sample. No significant enhancement of pulsed VHE emission was found in any of the preformed searches. We set upper limits of 5-10 times the average VHE flux of the Crab pulsar on the flux simultaneous with interpulse GRPs on single-rotation-period timescales. On approx. 8 s timescales around interpulse GRPs, we set an upper limit of 2-3 times the average VHE flux. Within the framework of recent models for pulsed VHE emission from the Crab pulsar, the expected VHE-GRP emission correlations are below the derived limits.
The H.E.S.S. Galactic plane survey
H. E. S. S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Benkhali, F. Ait; Angüner, E. O.; Arakawa, M.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Tjus, J. Becker; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bonnefoy, S.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Büchele, M.; Bulik, T.; Capasso, M.; Carrigan, S.; Caroff, S.; Carosi, A.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Colafrancesco, S.; Condon, B.; Conrad, J.; Davids, I. D.; Decock, J.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dutson, K.; Dyks, J.; Edwards, T.; Egberts, K.; Eger, P.; Emery, G.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Garrigoux, T.; Gast, H.; Gaté, F.; Giavitto, G.; Giebels, B.; Glawion, D.; Glicenstein, J. F.; Gottschall, D.; Grondin, M.-H.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holch, T. L.; Holler, M.; Horns, D.; Ivascenko, A.; Iwasaki, H.; Jacholkowska, A.; Jamrozy, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katsuragawa, M.; Katz, U.; Kerszberg, D.; Khangulyan, D.; Khélifi, B.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Marandon, V.; Malyshev, D.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Nakashima, S.; de Naurois, M.; Ndiyavala, H.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Paz Arribas, M.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poireau, V.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Rauth, R.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Rieger, F.; Rinchiuso, L.; Romoli, C.; Rowell, G.; Rudak, B.; Rulten, C. B.; Safi-Harb, S.; Sahakian, V.; Saito, S.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schandri, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seglar-Arroyo, M.; Settimo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Shiningayamwe, K.; Simoni, R.; Sol, H.; Spanier, F.; Spir-Jacob, M.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Steppa, C.; Sushch, I.; Takahashi, T.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tsirou, M.; Tsuji, N.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Zorn, J.; Żywucka, N.
2018-04-01
We present the results of the most comprehensive survey of the Galactic plane in very high-energy (VHE) γ-rays, including a public release of Galactic sky maps, a catalog of VHE sources, and the discovery of 16 new sources of VHE γ-rays. The High Energy Spectroscopic System (H.E.S.S.) Galactic plane survey (HGPS) was a decade-long observation program carried out by the H.E.S.S. I array of Cherenkov telescopes in Namibia from 2004 to 2013. The observations amount to nearly 2700 h of quality-selected data, covering the Galactic plane at longitudes from ℓ = 250° to 65° and latitudes |b|≤ 3°. In addition to the unprecedented spatial coverage, the HGPS also features a relatively high angular resolution (0.08° ≈ 5 arcmin mean point spread function 68% containment radius), sensitivity (≲1.5% Crab flux for point-like sources), and energy range (0.2-100 TeV). We constructed a catalog of VHE γ-ray sources from the HGPS data set with a systematic procedure for both source detection and characterization of morphology and spectrum. We present this likelihood-based method in detail, including the introduction of a model component to account for unresolved, large-scale emission along the Galactic plane. In total, the resulting HGPS catalog contains 78 VHE sources, of which 14 are not reanalyzed here, for example, due to their complex morphology, namely shell-like sources and the Galactic center region. Where possible, we provide a firm identification of the VHE source or plausible associations with sources in other astronomical catalogs. We also studied the characteristics of the VHE sources with source parameter distributions. 16 new sources were previously unknown or unpublished, and we individually discuss their identifications or possible associations. We firmly identified 31 sources as pulsar wind nebulae (PWNe), supernova remnants (SNRs), composite SNRs, or gamma-ray binaries. Among the 47 sources not yet identified, most of them (36) have possible
Ahnen, M. L.; Ansoldi, S.; Antonelli, L. A.; Arcaro, C.; Babić, A.; Banerjee, B.; Bangale, P.; Barres de Almeida, U.; Barrio, J. A.; Becerra González, J.; Bednarek, W.; Bernardini, E.; Berti, A.; Bhattacharyya, W.; Biasuzzi, B.; Biland, A.; Blanch, O.; Bonnefoy, S.; Bonnoli, G.; Carosi, R.; Carosi, A.; Chatterjee, A.; Colin, P.; Colombo, E.; Contreras, J. L.; Cortina, J.; Covino, S.; Cumani, P.; da Vela, P.; Dazzi, F.; de Angelis, A.; de Lotto, B.; de Oña Wilhelmi, E.; di Pierro, F.; Doert, M.; Domínguez, A.; Dominis Prester, D.; Dorner, D.; Doro, M.; Einecke, S.; Eisenacher Glawion, D.; Elsaesser, D.; Engelkemeier, M.; Fallah Ramazani, V.; Fernández-Barral, A.; Fidalgo, D.; Fonseca, M. V.; Font, L.; Fruck, C.; Galindo, D.; García López, R. J.; Garczarczyk, M.; Gaug, M.; Giammaria, P.; Godinović, N.; Gora, D.; Guberman, D.; Hadasch, D.; Hahn, A.; Hassan, T.; Hayashida, M.; Herrera, J.; Hose, J.; Hrupec, D.; Ishio, K.; Konno, Y.; Kubo, H.; Kushida, J.; Kuveždić, D.; Lelas, D.; Lindfors, E.; Lombardi, S.; Longo, F.; López, M.; Maggio, C.; Majumdar, P.; Makariev, M.; Maneva, G.; Manganaro, M.; Mannheim, K.; Maraschi, L.; Mariotti, M.; Martínez, M.; Mazin, D.; Menzel, U.; Minev, M.; Mirzoyan, R.; Moralejo, A.; Moreno, V.; Moretti, E.; Neustroev, V.; Niedzwiecki, A.; Nievas Rosillo, M.; Nilsson, K.; Ninci, D.; Nishijima, K.; Noda, K.; Nogués, L.; Paiano, S.; Palacio, J.; Paneque, D.; Paoletti, R.; Paredes, J. M.; Paredes-Fortuny, X.; Pedaletti, G.; Peresano, M.; Perri, L.; Persic, M.; Prada Moroni, P. G.; Prandini, E.; Puljak, I.; Garcia, J. R.; Reichardt, I.; Rhode, W.; Ribó, M.; Rico, J.; Righi, C.; Saito, T.; Satalecka, K.; Schroeder, S.; Schweizer, T.; Sitarek, J.; Šnidarić, I.; Sobczynska, D.; Stamerra, A.; Strzys, M.; Surić, T.; Takalo, L.; Tavecchio, F.; Temnikov, P.; Terzić, T.; Tescaro, D.; Teshima, M.; Torres, D. F.; Torres-Albà, N.; Treves, A.; Vanzo, G.; Vazquez Acosta, M.; Vovk, I.; Ward, J. E.; Will, M.; Zarić, D.; MAGIC Collaboration; Bosch-Ramon, V.; Pooley, G. G.; Trushkin, S. A.; Zanin, R.
2017-12-01
The microquasar Cygnus X-1 displays the two typical soft and hard X-ray states of a black hole transient. During the latter, Cygnus X-1 shows a one-sided relativistic radio-jet. Recent detection of the system in the high energy (HE; E ≳ 60 MeV) gamma-ray range with Fermi-LAT associates this emission with the outflow. Former MAGIC observations revealed a hint of flaring activity in the very high-energy (VHE; E ≳ 100 GeV) regime during this X-ray state. We analyse ∼97 h of Cygnus X-1 data taken with the MAGIC telescopes between July 2007 and October 2014. To shed light on the correlation between hard X-ray and VHE gamma rays as previously suggested, we study each main X-ray state separately. We perform an orbital phase-folded analysis to look for variability in the VHE band. Additionally, to place this variability behaviour in a multiwavelength context, we compare our results with Fermi-LAT, AGILE, Swift-BAT, MAXI, RXTE-ASM, AMI and RATAN-600 data. We do not detect Cygnus X-1 in the VHE regime. We establish upper limits for each X-ray state, assuming a power-law distribution with photon index Γ = 3.2. For steady emission in the hard and soft X-ray states, we set integral upper limits at 95 per cent confidence level for energies above 200 GeV at 2.6 × 10-12 photons cm-2 s-1 and 1.0 × 10-11 photons cm-2 s-1, respectively. We rule out steady VHE gamma-ray emission above this energy range, at the level of the MAGIC sensitivity, originating in the interaction between the relativistic jet and the surrounding medium, while the emission above this flux level produced inside the binary still remains a valid possibility.
The opacity of the universe for high and very high energy {gamma}-rays
Energy Technology Data Exchange (ETDEWEB)
Meyer, Manuel
2013-08-15
The flux of high energy (HE, energy 100 MeV
Study of extragalactic sources with H.E.S.S
International Nuclear Information System (INIS)
Giebels, Berrie
2007-01-01
The field of Very High Energy (VHE) γ-ray emitting extragalactic sources has considerably evolved since the new generation of atmospheric Cerenkov telescopes (ACT) of improved sensitivity, such as H.E.S.S. array and the MAGIC ACT, have started operating. This has led to a wealth of new clues about emission mechanisms at high energy through the discovery of new sources, more accurate spectra and temporal studies of sources known previously, and simultaneous multi-wavelength (MWL) campaigns since broad band variability is a key phenomenon to the underlying physical mechanisms at play. The fact that some of these new sources are located at redshifts close to z ∼ 0.2 makes them powerful probes of the Extragalactic Background Light (EBL) through the attenuation of γ-rays above 100 GeV
Simulated gamma-ray pulse profile of the Crab pulsar with the Cherenkov Telescope Array
Burtovoi, A.; Zampieri, L.
2016-07-01
We present simulations of the very high energy (VHE) gamma-ray light curve of the Crab pulsar as observed by the Cherenkov Telescope Array (CTA). The CTA pulse profile of the Crab pulsar is simulated with the specific goal of determining the accuracy of the position of the interpulse. We fit the pulse shape obtained by the Major Atmospheric Gamma-Ray Imaging Cherenkov (MAGIC) telescope with a three-Gaussian template and rescale it to account for the different CTA instrumental and observational configurations. Simulations are performed for different configurations of CTA and for the ASTRI (Astrofisica con Specchi a Tecnologia Replicante Italiana) mini-array. The northern CTA configuration will provide an improvement of a factor of ˜3 in accuracy with an observing time comparable to that of MAGIC (73 h). Unless the VHE spectrum above 1 TeV behaves differently from what we presently know, unreasonably long observing times are required for a significant detection of the pulsations of the Crab pulsar with the high-energy-range sub-arrays. We also found that an independent VHE timing analysis is feasible with Large Size Telescopes. CTA will provide a significant improvement in determining the VHE pulse shape parameters necessary to constrain theoretical models of the gamma-ray emission of the Crab pulsar. One of such parameters is the shift in phase between peaks in the pulse profile at VHE and in other energy bands that, if detected, may point to different locations of the emission regions.
VERITAS OBSERVATIONS OF GAMMA-RAY BURSTS DETECTED BY SWIFT
International Nuclear Information System (INIS)
Acciari, V. A.; Benbow, W.; Aliu, E.; Errando, M.; Arlen, T.; Aune, T.; Beilicke, M.; Buckley, J. H.; Bugaev, V.; Bradbury, S. M.; Byrum, K.; Cannon, A.; Collins-Hughes, E.; Cesarini, A.; Connolly, M. P.; Christiansen, J. L.; Ciupik, L.; Cui, W.; Duke, C.; Falcone, A.
2011-01-01
We present the results of 16 Swift-triggered Gamma-ray burst (GRB) follow-up observations taken with the Very Energetic Radiation Imaging Telescope Array System (VERITAS) telescope array from 2007 January to 2009 June. The median energy threshold and response time of these observations were 260 GeV and 320 s, respectively. Observations had an average duration of 90 minutes. Each burst is analyzed independently in two modes: over the whole duration of the observations and again over a shorter timescale determined by the maximum VERITAS sensitivity to a burst with a t –1.5 time profile. This temporal model is characteristic of GRB afterglows with high-energy, long-lived emission that have been detected by the Large Area Telescope on board the Fermi satellite. No significant very high energy (VHE) gamma-ray emission was detected and upper limits above the VERITAS threshold energy are calculated. The VERITAS upper limits are corrected for gamma-ray extinction by the extragalactic background light and interpreted in the context of the keV emission detected by Swift. For some bursts the VHE emission must have less power than the keV emission, placing constraints on inverse Compton models of VHE emission.
HESS J1427−608: AN UNUSUAL HARD, UNBROKEN γ -RAY SPECTRUM IN A VERY WIDE ENERGY RANGE
Energy Technology Data Exchange (ETDEWEB)
Guo, Xiao-Lei; Gao, Wei-Hong [Department of Physics and Institute of Theoretical Physics, Nanjing Normal University, Nanjing 210046 (China); Xin, Yu-Liang; Liao, Neng-Hui; Yuan, Qiang; He, Hao-Ning; Fan, Yi-Zhong; Liu, Si-Ming, E-mail: yuanq@pmo.ac.cn, E-mail: gaoweihong@njnu.edu.cn, E-mail: liusm@pmo.ac.cn [Key Laboratory of Dark Matter and Space Astronomy, Purple Mountain Observatory, Chinese Academy of Sciences, Nanjing 210008 (China)
2017-01-20
We report the detection of a GeV γ -ray source that spatially overlaps and is thus very likely associated with the unidentified very high energy (VHE) γ -ray source HESS J1427−608 with the Pass 8 data recorded by the Fermi Large Area Telescope . The photon spectrum of this source is best described by a power law with an index of 1.85 ± 0.17 in the energy range of 3–500 GeV, and the measured flux connects smoothly with that of HESS J1427−608 at a few hundred gigaelectronvolts. This source shows no significant extension and time variation. The broadband GeV to TeV emission over four decades of energies can be well fitted by a single power-law function with an index of 2.0, without obvious indication of spectral cutoff toward high energies. Such a result implies that HESS J1427−608 may be a PeV particle accelerator. We discuss the possible nature of HESS J1427−608 according to the multiwavelength spectral fittings. Given the relatively large errors, either a leptonic or a hadronic model can explain the multiwavelength data from radio to VHE γ -rays. The inferred magnetic field strength is a few micro-Gauss, which is smaller than the typical values of supernova remnants (SNRs) and is consistent with some pulsar wind nebulae (PWNe). On the other hand, the flat γ -ray spectrum is slightly different from typical PWNe but is similar to that of some known SNRs.
X-ray sources in regions of star formation. II. The pre-main-sequence G star HDE 283572
International Nuclear Information System (INIS)
Walter, F.M.; Brown, A.; Linsky, J.L.; Rydgren, A.E.; Vrba, F.; Joint Institute for Laboratory Astrophysics, Boulder, CO; Computer Sciences Corp., El Segundo, CA; Naval Observatory, Flagstaff, AZ)
1987-01-01
This paper reports the detection of HDE 283572, a ninth-magnitude G star 8 arcmin south of RY Tau, as a bright X-ray source. The observations reveal this object to be a fairly massive (about 2 solar masses) pre-main-sequence star associated with the Taurus-Auriga star formation complex. It exhibits few of the characteristics of the classical T Tauri stars and is a good example of a naked T Tauri star. The star is a mid-G subgiant, of about three solar radii and rotates with a period of 1.5 d. The coronal and chromospheric surface fluxes are similar to those of the most active late type stars (excluding T Tauri stars). The X-ray and UV lines most likely arise in different atmospheric structures. Radiative losses are some 1000 times the quiet solar value and compare favorably with those of T Tauri stars. 49 references
Very high energy gamma ray astrophysics. Progress report, August 1, 1980-July 31, 1981
International Nuclear Information System (INIS)
Lamb, R.C.
1981-04-01
Very high energy (VHE) gamma ray astronomy gives insight into fundamental questions regarding the origins of cosmic rays and the types of particle acceleration mechanisms which operate in nature. VHE photons are detected by means of the Cerenkov light their secondaries produce in the atmosphere. During June - September 1981 the solar collectors at Edwards Air Force Base will be used to detect the Cerenkov light from the photons from Cygnus X-3 thus extending its observation into a previously unexplored region. The time of each detector event will be recorded to the nearest 0.5 ms. If Cygnus X-3 is the neutron star remnant of a recent (unseen) supernova, then the VHE gamma rays may be pulsed at its rotation rate, and the data obtained will allow a sensitive test of this possibility. The equipment for the summer observations is nearly ready and will be tested in May prior to any early run in June
Detection of Primordial Magnetic Fields in TeV gamma-ray data
Wingler, A.
The analysis of the time-variable flux of γ-ray photons from extragalactic sources is currently the only proposed way to directly determine the magnetic field strengths in intergalactic space - far away from galaxies and clusters (in the cosmological "voids") - in the range below about 10,10 Gauss (Plaga 1995). Remnant magnetic fields with field strengths much below this, which may well have formed in early cosmological times, could exist in these voids. Due to their interaction with infrared photons TeV gamma-rays induce pair production in intergalactic space. The electrons and positrons are deflected by ambient magnetic fields and produce γ-rays via inverse Compton scattering that are delayed with respect to the original photons in an energy-dependent, characteristic manner. A standard method to identify these delayed events in a data sample of a source with a variable VHE γ-ray flux (as available from several Cherenkov telescope experiments for the high-emission phase of the AGN Mrk 501 in 1997) is described. Monte-Carlo simulations of existing data sets (taking into backgrounds and instrumental limitations) are used to explore how sensitive data sets similar to the existing ones are to primordial magnetic fields. We find that about 22000 (15000) events from a source with characteristics similar to Mrk 501 are needed to detect a primordial B field of 3 (10) atto Gauss (10,18 G) with a 3 significance.
Radio and X-ray properties of the source G29.37+0.1 linked to HESS J1844-030
Castelletti, G.; Supan, L.; Petriella, A.; Giacani, E.; Joshi, B. C.
2017-06-01
Aims: We report on the first detailed multiwavelength study of the radio source G29.37+0.1, which is an as-yet-unclassified object linked to the very-high-energy γ-emitting source HESS J1844-030. The origin of the multiwavelength emission toward G29.37+0.1 has not been clarified so far, leaving open the question about the physical relationship between these sources. Methods: Using observations carried out with the Giant Metrewave Radio Telescope (GMRT), we performed high-quality full-synthesis imaging at 610 MHz of the field containing G29.37+0.1. The obtained data, combined with observations at 1400 MHz from The Multi-Array Galactic Plane Imaging Survey (MAGPIS) were used to investigate in detail the properties of its radio emission. Additionally, we reprocessed archival data obtained with the XMM-Newton and Chandra observatories in order to get a multiwavelength view of this unusual source. Results: The radio source G29.37+0.1 mainly consists of a bright twisted structure, named the S-shaped feature. The high sensitivity of the new GMRT observations allowed the identification of potential lobes, jets, and a nuclear central region in the S-shaped morphology of G29.37+0.1. We also highlight the detection of diffuse and low surface brightness emission enveloping the brightest emitting regions. The brightest emission in G29.37+0.1 has a radio synchrotron spectral index α = 0.59 ± 0.09. Variations in the spectral behaviour are observed across the whole radio source with the flattest spectral features in the central nuclear and jets components (α 0.3). These results lead us to conclude that the brightest radio emission from G29.37+0.1 likely represents a newly recognized radio galaxy. The identification of optical and infrared counterparts to the emission arising from the core of G29.37+0.1 strengthens our interpretation of an extragalactic origin of the radio emission. We performed several tests to explain the physical mechanism responsible for the observed X-ray
Optical technologies for extreme-ultraviolet and soft X-ray coherent sources
International Nuclear Information System (INIS)
Canova, Federico; Poletto, Luca
2015-01-01
The book reviews the most recent achievements in optical technologies for XUV and X-ray coherent sources. Particular attention is given to free-electron-laser facilities, but also to other sources available at present, such as synchrotrons, high-order laser harmonics and X-ray lasers. The optical technologies relevant to each type of source are discussed. In addition, the main technologies used for photon handling and conditioning, namely multilayer mirrors, adaptive optics, crystals and gratings are explained. Experiments using coherent light received during the last decades a lot of attention for the X-ray regime. Strong efforts were taken for the realization of almost fully coherent sources, e.g. the free-electron lasers, both as independent sources in the femtosecond and attosecond regimes and as seeding sources for free-electron-lasers and X-ray gas lasers. In parallel to the development of sources, optical technologies for photon handling and conditioning of such coherent and intense X-ray beams advanced. New problems were faced for the realization of optical components of beamlines demanding to manage coherent X-ray photons, e.g. the preservation of coherence and time structure of ultra short pulses.
Aleksić, J.; Antonelli, L A; Antoranz, P; Babic, A; Bangale, P; Barrio, J A; González, J Becerra; Bednarek, W; Bernardini, E; Biasuzzi, B; Biland, A; Blanch, O; Bonnefoy, S; Bonnoli, G; Borracci, F; Bretz, T; Carmona, E; Carosi, A; Colin, P; Colombo, E; Contreras, J.L; Cortina, J; Covino, S; Da Vela, P; Dazzi, F; De Angelis, A; De Caneva, G; De Lotto, B; Wilhelmi, E de Oña; Mendez, C Delgado; Prester, D Dominis; Dorner, D; Doro, M; Einecke, S; Eisenacher, D; Elsaesser, D; Fidalgo, D; Fonseca, M.V; Font, L; Frantzen, K; Fruck, C; Galindo, D; López, R J García; Garczarczyk, M; Terrats, D Garrido; Gaug, M; Godinović, N; Muñoz, A González; Gozzini, S R; Hadasch, D; Hanabata, Y; Hayashida, M; Herrera, J; Hose, J; Hrupec, D; Idec, W; Kadenius, V; Kellermann, H; Knoetig, M L; Kodani, K; Konno, Y; Krause, J; Kubo, H; Kushida, J; La Barbera, A; Lelas, D; Lewandowska, N; Lindfors, E; Lombardi, S; Longo, F; López, M; López-Coto, R; López-Oramas, A; Lorenz, E; Lozano, I; Makariev, M; Mallot, K; Maneva, G; Mannheim, K; Maraschi, L; Marcote, B; Mariotti, M; Martínez, M; Mazin, D; Menzel, U; Miranda, J M; Mirzoyan, R; Moralejo, A; Munar-Adrover, P; Nakajima, D; Neustroev, V; Niedzwiecki, A; Nilsson, K; Nishijima, K; Noda, K; Orito, R; Overkemping, A; Paiano, S; Palatiello, M; Paneque, D; Paoletti, R; Paredes, J M; Paredes-Fortuny, X; Persic, M; Poutanen, J; Moroni, P G Prada; Prandini, E; Puljak, I; Reinthal, R; Rhode, W; Ribó, M; Rico, J; Garcia, J Rodriguez; Rügamer, S; Saito, T; Saito, K; Satalecka, K; Scalzotto, V; Scapin, V; Schultz, C; Schweizer, T; Sillanpää, A; Sitarek, J; Snidaric, I; Sobczynska, D; Spanier, F; Stamerra, A; Steinbring, T; Storz, J; Strzys, M; Takalo, L; Takami, H; Tavecchio, F; Temnikov, P; Terzić, T; Tescaro, D; Teshima, M; Thaele, J; Tibolla, O; Torres, D F; Toyama, T; Treves, A; Vogler, P; Will, M; Zanin, R; D'Ammando, F; Lähteenmäki, A; Tornikoski, M; Hovatta, T; Readhead, A C S; Max-Moerbeck, W; Richards, J.L
2015-01-01
PG 1553+113 is a very-high-energy (VHE, E>100 GeV) gamma-ray emitter classified as a BL Lac object. Its redshift is constrained by intergalactic absorption lines in the range 0.40.2). The observed curvature is compatible with the extragalactic background light (EBL) imprint predicted by the current generation of EBL models assuming a redshift z~0.4. New constraints on the redshift were derived from the VHE spectrum. These constraints are compatible with previous limits and suggest that the source is most likely located around the optical lower limit, z=0.4. Finally, we find that the synchrotron self-Compton (SSC) model gives a satisfactory description of the observed multi-wavelength spectral energy distribution during the flare.
VLBI OBSERVATIONS OF THE JET IN M 87 DURING THE VERY HIGH ENERGY {gamma}-RAY FLARE IN 2010 APRIL
Energy Technology Data Exchange (ETDEWEB)
Hada, Kazuhiro; Giroletti, Marcello; Giovannini, Gabriele [INAF Istituto di Radioastronomia, via Gobetti 101, I-40129 Bologna (Italy); Kino, Motoki; Nagai, Hiroshi [National Astronomical Observatory of Japan, Osawa, Mitaka, Tokyo 181-8588 (Japan); Doi, Akihiro [Institute of Space and Astronautical Science, Japan Aerospace Exploration Agency, 3-1-1 Yoshinodai, Chuo, Sagamihara 252-5210 (Japan); Hagiwara, Yoshiaki; Honma, Mareki; Kawaguchi, Noriyuki [Department of Astronomical Science, Graduate University for Advanced Studies (SOKENDAI), 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan)
2012-11-20
We report on the detailed radio status of the M 87 jet during the very high energy (VHE) {gamma}-ray flaring event in 2010 April, obtained from high-resolution, multi-frequency, phase-referencing Very Long Baseline Array observations. We especially focus on the properties of the jet base (the radio core) and the peculiar knot HST-1, which are currently favored as the {gamma}-ray emitting sites. During the VHE flaring event, the HST-1 region remains stable in terms of its structure and flux density in the optically thin regime above 2 GHz, being consistent with no signs of enhanced activities reported at X-ray for this feature. The radio core shows an inverted spectrum at least up to 43 GHz during this event. Astrometry of the core position, which is specified as {approx}20 R {sub s} from the central engine in our previous study, shows that the core position is stable on a level of 4 R {sub s}. The core at 43 and 22 GHz tends to show slightly ({approx}10%) higher flux level near the date of the VHE flux peak compared with the epochs before/after the event. The size of the 43 GHz core is estimated to be {approx}17 R {sub s}, which is close to the size of the emitting region suggested from the observed timescale of rapid variability at VHE. These results tend to favor the scenario that the VHE {gamma}-ray flare in 2010 April is associated with the radio core.
Arlen, T.; Aune, T.; Beilicke, M.; Benbow, W.; Bouvier, A.; Buckley, J. H.; Bugaev, V.; Byrum, K.; Cannon, A.; Cesarini, A.;
2012-01-01
Observations of radio halos and relics in galaxy clusters indicate efficient electron acceleration. Protons should likewise be accelerated and, on account of weak energy losses, can accumulate, suggesting that clusters may also be sources of very high energy (VHE; E greater than100 GeV) gamma-ray emission. We report here on VHE gamma-ray observations of the Coma galaxy cluster with the VERITAS array of imaging Cerenkov telescopes, with complementing Fermi Large Area Telescope observations at GeV energies. No significant gamma-ray emission from the Coma Cluster was detected. Integral flux upper limits at the 99 confidence level were measured to be on the order of (2-5) x 10(sup -8) photons m(sup -2) s(sup -1) (VERITAS,greater than 220 GeV) and approximately 2 x 10(sup -6) photons m(sup -2) s(sup -1) (Fermi, 1-3 GeV), respectively. We use the gamma-ray upper limits to constrain cosmic rays (CRs) and magnetic fields in Coma. Using an analytical approach, the CR-to-thermal pressure ratio is constrained to be less than 16% from VERITAS data and less than 1.7% from Fermi data (averaged within the virial radius). These upper limits are starting to constrain the CR physics in self-consistent cosmological cluster simulations and cap the maximum CR acceleration efficiency at structure formation shocks to be 50. Alternatively, this may argue for non-negligible CR transport processes such as CR streaming and diffusion into the outer cluster regions. Assuming that the radio-emitting electrons of the Coma halo result from hadronic CR interactions, the observations imply a lower limit on the central magnetic field in Coma of approximately (2-5.5)microG, depending on the radial magnetic field profile and on the gamma-ray spectral index. Since these values are below those inferred by Faraday rotation measurements in Coma (for most of the parameter space), this renders the hadronic model a very plausible explanation of the Coma radio halo. Finally, since galaxy clusters are dark
The opacity of the universe for high and very high energy γ-rays
International Nuclear Information System (INIS)
Meyer, Manuel
2013-08-01
The flux of high energy (HE, energy 100 MeV or similar 100 GeV) γ-rays originating from cosmological sources is attenuated due to pair production in interactions with photons at ultraviolet to infrared wavelengths of the extragalactic background light (EBL). The main components contributing to the EBL photon density are the starlight integrated over cosmic time and the starlight reprocessed by dust in galaxies. Consequently, the EBL is an integral measure of the cosmic star formation history. Depending on the source distance, the Universe should be opaque to γ-rays above a certain energy. Nevertheless, the number of detected γ-ray sources has increased continuously in recent years. VHE emitting objects beyond redshifts of z>0.5 have been detected with imaging air Cherenkov telescopes (IACTs), while HE γ-rays from active galactic nuclei (AGN) above redshifts z>or similar 3 have been observed with the Large Area Telescope (LAT) on board the Fermi satellite. In this work, a large sample of VHE γ-ray spectra will be combined with data of the Fermi-LAT to derive upper limits on the EBL photon density at z = 0. Generic EBL realizations are used to correct AGN spectra for absorption, which are subsequently tested against model assumptions. The evolution of the EBL with redshift is accounted for, and a possible formation of electromagnetic cascades is considered. As a result, the EBL density is constrained over almost three orders of magnitude in wavelength, between 0.4 μm and 100 μm. At optical wavelengths, an EBL intensity above 24 nW m -2 sr -1 is ruled out, and between 8 μm and 31 μm it is limited to be below 5 nW m -2 sr -1 . In the infrared, the constraints are within a factor ∝ 2 of lower limits derived from galaxy number counts. Additionally,the behavior of VHE spectra in the transition from the optical depth regimes τ γγ γγ ≥2 is investigated. The absorption-corrected spectra consistently show an upturn at high optical depths, significant at the
The Extended X-ray Nebula of PSR J1420-6048
Energy Technology Data Exchange (ETDEWEB)
Van Etten, Adam; Romani, Roger W.; /Stanford U., Phys. Dept.
2011-08-19
The vicinity of the unidentified EGRET source 3EG J1420-6038 has undergone extensive study in the search for counterparts, revealing the energetic young pulsar PSR J1420-6048 and its surrounding wind nebula as a likely candidate for at least part of the emission from this bright and extended gamma-ray source. We report on new Suzaku observations of PSR J1420-6048, along with analysis of archival XMM Newton data. The low background of Suzaku permits mapping of the extended X-ray nebula, indicating a tail stretching {approx} 8 minutes north of the pulsar. The X-ray data, along with archival radio and VHE data, hint at a pulsar birthsite to the North, and yield insights into its evolution and the properties of the ambient medium. We further explore such properties by modeling the spectral energy distribution (SED) of the extended nebula.
Li, Hui-Cai; Chen, Ming-Jun; Jia, Huan-Yu; Gao, Bo; Wu, Han-Rong; Yao, Zhi-Guo; Yuo, Xiao-Hao; Zhou, Bin; Zhu, Feng-Rong
2014-01-01
It is prpopsed that a water Cherenkov detector array, LHAASO-WCDA, is to be built at Shangri-la, Yunnan Province, China. As one of the major components of the LHAASO project, the main purpose of it is to survey the northern sky for gamma ray sources in the energy range of 100 GeV-30 TeV. In order to design the water Cherenkov array efficiently to economize the budget, a Monte Carlo simulation is carried out. With the help of the simulation, the cost performance of different configurations of the array are obtained and compared with each other, serving as a guide for the more detailed design of the experiment in the next step.
International Nuclear Information System (INIS)
Li Huicai; Chen Mingjun; Gao Bo; Wu Hanrong; Yao Zhiguo; Zhou Bin; Jia Huanyu; Zhu Fengrong; You Xiaohao
2014-01-01
It is proposed that a water Cherenkov detector array, LHAASO-WCDA, is to be built at Shangri-la, Yunnan Province, China. As one of the major components of the LHAASO project, the main purpose of it is to survey the northern sky for gamma ray sources in the energy range of 100 GeV-30 TeV. In order to design the water Cherenkov array efficiently to economize the budget, a Monte Carlo simulation is carried out. With the help of the simulation, the cost performance of different configurations of the array are obtained and compared with each other, serving as a guide for the more detailed design of the experiment in the next step. (authors)
Observations of the unidentified gamma-ray source TeV J2032+4130 by Veritas
Energy Technology Data Exchange (ETDEWEB)
Aliu, E.; Errando, M. [Department of Physics and Astronomy, Barnard College, Columbia University, NY 10027 (United States); Aune, T. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Behera, B.; Chen, X.; Federici, S. [DESY, Platanenallee 6, D-15738 Zeuthen (Germany); Beilicke, M.; Buckley, J. H.; Bugaev, V. [Department of Physics, Washington University, St. Louis, MO 63130 (United States); Benbow, W.; Cerruti, M. [Fred Lawrence Whipple Observatory, Harvard-Smithsonian Center for Astrophysics, Amado, AZ 85645 (United States); Berger, K. [Department of Physics and Astronomy and the Bartol Research Institute, University of Delaware, Newark, DE 19716 (United States); Bird, R. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Cardenzana, J. V. [Department of Physics and Astronomy, Iowa State University, Ames, IA 50011 (United States); Ciupik, L. [Astronomy Department, Adler Planetarium and Astronomy Museum, Chicago, IL 60605 (United States); Connolly, M. P. [School of Physics, National University of Ireland Galway, University Road, Galway (Ireland); Cui, W. [Department of Physics, Purdue University, West Lafayette, IN 47907 (United States); Duke, C. [Department of Physics, Grinnell College, Grinnell, IA 50112-1690 (United States); Dumm, J. [School of Physics and Astronomy, University of Minnesota, Minneapolis, MN 55455 (United States); Falcone, A., E-mail: pratik.majumdar@saha.ac.in, E-mail: gareth.hughes@desy.de [Department of Astronomy and Astrophysics, 525 Davey Lab, Pennsylvania State University, University Park, PA 16802 (United States); and others
2014-03-01
TeV J2032+4130 was the first unidentified source discovered at very high energies (VHEs; E > 100 GeV), with no obvious counterpart in any other wavelength. It is also the first extended source to be observed in VHE gamma rays. Following its discovery, intensive observational campaigns have been carried out in all wavelengths in order to understand the nature of the object, which have met with limited success. We report here on a deep observation of TeV J2032+4130 based on 48.2 hr of data taken from 2009 to 2012 by the Very Energetic Radiation Imaging Telescope Array System experiment. The source is detected at 8.7 standard deviations (σ) and is found to be extended and asymmetric with a width of 9.'5 ± 1.'2 along the major axis and 4.'0 ± 0.'5 along the minor axis. The spectrum is well described by a differential power law with an index of 2.10 ± 0.14{sub stat} ± 0.21{sub sys} and a normalization of (9.5 ± 1.6{sub stat} ± 2.2{sub sys}) × 10{sup –13} TeV{sup –1} cm{sup –2} s{sup –1} at 1 TeV. We interpret these results in the context of multiwavelength scenarios which particularly favor the pulsar wind nebula interpretation.
ESR examination of food for treatment with ionizing rays
International Nuclear Information System (INIS)
Erning, D.
1994-01-01
The author reports on routine uses of electron spin resonance spectroscopy in order to detect treatment with ionizing rays of poultry, fish, shellfish, spices, currents, nuts, dehydrated fruit and packaging material. (vhe) [de
X-RAY FLARING ACTIVITY OF MRK 421 IN THE FIRST HALF OF 2013
Energy Technology Data Exchange (ETDEWEB)
Kapanadze, B.; Kapanadze, S.; Tabagari, L. [E. Kharadze Abastumani Astrophysical Observatory, Ilia State University, Colokashvili Av. 3/5, Tbilisi, 0162, Georgia (United States); Dorner, D. [Universität Würzburg, Institute for Theoretical Physics and Astrophysics, Emil-Fischer-Str. 31, D-97074 Würtzburg (Germany); Vercellone, S.; Romano, P. [INAF, Istituto di Astrofisica Spaziale e Fisica Cosmica, Via U. La Malfa 153, I-90146 Palermo (Italy); Aller, H.; Aller, M.; Hughes, P.; Reynolds, M. [Astronomy Department, University of Michigan, Ann Arbor, MI 48109-1107 (United States)
2016-11-01
We present the results of the Swift and NuSTAR observations of the nearby BL Lac object Mrk 421 during 2013 January–June. The source exhibited a strong long-term variability in the 0.3–10 keV and 3–79 keV bands with the maximum-to-minimum daily-binned flux ratios of 22 and 95, respectively, in about 3 months, mainly due to unprecedented strong X-ray outbursts by more than an order of magnitude in both bands within 2 weeks in 2013 April when the 0.3–10 keV count rate exceeded the level of 200 cts s{sup −1} for the first time, and Mrk 421 became one of the brightest sources in the X-ray sky. The source was also very active on intra-day timescales, and it showed flux doubling and halving timescales of 1.16–7.20 hr and 1.04–3.54 hr, respectively. On some occasions, the flux varied by 4%–23% within 300–840 s. During this period, the source also exhibited some of the most extreme X-ray spectral variability ever reported for BL Lacs—the location of the synchrotron spectral energy distribution peak shifted from a few eV to ∼10 keV, and the photon index at 1 keV and curvature parameter varied on timescales from a few weeks down to intervals shorter than 1 ks. MAGIC and First G-APD Cherenkov Telescope observations also revealed a very strong very high energy (VHE) flare during April 11–17. The UV and HE γ -ray flares were much weaker compared to their X-ray counterparts, and they generally showed significantly stronger correlation with each other than with the X-ray fluxes.
Constraints on particle acceleration in SS433/W50 from MAGIC and H.E.S.S. observations
MAGIC Collaboration; Ahnen, M. L.; Ansoldi, S.; Antonelli, L. A.; Arcaro, C.; Babić, A.; Banerjee, B.; Bangale, P.; de Almeida, U. Barres; Barrio, J. A.; González, J. Becerra; Bednarek, W.; Bernardini, E.; Berti, A.; Biasuzzi, B.
2017-01-01
The large jet kinetic power and non-thermal processes occurring in the microquasar SS 433 make this source a good candidate for a very high-energy (VHE) gamma-ray emitter. Gamma-ray fluxes have been predicted for both the central binary and the interaction regions between jets and surrounding nebula. Also, non-thermal emission at lower energies has been previously reported. We explore the capability of SS 433 to emit VHE gamma rays during periods in which the expected flux attenuation due to ...
Accelerator-driven X-ray Sources
Energy Technology Data Exchange (ETDEWEB)
Nguyen, Dinh Cong [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2015-11-09
After an introduction which mentions x-ray tubes and storage rings and gives a brief review of special relativity, the subject is treated under the following topics and subtopics: synchrotron radiation (bending magnet radiation, wiggler radiation, undulator radiation, brightness and brilliance definition, synchrotron radiation facilities), x-ray free-electron lasers (linac-driven X-ray FEL, FEL interactions, self-amplified spontaneous emission (SASE), SASE self-seeding, fourth-generation light source facilities), and other X-ray sources (energy recovery linacs, Inverse Compton scattering, laser wakefield accelerator driven X-ray sources. In summary, accelerator-based light sources cover the entire electromagnetic spectrum. Synchrotron radiation (bending magnet, wiggler and undulator radiation) has unique properties that can be tailored to the users’ needs: bending magnet and wiggler radiation is broadband, undulator radiation has narrow spectral lines. X-ray FELs are the brightest coherent X-ray sources with high photon flux, femtosecond pulses, full transverse coherence, partial temporal coherence (SASE), and narrow spectral lines with seeding techniques. New developments in electron accelerators and radiation production can potentially lead to more compact sources of coherent X-rays.
High-intensity laser synchrotron x-ray source
International Nuclear Information System (INIS)
Pogorelsky, I.V.
1995-10-01
A laser interacting with a relativistic electron beam behaves like a virtual wiggler of an extremely short period equal to half of the laser wavelength. This approach opens a route to relatively compact, high-brightness x-ray sources alternative or complementary to conventional synchrotron light sources. Although not new, the Laser Synchrotron Light Source (LSLS) concept is still waiting for a convincing demonstration. Available at the BNL's Accelerator Test Facility (ATF), a high-brightness electron beam and the high-power C0 2 laser may be used as prototype LSLS brick stones. In a feasible demonstration experiment, 10-GW, 100-ps C0 2 laser beam will be brought to a head-on collision with a 10-ps, 0.5-nC, 70 MeV electron bunch. Flashes of well-collimated, up to 9.36-keV (∼ Angstrom) x-rays of 10-ps pulse duration, with a flux of ∼10 19 photons/sec will be produced via linear Compton backscattering. The x-ray spectrum is tunable proportionally to a variable e-beam energy. A natural short-term extension of the proposed experiment would be further enhancement of the x-ray flux to a 10 21 -10 22 photons/sec level, after the ongoing ATF CO 2 laser upgrade to 1 TW peak power and electron bunch shortening to 3 ps. The ATF LSLS x-ray beamline, exceeding by orders of magnitude the peak fluxes attained at the National Synchrotron Light Source (NSLS) x-ray storage ring, may become attractive for certain users, e.g., for biological x-ray microscopy. In addition, a terawatt CO 2 laser will enable harmonic multiplication of the x-ray spectrum via nonlinear Compton scattering
Diagnostic X-ray sources-present and future
Behling, Rolf; Grüner, Florian
2018-01-01
This paper compares very different physical principles of X-ray production to spur ideation. Since more than 120 years, bremsstrahlung from X-ray tubes has been the workhorse of medical diagnostics. Generated by X-ray segments comprised of X-ray tubes and high-voltage generators in the various medical systems, X-ray photons in the spectral range between about 16 keV and 150 keV deliver information about anatomy and function of human patients and in pre-clinical animal studies. Despite of strides to employ the wave nature of X-rays as phase sensitive means, commercial diagnostic X-ray systems available until the time of writing still rely exclusively on measuring the attenuation and scattering of X-rays by matter. Significant activities in research aim at building highly brilliant short pulse X-ray sources, based on e.g. synchrotron radiation, free electron lasers and/or laser wake-field acceleration of electrons followed by wiggling with magnetic structures or Thomson scattering in bunches of light. While both approaches, non-brilliant and brilliant sources, have different scope of application, we speculate that a combination may expand the efficacy in medical application. At this point, however, severe technical and commercial difficulties hinder closing this gap. This article may inspire further development and spark innovation in this important field.
X-Ray Scattering Applications Using Pulsed X-Ray Sources
Energy Technology Data Exchange (ETDEWEB)
Larson, B.C.
1999-05-23
Pulsed x-ray sources have been used in transient structural phenomena investigations for over fifty years; however, until the advent of synchrotrons sources and the development of table-top picosecond lasers, general access to ligh temporal resolution x-ray diffraction was relatively limited. Advances in diffraction techniques, sample excitation schemes, and detector systems, in addition to IncEased access to pulsed sources, have ld tO what is now a diverse and growing array of pulsed-source measurement applications. A survey of time-resolved investigations using pulsed x-ray sources is presented and research opportunities using both present and planned pulsed x-ray sources are discussed.
International Nuclear Information System (INIS)
Katz, J.I.; Washington Univ., St. Louis, MO
1988-01-01
I Review some of the salient accomplishments of X-rap studies of compact objects. Progress in this field has closely followed the improvement of observational methods, particularly in angular resolution and duration of exposure. Luminous compact X-ray sources are accreting neutron stars or black holes. Accreting neutron stars may have characteristic temporal signatures, but the only way to establish that an X-ray source is a black hole is to measure its mass. A rough phenomenological theory is succesful, but the transport of angular momentum in accretion flows is not onderstood. A number of interesting complications have been observed, including precessing accretion discs, X-ray bursts, and the acceleration of jets in SS433. Many puzzles remain unsolved, including the excitation of disc precession, the nature of the enigmatic A- and gamma-ray source Cyg X-3, the mechanism by which slowly spinning accreting neutron stars lose angular momentum, and the superabundance of X-ray sources in globular clusters. 41 refs.; 5 figs
International Nuclear Information System (INIS)
Fiasson, A.
2008-03-01
The H.E.S.S. telescope (High energy Stereoscopic System), located in Namibia, is currently the most efficient for the observation of very high energy (VHE) gamma-ray sources. It is composed of 4 large diameter telescopes working in stereoscopic mode and allows an unequaled survey of the galactic plane at these extreme wavelengths. The H.E.S.S. experiment showed the presence of high energy particles up to 100 TeV within supernova remnant. This astrophysical objects are believed to be the main particle accelerator within the Galaxy. However, the particle nature remains unclear. This thesis presents a new observational approach in order to show hadronic particles acceleration through diffusive shock within supernova remnant. A search of supernova remnant associated with molecular cloud have been led within the HESS source catalog and the H.E.S.S. observations. An analysis of the new VHE gamma-ray source in Monoceros and its interpretation are presented. As well, the analysis and interpretation of new observations of the unidentified source HESS J1745-303 are presented. The multi-wavelength analysis of the new source HESS J1714-385, coincident with the supernova remnant CTB37A is presented. A contribution to the H.E.S.S. phase II building is also presented. This second phase consists in the building of a fifth telescope at the center of the existing system. The series tests of the new camera sampling system are reported. (author)
A SEARCH FOR HYPERLUMINOUS X-RAY SOURCES IN THE XMM-NEWTON SOURCE CATALOG
Energy Technology Data Exchange (ETDEWEB)
Zolotukhin, I.; Webb, N. A.; Godet, O.; Barret, D. [CNRS, IRAP, 9 av. Colonel Roche, BP 44346, F-31028 Toulouse cedex 4 (France); Bachetti, M., E-mail: ivan.zolotukhin@irap.omp.eu [INAF/Osservatorio Astronomico di Cagliari, via della Scienza 5, I-09047 Selargius (Italy)
2016-02-01
We present a new method to identify luminous off-nuclear X-ray sources in the outskirts of galaxies from large public redshift surveys, distinguishing them from foreground and background interlopers. Using the 3XMM-DR5 catalog of X-ray sources and the SDSS DR12 spectroscopic sample of galaxies, with the help of this off-nuclear cross-matching technique, we selected 98 sources with inferred X-ray luminosities in the range 10{sup 41} < L{sub X} < 10{sup 44} erg s{sup −1}, compatible with hyperluminous X-ray objects (HLX). To validate the method, we verify that it allowed us to recover known HLX candidates such as ESO 243–49 HLX–1 and M82 X–1. From a statistical study, we conservatively estimate that up to 71 ± 11 of these sources may be foreground- or background sources, statistically leaving at least 16 that are likely to be HLXs, thus providing support for the existence of the HLX population. We identify two good HLX candidates and using other publicly available data sets, in particular the VLA FIRST in radio, UKIRT Infrared Deep Sky Survey in the near-infrared, GALEX in the ultraviolet and Canada–France–Hawaii Telescope Megacam archive in the optical, we present evidence that these objects are unlikely to be foreground or background X-ray objects of conventional types, e.g., active galactic nuclei, BL Lac objects, Galactic X-ray binaries, or nearby stars. However, additional dedicated X-ray and optical observations are needed to confirm their association with the assumed host galaxies and thus secure their HLX classification.
Steady-state emission of blazars at very high energies
Energy Technology Data Exchange (ETDEWEB)
Hoehne-Moench, Daniel
2010-07-01
One key scientific program of the MAGIC telescope project is the discovery and detection of blazars. They constitute the most prominent extragalactic source class in the very high energy (VHE) {gamma}-ray regime with 29 out of 34 known objects. Therefore a major part of the available observation time was spent in the last years on high-frequency peaked blazars. The selection criteria were chosen to increase the detection probability. As the X-ray flux is believed to be correlated to the VHE {gamma}-ray flux, only X-ray selected sources with a flux F{sub X}>2 {mu}Jy at 1 keV were considered. To avoid strong attenuation of the -rays in the extragalactic infrared background, the redshift was restricted to values between z<0.15 and z<0.4, depending on the declination of the objects. The latter determines the zenith distance during culmination which should not exceed 30 (for z<0.4) and 45 (for z<0.15), respectively. Between August 2005 and April 2009, a sample of 24 X-ray selected high-frequency peaked blazars has been observed with the MAGIC telescope. Three of them were detected including 1ES 1218+304 being the first high-frequency peaked BL Lacertae object (HBL) to be discovered with MAGIC in VHE {gamma}-rays. One previously detected object was not confirmed as VHE emitter in this campaign by MAGIC. A set of 20 blazars previously not detected is treated more closely in this work. In this campaign, during almost four years {proportional_to}450 hrs or {proportional_to}22% of the available observation time for extragalactic objects were dedicated to investigate the baseline emission of blazars and their broadband spectral properties in this emission state. For the sample of 20 objects in a redshift range of 0.018
International Nuclear Information System (INIS)
Hayakawa, S.; Murakami, T.; Nagase, F.; Tanaka, Y.; Yamashita, K.
1976-01-01
A rocket observation of cosmic soft X-rays suggests the existence of transient, recurrent soft X-ray sources which are found variable during the flight time of the rocket. Some of the soft X-ray sources thus far reported are considered to be of this time. These sources are listed and their positions are shown. (Auth.)
EVIDENCE FOR SECONDARY EMISSION AS THE ORIGIN OF HARD SPECTRA IN TeV BLAZARS
International Nuclear Information System (INIS)
Zheng, Y. G.; Kang, T.
2013-01-01
We develop a model for the possible origin of hard, very high energy (VHE) spectra from a distant blazar. In the model, both the primary photons produced in the source and secondary photons produced outside it contribute to the observed high-energy γ-ray emission. That is, the primary photons are produced through the synchrotron self-Compton process, and the secondary photons are produced through high-energy proton interactions with background photons along the line of sight. We apply the model to a characteristic case of VHE γ-ray emission in the distant blazar 1ES 1101-232. Assuming suitable electron and proton spectra, we obtain excellent fits to the observed spectra of this blazar. This indicated that the surprisingly low attenuation of the high-energy γ-rays, especially the shape of the VHE γ-ray tail of the observed spectra, can be explained by secondary γ-rays produced in interactions of cosmic-ray protons with background photons in intergalactic space.
Trebes, James E.; Bell, Perry M.; Robinson, Ronald B.
2000-01-01
A miniature x-ray source utilizing a hot filament cathode. The source has a millimeter scale size and is capable of producing broad spectrum x-ray emission over a wide range of x-ray energies. The miniature source consists of a compact vacuum tube assembly containing the hot filament cathode, an anode, a high voltage feedthru for delivering high voltage to the cathode, a getter for maintaining high vacuum, a connector for initial vacuum pump down and crimp-off, and a high voltage connection for attaching a compact high voltage cable to the high voltage feedthru. At least a portion of the vacuum tube wall is fabricated from highly x-ray transparent materials, such as sapphire, diamond, or boron nitride.
International Nuclear Information System (INIS)
Masswig, I.
1986-01-01
The tkb market survey comparatively evaluates the X-ray sources and replacement tubes for stationary equipment currently available on the German market. It lists the equipment parameters of 235 commercially available X-ray sources and their replacement tubes and gives the criteria for purchase decisions. The survey has been completed with December 1985, and offers good information concerning medical and technical aspects as well as those of safety and maintenance. (orig.) [de
THE DISCOVERY OF γ-RAY EMISSION FROM THE BLAZAR RGB J0710+591
International Nuclear Information System (INIS)
Acciari, V. A.; Benbow, W.; Aliu, E.; Arlen, T.; Aune, T.; Bautista, M.; Beilicke, M.; Buckley, J. H.; Bugaev, V.; Dickherber, R.; Boettcher, M.; Boltuch, D.; Bradbury, S. M.; Byrum, K.; Cannon, A.; Cesarini, A.; Ciupik, L.; Cui, W.; Duke, C.; Falcone, A.
2010-01-01
The high-frequency-peaked BL Lacertae object RGB J0710+591 was observed in the very high-energy (VHE; E > 100 GeV) wave band by the VERITAS array of atmospheric Cherenkov telescopes. The observations, taken between 2008 December and 2009 March and totaling 22.1 hr, yield the discovery of VHE gamma rays from the source. RGB J0710+591 is detected at a statistical significance of 5.5 standard deviations (5.5σ) above the background, corresponding to an integral flux of (3.9 ± 0.8) x 10 -12 cm -2 s -1 (3% of the Crab Nebula's flux) above 300 GeV. The observed spectrum can be fit by a power law from 0.31 to 4.6 TeV with a photon spectral index of 2.69 ± 0.26 stat ± 0.20 sys . These data are complemented by contemporaneous multiwavelength data from the Fermi Large Area Telescope, the Swift X-ray Telescope, the Swift Ultra-Violet and Optical Telescope, and the Michigan-Dartmouth-MIT observatory. Modeling the broadband spectral energy distribution (SED) with an equilibrium synchrotron self-Compton model yields a good statistical fit to the data. The addition of an external-Compton component to the model does not improve the fit nor brings the system closer to equipartition. The combined Fermi and VERITAS data constrain the properties of the high-energy emission component of the source over 4 orders of magnitude and give measurements of the rising and falling sections of the SED.
Interstellar medium around supernova remnants associated with gamma-ray sources
Duvidovich, L.; Petriella, A.; Giacani, E.; Dubner, G.
2017-07-01
Supernova remnants (SNRs) are potential sources of gamma-rays, either through inverse Compton scattering of electrons off ambient photons or through the decay of neutral pions created by the collision of energetic protons with dense ambient gas. The SNRs G298.6-0.0 and G298.5-0.3 are proposed to be associated to the gamma-ray sources 3FGL J1214.0-6236 and 3FGL J1212.2-6251, respectively. They are located in a complex portion of the Galactic plane, also containing sources of powerful stellar winds such as the star Wolf Rayet HD104994 and the HII regions G298.559-00.114, G298.868-00.432 and G298.228-00.331 with ongoing star formation. We present a study of the neutral hydrogen distribution towards the mentioned SNRs. We found a structure with ellipsoidal morphology that encloses a region containing G298.5-0.3, G298.6-0.0, HD104994, G298.559-00.114 and G298.228-00.331. This HI feature is detected in the velocity range 89-100 km s-1. We propose that the neutral gas would be the accelerated portion (which would explain its high radial velocity) of a gas shell swept up by a series of expansive and explosive events. The rest of this shell (at radial velocities compatible with the systemic velocity of the objects) is not visible because of confusion with galactic emission. We also inspected the distribution of the 12CO gas and found a dense molecular cloud at the systemic velocity of ˜ 22 km s-1 corresponding to the kinematical distance of ˜ 10.4 kpc, compatible with the distance to the SNR G298.6-0.0. This molecular cloud is in spatial coincidence, projected in the sky plane, with the very high energy source associated with the remnant. This fact, suggesting a possible hadronic origin for the gamma-rays emission. Regarding to the SNR G298.5-0.3, smaller and fainter than the previous one, the angular resolution of the molecular data is insufficient to draw meaningful conclusions.
Characterisation and application of a laser-based hard x-ray source
International Nuclear Information System (INIS)
Graetz, M.
1998-11-01
Hard X-rays are generated by focusing 110 fs laser pulses with intensities of about 1017 W/cm 2 onto solid metal targets. Characteristic properties of this X-ray source are the small source size, the short pulse duration and the high peak flux. The aim of the present work was to characterise this X-ray source and to demonstrate possible applications. A comparison with other X-ray sources and conventional imaging techniques is made. Characterising measurements were performed, including source size, emission spectrum, temporal behaviour, source stability and the influence of various laser parameters. The emission spectrum was measured using both energy-dispersive solid-state detectors and wavelength-dispersive crystal spectroscopy. The conversion efficiency from laser light to X-ray radiation was measured for different target materials. The laser ablation from different targets was studied. The feasibility of special imaging techniques, e.g. differential imaging and time-gated imaging, was investigated both theoretically and experimentally. Differential imaging allows for selective imaging of contrast agents, while time-gated imaging can reduce the influence of scattered radiation in X-ray imaging. Time-gated imaging was demonstrated in different imaging geometries, both for planar imaging and computed tomography imaging. Reasonable agreement between theoretically calculated values and experimental results was obtained
Characterisation and application of a laser-based hard x-ray source
Energy Technology Data Exchange (ETDEWEB)
Graetz, M
1998-11-01
Hard X-rays are generated by focusing 110 fs laser pulses with intensities of about 1017 W/cm{sup 2} onto solid metal targets. Characteristic properties of this X-ray source are the small source size, the short pulse duration and the high peak flux. The aim of the present work was to characterise this X-ray source and to demonstrate possible applications. A comparison with other X-ray sources and conventional imaging techniques is made. Characterising measurements were performed, including source size, emission spectrum, temporal behaviour, source stability and the influence of various laser parameters. The emission spectrum was measured using both energy-dispersive solid-state detectors and wavelength-dispersive crystal spectroscopy. The conversion efficiency from laser light to X-ray radiation was measured for different target materials. The laser ablation from different targets was studied. The feasibility of special imaging techniques, e.g. differential imaging and time-gated imaging, was investigated both theoretically and experimentally. Differential imaging allows for selective imaging of contrast agents, while time-gated imaging can reduce the influence of scattered radiation in X-ray imaging. Time-gated imaging was demonstrated in different imaging geometries, both for planar imaging and computed tomography imaging. Reasonable agreement between theoretically calculated values and experimental results was obtained 120 refs, figs, tabs
Delivering service adaptation with 3G technology
Liotta, A.; Yew, A.; Bohoris, C.; Pavlou, G.; Feridun, M.; Kropf, P.G.; Babin, G.
2002-01-01
Now that 3G technologies have reached their maturity, newly advanced services can be delivered to the mobile user. These include context- aware services, adaptable services and Virtual Home Environment (VHE)-like services. Important research issues relate, however, to managing such services through
Detection of the cosmic γ-ray horizon from multiwavelength observations of blazars
Energy Technology Data Exchange (ETDEWEB)
Dominguez, A. [Univ. of California, Riverside, CA (United States); Finke, J. D. [U.S. Naval Research Lab., Washington, DC (United States); Prada, F. [Campus of International Excellence UAM_CSIC, Madrid (Spain); Universidad Autonoma de Madrid (Spain); Instituto de Astrofisica de Andalucia, Granada (Spain); Primack, J. R. [Univ. of California, Santa Cruz, CA (United States); Kitaura, F. S. [Leibniz-Institut fuer Astrophysik, Potsdam (Germany); Siana, B. [Univ. Of California, Riverside, CA (United States); Paneque, D. [Stanford Univ., Stanford, CA (United States). Kavli Inst. sor Particle Astrophysics and Cosmology; Max-Planck-Institut fuer Physik, Munich (Germany)
2013-05-24
The first statistically significant detection of the cosmic γ-ray horizon (CGRH) that is independent of any extragalactic background light (EBL) model is presented. The CGRH is a fundamental quantity in cosmology. It gives an estimate of the opacity of the Universe to very high energy (VHE) γ-ray photons due to photon-photon pair production with the EBL. The only estimations of the CGRH to date are predictions from EBL models and lower limits from γ-ray observations of cosmological blazars and γ-ray bursts. Here, we present homogeneous synchrotron/synchrotron self-Compton (SSC) models of the spectral energy distributions of 15 blazars based on (almost) simultaneous observations from radio up to the highest energy γ-rays taken with the Fermi satellite. These synchrotron/SSC models predict the unattenuated VHE fluxes, which are compared with the observations by imaging atmospheric Cherenkov telescopes. The comparison provides an estimate of the optical depth of the EBL, which allows a derivation of the CGRH through a maximum likelihood analysis that is EBL-model independent. We find that the observed CGRH is compatible with the current knowledge of the EBL.
International Nuclear Information System (INIS)
Hermsen, W.
1980-01-01
Results are presented from an analysis of the celestial gamma-ray fine-scale structure based on over half of the data which may ultimately be available from the COS-B satellite. A catalogue consisting of 25 gamma-ray sources measured at energies above 100 MeV is presented. (Auth.)
A Search for bursts of TeV gamma rays with Milagro
Smith, A. J.; MILAGRO Collaboration
2001-08-01
The Very High Energy (VHE, E > 100 GeV) component of Gamma-Ray Bursts (GRBs) remains unmeasured, despite the fact that models predict that the spectrum of GRBs extends beyond 1 TeV. Satellite detectors capable of observing GRBs lack the sensitivity to detect γ-rays with energies greater than ≈ 30 GeV due to their small effective area. Air ˇCerenkov telescopes, capable of detecting TeV point sources with excellent sensitivity have limited sensitivity to GRBs due to their small fields of view and limited duty cycles. The detection of TeV emission from GRBs is further complicated by the attenuation of VHE photons by interaction with the intergalactic infrared radiation. This process limits the horizon for TeV observations of GRBs to z pond (4800 m2 ) instrumented with an array of photo-multiplier tubes. Milagro operates 24 hours a day and continuously observes the entire overhead sky (≈2 sr). Because of its wide field of view and high duty cycle Milagro is uniquely capable of searching for TeV emission from GRBs. An efficient algorithm has been developed to search the Milagro data for GRBs with durations from 250 microseconds to 40s. The search, while designed to search for the TeV component of GRBs, may also be sensitive to the evaporation of primordial black holes, or some other yet undiscovered phenomenon. The results of this search are presented.
International Nuclear Information System (INIS)
Gursky, H.; Schreier, E.
1975-01-01
The current observational evidence on galactic X-ray sources is presented both from an astrophysical and astronomical point of view. The distributional properties of the sources, where they appear in the Galaxy, and certain average characteristics are discussed. In this way, certain properties of the X-ray sources can be deduced which are not apparent in the study of single objects. The properties of individual X-ray sources are then described. The hope is that more can be learnt about neutron stars and black holes, their physical properties, their origin and evolution, and their influence on other galactic phenomena. Thus attention is paid to those elements of data which appear to have the most bearing on these questions. (Auth.)
Einstein Observatory survey of X-ray emission from solar-type stars - the late F and G dwarf stars
Energy Technology Data Exchange (ETDEWEB)
Maggio, A.; Sciortino, S.; Vaiana, G.S.; Majer, P.; Bookbinder, J.
1987-04-01
Results of a volume-limited X-ray survey of stars of luminosity classes IV and V in the spectral range F7-G9 observed with the Einstein Observatory are presented. Using survival analysis techniques, the stellar X-ray luminosity function in the 0.15-4.0 keV energy band for both single and multiple sources. It is shown that the difference in X-ray luminosity between these two classes of sources is consistent with the superposition of individual components in multiple-component systems, whose X-ray properties are similar to those of the single-component sources. The X-ray emission of the stars in our sample is well correlated with their chromospheric CA II H-K line emission and with their projected equatorial rotational velocity. Comparison of the X-ray luminosity function constructed for the sample of the dG stars of the local population with the corresponding functions derived elsewhere for the Hyades, the Pleiades, and the Orion Ic open cluster confirms that the level of X-ray emission decreases with stellar age. 62 references.
Einstein Observatory survey of X-ray emission from solar-type stars - The late F and G dwarf stars
Maggio, A.; Sciortino, S.; Vaiana, G. S.; Majer, P.; Bookbinder, J.
1987-01-01
Results of a volume-limited X-ray survey of stars of luminosity classes IV and V in the spectral range F7-G9 observed with the Einstein Observatory are presented. Using survival analysis techniques, the stellar X-ray luminosity function in the 0.15-4.0 keV energy band for both single and multiple sources. It is shown that the difference in X-ray luminosity between these two classes of sources is consistent with the superposition of individual components in multiple-component systems, whose X-ray properties are similar to those of the single-component sources. The X-ray emission of the stars in our sample is well correlated with their chromospheric CA II H-K line emission and with their projected equatorial rotational velocity. Comparison of the X-ray luminosity function constructed for the sample of the dG stars of the local population with the corresponding functions derived elsewhere for the Hyades, the Pleiades, and the Orion Ic open cluster confirms that the level of X-ray emission decreases with stellar age.
Three Bright X-ray Sources in NGC 1313
Colbert, E.; Petre, R.; Schlegel, E.
1992-12-01
Three bright X-ray sources were detected in a recent (April/May 1991) ROSAT PSPC observation of the nearby (D ~ 4.5 Mpc) face--on barred spiral galaxy NGC 1313. Two of the sources were at positions coincident with X-ray sources detected by Fabbiano & Trinchieri (ApJ 315, 1987) in a previous (Jan 1980) Einstein IPC observation. The position of the brightest Einstein source is near the center of NGC 1313, and the second Einstein source is ~ 7' south of the ``nuclear'' source, in the outskirts of the spiral arms. A third bright X-ray source was detected in the ROSAT observation ~ 7' southwest of the ``nuclear'' source. We present X-ray spectra and X-ray images for the three bright sources found in the ROSAT observation of NGC 1313, and compare with previous Einstein results. Spectral analysis of these sources require them to have very large soft X-ray luminosities ( ~ 10(40) erg s(-1) ) when compared with typical X-ray sources in our Galaxy. Feasible explanations for the X-ray emission are presented. The third X-ray source is positively identified with the recently discovered (Ryder et. al., ApJ 1992) peculiar type-II supernova 1978K.
X-ray and. gamma. -ray sources: a comparison of their characteristics
Energy Technology Data Exchange (ETDEWEB)
Freund, A K [Institut Max von Laue - Paul Langevin, 38 - Grenoble (France)
1979-11-01
A comparison of the various source characteristics, in particular the available fluxes of radiation in the X-ray/..gamma..-ray region from (1) high power rotary anode X-ray generators, (2) radioactive ..gamma..-ray sources and (3) high energy electron storage rings is presented. Some of the specific characteristics and possible applications of synchrotron radiation as a source are discussed in detail, together with problems associated with the monochromatization of the continuous radiation in the X-ray/..gamma..-ray region. The new high energy machines PEP at Stanford, the 8 GeV storage ring CESR at Cornell and the PETRA storage ring in Hamburg, which will soon come into operation provide a spectrum of high intensity radiation reaching well above h..gamma..sub(photon)=100 keV. The possibilities of using ondulators (wigglers), and laser-electron scattering for constructing high repetition rate tunable ..gamma..-ray sources are also discussed. Finally the potentials of using the powerful spontaneous emission of ..gamma..-quanta by relativistic channeled particles are mentioned.
International Nuclear Information System (INIS)
Dubois, Florent
2009-01-01
H.E.S.S. (High Energy Stereoscopic System) is one of the leading systems of four Imaging Atmospheric Cherenkov Telescopes that investigates very high energy (VHE) cosmic gamma-rays in the 100 GeV to 100 TeV energy range. H.E.S.S. is located in Namibia, near the Gamsberg mountain and operational since December 2003. The H.E.S.S. experiment is mainly aimed to the observation of the southern sky including the galactic plan and the numerous astrophysics sources therein. Three analysis methods have been developed using various properties of the electromagnetic showers generated by the interaction of primary cosmic gamma-rays within the Earth atmosphere. The first goal of this thesis was to combine the information from these methods for the selection and the energy and direction reconstruction of gamma-ray events. The new analysis called X eff improves significantly the quality of the selection and the precision of the reconstruction. This analysis has been afterwards applied to the study of pulsar wind nebulae like Vela X, G0.9+0.1 and MSH 15-52. New results were found concerning the source extension (Vela X) or spectral analysis (G0.9+0.1 and MSH 15-52) at TeV energies, thanks to additional data and to the improved efficiency of the new method. In 2010, a new phase will begin with the achievement of a fifth telescope dedicated to gamma-ray observation from tens GeV. The calibration processes of the photomultipliers equipping the camera of the new telescope, as well as the results of the tests, are also described in this thesis. (author)
International Nuclear Information System (INIS)
Garg, A.B.; Rout, R.K.; Shyam, A.; Srinivasan, M.
1993-01-01
X ray emission from an X pinch, a point x-ray source has been studied using a pin-hole camera by a 30 kV, 7.2 μ F capacitor bank. The wires of different material like W, Mo, Cu, S.S.(stainless steel) and Ti were used. Molybdenum pinch gives the most intense x-rays and stainless steel gives the minimum intensity x-rays for same bank energy (∼ 3.2 kJ). Point x-ray source of size (≤ 0.5 mm) was observed using pin hole camera. The size of the source is limited by the size of the pin hole camera. The peak current in the load is approximately 150 kA. The point x-ray source could be useful in many fields like micro lithography, medicine and to study the basic physics of high Z plasmas. (author). 4 refs., 3 figs
Energy Technology Data Exchange (ETDEWEB)
Katsuta, J. [Department of Physical Sciences, Hiroshima University, Higashi-Hiroshima, Hiroshima 739-8526 (Japan); Uchiyama, Y. [Rikkyo University, Nishi-Ikebukuro, Toshima-ku, Tokyo 171-8501 (Japan); Funk, S., E-mail: katsuta@hep01.hepl.hiroshima-u.ac.jp [Erlangen Centre for Astroparticle Physics, D-91058 Erlangen (Germany)
2017-04-20
We report a study of extended γ -ray emission with the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope , which is likely to be the second case of a γ -ray detection from a star-forming region (SFR) in our Galaxy. The LAT source is located in the G25 region, 1.°7 × 2.°1 around ( l , b ) = (25.°0, 0.°0). The γ -ray emission is found to be composed of two extended sources and one pointlike source. The extended sources have similar sizes of about 1.°4 × 0.°6. An ∼0.°4 diameter subregion of one has a photon index of Γ = 1.53 ± 0.15, and is spatially coincident with HESS J1837−069, likely a pulsar wind nebula. The other parts of the extended sources have a photon index of Γ = 2.1 ± 0.2 without significant spectral curvature. Given their spatial and spectral properties, they have no clear associations with sources at other wavelengths. Their γ -ray properties are similar to those of the Cygnus cocoon SFR, the only firmly established γ -ray detection of an SFR in the Galaxy. Indeed, we find bubble-like structures of atomic and molecular gas in G25, which may be created by a putative OB association/cluster. The γ -ray emitting regions appear confined in the bubble-like structure; similar properties are also found in the Cygnus cocoon. In addition, using observations with the XMM-Newton , we find a candidate young massive OB association/cluster G25.18+0.26 in the G25 region. We propose that the extended γ -ray emission in G25 is associated with an SFR driven by G25.18+0.26. Based on this scenario, we discuss possible acceleration processes in the SFR and compare them with the Cygnus cocoon.
Lunar occultations for gamma-ray source measurements
Koch, David G.; Hughes, E. B.; Nolan, Patrick L.
1990-01-01
The unambiguous association of discrete gamma-ray sources with objects radiating at other wavelengths, the separation of discrete sources from the extended emission within the Galaxy, the mapping of gamma-ray emission from nearby galaxies and the measurement of structure within a discrete source cannot presently be accomplished at gamma-ray energies. In the past, the detection processes used in high-energy gamma-ray astronomy have not allowed for good angular resolution. This problem can be overcome by placing gamma-ray detectors on the moon and using the horizon as an occulting edge to achieve arcsec resolution. For purposes of discussion, this concept is examined for gamma rays above 100 MeV for which pair production dominates the detection process and locally-generated nuclear gamma rays do not contribute to the background.
Time-resolved X-ray diffraction with accelerator- and laser-plasma-based X-ray sources
International Nuclear Information System (INIS)
Nicoul, Matthieu
2010-01-01
Femtosecond X-ray pulses are a powerful tool to investigate atomic motions triggered by femtosecond pump pulses. This thesis is dedicated to the production of such pulses and their use in optical pump - X-ray probe measurement. This thesis describes the laser-plasma-based sources available at the University of Duisburg-Essen. Part of it consists of the description of the design, built-up and characterization of a new ''modular'' X-ray source dedicated to optimize the X-ray flux onto the sample under investigation. The acoustic wave generation in femtosecond optically excited semiconductor (gallium arsenide) and metal (gold) was performed using the sources of the University of Duisburg-Essen. The physical answer of the material was modeled by a simple strain model for the semiconductor, pressure model for the metal, in order to gain information on the interplay of the electronic and thermal pressures rising after excitation. Whereas no reliable information could be obtain in gallium arsenide (principally due to the use of a bulk), the model for gold achieved very good agreement, providing useful information. The relaxation time of the electron to lattice energy was found to be (5.0±0.3) ps, and the ratio of the Grueneisen parameters was found to be γ e / γ i = (0.5±0.1). This thesis also describes the Sub-Picosecond Pulse Source (SPPS) which existed at the (formally) Stanford Linear Accelerator Center, an accelerator-based X-ray source, and two measurements performed with it. The first one is the detailed investigation of the phonon softening of the A 1g mode launch in bismuth upon fluence excitation. Detailed information concerning the new equilibrium position and phonon frequency were obtained over extended laser pump fluences. The second measurement concerned the study of the liquid phase dynamics in a newly formed liquid phase following ultrafast melting in indium antimonide. The formation of the liquid phase and its development for excitations close to the
Time-resolved X-ray diffraction with accelerator- and laser-plasma-based X-ray sources
Energy Technology Data Exchange (ETDEWEB)
Nicoul, Matthieu
2010-09-01
Femtosecond X-ray pulses are a powerful tool to investigate atomic motions triggered by femtosecond pump pulses. This thesis is dedicated to the production of such pulses and their use in optical pump - X-ray probe measurement. This thesis describes the laser-plasma-based sources available at the University of Duisburg-Essen. Part of it consists of the description of the design, built-up and characterization of a new ''modular'' X-ray source dedicated to optimize the X-ray flux onto the sample under investigation. The acoustic wave generation in femtosecond optically excited semiconductor (gallium arsenide) and metal (gold) was performed using the sources of the University of Duisburg-Essen. The physical answer of the material was modeled by a simple strain model for the semiconductor, pressure model for the metal, in order to gain information on the interplay of the electronic and thermal pressures rising after excitation. Whereas no reliable information could be obtain in gallium arsenide (principally due to the use of a bulk), the model for gold achieved very good agreement, providing useful information. The relaxation time of the electron to lattice energy was found to be (5.0{+-}0.3) ps, and the ratio of the Grueneisen parameters was found to be {gamma}{sub e} / {gamma}{sub i} = (0.5{+-}0.1). This thesis also describes the Sub-Picosecond Pulse Source (SPPS) which existed at the (formally) Stanford Linear Accelerator Center, an accelerator-based X-ray source, and two measurements performed with it. The first one is the detailed investigation of the phonon softening of the A{sub 1g} mode launch in bismuth upon fluence excitation. Detailed information concerning the new equilibrium position and phonon frequency were obtained over extended laser pump fluences. The second measurement concerned the study of the liquid phase dynamics in a newly formed liquid phase following ultrafast melting in indium antimonide. The formation of the liquid phase
Miniature x-ray point source for alignment and calibration of x-ray optics
International Nuclear Information System (INIS)
Price, R.H.; Boyle, M.J.; Glaros, S.S.
1977-01-01
A miniature x-ray point source of high brightness similar to that of Rovinsky, et al. is described. One version of the x-ray source is used to align the x-ray optics on the Argus and Shiva laser systems. A second version is used to determine the spatial and spectral transmission functions of the x-ray optics. The spatial and spectral characteristics of the x-ray emission from the x-ray point source are described. The physical constraints including size, intensity and thermal limitations, and useful lifetime are discussed. The alignment and calibration techniques for various x-ray optics and detector combinations are described
CHANDRA ACIS SURVEY OF X-RAY POINT SOURCES: THE SOURCE CATALOG
Energy Technology Data Exchange (ETDEWEB)
Wang, Song; Liu, Jifeng; Qiu, Yanli; Bai, Yu; Yang, Huiqin; Guo, Jincheng; Zhang, Peng, E-mail: jfliu@bao.ac.cn, E-mail: songw@bao.ac.cn [Key Laboratory of Optical Astronomy, National Astronomical Observatories, Chinese Academy of Sciences, Beijing 100012 (China)
2016-06-01
The Chandra archival data is a valuable resource for various studies on different X-ray astronomy topics. In this paper, we utilize this wealth of information and present a uniformly processed data set, which can be used to address a wide range of scientific questions. The data analysis procedures are applied to 10,029 Advanced CCD Imaging Spectrometer observations, which produces 363,530 source detections belonging to 217,828 distinct X-ray sources. This number is twice the size of the Chandra Source Catalog (Version 1.1). The catalogs in this paper provide abundant estimates of the detected X-ray source properties, including source positions, counts, colors, fluxes, luminosities, variability statistics, etc. Cross-correlation of these objects with galaxies shows that 17,828 sources are located within the D {sub 25} isophotes of 1110 galaxies, and 7504 sources are located between the D {sub 25} and 2 D {sub 25} isophotes of 910 galaxies. Contamination analysis with the log N –log S relation indicates that 51.3% of objects within 2 D {sub 25} isophotes are truly relevant to galaxies, and the “net” source fraction increases to 58.9%, 67.3%, and 69.1% for sources with luminosities above 10{sup 37}, 10{sup 38}, and 10{sup 39} erg s{sup −1}, respectively. Among the possible scientific uses of this catalog, we discuss the possibility of studying intra-observation variability, inter-observation variability, and supersoft sources (SSSs). About 17,092 detected sources above 10 counts are classified as variable in individual observation with the Kolmogorov–Smirnov (K–S) criterion ( P {sub K–S} < 0.01). There are 99,647 sources observed more than once and 11,843 sources observed 10 times or more, offering us a wealth of data with which to explore the long-term variability. There are 1638 individual objects (∼2350 detections) classified as SSSs. As a quite interesting subclass, detailed studies on X-ray spectra and optical spectroscopic follow-up are needed to
Journal of Astrophysics and Astronomy | Indian Academy of Sciences
Indian Academy of Sciences (India)
2016-01-27
Jan 27, 2016 ... The field of Very High Energy (VHE) gamma ray astronomy using the Atmospheric Cerenkov Technique has entered an interesting phase with detection of various galactic and extragalactic sources. Among galactic sources, only the Crab nebula has been established as a standard candle.
Energy Technology Data Exchange (ETDEWEB)
Kataoka, J.; Takahashi, Y.; Maeda, K. [Research Institute for Science and Engineering, Waseda University, 3-4-1, Okubo, Shinjuku, Tokyo 169-8555 (Japan); Yatsu, Y.; Kawai, N. [Tokyo Institute of Technology, 2-12-1, Ohokayama, Meguro, Tokyo 152-8551 (Japan); Urata, Y.; Tsai, A. [Institute of Astronomy, National Central University, Chung-Li 32054, Taiwan (China); Cheung, C. C. [National Research Council Research Associate, National Academy of Sciences, Washington, DC 20001 (United States); Totani, T.; Makiya, R. [Department of Astronomy, Kyoto University, Kitashirakawa, Sakyo-ku, Kyoto 606-8502 (Japan); Hanayama, H.; Miyaji, T., E-mail: kataoka.jun@waseda.jp [Ishigakijima Astronomical Observatory, National Astronomical Observatory of Japan, 1024-1 Arakawa, Ishigaki, Okinawa, 907-0024 (Japan)
2012-10-01
We present deep optical and X-ray follow-up observations of the bright unassociated Fermi-LAT gamma-ray source 1FGL J1311.7-3429. The source was already known as an unidentified EGRET source (3EG J1314-3431, EGR J1314-3417), hence its nature has remained uncertain for the past two decades. For the putative counterpart, we detected a quasi-sinusoidal optical modulation of {Delta}m {approx} 2 mag with a period of {approx_equal}1.5 hr in the Rc, r', and g' bands. Moreover, we found that the amplitude of the modulation and peak intensity changed by {approx}>1 mag and {approx}0.5 mag, respectively, over our total six nights of observations from 2012 March to May. Combined with Swift UVOT data, the optical-UV spectrum is consistent with a blackbody temperature, kT {approx_equal} 1 eV and the emission volume radius R{sub bb} {approx_equal} 1.5 Multiplication-Sign 10{sup 4} d{sub kpc} km (d{sub kpc} is the distance to the source in units of 1 kpc). In contrast, deep Suzaku observations conducted in 2009 and 2011 revealed strong X-ray flares with a light curve characterized with a power spectrum density of P(f) {proportional_to} f {sup -2.0{+-}0.4}, but the folded X-ray light curves suggest an orbital modulation also in X-rays. Together with the non-detection of a radio counterpart, and significant curved spectrum and non-detection of variability in gamma-rays, the source may be the second 'radio-quiet' gamma-ray emitting millisecond pulsar candidate after 1FGL J2339.7-0531, although the origin of flaring X-ray and optical variability remains an open question.
Directory of Open Access Journals (Sweden)
Kumiko Morihana
2014-12-01
Full Text Available We present the results of X-ray and Near-Infrared observations of the Galactic Ridge X-ray Emission (GRXE. We extracted 2,002 X-ray point sources in the Chandra Bulge Field (l =0°.113, b = 1°.424 down to ~10-14.8 ergscm-2s-1 in 2-8 keV band with the longest observation (900 ks of the GRXE. Based on X-ray brightness and hardness, we classied the X-ray point sources into three groups: A (hard, B (soft and broad spectrum, and C (soft and peaked spectrum. In order to know populations of the X-ray point sources, we carried out NIR imaging and spectroscopy observation. We identied 11% of X-ray point sources with NIR and extracted NIR spectra for some of them. Based on X-ray and NIR properties, we concluded that non-thermal sources in the group A are mostly active galactic nuclei and the thermal sources are mostly white dwarf binaries such as cataclysmic variables (CVs and Pre-CVs. We concluded that the group B and C sources are X-ray active stars in flare and quiescence, respectively.
Development and characterization of a tunable ultrafast X-ray source via inverse-Compton-scattering
International Nuclear Information System (INIS)
Jochmann, Axel
2014-01-01
Ultrashort, nearly monochromatic hard X-ray pulses enrich the understanding of the dynamics and function of matter, e.g., the motion of atomic structures associated with ultrafast phase transitions, structural dynamics and (bio)chemical reactions. Inverse Compton backscattering of intense laser pulses from relativistic electrons not only allows for the generation of bright X-ray pulses which can be used in a pump-probe experiment, but also for the investigation of the electron beam dynamics at the interaction point. The focus of this PhD work lies on the detailed understanding of the kinematics during the interaction of the relativistic electron bunch and the laser pulse in order to quantify the influence of various experiment parameters on the emitted X-ray radiation. The experiment was conducted at the ELBE center for high power radiation sources using the ELBE superconducting linear accelerator and the DRACO Ti:sapphire laser system. The combination of both these state-of-the-art apparatuses guaranteed the control and stability of the interacting beam parameters throughout the measurement. The emitted X-ray spectra were detected with a pixelated detector of 1024 by 256 elements (each 26μm by 26μm) to achieve an unprecedented spatial and energy resolution for a full characterization of the emitted spectrum to reveal parameter influences and correlations of both interacting beams. In this work the influence of the electron beam energy, electron beam emittance, the laser bandwidth and the energy-anglecorrelation on the spectra of the backscattered X-rays is quantified. A rigorous statistical analysis comparing experimental data to ab-initio 3D simulations enabled, e.g., the extraction of the angular distribution of electrons with 1.5% accuracy and, in total, provides predictive capability for the future high brightness hard X-ray source PHOENIX (Photon electron collider for Narrow bandwidth Intense X-rays) and potential all optical gamma-ray sources. The results
NLTE Model Atmospheres for Super-Soft X-ray Sources
Rauch, Thomas; Werner, Klaus
2009-09-01
Spectral analysis by means of fully line-blanketed Non-LTE model atmospheres has arrived at a high level of sophistication. The Tübingen NLTE Model Atmosphere Package (TMAP) is used to calculate plane-parallel NLTE model atmospheres which are in radiative and hydrostatic equilibrium. Although TMAP is not especially designed for the calculation of burst spectra of novae, spectral energy distributions (SEDs) calculated from TMAP models are well suited e.g. for abundance determinations of Super Soft X-ray Sources like nova V4743 Sgr or line identifications in observations of neutron stars with low magnetic fields in low-mass X-ray binaries (LMXBs) like EXO 0748-676.
Muon acceleration in cosmic-ray sources
International Nuclear Information System (INIS)
Klein, Spencer R.; Mikkelsen, Rune E.; Becker Tjus, Julia
2013-01-01
Many models of ultra-high energy cosmic-ray production involve acceleration in linear accelerators located in gamma-ray bursts, magnetars, or other sources. These transient sources have short lifetimes, which necessitate very high accelerating gradients, up to 10 13 keV cm –1 . At gradients above 1.6 keV cm –1 , muons produced by hadronic interactions undergo significant acceleration before they decay. This muon acceleration hardens the neutrino energy spectrum and greatly increases the high-energy neutrino flux. Using the IceCube high-energy diffuse neutrino flux limits, we set two-dimensional limits on the source opacity and matter density, as a function of accelerating gradient. These limits put strong constraints on different models of particle acceleration, particularly those based on plasma wake-field acceleration, and limit models for sources like gamma-ray bursts and magnetars.
X-ray Studies of Unidentified Galactic TeV Gamma-ray Sources
Pühlhofer, Gerd
2009-05-01
Many of the recently discovered Galactic TeV sources remain unidentified to date. A large fraction of the sources is possibly associated with relic pulsar wind nebula (PWN) systems. One key question here is the maximum energy (beyond TeV) attained in the compact PWNe. Hard X-ray emission can trace those particles, but current non-focussing X-ray instruments above 10 keV have difficulties to deconvolve the hard pulsar spectrum from its surrounding nebula. Some of the new TeV sources are also expected to originate from middle-aged and possibly even from old supernova remnants (SNR). But no compelling case for such an identification has been found yet. In established young TeV-emitting SNRs, X-ray imaging above 10 keV could help to disentangle the leptonic from the hadronic emission component in the TeV shells, if secondary electrons produced in hadronic collisions can be effectively detected. As SNRs get older, the high energy electron component is expected to fade away. This may allow to verify the picture through X-ray spectral evolution of the source population. Starting from the lessons we have learned so far from X-ray follow-up observations of unidentified TeV sources, prospects for Simbol-X to resolve open questions in this field will be discussed.
X-ray Studies of Unidentified Galactic TeV Gamma-ray Sources
International Nuclear Information System (INIS)
Puehlhofer, Gerd
2009-01-01
Many of the recently discovered Galactic TeV sources remain unidentified to date. A large fraction of the sources is possibly associated with relic pulsar wind nebula (PWN) systems. One key question here is the maximum energy (beyond TeV) attained in the compact PWNe. Hard X-ray emission can trace those particles, but current non-focussing X-ray instruments above 10 keV have difficulties to deconvolve the hard pulsar spectrum from its surrounding nebula.Some of the new TeV sources are also expected to originate from middle-aged and possibly even from old supernova remnants (SNR). But no compelling case for such an identification has been found yet. In established young TeV-emitting SNRs, X-ray imaging above 10 keV could help to disentangle the leptonic from the hadronic emission component in the TeV shells, if secondary electrons produced in hadronic collisions can be effectively detected. As SNRs get older, the high energy electron component is expected to fade away. This may allow to verify the picture through X-ray spectral evolution of the source population.Starting from the lessons we have learned so far from X-ray follow-up observations of unidentified TeV sources, prospects for Simbol-X to resolve open questions in this field will be discussed.
Laser plasma x-ray source for ultrafast time-resolved x-ray absorption spectroscopy
Directory of Open Access Journals (Sweden)
L. Miaja-Avila
2015-03-01
Full Text Available We describe a laser-driven x-ray plasma source designed for ultrafast x-ray absorption spectroscopy. The source is comprised of a 1 kHz, 20 W, femtosecond pulsed infrared laser and a water target. We present the x-ray spectra as a function of laser energy and pulse duration. Additionally, we investigate the plasma temperature and photon flux as we vary the laser energy. We obtain a 75 μm FWHM x-ray spot size, containing ∼106 photons/s, by focusing the produced x-rays with a polycapillary optic. Since the acquisition of x-ray absorption spectra requires the averaging of measurements from >107 laser pulses, we also present data on the source stability, including single pulse measurements of the x-ray yield and the x-ray spectral shape. In single pulse measurements, the x-ray flux has a measured standard deviation of 8%, where the laser pointing is the main cause of variability. Further, we show that the variability in x-ray spectral shape from single pulses is low, thus justifying the combining of x-rays obtained from different laser pulses into a single spectrum. Finally, we show a static x-ray absorption spectrum of a ferrioxalate solution as detected by a microcalorimeter array. Altogether, our results demonstrate that this water-jet based plasma source is a suitable candidate for laboratory-based time-resolved x-ray absorption spectroscopy experiments.
Identifying the TeV gamma-ray source MGRO J2228+61, FINALLY!
Aliu, Ester
2012-09-01
New VERITAS observations of MGRO J2228+61 allow us to associate its TeV emission with the enigmatic radio supernova remnant SNR G106.3+2.7. This remnant is part of a large complex that includes the Boomerang pulsar and nebula. The reduced field suggests that the TeV emission is not powered by the Boomerang, but instead associated with a much larger remnant. A recent SUZAKU X-ray observation of the smaller gamma-ray error box reveals two possible pulsar candidates. We propose short ACIS exposures to identify these sources to determine if one or both can be responsible for the gamma-ray emission. This will allow us to address the long standing problem on the nature of both MGRO J2228+61 and SNR G106.3+2.7.
High energy X-ray observations of COS-B gamma-ray sources from OSO-8
Dolan, J. F.; Crannell, C. J.; Dennis, B. R.; Frost, K. J.; Orwig, L. E.; Caraveo, P. A.
1985-01-01
During the three years between satellite launch in June 1975 and turn-off in October 1978, the high energy X-ray spectrometer on board OSO-8 observed nearly all of the COS-B gamma-ray source positions given in the 2CG catalog (Swanenburg et al., 1981). An X-ray source was detected at energies above 20 keV at the 6-sigma level of significance in the gamma-ray error box containing 2CG342 - 02 and at the 3-sigma level of significance in the error boxes containing 2CG065 + 00, 2CG195 + 04, and 2CG311 - 01. No definite association between the X-ray and gamma-ray sources can be made from these data alone. Upper limits are given for the 2CG sources from which no X-ray flux was detected above 20 keV.
Compact X-ray sources: X-rays from self-reflection
Mangles, Stuart P. D.
2012-05-01
Laser-based particle acceleration offers a way to reduce the size of hard-X-ray sources. Scientists have now developed a simple scheme that produces a bright flash of hard X-rays by using a single laser pulse both to generate and to scatter an electron beam.
X-ray bursters and the X-ray sources of the galactic bulge
International Nuclear Information System (INIS)
Lewin, W.H.G.; Joss, P.C.; Massachusetts Inst. of Tech., Cambridge; Massachusetts Inst. of Tech., Cambridge
1981-01-01
In this article we shall discuss the observed X-ray, optical, infrared and radio properties of the galactic bulge sources, with an emphasis on those that produce type I X-ray bursts. There is persuasive evidence that these burst sources and many other galactic bulge sources are neutron stars in low-mass, close-binary stellar systems. (orig./WL)
Radio and x-ray observations of compact sources in or near supernova remnants
International Nuclear Information System (INIS)
Seaquist, E.R.; Gilmore, W.S.
1982-01-01
We present VLA multifrequency radio observations of six compact radio sources from the list of nine objects proposed by Ryle et al. [Nature 276, 571 (1978)] as a new class of radio star, possibly the stellar remnants of supernovae. We also present the results of a search for x-ray emission from four of these objects with the Einstein observatory. The radio observations provide information on spectra, polarization, time variability, angular structure, and positions for these sources. The bearing of these new data on the nature of the sources is discussed. One particularly interesting result is that the polarization and angular-size measurements are combined in an astrophysical argument to conclude that one of the sources (2013+370) is extragalactic. No x-ray emission was detected from any of the four objects observed, but an extended x-ray source was found coincident with the supernova remnant G 33.6+0.1 near 1849+005. Our measurements provide no compelling arguments to consider any of the six objects studied as radio stars
Some observational aspects of compact galactic X-ray sources
International Nuclear Information System (INIS)
Heise, J.
1982-01-01
This thesis contains the following observations of compact galactic X-ray sources: i) the X-ray experiments onboard the Astronomical Netherlands Satellite ANS, ii) a rocket-borne ultra soft X-ray experiment and iii) the Objective Grating Spectrometer onboard the EINSTEIN observatory. In Chapter I the various types of compact galactic X-ray sources are reviewed and put into the perspective of earlier and following observations. In Chapter II the author presents some of the observations of high luminosity X-ray sources, made with ANS, including the detection of soft X-rays from the compact X-ray binary Hercules X-1 and the ''return to the high state'' of the black hole candidate Cygnus X-1. Chapter III deals with transient X-ray phenomena. Results on low luminosity galactic X-ray sources are collected in Chapter IV. (Auth.)
Research on point source simulating the γ-ray detection efficiencies of stander source
International Nuclear Information System (INIS)
Tian Zining; Jia Mingyan; Shen Maoquan; Yang Xiaoyan; Cheng Zhiwei
2010-01-01
For φ 75 mm x 25 mm sample, the full energy peak efficiencies on different heights of sample radius were obtained using the point sources, and the function parameters about the full energy peak efficiencies of point sources based on radius was fixed. The 59.54 keV γ-ray, 661.66 keV γ-ray, 1173.2 keV γ-ray, 1332.5 keV γ-ray detection efficiencies on different height of samples were obtained, based on the full energy peak efficiencies of point sources and its height, and the function parameters about the full energy peak efficiencies of surface sources based on sample height was fixed. The detection efficiency of (75 mm x 25 mm calibration source can be obtained by integrality, the detection efficiencies simulated by point sources are consistent with the results of stander source in 10%. Therefore, the calibration method of stander source can be substituted by the point source simulation method, and it tis feasible when there is no stander source.) (authors)
Compton backscattered collmated X-ray source
Ruth, Ronald D.; Huang, Zhirong
2000-01-01
A high-intensity, inexpensive and collimated x-ray source for applications such as x-ray lithography is disclosed. An intense pulse from a high power laser, stored in a high-finesse resonator, repetitively collides nearly head-on with and Compton backscatters off a bunched electron beam, having relatively low energy and circulating in a compact storage ring. Both the laser and the electron beams are tightly focused and matched at the interaction region inside the optical resonator. The laser-electron interaction not only gives rise to x-rays at the desired wavelength, but also cools and stabilizes the electrons against intrabeam scattering and Coulomb repulsion with each other in the storage ring. This cooling provides a compact, intense bunch of electrons suitable for many applications. In particular, a sufficient amount of x-rays can be generated by this device to make it an excellent and flexible Compton backscattered x-ray (CBX) source for high throughput x-ray lithography and many other applications.
Compton backscattered collimated x-ray source
Ruth, R.D.; Huang, Z.
1998-10-20
A high-intensity, inexpensive and collimated x-ray source is disclosed for applications such as x-ray lithography is disclosed. An intense pulse from a high power laser, stored in a high-finesse resonator, repetitively collides nearly head-on with and Compton backscatters off a bunched electron beam, having relatively low energy and circulating in a compact storage ring. Both the laser and the electron beams are tightly focused and matched at the interaction region inside the optical resonator. The laser-electron interaction not only gives rise to x-rays at the desired wavelength, but also cools and stabilizes the electrons against intrabeam scattering and Coulomb repulsion with each other in the storage ring. This cooling provides a compact, intense bunch of electrons suitable for many applications. In particular, a sufficient amount of x-rays can be generated by this device to make it an excellent and flexible Compton backscattered x-ray (CBX) source for high throughput x-ray lithography and many other applications. 4 figs.
A method to measure the γ-ray content in VHE cosmic ray showers
International Nuclear Information System (INIS)
Cresti, M.; Peruzzo, L.; Pesci, A.; Saggion, A.; Sartori, G.; Angelini, F.; Bedeschi, F.; Bellazzini, R.; Bertolucci, E.; Chiarelli, G.; Mariotti, M.; Massai, M.M.; Menzione, A.; Smith, D.A.; Stefanini, A.; Zetti, F.; Scribano, A.; Bartoli, B.; Budinich, M.; Liello, F.; Milotti, E.; Biral, A.R.P.; Chinellato, J.A.; Turtelli, A.; Luksys, M.
1991-01-01
An experimental technique is presented to determine the effectiveness of methods to tag photon initiated air showers and reject hadron initiated ones. The technique is based on the rate reduction in the Moon direction. With a photon energy threshold below or equal to 1 TeV, with an angular resolution of a few mrad and being insensitive to visible light, the proposed CLUE detector allows a wide and original physics program. In particular the direct measurement of the fraction of primary photons in the continuum of the cosmic ray flux is feasible with adequate statistics in a few months of data taking. (orig.)
Study of characteristic X-ray source and its applications
International Nuclear Information System (INIS)
Li Fuquan
1994-11-01
The law of characteristic X-rays emitted by target element under the radiation of isotope source in a range of low energy is discussed. Both the way of improving the rate of γ-X conversion and the method to eliminate the influence of scatter rays are introduced. The influence of the variation of isotopes source, targets and the relative position of source-target to the output of X-rays is also discussed and then the conditions of improving signal-to-noise radio is presented. The X-ray source based on these results can produce different energy X-rays, and so can be broadly used on nuclear instruments and other fields as a low energy source. The thickness gauge, as one of the applications, has succeeded in thickness measuring of the different materials in large range, and it presents a new application field for characteristic X-ray source. (11 figs., 10 tabs.)
Stellar Sources of Gamma-ray Bursts
Luchkov, B. I.
2011-01-01
Correlation analysis of Swift gamma-ray burst coordinates and nearby star locations (catalog Gliese) reveals 4 coincidences with good angular accuracy. The random probability is 4\\times 10^{-5}, so evidencing that coincident stars are indeed gamma-ray burst sources. Some additional search of stellar gamma-ray bursts is discussed.
DEFF Research Database (Denmark)
Gotthelf, E. V.; Tomsick, J. A.; Halpern, J. P.
2014-01-01
We report the discovery of a 206 ms pulsar associated with the TeV γ-ray source HESS J1640-465 using the Nuclear Spectroscopic Telescope Array (NuSTAR) X-ray observatory. PSR J1640-4631 lies within the shell-type supernova remnant (SNR) G338.3-0.0, and coincides with an X-ray point source...... and putative pulsar wind nebula (PWN) previously identified in XMM-Newton and Chandra images. It is spinning down rapidly with period derivative 9.758(44) × 10-13, yielding a spin-down luminosity 4.4 × 1036 erg s-1, characteristic age 3350 yr, and surface dipole magnetic field strength Bs = 1.4 × 1013 G....... For the measured distance of 12 kpc to G338.3-0.0, the 0.2-10 TeV luminosity of HESS J1640-465 is 6% of the pulsar's present . The Fermi source 1FHL J1640.5-4634 is marginally coincident with PSR J1640-4631, but we find no γ-ray pulsations in a search using five years of Fermi Large Area Telescope (LAT) data...
Very-high-energy gamma-ray observations of the Type Ia Supernova SN 2014J with the MAGIC telescopes
Ahnen, M. L.; Ansoldi, S.; Antonelli, L. A.; Antoranz, P.; Arcaro, C.; Babic, A.; Banerjee, B.; Bangale, P.; Barres de Almeida, U.; Barrio, J. A.; Becerra González, J.; Bednarek, W.; Bernardini, E.; Berti, A.; Biasuzzi, B.; Biland, A.; Blanch, O.; Bonnefoy, S.; Bonnoli, G.; Borracci, F.; Bretz, T.; Carosi, R.; Carosi, A.; Chatterjee, A.; Colin, P.; Colombo, E.; Contreras, J. L.; Cortina, J.; Covino, S.; Cumani, P.; Da Vela, P.; Dazzi, F.; De Angelis, A.; De Lotto, B.; de Oña Wilhelmi, E.; Di Pierro, F.; Doert, M.; Domínguez, A.; Dominis Prester, D.; Dorner, D.; Doro, M.; Einecke, S.; Eisenacher Glawion, D.; Elsaesser, D.; Engelkemeier, M.; Fallah Ramazani, V.; Fernández-Barral, A.; Fidalgo, D.; Fonseca, M. V.; Font, L.; Frantzen, K.; Fruck, C.; Galindo, D.; García López, R. J.; Garczarczyk, M.; Garrido Terrats, D.; Gaug, M.; Giammaria, P.; Godinović, N.; Gora, D.; Guberman, D.; Hadasch, D.; Hahn, A.; Hayashida, M.; Herrera, J.; Hose, J.; Hrupec, D.; Hughes, G.; Idec, W.; Kodani, K.; Konno, Y.; Kubo, H.; Kushida, J.; La Barbera, A.; Lelas, D.; Lindfors, E.; Lombardi, S.; Longo, F.; López, M.; López-Coto, R.; Majumdar, P.; Makariev, M.; Mallot, K.; Maneva, G.; Manganaro, M.; Mannheim, K.; Maraschi, L.; Marcote, B.; Mariotti, M.; Martínez, M.; Mazin, D.; Menzel, U.; Miranda, J. M.; Mirzoyan, R.; Moralejo, A.; Moretti, E.; Nakajima, D.; Neustroev, V.; Niedzwiecki, A.; Nievas Rosillo, M.; Nilsson, K.; Nishijima, K.; Noda, K.; Nogués, L.; Paiano, S.; Palacio, J.; Palatiello, M.; Paneque, D.; Paoletti, R.; Paredes, J. M.; Paredes-Fortuny, X.; Pedaletti, G.; Peresano, M.; Perri, L.; Persic, M.; Poutanen, J.; Prada Moroni, P. G.; Prandini, E.; Puljak, I.; Garcia, J. R.; Reichardt, I.; Rhode, W.; Ribó, M.; Rico, J.; Saito, T.; Satalecka, K.; Schroeder, S.; Schweizer, T.; Sillanpää, A.; Sitarek, J.; Snidaric, I.; Sobczynska, D.; Stamerra, A.; Strzys, M.; Surić, T.; Takalo, L.; Tavecchio, F.; Temnikov, P.; Terzić, T.; Tescaro, D.; Teshima, M.; Torres, D. F.; Toyama, T.; Treves, A.; Vanzo, G.; Vazquez Acosta, M.; Vovk, I.; Ward, J. E.; Will, M.; Wu, M. H.; Zanin, R.
2017-06-01
Context. In this work we present data from observations with the MAGIC telescopes of SN 2014J detected on January 21 2014, the closest Type Ia supernova since Imaging Air Cherenkov Telescopes started to operate. Aims: We aim to probe the possibility of very-high-energy (VHE; E ≥ 100 GeV) gamma rays produced in the early stages of Type Ia supernova explosions. Methods: We performed follow-up observations after this supernova (SN) explosion for five days, between January 27 and February 2 2014. We searched for gamma-ray signals in the energy range between 100 GeV and several TeV from the location of SN 2014J using data from a total of 5.5 h of observations. Prospects for observing gamma rays of hadronic origin from SN 2014J in the near future are also being addressed. Results: No significant excess was detected from the direction of SN 2014J. Upper limits at 95% confidence level on the integral flux, assuming a power-law spectrum, dF/dE ∝ E- Γ, with a spectral index of Γ = 2.6, for energies higher than 300 GeV and 700 GeV, are established at 1.3 × 10-12 and 4.1 × 10-13 photons cm-2 s-1, respectively. Conclusions: For the first time, upper limits on the VHE emission of a Type Ia supernova are established. The energy fraction isotropically emitted into TeV gamma rays during the first 10 days after the supernova explosion for energies greater than 300 GeV is limited to 10-6 of the total available energy budget ( 1051 erg). Within the assumed theoretical scenario, the MAGIC upper limits on the VHE emission suggest that SN 2014J will not be detectable in the future by any current or planned generation of Imaging Atmospheric Cherenkov Telescopes.
Determining the nature of faint X-ray sources from the ASCA Galactic center survey
Lutovinov, A. A.; Revnivtsev, M. G.; Karasev, D. I.; Shimansky, V. V.; Burenin, R. A.; Bikmaev, I. F.; Vorob'ev, V. S.; Tsygankov, S. S.; Pavlinsky, M. N.
2015-05-01
We present the results of the the identification of six objects from the ASCA Galactic center and Galactic plane surveys: AX J173548-3207, AX J173628-3141, AX J1739.5-2910, AX J1740.4-2856, AX J1740.5-2937, and AX J1743.9-2846. Chandra, XMM-Newton, and XRT/Swift X-ray data have been used to improve the positions of the optical counterparts to these sources. Thereafter, we have carried out a series of spectroscopic observations of the established optical counterparts at the RTT-150 telescope. Analysis of X-ray and optical spectra as well as photometric measurements in a wide wavelength range based on optical and infrared catalogs has allowed the nature of the program sources to be determined. Two X-ray objects have been detected in the error circle of AX J173628-3141: one is a coronally active G star and the other may be a symbiotic star, a red giant with an accreting white dwarf. Three sources (AX J1739.5-2910, AX J1740.5-2937, AX J1743.9-2846) have turned out to be active G-K stars, presumably RS CVn objects, one (AX J1740.4-2856) is an M dwarf, and another one (AX J173548-3207) most likely a low-mass X-ray binary in its low state. The distances and corresponding luminosities of the sources in the soft X-ray band (0.5-10 keV) have been estimated; analysis of deep INTEGRAL Galactic center observations has not revealed a statistically significant flux at energies >20 keV from any of them.
Are gamma-ray bursts the sources of ultra-high energy cosmic rays?
International Nuclear Information System (INIS)
Baerwald, Philipp
2014-07-01
We reconsider the possibility that gamma-ray bursts (GRBs) are the sources of the ultra-high energy cosmic rays (UHECRs) within the internal shock model, assuming a pure proton composition of the UHECRs. For the first time, we combine the information from gamma-rays, cosmic rays, prompt neutrinos, and cosmogenic neutrinos quantitatively in a joint cosmic ray production and propagation model, and we show that the information on the cosmic energy budget can be obtained as a consequence. In addition to the neutron model, we consider alternative scenarios for the cosmic ray escape from the GRBs, i.e., that cosmic rays can leak from the sources. We find that the dip model, which describes the ankle in UHECR observations by the pair production dip, is strongly disfavored in combination with the internal shock model because (a) unrealistically high baryonic loadings (energy in protons versus energy in electrons/gamma-rays) are needed for the individual GRBs and (b) the prompt neutrino flux easily overshoots the corresponding neutrino bound. On the other hand, GRBs may account for the UHECRs in the ankle transition model if cosmic rays leak out from the source at the highest energies. In that case, we demonstrate that future neutrino observations can efficiently test most of the parameter space - unless the baryonic loading is much larger than previously anticipated.
21 CFR 872.1810 - Intraoral source x-ray system.
2010-04-01
... (CONTINUED) MEDICAL DEVICES DENTAL DEVICES Diagnostic Devices § 872.1810 Intraoral source x-ray system. (a... structures. The x-ray source (a tube) is located inside the mouth. This generic type of device may include... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Intraoral source x-ray system. 872.1810 Section...
Multiwavelength study of Chandra X-ray sources in the Antennae
Clark, D. M.; Eikenberry, S. S.; Brandl, B. R.; Wilson, J. C.; Carson, J. C.; Henderson, C. P.; Hayward, T. L.; Barry, D. J.; Ptak, A. F.; Colbert, E. J. M.
2011-01-01
We use Wide-field InfraRed Camera (WIRC) infrared (IR) images of the Antennae (NGC 4038/4039) together with the extensive catalogue of 120 X-ray point sources to search for counterpart candidates. Using our proven frame-tie technique, we find 38 X-ray sources with IR counterparts, almost doubling the number of IR counterparts to X-ray sources that we first identified. In our photometric analysis, we consider the 35 IR counterparts that are confirmed star clusters. We show that the clusters with X-ray sources tend to be brighter, Ks≈ 16 mag, with (J-Ks) = 1.1 mag. We then use archival Hubble Space Telescope (HST) images of the Antennae to search for optical counterparts to the X-ray point sources. We employ our previous IR-to-X-ray frame-tie as an intermediary to establish a precise optical-to-X-ray frame-tie with <0.6 arcsec rms positional uncertainty. Due to the high optical source density near the X-ray sources, we determine that we cannot reliably identify counterparts. Comparing the HST positions to the 35 identified IR star cluster counterparts, we find optical matches for 27 of these sources. Using Bruzual-Charlot spectral evolutionary models, we find that most clusters associated with an X-ray source are massive, and young, ˜ 106 yr.
Pulsar Wind Nebulae and Cosmic Rays: A Bedtime Story
Energy Technology Data Exchange (ETDEWEB)
Weinstein, A.
2014-11-15
The role pulsar wind nebulae play in producing our locally observed cosmic ray spectrum remains murky, yet intriguing. Pulsar wind nebulae are born and evolve in conjunction with SNRs, which are favored sites of Galactic cosmic ray acceleration. As a result they frequently complicate interpretation of the gamma-ray emission seen from SNRs. However, pulsar wind nebulae may also contribute directly to the local cosmic ray spectrum, particularly the leptonic component. This paper reviews the current thinking on pulsar wind nebulae and their connection to cosmic ray production from an observational perspective. It also considers how both future technologies and new ways of analyzing existing data can help us to better address the relevant theoretical questions. A number of key points will be illustrated with recent results from the VHE (E > 100 GeV) gamma-ray observatory VERITAS.
Optical observations of binary X-ray sources
International Nuclear Information System (INIS)
Boynton, P.E.
1975-01-01
The contribution to the recent progress in astronomy made by optical observations is pointed out. The optical properties of X-ray sources help to establish the physical nature of these objects. The current observational evidence on the binary X-ray sources HZ Her/Her X-1 and HDE 226868/Cyg X-1 is reported. (P.J.S.)
Characterizing the source properties of terrestrial gamma ray flashes
Dwyer, Joseph R.; Liu, Ningyu; Eric Grove, J.; Rassoul, Hamid; Smith, David M.
2017-08-01
Monte Carlo simulations are used to determine source properties of terrestrial gamma ray flashes (TGFs) as a function of atmospheric column depth and beaming geometry. The total mass per unit area traversed by all the runaway electrons (i.e., the total grammage) during a TGF, Ξ, is introduced, defined to be the total distance traveled by all the runaway electrons along the electric field lines multiplied by the local air mass density along their paths. It is shown that key properties of TGFs may be directly calculated from Ξ and its time derivative, including the gamma ray emission rate, the current moment, and the optical power of the TGF. For the calculations presented in this paper, a standard TGF gamma ray fluence, F0 = 0.1 cm-2 above 100 keV for a spacecraft altitude of 500 km, and a standard total grammage, Ξ0 = 1018 g/cm2, are introduced, and results are presented in terms of these values. In particular, the current moments caused by the runaway electrons and their accompanying ionization are found for a standard TGF fluence, as a function of source altitude and beaming geometry, allowing a direct comparison between the gamma rays measured in low-Earth orbit and the VLF-LF radio frequency emissions recorded on the ground. Such comparisons should help test and constrain TGF models and help identify the roles of lightning leaders and streamers in the production of TGFs.
Basic study on gamma- and X-ray imaging technology using miniature radiation source
International Nuclear Information System (INIS)
Saito, Naoki; Koroki, Kenro; Kurosawa, Kenji
2000-01-01
In order to visualize a concealed unlawful matter, visualization using X-ray perspective image is effective, which is actualized. However, it is insufficient by conventional X-ray perspective image to visualize matters and substances of light elements such as narcotics, plastic bombs, and so forth, especially those in a metal container. Then, this study aims at basic research on visualization of perspective image on a weapon such as pistol and so on or a light element substance in a metal container such as car by using gamma-ray with various wave-lengths from a small radiation source. In 1998 fiscal year, a photographing system consisting of an X-ray 2 and a cooled CCD camera was constructed to carry out some simple photographing experiments. By judging through this experimental results only, 57 Co can be said to be more suitable to gamma-ray source for the perspective image photographing than 137 Cs is, which will be a future subject because of supposed dependence of specimen amount, shielding panel thickness or detector. (G.K.)
GAMMA-RAY SIGNAL FROM THE PULSAR WIND IN THE BINARY PULSAR SYSTEM PSR B1259-63/LS 2883
Energy Technology Data Exchange (ETDEWEB)
Khangulyan, Dmitry [Institute of Space and Astronautical Science/JAXA, 3-1-1 Yoshinodai, Chuo-ku, Sagamihara, Kanagawa 252-5210 (Japan); Aharonian, Felix A. [Dublin Institute for Advanced Studies, 31 Fitzwilliam Place, Dublin 2 (Ireland); Bogovalov, Sergey V. [National Research Nuclear University-MEPHI, Kashirskoe Shosse 31, Moscow 115409 (Russian Federation); Ribo, Marc, E-mail: khangul@astro.isas.jaxa.jp, E-mail: felix.aharonian@dias.ie, E-mail: svbogovalov@mephi.ru, E-mail: mribo@am.ub.es [Departament d' Astronomia i Meteorologia, Institut de Ciences del Cosmos (ICC), Universitat de Barcelona (IEEC-UB), Marti i Franques 1, E-08028 Barcelona (Spain)
2011-12-01
Binary pulsar systems emit potentially detectable components of gamma-ray emission due to Comptonization of the optical radiation of the companion star by relativistic electrons of the pulsar wind, both before and after termination of the wind. The recent optical observations of binary pulsar system PSR B1259-63/LS 2883 revealed radiation properties of the companion star which differ significantly from previous measurements. In this paper, we study the implications of these observations for the interaction rate of the unshocked pulsar wind with the stellar photons and the related consequences for fluxes of high energy and very high energy (VHE) gamma rays. We show that the signal should be strong enough to be detected with Fermi close to the periastron passage, unless the pulsar wind is strongly anisotropic or the Lorentz factor of the wind is smaller than 10{sup 3} or larger than 10{sup 5}. The higher luminosity of the optical star also has two important implications: (1) attenuation of gamma rays due to photon-photon pair production and (2) Compton drag of the unshocked wind. While the first effect has an impact on the light curve of VHE gamma rays, the second effect may significantly decrease the energy available for particle acceleration after termination of the wind.
Energy Technology Data Exchange (ETDEWEB)
Wang, Song; Qiu, Yanli; Liu, Jifeng [Key Laboratory of Optical Astronomy, National Astronomical Observatories, Chinese Academy of Sciences, Beijing 100012 (China); Bregman, Joel N., E-mail: songw@bao.ac.cn, E-mail: jfliu@bao.ac.cn [University of Michigan, Ann Arbor, MI 48109 (United States)
2016-09-20
Based on the recently completed Chandra /ACIS survey of X-ray point sources in nearby galaxies, we study the X-ray luminosity functions (XLFs) for X-ray point sources in different types of galaxies and the statistical properties of ultraluminous X-ray sources (ULXs). Uniform procedures are developed to compute the detection threshold, to estimate the foreground/background contamination, and to calculate the XLFs for individual galaxies and groups of galaxies, resulting in an XLF library of 343 galaxies of different types. With the large number of surveyed galaxies, we have studied the XLFs and ULX properties across different host galaxy types, and confirm with good statistics that the XLF slope flattens from lenticular ( α ∼ 1.50 ± 0.07) to elliptical (∼1.21 ± 0.02), to spirals (∼0.80 ± 0.02), to peculiars (∼0.55 ± 0.30), and to irregulars (∼0.26 ± 0.10). The XLF break dividing the neutron star and black hole binaries is also confirmed, albeit at quite different break luminosities for different types of galaxies. A radial dependency is found for ellipticals, with a flatter XLF slope for sources located between D {sub 25} and 2 D {sub 25}, suggesting the XLF slopes in the outer region of early-type galaxies are dominated by low-mass X-ray binaries in globular clusters. This study shows that the ULX rate in early-type galaxies is 0.24 ± 0.05 ULXs per surveyed galaxy, on a 5 σ confidence level. The XLF for ULXs in late-type galaxies extends smoothly until it drops abruptly around 4 × 10{sup 40} erg s{sup −1}, and this break may suggest a mild boundary between the stellar black hole population possibly including 30 M {sub ⊙} black holes with super-Eddington radiation and intermediate mass black holes.
Feasibility study on X-ray source with pinhole imaging method
International Nuclear Information System (INIS)
Qiu Rui; Li Junli
2007-01-01
In order to verify the feasibility of study on X-ray source with pinhole imaging method, and optimize the design of X-ray pinhole imaging system, an X-ray pinhole imaging equipment was set up. The change of image due to the change of the position and intensity of X-ray source was estimated with mathematical method and validated with experiment. The results show that the change of the spot position and gray of the spot is linearly related with the change of the position and intensity of X-ray source, so it is feasible to study X-ray source with pinhole imaging method in this application. The results provide some references for the design of X-ray pinhole imaging system. (authors)
Radioisotope sources for X-ray fluorescence analysis
International Nuclear Information System (INIS)
Leonowich, J.; Pandian, S.; Preiss, I.L.
1977-01-01
Problems involved in developing radioisotope sources and the characteristics of potentially useful radioisotopes for X-ray fluorescence analysis are presented. These include the following. The isotope must be evaluated for the physical and chemical forms available, purity, half-life, specific activity, toxicity, and cost. The radiation hazards of the source must be considered. The type and amount of radiation output of the source must be evaluated. The source construction must be planned. The source should also present an advance over those currently available in order to justify its development. Some of the isotopes, which are not in use but look very promising, are indicated, and their data are tabulated. A more or less ''perfect'' source within a given range of interest would exhibit the following characteristics. (1) Decay by an isometric transition with little or no internal conversion, (2) Have an intense gamma transition near the absorption edge of the element(s) of interest with no high energy gammas, (3) Have a sufficiently long half-life (in the order of years) for both economic and calibration reasons, (4) Have a sufficiently large cross-section for production in a reasonable amount of time. If there are competing reactions the interfering isotopes should be reasonably short-lived, or if not, be apt to be separated from the isotope chemically with a minimum of difficulty. (T.G.)
Multiple station beamline at an undulator x-ray source
DEFF Research Database (Denmark)
Als-Nielsen, J.; Freund, A.K.; Grübel, G.
1994-01-01
The undulator X-ray source is an ideal source for many applications: the beam is brilliant, highly collimated in all directions, quasi-monochromatic, pulsed and linearly polarized. Such a precious source can feed several independently operated instruments by utilizing a downstream series of X......-ray transparent monochromator crystals. Diamond in particular is an attractive monochromator as it is rather X-ray transparent and can be fabricated to a high degree of crystal perfection. Moreover, it has a very high heat conductivity and a rather small thermal expansion so the beam X-ray heat load problem...
Magnetic field strength of a neutron-star-powered ultraluminous X-ray source
Brightman, M.; Harrison, F. A.; Fürst, F.; Middleton, M. J.; Walton, D. J.; Stern, D.; Fabian, A. C.; Heida, M.; Barret, D.; Bachetti, M.
2018-04-01
Ultraluminous X-ray sources (ULXs) are bright X-ray sources in nearby galaxies not associated with the central supermassive black hole. Their luminosities imply they are powered by either an extreme accretion rate onto a compact stellar remnant, or an intermediate mass ( 100-105M⊙) black hole1. Recently detected coherent pulsations coming from three bright ULXs2-5 demonstrate that some of these sources are powered by accretion onto a neutron star, implying accretion rates significantly in excess of the Eddington limit, a high degree of geometric beaming, or both. The physical challenges associated with the high implied accretion rates can be mitigated if the neutron star surface field is very high (1014 G)6, since this suppresses the electron scattering cross-section, reducing the radiation pressure that chokes off accretion for high luminosities. Surface magnetic field strengths can be determined through cyclotron resonance scattering features7,8 produced by the transition of charged particles between quantized Landau levels. Here, we present the detection at a significance of 3.8σ of an absorption line at 4.5 keV in the Chandra spectrum of a ULX in M51. This feature is likely to be a cyclotron resonance scattering feature produced by the strong magnetic field of a neutron star. Assuming scattering off electrons, the magnetic field strength is implied to be 1011 G, while protons would imply a magnetic field of B 1015 G.
Infrared Counterparts to Chandra X-Ray Sources in the Antennae
Clark, D. M.; Eikenberry, S. S.; Brandl, B. R.; Wilson, J. C.; Carson, J. C.; Henderson, C. P.; Hayward, T. L.; Barry, D. J.; Ptak, A. F.; Colbert, E. J. M.
2007-03-01
We use deep J (1.25 μm) and Ks (2.15 μm) images of the Antennae (NGC 4038/4039) obtained with the Wide-field InfraRed Camera on the Palomar 200 inch (5 m) telescope, together with the Chandra X-ray source list of Zezas and coworkers to search for infrared counterparts to X-ray point sources. We establish an X-ray/IR astrometric frame tie with ~0.5" rms residuals over a ~4.3' field. We find 13 ``strong'' IR counterparts brighter than Ks=17.8 mag and 99.9% confidence level that IR counterparts to X-ray sources are ΔMKs~1.2 mag more luminous than average non-X-ray clusters. We also note that the X-ray/IR matches are concentrated in the spiral arms and ``overlap'' regions of the Antennae. This implies that these X-ray sources lie in the most ``super'' of the Antennae's super star clusters, and thus trace the recent massive star formation history here. Based on the NH inferred from the X-ray sources without IR counterparts, we determine that the absence of most of the ``missing'' IR counterparts is not due to extinction, but that these sources are intrinsically less luminous in the IR, implying that they trace a different (possibly older) stellar population. We find no clear correlation between X-ray luminosity classes and IR properties of the sources, although small-number statistics hamper this analysis.
Measuring The Variability Of Gamma-Ray Sources With AGILE
International Nuclear Information System (INIS)
Chen, Andrew W.; Vercellone, Stefano; Pellizzoni, Alberto; Tavani, Marco
2005-01-01
Variability in the gamma-ray flux above 100 MeV at various time scales is one of the primary characteristics of the sources detected by EGRET, both allowing the identification of individual sources and constraining the unidentified source classes. We present a detailed simulation of the capacity of AGILE to characterize the variability of gamma-ray sources, discussing the implications for source population studies
International Nuclear Information System (INIS)
Cooperstein, G.; Lanza, R.C.; Sohval, A.R.
1983-01-01
A circular array of cold cathode diode X-ray sources, for radiation imaging applications, such as computed tomography includes electrically conductive cathode plates each of which cooperates with at least two anodes to form at least two diode sources. In one arrangement, two annular cathodes are separated by radially extending, rod-like anodes. Field enhancement blades may be provided on the cathodes. In an alternative arrangement, the cathode plates extend radially and each pair is separated by an anode plate also extending radially. (author)
Characteristics of hard X-ray double sources in impulsive solar flares
Sakao, T.; Kosugi, T.; Masuda, S.; Yaji, K.; Inda-Koide, M.; Makishima, K.
1996-01-01
Imaging observations of solar flare hard X-ray sources with the Hard X-ray Telescope (HXT) aboard the Yohkoh satellite have revealed that hard X-ray emissions (greater than 30 ke V) originate most frequently from double sources. The double sources are located on both sides of the magnetic neutral line, suggesting that the bulk of hard X-rays is emitted from footpoints of flaring magnetic loops. We also found that hard X-rays from the double sources are emitted simultaneously within a fraction of second and that the weaker source tends to be located in the stronger magnetic field region, showing a softer spectrum. Physcial implications on the observed characteristics of the hard X-ray double sources are discussed.
Diagnostic Spectrometers for High Energy Density X-Ray Sources
International Nuclear Information System (INIS)
Hudson, L. T.; Henins, A.; Seely, J. F.; Holland, G. E.
2007-01-01
A new generation of advanced laser, accelerator, and plasma confinement devices are emerging that are producing extreme states of light and matter that are unprecedented for laboratory study. Examples of such sources that will produce laboratory x-ray emissions with unprecedented characteristics include megajoule-class and ultrafast, ultraintense petawatt laser-produced plasmas; tabletop high-harmonic-generation x-ray sources; high-brightness zeta-pinch and magnetically confined plasma sources; and coherent x-ray free electron lasers and compact inverse-Compton x-ray sources. Characterizing the spectra, time structure, and intensity of x rays emitted by these and other novel sources is critical to assessing system performance and progress as well as pursuing the new and unpredictable physical interactions of interest to basic and applied high-energy-density (HED) science. As these technologies mature, increased emphasis will need to be placed on advanced diagnostic instrumentation and metrology, standard reference data, absolute calibrations and traceability of results.We are actively designing, fabricating, and fielding wavelength-calibrated x-ray spectrometers that have been employed to register spectra from a variety of exotic x-ray sources (electron beam ion trap, electron cyclotron resonance ion source, terawatt pulsed-power-driven accelerator, laser-produced plasmas). These instruments employ a variety of curved-crystal optics, detector technologies, and data acquisition strategies. In anticipation of the trends mentioned above, this paper will focus primarily on optical designs that can accommodate the high background signals produced in HED experiments while also registering their high-energy spectral emissions. In particular, we review the results of recent laboratory testing that explores off-Rowland circle imaging in an effort to reclaim the instrumental resolving power that is increasingly elusive at higher energies when using wavelength
Galactic distribution of X-ray burst sources
International Nuclear Information System (INIS)
Lewin, W.H.G.; Hoffman, J.A.; Doty, J.; Clark, G.W.; Swank, J.H.; Becker, R.H.; Pravdo, S.H.; Serlemitsos, P.J.
1977-01-01
It is stated that 18 X-ray burst sources have been observed to date, applying the following definition for these bursts - rise times of less than a few seconds, durations of seconds to minutes, and recurrence in some regular pattern. If single burst events that meet the criteria of rise time and duration, but not recurrence are included, an additional seven sources can be added. A sky map is shown indicating their positions. The sources are spread along the galactic equator and cluster near low galactic longitudes, and their distribution is different from that of the observed globular clusters. Observations based on the SAS-3 X-ray observatory studies and the Goddard X-ray Spectroscopy Experiment on OSO-9 are described. The distribution of the sources is examined and the effect of uneven sky exposure on the observed distribution is evaluated. It has been suggested that the bursts are perhaps produced by remnants of disrupted globular clusters and specifically supermassive black holes. This would imply the existence of a new class of unknown objects, and at present is merely an ad hoc method of relating the burst sources to globular clusters. (U.K.)
Overview of high intensity x-ray and gamma-ray sources
International Nuclear Information System (INIS)
Prestwich, K.R.; Lee, J.R.; Ramirez, J.J.; Sanford, T.W.L.; Agee, F.J.; Frazier, G.B.; Miller, A.R.
1987-01-01
The requirements for intense x-ray and gamma-ray sources to simulate the radiation effects from nuclear weapons has led to the development of several types of terawatt-pulsed power systems. One example of a major gamma-ray source is Aurora, a 10-MV, 1.6-MA, 120-ns four-module, electron-beam generator. Recent requirements to improve the dose rate has led to the Aurora upgrade program and to the development of the 20-MV, 800-kA, 40-ns Hermes-III electron-beam accelerator. The Aurora program includes improvements to the pulsed power system and research on techniques to improve the pulse shape of the electron beam. Hermes III will feature twenty 1-MV, 800-kA induction accelerator cavities supplying energy to a magnetically insulated transmission line adder. Hermes III will become operational in 1988. Intense x-ray sources consist of pulsed power systems that operate with 1-MV to 2-MV output voltages and up to 25-TW output powers. These high powers are achieved with either low impedance electron-beam generators or multimodular pulsed power systems. The low-impedance generators have high voltage Marx generators that store the energy and then sequentially transfer this energy to pulse-forming transmission lines with lower and lower impedance until the high currents are reached. In the multimode machines, each module produces 0.7-TW to 4-TW output pulses, and all of the modules are connected together to supply energy to a single diode
International Nuclear Information System (INIS)
Lenain, J.P.
2009-01-01
Active Galactic Nuclei (AGN) are among the most energetic sources in the Universe. A subgroup of AGN possesses relativistic jets, the emission of which is purely non-thermal. In the case where the jet is aligned to the line of sight, these objects, called 'blazars', have their emission amplified by the relativistic Doppler effect. Since the advent of very high energy (VHE; E > 100 GeV) γ-ray astrophysics, Cerenkov telescopes like H.E.S.S. have observed almost thirty AGN, mainly blazars, from the ground. Cerenkov radiation from particle showers created by the interaction of γ-rays in the terrestrial atmosphere is used to derive the properties of the incident photon and thus to study these extragalactic sources. We have studied the highly variable VHE γ-ray emission from the blazar PKS 2155-304, from which 2 major outbursts were detected in July 2006, within the framework of a dynamic Synchrotron self-Compton (SSC) model. This variable emission presents properties excluding the most standard emission scenarios for blazars. We have also developed an SSC emission model for misaligned relativistic jets, to interpret the recent discovery of VHE γ-ray emission from 2 radio galaxies, M87 and Cen-A, which established the emergence of a new family of cosmic TeV emitters. We conclude with a systematic study conducted on all the AGN currently known at TeV with a stationary SSC model. We present tools for predictions of flux densities in these objects, which can be confronted with future observations by the Cerenkov Telescope Array (CTA). (author)
Classification of X-ray sources in the direction of M31
Vasilopoulos, G.; Hatzidimitriou, D.; Pietsch, W.
2012-01-01
M31 is our nearest spiral galaxy, at a distance of 780 kpc. Identification of X-ray sources in nearby galaxies is important for interpreting the properties of more distant ones, mainly because we can classify nearby sources using both X-ray and optical data, while more distant ones via X-rays alone. The XMM-Newton Large Project for M31 has produced an abundant sample of about 1900 X-ray sources in the direction of M31. Most of them remain elusive, giving us little signs of their origin. Our goal is to classify these sources using criteria based on properties of already identified ones. In particular we construct candidate lists of high mass X-ray binaries, low mass X-ray binaries, X-ray binaries correlated with globular clusters and AGN based on their X-ray emission and the properties of their optical counterparts, if any. Our main methodology consists of identifying particular loci of X-ray sources on X-ray hardness ratio diagrams and the color magnitude diagrams of their optical counterparts. Finally, we examined the X-ray luminosity function of the X-ray binaries populations.
The γ-ray sky seen with H.E.S.S
International Nuclear Information System (INIS)
Volpe, F.
2011-01-01
H.E.S.S. is an array of four imaging Cherenkov telescopes located in the Khomas Highlands of Namibia. It has been in operation since December 2003 and detects very-high-energy (VHE) γ-rays with energies ranging from 100 GeV to ∼ 50 TeV. Since 2004, regular observation of the Galactic Plane has yielded wind nebulae (PWN), supernova remnants (SNRs), γ-ray binaries and, more recently, a stellar cluster and molecular clouds in the vicinity of shell-type SNRs. H.E.S.S. has observed fast and intense TeV variability. Highlights of the most recent H.E.S.S. observations are presented and their implications are discussed.
Medical X-ray sources now and for the future
Behling, Rolf
2017-11-01
This paper focuses on the use of X-rays in their largest field of application: medical diagnostic imaging and image-guided therapy. For this purpose, vacuum electronics in the form of X-ray tubes as the source of bremsstrahlung (braking radiation) have been the number one choice for X-ray production in the range of photon energies between about 16 keV for mammography and 150 keV for general radiography. Soft tissue on one end and bony structures on the other are sufficiently transparent and the contrast delivered by difference of absorption is sufficiently high for this spectral range. The dominance of X-ray tubes holds even more than 120 years after Conrad Roentgen's discovery of the bremsstrahlung mechanism. What are the specifics of current X-ray tubes and their medical diagnostic applications? How may the next available technology at or beyond the horizon look like? Can we hope for substantial game changers? Will flat panel sources, less expensive X-ray "LED's", compact X-ray Lasers, compact synchrotrons or equivalent X-ray sources appear in medical diagnostic imaging soon? After discussing the various modalities of imaging systems and their sources of radiation, this overview will briefly touch on the physics of bremsstrahlung generation, key characteristics of X-ray tubes, and material boundary conditions, which restrict performance. It will discuss the deficits of the bremsstrahlung technology and try to sketch future alternatives and their prospects of implementation in medical diagnostics.
Measurement of the G-value for 1. 5 keV X-rays
Energy Technology Data Exchange (ETDEWEB)
Freyer, J.P.; Schillaci, M.E.; Raju, M.R. (Los Alamos National Lab., NM (USA))
1989-12-01
Using a ferrous sulfate solution modified by the addition of benzoic acid, the authors measured relative G-values for Al{sub k} characteristic X-rays (1.5keV), {sup 238}Pu {alpha}-particles (3.7MeV), {sup 60}Co (1.17 MeV) and {sup 137}Cs (0.66 MeV){gamma}-rays. Relative ferrous-to-ferric conversions as a function of dose were similar for the two {gamma}-ray energies, yielding G-values of 1.62 and 1.59 {mu}mol J{sup -1} for the {sup 60}Co and {sup 137}Cs radiations. The {alpha}-particle G-value was 0.52 {mu}mol J{sup -1}, or 31% of that for {sup 60}Co {gamma}-rays. The Al{sub k} X-rays had a G-value of 0.92 {mu}mol J{sup -1} or 57% of that of the {sup 60}Co radiation. This G-value for 1.5 keV X-rays is within 20% of values predicted by current theories, and theoretical values are within the error range of the authors' measurements. (author).
Hard-x-ray phase-difference microscopy with a low-brilliance laboratory x-ray source
International Nuclear Information System (INIS)
Kuwabara, Hiroaki; Yashiro, Wataru; Harasse, Sebastien; Momose, Atsushi; Mizutani, Haruo
2011-01-01
We have developed a hard-X-ray phase-imaging microscopy method using a low-brilliance X-ray source. The microscope consists of a sample, a Fresnel zone plate, a transmission grating, and a source grating creating an array of mutually incoherent X-ray sources. The microscope generates an image exhibiting twin features of the sample with opposite signs separated by a distance, which is processed to generate a phase image. The method is quantitative even for non-weak-phase objects that are difficult to be quantitatively examined by the widely used Zernike phase-contrast microscopy, and it has potentially broad applications in the material and biological science fields. (author)
A portable x-ray source and method for radiography
International Nuclear Information System (INIS)
Golovanivsky, K.S.
1996-01-01
A portable x-ray source that produces a sufficient x-ray flux to produce high quality x-ray images on x-ray films. The source includes a vacuum chamber filled with a heavy atomic weight gas at low pressure and an x-ray emitter. The chamber is in a magnetic field and an oscillating electric field and generates electron cyclotron resonance (ECR) plasma having a ring of energetic electrons inside the chamber. The electrons bombard the x-ray emitter which in turn produces x-ray. A pair of magnetic members generate an axisymmetric magnetic mirror trap inside the chamber. The chamber may be nested within a microwave resonant cavity and between the magnets or the chamber and the microwave cavity may be a single composite structure. (author)
2009-01-01
Ecole de physique - Département de physique nucléaire et corspusculaire 24, Quai Ernest-Ansermet 1211 GENEVE 4 Tél: (022) 379 62 73 - Fax: (022) 379 69 92 Wednesday 25 February 2009 PARTICLE PHYSICS SEMINAR at 17:00 – Stückelberg Auditorium Physics insights from recent HESS AGN observations by Dr. Francesca Volpe, Max-Planck-Institute for Nuclear Physics, Heidelberg The extragalactic sources are still the most powerful, variable and brightest objects in the VHE gamma-ray sky. The improved sensitivity of the new generation of ground-based instruments have increased the VHE emitting population, providing information about cosmology and giving new clues about particle acceleration mechanisms at play in active galactic nuclei. Emphasis will be put on the contribution of the H.E.S.S. experiment to the temporal variability of extragalactic gamma-ray sources, including an update on the most recent detections and on the giant flares from PKS 2155-304. Information : http://dpnc.unige.ch/seminaire/annonce.htmlOr...
2009-01-01
École de physique - Département de physique nucléaire et corspusculaire 24, quai Ernest-Ansermet 1211 GENÈVE 4 Tél: (022) 379 62 73 - Fax: (022) 379 69 92 Wednesday 25 February 2009 PARTICLE PHYSICS SEMINAR at 17:00 – Stückelberg Auditorium Physics insights from recent HESS AGN observations by Dr. Francesca Volpe / Max-Planck-Institute for Nuclear Physics, Heidelberg The extragalactic sources are still the most powerful, variable and brightest objects in the VHE gamma-ray sky. The improved sensitivity of the new generation of ground-based instruments have increased the VHE emitting population, providing information about cosmology and giving new clues about particle acceleration mechanisms at play in active galactic nuclei. Emphasis will be put on the contribution of the H.E.S.S. experiment to the temporal variability of extragalactic gamma-ray sources, including an update on the most recent detections and on the giant flares from PKS 2155-304. Information: http://d...
Synchrotron radiation sources and condensers for projection x-ray lithography
International Nuclear Information System (INIS)
Murphy, J.B.; MacDowell, A.A.; White, D.L.; Wood, O.R. II
1992-01-01
The design requirements for a compact electron storage ring that could be used as a soft x-ray source for projection lithography are discussed. The design concepts of the x-ray optics that are required to collect and condition the radiation in divergence, uniformity and direction to properly illuminate the mask and the particular x-ray projection camera used are discussed. Preliminary designs for an entire soft x-ray projection lithography system using an electron storage ring as a soft X-ray source are presented. It is shown that by combining the existing technology of storage rings with large collection angle condensers, a powerful and reliable source of 130 Angstrom photons for production line projection x-ray lithography is possible
WORKSHOP: Accreting X-ray sources
Energy Technology Data Exchange (ETDEWEB)
Anon.
1986-09-15
Earlier this year a workshop on 'High Energy/Ultra High Energy Behaviour of Accreting X-Ray Sources' was held in Vulcano, a small island near Sicily, jointly organized by the Italian Istituto Nazionale di Fisica Nucleare and Consiglio Nazionale delle Ricerche. About 60 astrophysicists and particle physicists attended the meeting which covered the study of galactic cosmic sources emitting in the wide energy range from the optical region to some 10{sup 15} eV.
Near stellar sources of gamma-ray bursts
Luchkov, B. I.; Markin, P. D.
2012-01-01
Correlation analysis of gamma-ray burst coordinates and nearby stars, registered on 2008-2011, revealed 5 coincidences with angular accuracy better than 0.1 degree. The random probability is $7\\times 10^{-7}$, so evidencing that coincident stars are indeed gamma-ray burst sources. The proposed method should be continued in order to provide their share in common balance of cosmic gamma-ray bursts.
Simple, compact, high brightness source for x-ray lithography and x-ray radiography
International Nuclear Information System (INIS)
Hawryluk, A.M.
1986-01-01
A simple, compact, high brightness x-ray source has recently been built. This source utilizes a commercially available, cylindrical geometry electron beam evaporator, which has been modified to enhance the thermal cooling to the anode. Cooling is accomplished by using standard, low-conductivity laboratory water, with an inlet pressure of less than 50 psi, and a flow rate of approx.0.3 gal/min. The anode is an inverted cone geometry for efficient cooling. The x-ray source has a measured sub-millimeter spot size (FWHM). The anode has been operated at 1 KW e-beam power (10 KV, 100 ma). Higher operating levels will be investigated. A variety of different x-ray lines can be obtained by the simple interchange of anodes of different materials. Typical anodes are made from easily machined metals, or materials which are vacuum deposited onto a copper anode. Typically, a few microns of material is sufficient to stop 10 KV electrons without significantly decreasing the thermal conductivity through the anode. The small size and high brightness of this source make it useful for step and repeat exposures over several square centimeter areas, especially in a research laboratory environment. For an aluminum anode, the estimated Al-K x-ray flux at 10 cms from the source is 70 μW/cm 2
2XMM ultraluminous X-ray source candidates in nearby galaxies
Walton, D. J.; Roberts, T. P.; Mateos, S.; Heard, V.
2011-09-01
Ultraluminous X-ray sources (ULXs) are some of the most enigmatic X-ray bright sources known to date. It is generally accepted that they cannot host black holes as large as those associated with active galaxies, but they appear to be significantly more luminous than their better understood Galactic X-ray binary (XRB) cousins, while displaying an intriguing combination of differences and similarities with them. Through studying large, representative samples of these sources we may hope to enhance our understanding of them. To this end, we derive a large catalogue of 650 X-ray detections of 470 ULX candidates, located in 238 nearby galaxies, by cross-correlating the 2XMM Serendipitous Survey with the Third Reference Catalogue of Bright Galaxies. The presented dedicated catalogue offers a significant improvement over those previously published in terms of both the number and the contribution of background contaminants, e.g. distant quasars, which we estimate to be at most 24 per cent, but more likely ˜17 per cent. To undertake population studies, we define a 'complete' sub-sample of sources compiled from observations of galaxies with sensitivity limits below 1039 erg s-1. The luminosity function of this sample is consistent with a simple power law of form N(>LX) ∝ L-0.96 ± 0.11X. Although we do not find any statistical requirement for a cut-off luminosity of Lc˜ 1040 erg s-1, as has been reported previously, we are not able to rule out its presence. Also, we find that the number of ULXs per unit galaxy mass, Su, decreases with increasing galaxy mass for ULXs associated with spiral galaxies, and is well modelled with a power law of form Su ∝ M-0.64 ± 0.07. This is in broad agreement with previous results, and is likely to be a consequence of the decrease in specific star formation and increase in metallicity with increasing spiral galaxy mass. Su is consistent with being constant with galaxy mass for sources associated with elliptical galaxies, implying this
Gabányi, K. É.; Frey, S.; An, T.
2018-05-01
Context. The Fermi Large Area Telescope revealed that the extragalactic γ-ray sky is dominated by blazars, active galactic nuclei (AGN) whose jet is seen at very small angle to the line of sight. To associate and then classify the γ-ray sources, data have been collected from lower frequency surveys and observations. Since those have superior angular resolution and positional accuracy compared to the γ-ray observations, some associations are not straightforward. Aims: The γ-ray source 3FGL J1323.0+2942 is associated with the radio source 4C+29.48 and classified as a blazar of unknown type, lacking optical spectrum and redshift. The higher-resolution radio data showed that 4C+29.48 comprises three bright radio-emitting features located within a 1'-diameter area. We aim to reveal their nature and pinpoint the origin of the γ-ray emission. Methods: We (re-)analyzed archival Very Large Array (VLA) and unpublished very long baseline interferometry (VLBI) observations conducted by the Very Long Baseline Array (VLBA) and the European VLBI Network of 4C+29.48. We also collected data form optical, infrared and X-ray surveys. Results: According to the VLBI data, the northernmost complex of 4C+29.48 contains a blazar with a high brightness temperature compact core and a steep-spectrum jet feature. The blazar is positionally coincident with an optical source at a redshift of 1.142. Its mid-infrared colors also support its association with a γ-ray emitting blazar. The two other radio complexes have steep radio spectra similar to AGN-related lobes and do not have optical or infrared counterparts in currently available surveys. Based on the radio morphology, they are unlikely to be related to the blazar. There is an optical source between the two radio features, also detected in infrared wavebands. We discuss the possibilities whether the two radio features are lobes of a radio galaxy, or gravitationally lensed images of a background source. Conclusions: We propose to
Advanced imaging technology using carbon nanotube x ray source
International Nuclear Information System (INIS)
Choi, Hae Young; Seol, Seung Kown; Kim, Jaehoon; Yoo, Seung Hoon; Kim, Jong Uk
2008-01-01
Recently, X ray imaging technology is a useful and leading medical diagnostic tool for healthcare professionals to diagnose disease in human body. CNTs(i.e. carbon nanotubes)are used in many applications like FED, Micro wave amplifier, X ray source, etc. because of its suitable electrical, chemical and physical properties. Specially, CNTs are well used electron emitters for x ray source. Conventionally, thermionic type of tungsten filament x ray tube is widely employed in the field of bio medical and industrial application fields. However, intrinsic problems such as, poor emission efficiency and low imaging resolution cause the limitation of use of the x ray tube. To fulfill the current market requirement specifically for medical diagnostic field, we have developed rather a portable and compact CNT based x ray source in which high imaging resolution is provided. Electron sources used in X ray tubes should be well focused to the anode target for generation of high quality x ray. In this study, Pierce type x ray generation module was tested based its simulation results using by OPERA 3D code. Pierce type module is composed of cone type electrical lens with its number of them and inner angles of them that shows different results with these parameters. And some preliminary images obtained using the CNT x ray source were obtained. The represented images are the finger bone and teeth in human body. It is clear that the trabeculation shape is observed in finger bone. To obtain the finger bone image, tube currents of 250A at 42kV tube voltage was applied. The human tooth image, however, is somewhat unclear because the supplied voltage to the tube was limited to max. 50kV in the system developed. It should be noted that normally 60∼70kV of tube voltage is supplied in dental imaging. Considering these it should be emphasized that if the tube voltage is over 60kV then clearer image is possible. In this paper, we are discussed comparing between these experiment results and
Fermi LAT Observations of LS I +61 303: First Detection of an Orbital Modulation in GeV Gamma Rays
Energy Technology Data Exchange (ETDEWEB)
Abdo, A.A.; /Federal City Coll. /Naval Research Lab, Wash., D.C.; Ackermann, M.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Ajello, M.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Atwood, W.B.; /UC, Santa Cruz; Axelsson, M.; /Stockholm U., OKC /Stockholm U.; Baldini, L.; /INFN, Pisa; Ballet, J.; /DAPNIA, Saclay; Barbiellini, G.; /INFN, Trieste /Trieste U.; Bastieri, D.; /INFN, Padua /Padua U.; Baughman, B.M.; /Ohio State U.; Bechtol, K.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bellazzini, R.; /INFN, Pisa; Berenji, B.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Blandford, R.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bloom, E.D.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bonamente, E.; /INFN, Perugia /Perugia U.; Borgland, A.W.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bregeon, J.; /INFN, Pisa; Brez, A.; /INFN, Pisa; Brigida, M.; /Bari U. /INFN, Bari; Bruel, P.; /Ecole Polytechnique /Washington U., Seattle /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /IASF, Milan /Milan Polytechnic /DAPNIA, Saclay /ASDC, Frascati /INFN, Perugia /Perugia U. /NASA, Goddard /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /DAPNIA, Saclay /Naval Research Lab, Wash., D.C. /George Mason U. /NASA, Goddard /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /INFN, Perugia /Perugia U. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Montpellier U. /Sonoma State U. /Stockholm U., OKC /Royal Inst. Tech., Stockholm /Stockholm U. /DAPNIA, Saclay /NASA, Goddard /CSST, Baltimore /ASDC, Frascati /Naval Research Lab, Wash., D.C. /INFN, Trieste /Pavia U. /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /UC, Santa Cruz /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /SLAC /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Grenoble, CEN; /more authors..
2012-04-02
This Letter presents the first results from the observations of LS I +61{sup o}303 using Large Area Telescope data from the Fermi Gamma-Ray Space Telescope between 2008 August and 2009 March. Our results indicate variability that is consistent with the binary period, with the emission being modulated at 26.6 {+-} 0.5 days. This constitutes the first detection of orbital periodicity in high-energy gamma rays (20 MeV-100 GeV, HE). The light curve is characterized by a broad peak after periastron, as well as a smaller peak just before apastron. The spectrum is best represented by a power law with an exponential cutoff, yielding an overall flux above 100 MeV of 0.82 {+-} 0.03(stat) {+-} 0.07(syst) 10{sup -6} ph cm{sup -2} s{sup -1}, with a cutoff at 6.3 {+-} 1.1(stat) {+-} 0.4(syst) GeV and photon index {Gamma} = 2.21 {+-} 0.04(stat) {+-} 0.06(syst). There is no significant spectral change with orbital phase. The phase of maximum emission, close to periastron, hints at inverse Compton scattering as the main radiation mechanism. However, previous very high-energy gamma ray (>100 GeV, VHE) observations by MAGIC and VERITAS show peak emission close to apastron. This and the energy cutoff seen with Fermi suggest that the link between HE and VHE gamma rays is nontrivial.
The Extragalactic Background Light and the Gamma-ray Opacity of the Universe
Dwek, Eli; Krennrich, Frank
2012-01-01
The extragalactic background light (EBL) is one of the fundamental observational quantities in cosmology. All energy releases from resolved and unresolved extragalactic sources, and the light from any truly diffuse background, excluding the cosmic microwave background (CMB), contribute to its intensity and spectral energy distribution. It therefore plays a crucial role in cosmological tests for the formation and evolution of stellar objects and galaxies, and for setting limits on exotic energy releases in the universe. The EBL also plays an important role in the propagation of very high energy gamma-rays which are attenuated en route to Earth by pair producing gamma-gamma interactions with the EBL and CMB. The EBL affects the spectrum of the sources, predominantly blazars, in the approx 10 GeV to 10 TeV energy regime. Knowledge of the EBL intensity and spectrum will allow the determination of the intrinsic blazar spectrum in a crucial energy regime that can be used to test particle acceleration mechanisms and VHE gamma-ray production models. Conversely, knowledge of the intrinsic gamma-ray spectrum and the detection of blazars at increasingly higher redshifts will set strong limits on the EBL and its evolution. This paper reviews the latest developments in the determination of the EBL and its impact on the current understanding of the origin and production mechanisms of gamma-rays in blazars, and on energy releases in the universe. The review concludes with a summary and future directions in Cherenkov Telescope Array techniques and in infrared ground-based and space observatories that will greatly improve our knowledge of the EBL and the origin and production of very high energy gamma-rays.
Energy Technology Data Exchange (ETDEWEB)
Saz Parkinson, P. M. [Department of Physics, The University of Hong Kong, Pokfulam Road, Hong Kong (China); Xu, H.; Yu, P. L. H. [Department of Statistics and Actuarial Science, The University of Hong Kong, Pokfulam Road, Hong Kong (China); Salvetti, D.; Marelli, M. [INAF—Istituto di Astrofisica Spaziale e Fisica Cosmica Milano, via E. Bassini 15, I-20133, Milano (Italy); Falcone, A. D. [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States)
2016-03-20
We apply a number of statistical and machine learning techniques to classify and rank gamma-ray sources from the Third Fermi Large Area Telescope Source Catalog (3FGL), according to their likelihood of falling into the two major classes of gamma-ray emitters: pulsars (PSR) or active galactic nuclei (AGNs). Using 1904 3FGL sources that have been identified/associated with AGNs (1738) and PSR (166), we train (using 70% of our sample) and test (using 30%) our algorithms and find that the best overall accuracy (>96%) is obtained with the Random Forest (RF) technique, while using a logistic regression (LR) algorithm results in only marginally lower accuracy. We apply the same techniques on a subsample of 142 known gamma-ray pulsars to classify them into two major subcategories: young (YNG) and millisecond pulsars (MSP). Once more, the RF algorithm has the best overall accuracy (∼90%), while a boosted LR analysis comes a close second. We apply our two best models (RF and LR) to the entire 3FGL catalog, providing predictions on the likely nature of unassociated sources, including the likely type of pulsar (YNG or MSP). We also use our predictions to shed light on the possible nature of some gamma-ray sources with known associations (e.g., binaries, supernova remnants/pulsar wind nebulae). Finally, we provide a list of plausible X-ray counterparts for some pulsar candidates, obtained using Swift, Chandra, and XMM. The results of our study will be of interest both for in-depth follow-up searches (e.g., pulsar) at various wavelengths and for broader population studies.
International Nuclear Information System (INIS)
Saz Parkinson, P. M.; Xu, H.; Yu, P. L. H.; Salvetti, D.; Marelli, M.; Falcone, A. D.
2016-01-01
We apply a number of statistical and machine learning techniques to classify and rank gamma-ray sources from the Third Fermi Large Area Telescope Source Catalog (3FGL), according to their likelihood of falling into the two major classes of gamma-ray emitters: pulsars (PSR) or active galactic nuclei (AGNs). Using 1904 3FGL sources that have been identified/associated with AGNs (1738) and PSR (166), we train (using 70% of our sample) and test (using 30%) our algorithms and find that the best overall accuracy (>96%) is obtained with the Random Forest (RF) technique, while using a logistic regression (LR) algorithm results in only marginally lower accuracy. We apply the same techniques on a subsample of 142 known gamma-ray pulsars to classify them into two major subcategories: young (YNG) and millisecond pulsars (MSP). Once more, the RF algorithm has the best overall accuracy (∼90%), while a boosted LR analysis comes a close second. We apply our two best models (RF and LR) to the entire 3FGL catalog, providing predictions on the likely nature of unassociated sources, including the likely type of pulsar (YNG or MSP). We also use our predictions to shed light on the possible nature of some gamma-ray sources with known associations (e.g., binaries, supernova remnants/pulsar wind nebulae). Finally, we provide a list of plausible X-ray counterparts for some pulsar candidates, obtained using Swift, Chandra, and XMM. The results of our study will be of interest both for in-depth follow-up searches (e.g., pulsar) at various wavelengths and for broader population studies
X-ray Optics for BES Light Source Facilities
Energy Technology Data Exchange (ETDEWEB)
Mills, Dennis [Argonne National Lab. (ANL), Argonne, IL (United States); Padmore, Howard [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Lessner, Eliane [Dept. of Energy (DOE), Washington DC (United States). Office of Science
2013-03-27
Each new generation of synchrotron radiation sources has delivered an increase in average brightness 2 to 3 orders of magnitude over the previous generation. The next evolution toward diffraction-limited storage rings will deliver another 3 orders of magnitude increase. For ultrafast experiments, free electron lasers (FELs) deliver 10 orders of magnitude higher peak brightness than storage rings. Our ability to utilize these ultrabright sources, however, is limited by our ability to focus, monochromate, and manipulate these beams with X-ray optics. X-ray optics technology unfortunately lags behind source technology and limits our ability to maximally utilize even today’s X-ray sources. With ever more powerful X-ray sources on the horizon, a new generation of X-ray optics must be developed that will allow us to fully utilize these beams of unprecedented brightness. The increasing brightness of X-ray sources will enable a new generation of measurements that could have revolutionary impact across a broad area of science, if optical systems necessary for transporting and analyzing X-rays can be perfected. The high coherent flux will facilitate new science utilizing techniques in imaging, dynamics, and ultrahigh-resolution spectroscopy. For example, zone-plate-based hard X-ray microscopes are presently used to look deeply into materials, but today’s resolution and contrast are restricted by limitations of the current lithography used to manufacture nanodiffractive optics. The large penetration length, combined in principle with very high spatial resolution, is an ideal probe of hierarchically ordered mesoscale materials, if zone-plate focusing systems can be improved. Resonant inelastic X-ray scattering (RIXS) probes a wide range of excitations in materials, from charge-transfer processes to the very soft excitations that cause the collective phenomena in correlated electronic systems. However, although RIXS can probe high-energy excitations, the most exciting and
X-ray Optics for BES Light Source Facilities
International Nuclear Information System (INIS)
Mills, Dennis; Padmore, Howard; Lessner, Eliane
2013-01-01
Each new generation of synchrotron radiation sources has delivered an increase in average brightness 2 to 3 orders of magnitude over the previous generation. The next evolution toward diffraction-limited storage rings will deliver another 3 orders of magnitude increase. For ultrafast experiments, free electron lasers (FELs) deliver 10 orders of magnitude higher peak brightness than storage rings. Our ability to utilize these ultrabright sources, however, is limited by our ability to focus, monochromate, and manipulate these beams with X-ray optics. X-ray optics technology unfortunately lags behind source technology and limits our ability to maximally utilize even today's X-ray sources. With ever more powerful X-ray sources on the horizon, a new generation of X-ray optics must be developed that will allow us to fully utilize these beams of unprecedented brightness. The increasing brightness of X-ray sources will enable a new generation of measurements that could have revolutionary impact across a broad area of science, if optical systems necessary for transporting and analyzing X-rays can be perfected. The high coherent flux will facilitate new science utilizing techniques in imaging, dynamics, and ultrahigh-resolution spectroscopy. For example, zone-plate-based hard X-ray microscopes are presently used to look deeply into materials, but today's resolution and contrast are restricted by limitations of the current lithography used to manufacture nanodiffractive optics. The large penetration length, combined in principle with very high spatial resolution, is an ideal probe of hierarchically ordered mesoscale materials, if zone-plate focusing systems can be improved. Resonant inelastic X-ray scattering (RIXS) probes a wide range of excitations in materials, from charge-transfer processes to the very soft excitations that cause the collective phenomena in correlated electronic systems. However, although RIXS can probe high-energy excitations, the most exciting
Compound refractive lenses for novel X-ray sources
Energy Technology Data Exchange (ETDEWEB)
Piestrup, M.A. E-mail: melpie@adelphitech.com; Beguiristain, H.R.; Gary, C.K.; Cremer, J.T.; Pantell, R.H.; Tatchyn, R
2001-01-01
We have measured the intensity profile of X-rays focused by a linear array of closely spaced spherical lenses fabricated using Mylar (C{sub 5}H{sub 4}O{sub 2}). We have experimentally demonstrated that we can achieve two-dimensional focusing for photon energies between 7 and 9 keV with imaging distances of less than 1 m. For example, using 8-keV X-rays we have achieved full-width-at-half-maximum (FWHM) linewidths down to 27.5 {mu}m at a distance of only 62 cm from the lens. The effective aperture of the lens was measured to be about 390 {mu}m with 38% transmission at 9 keV. A synchrotron source having source-size dimensions of 0.44x1.7 mm{sup 2} was utilized for the experimental work. Such lenses are seen as useful for focusing and increasing the intensity of novel X-ray sources that are directional and have small source size ({sigma}<1 mm)
Volegov, P. L.; Danly, C. R.; Fittinghoff, D.; Geppert-Kleinrath, V.; Grim, G.; Merrill, F. E.; Wilde, C. H.
2017-11-01
Neutron, gamma-ray, and x-ray imaging are important diagnostic tools at the National Ignition Facility (NIF) for measuring the two-dimensional (2D) size and shape of the neutron producing region, for probing the remaining ablator and measuring the extent of the DT plasmas during the stagnation phase of Inertial Confinement Fusion implosions. Due to the difficulty and expense of building these imagers, at most only a few two-dimensional projections images will be available to reconstruct the three-dimensional (3D) sources. In this paper, we present a technique that has been developed for the 3D reconstruction of neutron, gamma-ray, and x-ray sources from a minimal number of 2D projections using spherical harmonics decomposition. We present the detailed algorithms used for this characterization and the results of reconstructed sources from experimental neutron and x-ray data collected at OMEGA and NIF.
Upper limits on the total cosmic-ray luminosity of individual sources
Energy Technology Data Exchange (ETDEWEB)
Anjos, R.C.; De Souza, V. [Instituto de Física de São Carlos, Universidade de São Paulo, São Paulo (Brazil); Supanitsky, A.D., E-mail: rita@ifsc.usp.br, E-mail: vitor@ifsc.usp.br, E-mail: supanitsky@iafe.uba.ar [Instituto de Astronomía y Física del Espacio (IAFE), CONICET-UBA, Buenos Aires (Argentina)
2014-07-01
In this paper, upper limits on the total luminosity of ultra-high-energy cosmic-rays (UHECR) E > 10{sup 18} eV) are determined for five individual sources. The upper limit on the integral flux of GeV--TeV gamma-rays is used to extract the upper limit on the total UHECR luminosity of individual sources. The correlation between upper limit on the integral GeV--TeV gamma-ray flux and upper limit on the UHECR luminosity is established through the cascading process that takes place during propagation of the cosmic rays in the background radiation fields, as explained in reference [1]. Twenty-eight sources measured by FERMI-LAT, VERITAS and MAGIC observatories have been studied. The measured upper limit on the GeV--TeV gamma-ray flux is restrictive enough to allow the calculation of an upper limit on the total UHECR cosmic-ray luminosity of five sources. The upper limit on the UHECR cosmic-ray luminosity of these sources is shown for several assumptions on the emission mechanism. For all studied sources an upper limit on the ultra-high-energy proton luminosity is also set.
Upper limits on the total cosmic-ray luminosity of individual sources
International Nuclear Information System (INIS)
Anjos, R.C.; De Souza, V.; Supanitsky, A.D.
2014-01-01
In this paper, upper limits on the total luminosity of ultra-high-energy cosmic-rays (UHECR) E > 10 18 eV) are determined for five individual sources. The upper limit on the integral flux of GeV--TeV gamma-rays is used to extract the upper limit on the total UHECR luminosity of individual sources. The correlation between upper limit on the integral GeV--TeV gamma-ray flux and upper limit on the UHECR luminosity is established through the cascading process that takes place during propagation of the cosmic rays in the background radiation fields, as explained in reference [1]. Twenty-eight sources measured by FERMI-LAT, VERITAS and MAGIC observatories have been studied. The measured upper limit on the GeV--TeV gamma-ray flux is restrictive enough to allow the calculation of an upper limit on the total UHECR cosmic-ray luminosity of five sources. The upper limit on the UHECR cosmic-ray luminosity of these sources is shown for several assumptions on the emission mechanism. For all studied sources an upper limit on the ultra-high-energy proton luminosity is also set
Very Luminous X-ray Point Sources in Starburst Galaxies
Colbert, E.; Heckman, T.; Ptak, A.; Weaver, K. A.; Strickland, D.
Extranuclear X-ray point sources in external galaxies with luminosities above 1039.0 erg/s are quite common in elliptical, disk and dwarf galaxies, with an average of ~ 0.5 and dwarf galaxies, with an average of ~0.5 sources per galaxy. These objects may be a new class of object, perhaps accreting intermediate-mass black holes, or beamed stellar mass black hole binaries. Starburst galaxies tend to have a larger number of these intermediate-luminosity X-ray objects (IXOs), as well as a large number of lower-luminosity (1037 - 1039 erg/s) point sources. These point sources dominate the total hard X-ray emission in starburst galaxies. We present a review of both types of objects and discuss possible schemes for their formation.
Energy Technology Data Exchange (ETDEWEB)
Schinzel, Frank K. [National Radio Astronomy Observatory, P.O. Box O, Socorro, NM 87801 (United States); Petrov, Leonid [Astrogeo Center, Falls Church, VA 22043 (United States); Taylor, Gregory B. [Department of Physics and Astronomy, University of New Mexico, Albuquerque, NM 87131 (United States); Edwards, Philip G., E-mail: fschinze@nrao.edu [CSIRO Astronomy and Space Science, P.O. Box 76, Epping, 1710 NSW (Australia)
2017-04-01
The third Fermi Large Area Telescope γ -ray source catalog (3FGL) contains over 1000 objects for which there is no known counterpart at other wavelengths. The physical origin of the γ -ray emission from those objects is unknown. Such objects are commonly referred to as unassociated and mostly do not exhibit significant γ -ray flux variability. We performed a survey of all unassociated γ -ray sources found in 3FGL using the Australia Telescope Compact Array and Very Large Array in the range 4.0–10.0 GHz. We found 2097 radio candidates for association with γ -ray sources. The follow-up with very long baseline interferometry for a subset of those candidates yielded 142 new associations with active galactic nuclei that are γ -ray sources, provided alternative associations for seven objects, and improved positions for another 144 known associations to the milliarcsecond level of accuracy. In addition, for 245 unassociated γ -ray sources we did not find a single compact radio source above 2 mJy within 3 σ of their γ -ray localization. A significant fraction of these empty fields, 39%, are located away from the Galactic plane. We also found 36 extended radio sources that are candidates for association with a corresponding γ -ray object, 19 of which are most likely supernova remnants or H ii regions, whereas 17 could be radio galaxies.
Flash X-Ray (FXR) Accelerator Optimization Electronic Time-Resolved Measurement of X-Ray Source Size
International Nuclear Information System (INIS)
Jacob, J; Ong, M; Wargo, P
2005-01-01
Lawrence Livermore National Laboratory (LLNL) is currently investigating various approaches to minimize the x-ray source size on the Flash X-Ray (FXR) linear induction accelerator in order to improve x-ray flux and increase resolution for hydrodynamic radiography experiments. In order to effectively gauge improvements to final x-ray source size, a fast, robust, and accurate system for measuring the spot size is required. Timely feedback on x-ray source size allows new and improved accelerator tunes to be deployed and optimized within the limited run-time constraints of a production facility with a busy experimental schedule; in addition, time-resolved measurement capability allows the investigation of not only the time-averaged source size, but also the evolution of the source size, centroid position, and x-ray dose throughout the 70 ns beam pulse. Combined with time-resolved measurements of electron beam parameters such as emittance, energy, and current, key limiting factors can be identified, modeled, and optimized for the best possible spot size. Roll-bar techniques are a widely used method for x-ray source size measurement, and have been the method of choice at FXR for many years. A thick bar of tungsten or other dense metal with a sharp edge is inserted into the path of the x-ray beam so as to heavily attenuate the lower half of the beam, resulting in a half-light, half-dark image as seen downstream of the roll-bar; by measuring the width of the transition from light to dark across the edge of the roll-bar, the source size can be deduced. For many years, film has been the imaging medium of choice for roll-bar measurements thanks to its high resolution, linear response, and excellent contrast ratio. Film measurements, however, are fairly cumbersome and require considerable setup and analysis time; moreover, with the continuing trend towards all-electronic measurement systems, film is becoming increasingly difficult and expensive to procure. Here, we shall
International Nuclear Information System (INIS)
Hudson, L.T.; Seely, J.F.
2010-01-01
A formidable array of advanced laser systems are emerging that produce extreme states of light and matter. By irradiating solid and gaseous targets with lasers of increasing energy densities, new physical regimes of radiation effects are being explored for the first time in controlled laboratory settings. One result that is being accomplished or pursued using a variety of techniques, is the realization of novel sources of X-rays with unprecedented characteristics and light-matter interactions, the mechanisms of which are in many cases still being elucidated. Examples include the megajoule class of laser-produced plasmas designed in pursuit of alternative-energy and security applications and the petawatt class of lasers used for fast ignition and X-ray radiographic applications such as medical imaging and real-time imaging of plasma hydrodynamics. As these technologies mature, increased emphasis will need to be placed on advanced instrumentation and diagnostic metrology to characterize the spectra, time structure, and absolute brightness of X-rays emitted by these unconventional sources. Such customized and absolutely calibrated measurement tools will serve as an enabling technology that can help in assessing the overall system performance and progress, as well as identification of the underlying interaction mechanisms of interest to basic and applied strong-field and high-energy-density science.
Automatic classification of time-variable X-ray sources
Energy Technology Data Exchange (ETDEWEB)
Lo, Kitty K.; Farrell, Sean; Murphy, Tara; Gaensler, B. M. [Sydney Institute for Astronomy, School of Physics, The University of Sydney, Sydney, NSW 2006 (Australia)
2014-05-01
To maximize the discovery potential of future synoptic surveys, especially in the field of transient science, it will be necessary to use automatic classification to identify some of the astronomical sources. The data mining technique of supervised classification is suitable for this problem. Here, we present a supervised learning method to automatically classify variable X-ray sources in the Second XMM-Newton Serendipitous Source Catalog (2XMMi-DR2). Random Forest is our classifier of choice since it is one of the most accurate learning algorithms available. Our training set consists of 873 variable sources and their features are derived from time series, spectra, and other multi-wavelength contextual information. The 10 fold cross validation accuracy of the training data is ∼97% on a 7 class data set. We applied the trained classification model to 411 unknown variable 2XMM sources to produce a probabilistically classified catalog. Using the classification margin and the Random Forest derived outlier measure, we identified 12 anomalous sources, of which 2XMM J180658.7–500250 appears to be the most unusual source in the sample. Its X-ray spectra is suggestive of a ultraluminous X-ray source but its variability makes it highly unusual. Machine-learned classification and anomaly detection will facilitate scientific discoveries in the era of all-sky surveys.
Automatic classification of time-variable X-ray sources
International Nuclear Information System (INIS)
Lo, Kitty K.; Farrell, Sean; Murphy, Tara; Gaensler, B. M.
2014-01-01
To maximize the discovery potential of future synoptic surveys, especially in the field of transient science, it will be necessary to use automatic classification to identify some of the astronomical sources. The data mining technique of supervised classification is suitable for this problem. Here, we present a supervised learning method to automatically classify variable X-ray sources in the Second XMM-Newton Serendipitous Source Catalog (2XMMi-DR2). Random Forest is our classifier of choice since it is one of the most accurate learning algorithms available. Our training set consists of 873 variable sources and their features are derived from time series, spectra, and other multi-wavelength contextual information. The 10 fold cross validation accuracy of the training data is ∼97% on a 7 class data set. We applied the trained classification model to 411 unknown variable 2XMM sources to produce a probabilistically classified catalog. Using the classification margin and the Random Forest derived outlier measure, we identified 12 anomalous sources, of which 2XMM J180658.7–500250 appears to be the most unusual source in the sample. Its X-ray spectra is suggestive of a ultraluminous X-ray source but its variability makes it highly unusual. Machine-learned classification and anomaly detection will facilitate scientific discoveries in the era of all-sky surveys.
Deep H.E.S.S. observations of the supernova remnant RX J0852.0-4622
Sushch, Iurii; Paz Arribas, Manuel; Komin, Nukri; Schwanke, Ullrich
2016-06-01
The largest TeV source, RX J0852.0-4622 (Vela Jr.), is one of the few supernova remnants (SNRs) with well resolved shell-like morphology at very-high-energy (VHE; E>100 GeV) gamma-rays. Strong non-thermal emission across the electromagnetic spectrum from radio to VHE gamma-rays, young age and proximity of the remnant makes it one of the prime objects for the study of particle acceleration aiming to test the paradigm of SNRs being sources of Galactic cosmic rays. Here we present deep H.E.S.S. observations of RX J0852.0-4622 with roughly doubled exposure comparing to previously published results. Improved statistics together with new analysis techniques result in a firm determination of the cut-off in the gamma-ray spectrum and allow the spatially resolved spectroscopy studies. A smooth connection of the H.E.S.S. spectrum to the spectrum at GeV energies as reported by Fermi/LAT provides an exciting opportunity to recover the present-time parent particle population in both leptonic and hadronic scenarios directly from the gamma-ray data alone. These new observations provide us a deeper insight and better understanding of the physical processes in SNRs.
FERMI/LARGE AREA TELESCOPE BRIGHT GAMMA-RAY SOURCE LIST
International Nuclear Information System (INIS)
Abdo, A. A.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Blandford, R. D.; Bloom, E. D.; Borgland, A. W.; Atwood, W. B.; Axelsson, M.; Battelino, M.; Baldini, L.; Bellazzini, R.; Ballet, J.; Band, D. L.; Barbiellini, G.; Bastieri, D.; Baughman, B. M.; Bignami, G. F.; Bonamente, E.
2009-01-01
Following its launch in 2008 June, the Fermi Gamma-ray Space Telescope (Fermi) began a sky survey in August. The Large Area Telescope (LAT) on Fermi in three months produced a deeper and better resolved map of the γ-ray sky than any previous space mission. We present here initial results for energies above 100 MeV for the 205 most significant (statistical significance greater than ∼10σ) γ-ray sources in these data. These are the best characterized and best localized point-like (i.e., spatially unresolved) γ-ray sources in the early mission data.
Fermi Large Area Telescope Bright Gamma-ray Source List
Energy Technology Data Exchange (ETDEWEB)
Abdo, Aous A.; /Naval Research Lab, Wash., D.C.; Ackermann, M.; /KIPAC, Menlo Park /SLAC; Ajello, M.; /KIPAC, Menlo Park /SLAC; Atwood, W.B.; /UC, Santa Cruz; Axelsson, M.; /Stockholm U., OKC /Stockholm U.; Baldini, L.; /INFN, Pisa; Ballet, J.; /DAPNIA, Saclay; Band, D.L.; /NASA, Goddard /NASA, Goddard; Barbiellini, Guido; /INFN, Trieste /Trieste U.; Bastieri, Denis; /INFN, Padua /Padua U.; Bechtol, K.; /KIPAC, Menlo Park /SLAC; Bellazzini, R.; /INFN, Pisa; Berenji, B.; /KIPAC, Menlo Park /SLAC; Bignami, G.F.; /Pavia U.; Bloom, Elliott D.; /KIPAC, Menlo Park /SLAC; Bonamente, E.; /INFN, Perugia /Perugia U.; Borgland, A.W.; /KIPAC, Menlo Park /SLAC; Bregeon, J.; /INFN, Pisa; Brigida, M.; /Bari U. /INFN, Bari; Bruel, P.; /Ecole Polytechnique; Burnett, Thompson H.; /Washington U., Seattle /Bari U. /INFN, Bari /KIPAC, Menlo Park /SLAC /IASF, Milan /IASF, Milan /DAPNIA, Saclay /ASDC, Frascati /INFN, Perugia /Perugia U. /KIPAC, Menlo Park /SLAC /George Mason U. /Naval Research Lab, Wash., D.C. /NASA, Goddard /KIPAC, Menlo Park /SLAC /INFN, Perugia /Perugia U. /KIPAC, Menlo Park /SLAC /Montpellier U. /Sonoma State U. /Stockholm U., OKC /Royal Inst. Tech., Stockholm /Stockholm U. /KIPAC, Menlo Park /SLAC /ASDC, Frascati /NASA, Goddard /Maryland U. /Naval Research Lab, Wash., D.C. /INFN, Trieste /Pavia U. /Bari U. /INFN, Bari /KIPAC, Menlo Park /SLAC /UC, Santa Cruz /KIPAC, Menlo Park /SLAC /KIPAC, Menlo Park /SLAC /KIPAC, Menlo Park /SLAC /Montpellier U. /Bari U. /INFN, Bari /Ecole Polytechnique /NASA, Goddard; /more authors..
2009-05-15
Following its launch in 2008 June, the Fermi Gamma-ray Space Telescope (Fermi) began a sky survey in August. The Large Area Telescope (LAT) on Fermi in three months produced a deeper and better resolved map of the {gamma}-ray sky than any previous space mission. We present here initial results for energies above 100 MeV for the 205 most significant (statistical significance greater than {approx}10{sigma}) {gamma}-ray sources in these data. These are the best characterized and best localized point-like (i.e., spatially unresolved) {gamma}-ray sources in the early mission data.
Laser plasmas as x-ray sources for lithographic imaging of submicron structures
International Nuclear Information System (INIS)
Bijkerk, F.; van Dorssen, G.E.; van der Wiel, M.J.
1988-01-01
Laser radiation can be used efficiently to generate x-rays for lithographic imaging of submicron patterns, e.g., for VLSI device fabrication. Due to their short wavelength and high average power, excimer lasers show much potential for this application. Results are presented of scaling studies for high repetition rate excimer laser application, using the frequency doubled output of a low repetition rate Nd:YAG/Glass laser. Spectral and spatial characteristics of x-ray emission of the laser plasma are shown. The power density in the laser focus was 3 x 10 12 W/cm 2 . With this source Si x-ray masks with submicron Au absorber profiles are imaged into high sensitivity x-ray photoresist. For the exposures 80 laser shots sufficed to yield high quality submicron structures. Extrapolation of the results to a high power excimer laser reduces the exposure time of the photoresists to several seconds, enabling a wafer throughput at an industrial level
Observation of extragalactic X-ray sources
International Nuclear Information System (INIS)
Bui-Van, Andre.
1973-01-01
A narrow angular resolution detection apparatus using a high performance collimator has proved particularly well suited for the programs of observation of X ray sources. The experimental set-up and its performance are described. One chapter deals with the particular problems involved in the observation of X ray sources with the aid of sounding balloons. The absorption of extraterrestrial photons by the earth atmosphere is taken into account in the procesing of the observation data using two methods of calculation: digital and with simulation techniques. The results of three balloon flights are then presented with the interpretation of the observations carried out using both thermal and non thermal emission models. This analysis leads to some possible characteristics of structure of the Perseus galaxy cluster [fr
Relevance of axionlike particles for very-high-energy astrophysics
International Nuclear Information System (INIS)
De Angelis, Alessandro; Galanti, Giorgio; Roncadelli, Marco
2011-01-01
Several extensions of the standard model and, in particular, superstring theories suggest the existence of axionlike particles (ALPs), which are very light spin-zero bosons with a two-photon coupling. As a consequence, photon-ALP oscillations occur in the presence of an external magnetic field, and ALPs can lead to observable effects on the measured photon spectrum of astrophysical sources. An intriguing situation arises when blazars are observed in the very-high-energy (VHE) band--namely, above 100 GeV--as it is the case with the presently operating Imaging Atmospheric Cherenkov Telescopes H.E.S.S, Major Atmospheric Gamma Imaging Cherenkov telescope, Collaboration of Australia and Nippon for a Gamma Ray Observatory in the Outback III, and VERITAS. The extragalactic background light produced by galaxies during cosmic evolution gives rise to a source dimming which becomes important in the VHE band and increases with energy, since hard photons from a blazar scatter off soft extragalactic background light photons thereby disappearing into e + e - pairs. This dimming can be considerably reduced by photon-ALP oscillations, and since they are energy independent the resulting blazar spectra become harder than expected. We consider throughout a scenario first proposed by De Angelis, Roncadelli, and Mansutti in which the above strategy is implemented with photon-ALP oscillations triggered by large-scale magnetic fields, and we systematically investigate its implications for VHE blazars. We find that for ALPs lighter than 5·10 -10 eV the photon survival probability is larger than predicted by conventional physics above a few hundred GeV. Specifically, a boost factor of 10 can easily occur for sources at large distance and large energy, e.g. at 8 TeV for the blazar 1ES 0347-121 at redshift z=0.188. This is a clear-cut prediction which can be tested with the planned Cherenkov Telescope Array and the High Altitude Water Cherenkov Experiment (HAWC) water Cherenkov γ-ray
Hang, Shuang; Liu, Yunpeng; Li, Huan; Tang, Xiaobin; Chen, Da
2018-04-01
X-ray communication (XCOM) is a new communication type and is expected to realize high-speed data transmission in some special communication scenarios, such as deep space communication and blackout communication. This study proposes a high-speed modulated X-ray source scheme based on the laser-to-X-ray conversion. The temporal characteristics of the essential components of the proposed laser-modulated pulsed X-ray source (LMPXS) were analyzed to evaluate its pulse emission performance. Results show that the LMPXS can provide a maximum modulation rate up to 100 Mbps which is expected to significantly improve the data rate of XCOM.
21 CFR 872.1800 - Extraoral source x-ray system.
2010-04-01
... (CONTINUED) MEDICAL DEVICES DENTAL DEVICES Diagnostic Devices § 872.1800 Extraoral source x-ray system. (a... dental radiographic examination and diagnosis of diseases of the teeth, jaw, and oral structures. The x... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Extraoral source x-ray system. 872.1800 Section...
Ofek, Eran O.; Zackay, Barak
2018-04-01
Detection of templates (e.g., sources) embedded in low-number count Poisson noise is a common problem in astrophysics. Examples include source detection in X-ray images, γ-rays, UV, neutrinos, and search for clusters of galaxies and stellar streams. However, the solutions in the X-ray-related literature are sub-optimal in some cases by considerable factors. Using the lemma of Neyman–Pearson, we derive the optimal statistics for template detection in the presence of Poisson noise. We demonstrate that, for known template shape (e.g., point sources), this method provides higher completeness, for a fixed false-alarm probability value, compared with filtering the image with the point-spread function (PSF). In turn, we find that filtering by the PSF is better than filtering the image using the Mexican-hat wavelet (used by wavdetect). For some background levels, our method improves the sensitivity of source detection by more than a factor of two over the popular Mexican-hat wavelet filtering. This filtering technique can also be used for fast PSF photometry and flare detection; it is efficient and straightforward to implement. We provide an implementation in MATLAB. The development of a complete code that works on real data, including the complexities of background subtraction and PSF variations, is deferred for future publication.
Laser-driven soft-X-ray undulator source
International Nuclear Information System (INIS)
Fuchs, Matthias
2010-01-01
The experimental results described in this thesis demonstrate the successful synergy between the research fields described above: the development of an undulator source driven by laser-plasma accelerated electron beams. First efforts in this new field have led to the production of radiation in the visible to infrared part of the electromagnetic spectrum [Schlenvoigt et al., 2008]. In contrast to these early achievements, the experiment described here shows the successful production of laser-driven undulator radiation in the soft-X-ray range with a remarkable reproducibility. The source produced tunable, collimated beams with a wavelength of ∝17 nm from a compact setup. Undulator spectra were detected in ∝70% of consecutive driver-laser shots, which is a remarkable reproducibility for a first proof-of-concept demonstration using ultra-high intensity laser systems. This can be attributed to a stable electron acceleration scheme as well as to the first application of miniature magnetic quadrupole lenses with laseraccelerated beams. The lenses significantly reduce the electron beam divergence and its angular shot-to-shot fluctuations The setup of this experiment is the foundation of potential university-laboratory-sized, highly-brilliant hard X-ray sources. By increasing the electron energy to about 1 GeV, X-ray pulses with an expected duration of ∝10 fs and a photon energy of 1 keV could be produced in an almost identical arrangement. It can also be used as a testbed for the development of a free-electron laser of significantly smaller dimension than facilities based on conventional accelerators [Gruener et al., 2007]. Such compact sources have the potential for application in many fields of science. In addition, these developments could lead to ideal sources for ultrafast pump-probe experiments due to the perfect synchronization of the X-ray beam to the driver laser. (orig.)
Laser-driven soft-X-ray undulator source
Energy Technology Data Exchange (ETDEWEB)
Fuchs, Matthias
2010-08-04
The experimental results described in this thesis demonstrate the successful synergy between the research fields described above: the development of an undulator source driven by laser-plasma accelerated electron beams. First efforts in this new field have led to the production of radiation in the visible to infrared part of the electromagnetic spectrum [Schlenvoigt et al., 2008]. In contrast to these early achievements, the experiment described here shows the successful production of laser-driven undulator radiation in the soft-X-ray range with a remarkable reproducibility. The source produced tunable, collimated beams with a wavelength of {proportional_to}17 nm from a compact setup. Undulator spectra were detected in {proportional_to}70% of consecutive driver-laser shots, which is a remarkable reproducibility for a first proof-of-concept demonstration using ultra-high intensity laser systems. This can be attributed to a stable electron acceleration scheme as well as to the first application of miniature magnetic quadrupole lenses with laseraccelerated beams. The lenses significantly reduce the electron beam divergence and its angular shot-to-shot fluctuations The setup of this experiment is the foundation of potential university-laboratory-sized, highly-brilliant hard X-ray sources. By increasing the electron energy to about 1 GeV, X-ray pulses with an expected duration of {proportional_to}10 fs and a photon energy of 1 keV could be produced in an almost identical arrangement. It can also be used as a testbed for the development of a free-electron laser of significantly smaller dimension than facilities based on conventional accelerators [Gruener et al., 2007]. Such compact sources have the potential for application in many fields of science. In addition, these developments could lead to ideal sources for ultrafast pump-probe experiments due to the perfect synchronization of the X-ray beam to the driver laser. (orig.)
Monitoring variable X-ray sources in nearby galaxies
Kong, A. K. H.
2010-12-01
In the last decade, it has been possible to monitor variable X-ray sources in nearby galaxies. In particular, since the launch of Chandra, M31 has been regularly observed. It is perhaps the only nearby galaxy which is observed by an X-ray telescope regularly throughout operation. With 10 years of observations, the center of M31 has been observed with Chandra for nearly 1 Msec and the X-ray skies of M31 consist of many transients and variables. Furthermore, the X-ray Telescope of Swift has been monitoring several ultraluminous X-ray sources in nearby galaxies regularly. Not only can we detect long-term X-ray variability, we can also find spectral variation as well as possible orbital period. In this talk, I will review some of the important Chandra and Swift monitoring observations of nearby galaxies in the past 10 years. I will also present a "high-definition" movie of M31 and discuss the possibility of detecting luminous transients in M31 with MAXI.
PULSED VERY HIGH ENERGY γ-RAY EMISSION CONSTRAINTS FOR PSR B1951+32 FROM STACEE OBSERVATIONS
International Nuclear Information System (INIS)
Zweerink, J.; Ball, J.; Carson, J. E.; Jarvis, A.; Ong, R. A.; Kildea, J.; Hanna, D. S.; Lindner, T.; Mueller, C.; Ragan, K.; Covault, C. E.; Driscoll, D. D.; Fortin, P.; Mukherjee, R.; Gingrich, D. M.; Williams, D. A.
2009-01-01
The Solar Tower Atmospheric Cherenkov Effect Experiment (STACEE) is a ground-based telescope that uses the wave-front-sampling technique to detect very high energy (VHE) gamma rays. STACEE's sensitivity in the energy range near 100 GeV permits useful observations of pulsars with the potential to discriminate between various proposed mechanisms for pulsed gamma-ray emission. Based on the 11.3 hr of data taken during the 2005 and 2006 observing seasons, we derive an upper limit on the pulsed gamma-ray emission from PSR B1951+32 of -11 photons cm -2 s -1 above an energy threshold of 117 GeV.
Development of a compact laser-produced plasma soft X-ray source for radiobiology experiments
Energy Technology Data Exchange (ETDEWEB)
Adjei, Daniel, E-mail: nana.adjeidan@gmail.com [Institute of Optoelectronics, Military University of Technology, 2, Kaliskiego Str., 00-908 Warsaw (Poland); Radiation Protection Institute, Ghana Atomic Energy Commission, P.O. Box LG 80, Legon, Accra (Ghana); Ayele, Mesfin Getachew; Wachulak, Przemyslaw; Bartnik, Andrzej; Wegrzynski, Łukasz; Fiedorowicz, Henryk [Institute of Optoelectronics, Military University of Technology, 2, Kaliskiego Str., 00-908 Warsaw (Poland); Vyšín, Luděk [Institute of Physics, Czech Academy of Sciences, Na Slovance 2, 182 21 Prague 8 (Czech Republic); Faculty of Nuclear Sciences and Engineering Physics, Czech Technical University in Prague, Břehová 7, 115 19 Prague 1 (Czech Republic); Wiechec, Anna; Lekki, Janusz; Kwiatek, Wojciech M. [Institute of Nuclear Physics, Polish Academy of Sciences, 152, Radzikowskiego Str., 31-342 Cracow (Poland); Pina, Ladislav [Faculty of Nuclear Sciences and Engineering Physics, Czech Technical University in Prague, Břehová 7, 115 19 Prague 1 (Czech Republic); Davídková, Marie [Institute of Nuclear Physics, Czech Academy of Sciences, Řež (Czech Republic); Juha, Libor [Institute of Physics, Czech Academy of Sciences, Na Slovance 2, 182 21 Prague 8 (Czech Republic)
2015-12-01
A desk-top laser-produced plasma (LPP) source of soft X-rays (SXR) has been developed for radiobiology research. The source is based on a double-stream gas puff target, irradiated with the focused beam of a commercial Nd:YAG laser. The source has been optimized to get a maximum photon emission from LPP in the X-ray “water window” spectral wavelength range from 2.3 nm (i.e., an absorption edge of oxygen) to 4.4 nm (i.e., an absorption edge of carbon) (280–540 eV in photon energy units) by using argon gas-puff target and spectral filtering by free-standing thin foils. The present source delivers nanosecond pulses of soft X-rays at a fluence of about 4.2 × 10{sup 3} photons/μm{sup 2}/pulse on a sample placed inside the vacuum chamber. In this paper, the source design, radiation output characterization measurements and initial irradiation experiments are described. The source can be useful in addressing observations related to biomolecular, cellular and organisms’ sensitivity to pulsed radiation in the “water window”, where carbon atoms absorb X-rays more strongly than the oxygen, mostly present in water. The combination of the SXR source and the radiobiology irradiation layout, reported in this article, make possible a systematic investigation of relationships between direct and indirect action of ionizing radiation, an increase of a local dose in carbon-rich compartments of the cell (e.g., lipid membranes), an experimental estimation of a particular role of the Auger effect (in particular in carbon atoms) in the damage to biological systems, and the study of ionization/excitation-density (LET – Linear Energy Transfer) and dose-rate effects in radiobiology.
X-ray bursters and the X-ray sources of the galactic bulge
Lewin, W. H. G.; Joss, P. C.
An attempt is made to distill from observational and theoretical information on the galactic bulge X-ray sources in general, and on the X-ray burst sources in particular, those aspects which seem to have the greatest relevance to the understanding of these sources. Galactic bulge sources appear to be collapsed objects of roughly solar mass, in most cases neutron stars, which are accreting matter from low-mass stellar companions. Type I bursts seem to result from thermonuclear flashes in the surface layers of some of these neutron stars, while the type II bursts from the Rapid Burster are almost certainly due to an instability in the accretion flow onto a neutron star. It is concluded that the studies cited offer a new and powerful observational handle on the fundamental properties of neutron stars and of the interacting binary systems in which they are often contained.
CORRELATION OF SUPERNOVA REMNANT MASERS AND GAMMA-RAY SOURCES
International Nuclear Information System (INIS)
Hewitt, John W.; Yusef-Zadeh, Farhad; Wardle, Mark
2009-01-01
Supernova remnants (SNRs) interacting with molecular clouds are potentially exciting systems in which to detect evidence of cosmic ray acceleration. Prominent γ-ray emission is produced via the decay of neutral pions when cosmic rays encounter nearby dense clouds. In many of the SNRs coincident with γ-ray sources, the presence of OH (1720 MHz) masers is used to identify interaction with dense gas and to provide a kinematic distance to the system. In this Letter we use statistical tests to demonstrate that there is a correlation between these masers and a class of GeV- to TeV-energy γ-ray sources coincident with interacting remnants. For pion decay the γ-ray luminosity provides a direct estimate of the local cosmic ray density. We find the cosmic ray density is enhanced by one to two orders of magnitude over the local solar value, comparable to X-ray-induced ionization in these remnants. The inferred ionization rates are sufficient to explain non-equilibrium chemistry in the post-shock gas, where high columns of hydroxyl are observed.
Gotthelf, E. V.; Tomsick, J. A.; Halpern, J. P.; Gelfand, J. D.; Harrison, F. A.; Boggs, S. E.; Christensen, F. E.; Craig, W. W.; Hailey, J. C.; Kaspi, V. M.;
2014-01-01
We report the discovery of a 206 ms pulsar associated with the TeV gamme-ray source HESS J1640-465 using the Nuclear Spectroscopic Telescope Array (NuSTAR) X-ray observatory. PSR J1640-4631 lies within the shelltype supernova remnant (SNR) G338.3-0.0, and coincides with an X-ray point source and putative pulsar wind nebula (PWN) previously identified in XMM-Newton and Chandra images. It is spinning down rapidly with period derivative P = 9.758(44) × 10(exp -13), yielding a spin-down luminosity E = 4.4 × 10(exp 36) erg s(exp -1), characteristic age tau(sub c) if and only if P/2 P = 3350 yr, and surface dipole magnetic field strength B(sub s) = 1.4×10(exp 13) G. For the measured distance of 12 kpc to G338.3-0.0, the 0.2-10 TeV luminosity of HESS J1640-465 is 6% of the pulsar's present E. The Fermi source 1FHL J1640.5-4634 is marginally coincident with PSR J1640-4631, but we find no gamma-ray pulsations in a search using five years of Fermi Large Area Telescope (LAT) data. The pulsar energetics support an evolutionary PWN model for the broadband spectrum of HESS J1640-465, provided that the pulsar's braking index is n approximately equal to 2, and that its initial spin period was P(sub 0) approximately 15 ms.
Cosmic ray injection spectrum at the galactic sources
Lagutin, Anatoly; Tyumentsev, Alexander; Volkov, Nikolay
The spectra of cosmic rays measured at Earth are different from their source spectra. A key to understanding this difference, being crucial for solving the problem of cosmic-ray origin, is the determination of how cosmic-ray (CR) particles propagate through the turbulent interstellar medium (ISM). If the medium is a quasi-homogeneous the propagation process can be described by a normal diffusion model. However, during a last few decades many evidences, both from theory and observations, of the existence of multiscale structures in the Galaxy have been found. Filaments, shells, clouds are entities widely spread in the ISM. In such a highly non-homogeneous (fractal-like) ISM the normal diffusion model certainly is not kept valid. Generalization of this model leads to what is known as "anomalous diffusion". The main goal of the report is to retrieve the cosmic ray injection spectrum at the galactic sources in the framework of the anomalous diffusion (AD) model. The anomaly in this model results from large free paths ("Levy flights") of particles between galactic inhomogeneities. In order to evaluate the CR spectrum at the sources, we carried out new calculation of the CR spectra at Earth. AD equation in terms of fractional derivatives have been used to describe CR propagation from the nearby (r≤1 kpc) young (t≤ 1 Myr) and multiple old distant (r > 1 kpc) sources. The assessment of the key model parameters have been based on the results of the particles diffusion in the cosmic and laboratory plasma. We show that in the framework of the anomalous diffusion model the locally observed basic features of the cosmic rays (difference between spectral exponents of proton, He and other nuclei, "knee" problem, positron to electron ratio) can be explained if the injection spectrum at the main galactic sources of cosmic rays has spectral exponent p˜ 2.85. The authors acknowledge support from The Russian Foundation for Basic Research grant No. 14-02-31524.
International Nuclear Information System (INIS)
Acciari, V. A.; Benbow, W.; Aliu, E.; Boltuch, D.; Arlen, T.; Chow, Y. C.; Aune, T.; Bautista, M.; Cogan, P.; Beilicke, M.; Buckley, J. H.; Bugaev, V.; Boettcher, M.; Bradbury, S. M.; Byrum, K.; Cannon, A.; Cesarini, A.; Ciupik, L.; Cui, W.; Duke, C.
2010-01-01
We report the first detection of very high energy 83 Gamma-ray emission above 100 GeV. (VHE) gamma-ray emission above 140 GeV from PKS 1424+240, a BL Lac object with an unknown redshift. The photon spectrum above 140 GeV measured by VERITAS is well described by a power law with a photon index of 3.8 ± 0.5 stat ± 0.3 syst and a flux normalization at 200 GeV of (5.1 ± 0.9 stat ± 0.5 syst ) x 10 -11 TeV -1 cm -2 s -1 , where stat and syst denote the statistical and systematical uncertainties, respectively. The VHE flux is steady over the observation period between MJD 54881 and 55003 (from 2009 February 19 to June 21). Flux variability is also not observed in contemporaneous high-energy observations with the Fermi Large Area Telescope. Contemporaneous X-ray and optical data were also obtained from the Swift XRT and MDM observatory, respectively. The broadband spectral energy distribution is well described by a one-zone synchrotron self-Compton model favoring a redshift of less than 0.1. Using the photon index measured with Fermi in combination with recent extragalactic background light absorption models it can be concluded from the VERITAS data that the redshift of PKS 1424+240 is less than 0.66.
Development of Compton gamma-ray sources at LLNL
Energy Technology Data Exchange (ETDEWEB)
Albert, F.; Anderson, S. G.; Ebbers, C. A.; Gibson, D. J.; Hartemann, F. V.; Marsh, R. A.; Messerly, M. J.; Prantil, M. A.; Wu, S.; Barty, C. P. J. [Lawrence Livermore National Laboratory, NIF and Photon Science, 7000 East avenue, Livermore, CA 94550 (United States)
2012-12-21
Compact Compton scattering gamma-ray sources offer the potential of studying nuclear photonics with new tools. The optimization of such sources depends on the final application, but generally requires maximizing the spectral density (photons/eV) of the gamma-ray beam while simultaneously reducing the overall bandwidth on target to minimize noise. We have developed an advanced design for one such system, comprising the RF drive, photoinjector, accelerator, and electron-generating and electron-scattering laser systems. This system uses a 120 Hz, 250 pC, 2 ps, 0.35 mm mrad electron beam with 250 MeV maximum energy in an X-band accelerator scattering off a 150 mJ, 10 ps, 532 nm laser to generate 5 Multiplication-Sign 10{sup 10} photons/eV/s/Sr at 0.5 MeV with an overall bandwidth of less than 1%. The source will be able to produce photons up to energies of 2.5 MeV. We also discuss Compton scattering gamma-ray source predictions given by numerical codes.
Energy Technology Data Exchange (ETDEWEB)
Lin, Dacheng; Webb, Natalie A.; Barret, Didier, E-mail: dlin@ua.edu [CNRS, IRAP, 9 Avenue du Colonel Roche, BP 44346, F-31028 Toulouse Cedex 4 (France)
2014-01-01
We analyze 18 sources that showed interesting properties of periodicity, very soft spectra, and/or large long-term variability in X-rays in our project of classification of sources from the 2XMMi-DR3 catalog, but were poorly studied in the literature, in order to investigate their nature. Two hard sources show X-ray periodicities of ∼1.62 hr (2XMM J165334.4–414423) and ∼2.1 hr (2XMM J133135.2–315541) and are probably magnetic cataclysmic variables. One source, 2XMM J123103.2+110648, is an active galactic nucleus (AGN) candidate showing very soft X-ray spectra (kT ∼ 0.1 keV) and exhibiting an intermittent ∼3.8 hr quasi-periodic oscillation. There are six other very soft sources (with kT < 0.2 keV), which might be in other galaxies with luminosities between ∼10{sup 38}-10{sup 42} erg s{sup –1}. They probably represent a diverse group that might include objects such as ultrasoft AGNs and cool thermal disk emission from accreting intermediate-mass black holes. Six highly variable sources with harder spectra are probably in nearby galaxies with luminosities above 10{sup 37} erg s{sup –1} and thus are great candidates for extragalactic X-ray binaries. One of them (2XMMi J004211.2+410429, in M31) is probably a new-born persistent source, having been X-ray bright and hard in 0.3-10 keV for at least four years since it was discovered entering an outburst in 2007. Three highly variable hard sources appear at low galactic latitudes and have maximum luminosities below ∼10{sup 34} erg s{sup –1} if they are in our Galaxy. Thus, they are great candidates for cataclysmic variables or very faint X-ray transients harboring a black hole or neutron star. Our interpretations of these sources can be tested with future long-term X-ray monitoring and multi-wavelength observations.
Energy spectrum of extragalactic gamma-ray sources
Protheroe, R. J.
1985-01-01
The result of Monte Carlo electron photon cascade calculations for propagation of gamma rays through regions of extragalactic space containing no magnetic field are given. These calculations then provide upper limits to the expected flux from extragalactic sources. Since gamma rays in the 10 to the 14th power eV to 10 to the 17th power eV energy range are of interest, interactions of electrons and photons with the 3 K microwave background radiation are considered. To obtain an upper limit to the expected gamma ray flux from sources, the intergalactic field is assumed to be so low that it can be ignored. Interactions with photons of the near-infrared background radiation are not considered here although these will have important implications for gamma rays below 10 to the 14th power eV if the near infrared background radiation is universal. Interaction lengths of electrons and photons in the microwave background radiation at a temperature of 2.96 K were calculated and are given.
FERMI LAT OBSERVATIONS OF LS I +610303: FIRST DETECTION OF AN ORBITAL MODULATION IN GeV GAMMA RAYS
International Nuclear Information System (INIS)
Abdo, A. A.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Blandford, R.; Bloom, E. D.; Borgland, A. W.; Atwood, W. B.; Axelsson, M.; Baldini, L.; Bellazzini, R.; Bregeon, J.; Brez, A.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Baughman, B. M.; Bonamente, E.; Brigida, M.
2009-01-01
This Letter presents the first results from the observations of LS I +61 0 303 using Large Area Telescope data from the Fermi Gamma-Ray Space Telescope between 2008 August and 2009 March. Our results indicate variability that is consistent with the binary period, with the emission being modulated at 26.6 ± 0.5 days. This constitutes the first detection of orbital periodicity in high-energy gamma rays (20 MeV-100 GeV, HE). The light curve is characterized by a broad peak after periastron, as well as a smaller peak just before apastron. The spectrum is best represented by a power law with an exponential cutoff, yielding an overall flux above 100 MeV of 0.82 ± 0.03(stat) ± 0.07(syst) 10 -6 ph cm -2 s -1 , with a cutoff at 6.3 ± 1.1(stat) ± 0.4(syst) GeV and photon index Γ = 2.21 ± 0.04(stat) ± 0.06(syst). There is no significant spectral change with orbital phase. The phase of maximum emission, close to periastron, hints at inverse Compton scattering as the main radiation mechanism. However, previous very high-energy gamma ray (>100 GeV, VHE) observations by MAGIC and VERITAS show peak emission close to apastron. This and the energy cutoff seen with Fermi suggest that the link between HE and VHE gamma rays is nontrivial.
X-Ray Emission from Compact Sources
Energy Technology Data Exchange (ETDEWEB)
Cominsky, L
2004-03-23
This paper presents a review of the physical parameters of neutron stars and black holes that have been derived from X-ray observations. I then explain how these physical parameters can be used to learn about the extreme conditions occurring in regions of strong gravity, and present some recent evidence for relativistic effects seen in these systems. A glossary of commonly used terms and a short tutorial on the names of X-ray sources are also included.
Magic gamma rays, extra-atmospheric source
International Nuclear Information System (INIS)
Bolufer, P.
2010-01-01
Without the atmospheric layer, the cosmos radiation would kill every living, our planet would be like the moon. The cosmic gamma ray to collide with gases in land cover, as it is disintegrated. They are harmless, they form a cone of light that points to the cosmic source comes from. On April 25, 2009 was born on the island of Palma Magic II and Magic I the best observer of atmospheric gamma rays of low intensity. (Author)
Long-term studies of Markarian 421 from 2007 to 2009
Energy Technology Data Exchange (ETDEWEB)
Schroeder, Sonja; Overkemping, Ann-Kristin [TU Dortmund, Dortmund (Germany); Manganaro, Marina [IAC La Laguna, Teneriffa (Spain); Tescaro, Diego [INFN, Padova (Italy); Collaboration: MAGIC-Collaboration
2016-07-01
The MAGIC experiment consists of two Imaging Air shower Cherenkov Telescopes to detect and study gamma-rays from galactic and extragalactic sources. Blazars are a special type of extragalactic sources hosting an Active Galactic Nucleus (AGN) with a jet directed towards earth. The AGN Mrk 421 is one of the strongest and brightest known blazars suitable for very high-energy (VHE) observations. This talk gives an overview over long-term variability and correlation studies of the blazar Mrk 421. For this study a VHE dataset collected by MAGIC-I covering the extensive timespan from February 2007 to June 2009 was examined together with data of different wavelengths from other telescopes. These kind of studies could allow for an increase of knowledge about the possible emission processes inside Mrk 421.
Parameters estimation for X-ray sources: positions
International Nuclear Information System (INIS)
Avni, Y.
1977-01-01
It is shown that the sizes of the positional error boxes for x-ray sources can be determined by using an estimation method which we have previously formulated generally and applied in spectral analyses. It is explained how this method can be used by scanning x-ray telescopes, by rotating modulation collimators, and by HEAO-A (author)
Mirzoyan, Razmik
2018-04-01
The MAGIC collaboration reports the first detection of very-high-energy (VHE; E > 100 GeV) gamma-ray emission from PGC 2402248, also known as 2WHSP J073326.7+515354 (Chang et al. 2016, A & A, 598, A17) with coordinates R.A.: 07:33:26.7 h, Dec: +51:53:54.99 deg. The source is classified as an extreme high-energy peaked BL Lacertae object of unknown redshift, included in the 2WHSP catalog with a synchrotron peak located at 10^17.9 Hz. PGC 2402248 was observed with the MAGIC telescopes from 2018/01/23 to 2018/04/18 (MJD 58141-58226) for about 23 h. The preliminary analysis of these data resulted in the detection of PGC 2402248 with a statistical significance of more than 6 standard deviations.
Science with the Advanced Gamma Ray Imaging System (AGIS)
Coppi, Paolo
2009-05-01
We present the scientific drivers for the Advanced Gamma Ray Imaging System (AGIS), a concept for the next-generation ground- based gamma-ray experiment, comprised of an array of ˜100 imaging atmospheric Cherenkov telescopes. Design requirements for AGIS include achieving a sensitivity an order of magnitude better than the current generation of space or ground-based instruments in the energy range of 40 GeV to ˜100 TeV. We present here an overview of the scientific goals of AGIS, including the prospects for understanding VHE phenomena in the vicinity of accreting black holes, particle acceleration in a variety of astrophysical environments, indirect detection of dark matter, study of cosmological background radiation fields, and particle physics beyond the standard model.
International Nuclear Information System (INIS)
Yamaguchi, N.; Okamoto, Y.; Hara, T.; Takahashi, Z.; Nishimura, Y.; Sakata, A.; Watanabe, K.; Azuma, H.
2004-01-01
Full text: A laboratory-sized microscopic system of x-ray photoelectrons has been developing using a compact x-ray source produced by line-focused laser irradiation. The system is a scanning type photoelectron microscope where x-ray beam is micro-focused via a Schwartzschild optics. A compact laser-plasma x-ray source has been developed with a YAG laser system, a line-focus lens system, a tape-target driving system and a debris prevention system, that was operated at repetition rate of 10 Hz or 50 Hz. X-rays were delivered along line plasma whose length was 0.6 to 11 mm with higher intensity than that from a point-focused source. Because the transition line of Al V (13.1 nm) was prominent in the soft x-ray spectrum when the Al tape target irradiated at the lower power density of 10 11 W/cm 2 , the 13.1 nm x-ray was used as an excitation source. The Schwartzschild optics was set on the beamline at a distance about 1 m from the source, which was coated with Mo/Si multilayers for 13.1 nm x-ray. The designed demagnification is 224 that was confirmed in the previous experiment. Therefore, an x-ray micro spot of sub-micron size can be formed on a sample surface when the source size is less than about 0.2 mm. Samples were set on a two-axis high-precision piezo stage mounted to a four-axis manipulator. The electron energy analyzer was a spherical capacitor analyzer with mean diameter of 279.4 mm. The electron detector was a microchannel plate (MCP) with a phosphor screen and the optical image of electrons on the exit plane of the analyzer was taken and recorded by using an ultra low dark noise CCD camera, that was suited for detection of vast photoelectrons excited by x-ray pulse of ns-order duration. We performed spatial resolution test measurements by using a GaAs wafer coated with photo-resist that formed a stripe pattern. The spatial resolution less than 3 micron has been obtained from the variation of As 3d electron intensity along the position of the GaAs sample
X-ray Counterparts of Infrared Faint Radio Sources
Schartel, Norbert
2011-10-01
Infrared Faint Radio Sources (IFRS) are radio sources with extremely faint or even absent infrared emission in deep Spitzer Surveys. Models of their spectral energy distributions, the ratios of radio to infrared flux densities and their steep radio spectra strongly suggest that IFRS are AGN at high redshifts (2IFRS, but if confirmed, the increased AGN numbers at these redshifts will account for the unresolved part of the X-ray background. The identification of X-ray counterparts of IFRS is considered to be the smoking gun for this hypothesis. We propose to observe 8 IFRS using 30ks pointed observations. X-ray detections of IFRS with different ratios of radio-to-infrared fluxes, will constrain the class-specific SED.
Simulation of a dense plasma focus x-ray source
International Nuclear Information System (INIS)
Stark, R.A.
1994-01-01
The authors are performing simulations of the magnetohydrodynamics of a Dense Plasma Focus (DPF) x-ray source located at Science Research Laboratory (SRL), Alameda, CA, in order to optimize its performance. The SRL DPF, which was developed as a compact source for x-ray lithography, operates at 20 Hz, giving x-ray power (9--14 Angstroms) of 500 W using neon gas. The simulations are performed with the two dimensional MHD code MACH2, developed by Mission Research Corporation, with a steady state corona model as the equation of state. The results of studies of the sensitivity of x-ray output to charging voltage and current, and to initial gas density will be presented. These studies should indicate ways to optimize x-ray production efficiency. Simulations of various inner electrode configurations will also be presented
Debris-free soft x-ray source with gas-puff target
Ni, Qiliang; Chen, Bo; Gong, Yan; Cao, Jianlin; Lin, Jingquan; Lee, Hongyan
2001-12-01
We have been developing a debris-free laser plasma light source with a gas-puff target system whose nozzle is driven by a piezoelectric crystal membrane. The gas-puff target system can utilize gases such as CO2, O2 or some gas mixture according to different experiments. Therefore, in comparison with soft X-ray source using a metal target, after continuously several-hour laser interaction with gas from the gas-puff target system, no evidences show that the light source can produce debris. The debris-free soft X-ray source is prepared for soft X-ray projection lithography research at State Key Laboratory of Applied Optics. Strong emission from CO2, O2 and Kr plasma is observed.
Time-resolved X-ray studies using third generation synchrotron radiation sources
International Nuclear Information System (INIS)
Mills, D.M.
1991-10-01
The third generation, high-brilliance, hard x-ray, synchrotron radiation (SR) sources currently under construction (ESRF at Grenoble, France; APS at Argonne, Illinois; and SPring-8 at Harima, Japan) will usher in a new era of x-ray experimentation for both physical and biological sciences. One of the most exciting areas of experimentation will be the extension of x-ray scattering and diffraction techniques to the study of transient or time-evolving systems. The high repetition rate, short-pulse duration, high brilliance, and variable spectral bandwidth of these sources make them ideal for x-ray time-resolved studies. The temporal properties (bunch length, interpulse period, etc.) of these new sources will be summarized. Finally, the scientific potential and the technological challenges of time-resolved x-ray scattering from these new sources will be described. 13 refs., 4 figs
International Nuclear Information System (INIS)
Wittry, D.B.
1979-01-01
A rotating anode x-ray source is described which consists of a rotary anode disc including a target ring and a chamber within the anode disc. Liquid is evaporated into the chamber from the target ring to cool the target and a method is provided of removing the latent heat of the vapor. (U.K.)
Axion-like particle imprint in cosmological very-high-energy sources
International Nuclear Information System (INIS)
Domínguez, A.; Sánchez-Conde, M.A.; Prada, F.
2011-01-01
Discoveries of very high energy (VHE) photons from distant blazars suggest that, after correction by extragalactic background light (EBL) absorption, there is a flatness or even a turn-up in their spectra at the highest energies that cannot be easily explained by the standard framework. Here, it is shown that a possible solution to this problem is achieved by assuming the existence of axion-like particles (ALPs) with masses ∼ 1 neV. The ALP scenario is tested making use of observations of the highest redshift blazars known in the VHE energy regime, namely 3C 279, 3C 66A, PKS 1222+216 and PG 1553+113. In all cases, better fits to the observed spectra are found when including ALPs rather than considering EBL only. Interestingly, quite similar critical energies for photon/ALP conversions are also derived, independently of the source considered
X-ray Point Source Populations in Spiral and Elliptical Galaxies
Colbert, E.; Heckman, T.; Weaver, K.; Strickland, D.
2002-01-01
The hard-X-ray luminosity of non-active galaxies has been known to be fairly well correlated with the total blue luminosity since the days of the Einstein satellite. However, the origin of this hard component was not well understood. Some possibilities that were considered included X-ray binaries, extended upscattered far-infrared light via the inverse-Compton process, extended hot 107 K gas (especially in ellipitical galaxies), or even an active nucleus. Chandra images of normal, elliptical and starburst galaxies now show that a significant amount of the total hard X-ray emission comes from individual point sources. We present here spatial and spectral analyses of the point sources in a small sample of Chandra obervations of starburst galaxies, and compare with Chandra point source analyses from comparison galaxies (elliptical, Seyfert and normal galaxies). We discuss possible relationships between the number and total hard luminosity of the X-ray point sources and various measures of the galaxy star formation rate, and discuss possible options for the numerous compact sources that are observed.
The second COS-B catalogue of high-energy γ-ray sources
International Nuclear Information System (INIS)
Hermsen, W.
1981-01-01
Gamma-ray emission is produced in many localized regions. 13 high energy gamma-ray sources have previously been detected but because of difficulties of identification the nature of these sources is not clear. Further data from COS-B has been accumulated and allow a more systematic search for gamma-ray sources in the Galaxy. The 32 observations used were made between August 1975 and December 1978. Only events above 100 MeV have been included. The positions of the 25 detected gamma-ray sources are given. Only four sources of the catalogue have been identified, two with the Crab and Vela pulsars, one with 3C273 and one with the rho-Oph cloud complex. For the remainder, all but one of which lie close to the galactic disc, no unambiguous counterparts appear to exist at other wavelengths. (U.K.)
The Polarimeter for Relativistic Astrophysical X-ray Sources
Jahoda, Keith; Kallman, Timothy R.; Kouveliotou, Chryssa; Angelini, Lorella; Black, J. Kevin; Hill, Joanne E.; Jaeger, Theodore; Kaaret, Philip E.; Markwardt, Craig B.; Okajima, Takashi; Petre, Robert; Schnittman, Jeremy; Soong, Yang; Strohmayer, Tod E.; Tamagawa, Toru; Tawara, Yuzuru
2016-07-01
The Polarimeter for Relativistic Astrophysical X-ray Sources (PRAXyS) is one of three Small Explorer (SMEX) missions selected by NASA for Phase A study, with a launch date in 2020. The PRAXyS Observatory exploits grazing incidence X-ray mirrors and Time Projection Chamber Polarimeters capable of measuring the linear polarization of cosmic X-ray sources in the 2-10 keV band. PRAXyS combines well-characterized instruments with spacecraft rotation to ensure low systematic errors. The PRAXyS payload is developed at the Goddard Space Flight Center with the Johns Hopkins University Applied Physics Laboratory, University of Iowa, and RIKEN (JAXA) collaborating on the Polarimeter Assembly. The LEOStar-2 spacecraft bus is developed by Orbital ATK, which also supplies the extendable optical bench that enables the Observatory to be compatible with a Pegasus class launch vehicle. A nine month primary mission will provide sensitive observations of multiple black hole and neutron star sources, where theory predicts polarization is a strong diagnostic, as well as exploratory observations of other high energy sources. The primary mission data will be released to the community rapidly and a Guest Observer extended mission will be vigorously proposed.
High energy cosmic rays: sources and fluxes
Energy Technology Data Exchange (ETDEWEB)
Stanev, Todor; Gaisser, Thomas K.; Tilav, Serap
2014-04-01
We discuss the production of a unique energy spectrum of the high energy cosmic rays detected with air showers by shifting the energy estimates of different detectors. After such a spectrum is generated we fit the spectrum with three or four populations of cosmic rays that might be accelerated at different cosmic ray sources. We also present the chemical composition that the fits of the spectrum generates and discuss some new data sets presented this summer at the ICRC in Rio de Janeiro that may require new global fits.
Constraints on particle acceleration in SS433/W50 from MAGIC and H.E.S.S. observations
Ahnen, M. L.; Ansoldi, S.; Bednarek, W.; Paiano, S.; Palacio, J.; Paneque, D.; Paoletti, R.; Paredes, J. M.; Paredes-Fortuny, X.; Pedaletti, G.; Peresano, M.; Perri, L.; Persic, M.; Bernardini, E.; Prada Moroni, P. G.
2018-01-01
Context. The large jet kinetic power and non-thermal processes occurring in the microquasar SS 433 make this source a good candidate for a very high-energy (VHE) gamma-ray emitter. Gamma-ray fluxes above the sensitivity limits of current Cherenkov telescopes have been predicted for both the central X-ray binary system and the interaction regions of SS 433 jets with the surrounding W50 nebula. Non-thermal emission at lower energies has been previously reported, indicating that efficient partic...
X-ray emission as a diagnostic from pseudospark-sourced electron beams
Energy Technology Data Exchange (ETDEWEB)
Bowes, D., E-mail: david.bowes@strath.ac.uk [Department of Physics, SUPA, University of Strathclyde, Glasgow G4 0NG (United Kingdom); Yin, H.; He, W.; Zhang, L.; Cross, A.W.; Ronald, K.; Phelps, A.D.R. [Department of Physics, SUPA, University of Strathclyde, Glasgow G4 0NG (United Kingdom); Chen, D.; Zhang, P. [Computed Tomography Lab, School of Mathematical Sciences, Capital Normal University, Beijing 100048 (China); Chen, X.; Li, D. [Department of Electronic Engineering, Queen Mary University of London, London E1 4NS (United Kingdom)
2014-09-15
X-ray emission has been achieved using an electron beam generated by a pseudospark low-pressure discharge and utilised as a diagnostic for beam detection. A 300 A, 34 kV PS-sourced electron beam pulse of 3 mm diameter impacting on a 0.1 mm-thick molybdenum target generated X-rays which were detected via the use of a small, portable X-ray detector. Clear X-ray images of a micro-sized object were captured using an X-ray photodetector. This demonstrates the inducement of proton induced X-ray emission (PIXE) not only as an indicator of beam presence but also as a future X-ray source for small-spot X-ray imaging of materials.
Discovery of X-Ray Emission from the Galactic Supernova Remnant G32.8-0.1 with Suzaku
Bamba, Aya; Terada, Yukikatsu; Hewitt, John; Petre, Robert; Angelini, Lorella; Safi-Harb, Samar; Zhou, Ping; Bocchino, Fabrizio; Sawada, Makoto
2016-01-01
We present the first dedicated X-ray study of the supernova remnant (SNR) G32.8-0.1 (Kes 78) with Suzaku. X-ray emission from the whole SNR shell has been detected for the first time. The X-ray morphology is well correlated with the emission from the radio shell, while anti-correlated with the molecular cloud found in the SNR field. The X-ray spectrum shows not only conventional low-temperature (kT approximately 0.6 kiloelectronvolts) thermal emission in a nonequilibrium ionization state, but also a very high-temperature (approximately 3.4 kiloelectronvolts) component with a very low ionization timescale (approximately 2.7 times 10 (sup 9) per cubic centimeter per second), or a hard nonthermal component with a photon index Gamma approximately equal to 2.3. The average density of the low-temperature plasma is rather low, of the order of 10 (sup -3) - 10 (sup -2) per cubic centimeter, implying that this SNR is expanding into a low-density cavity. We discuss the X-ray emission of the SNR, also detected in teraelectronvolts with H.E.S.S. (High Energy Stereoscopic System), together with multi-wavelength studies of the remnant and other gamma-ray emitting SNRs, such as W28 and RCW 86. Analysis of a time-variable source, 2XMM J185114.3-000004, found in the northern part of the SNR, is also reported for the first time. Rapid time variability and a heavily absorbed hard-X-ray spectrum suggest that this source could be a new supergiant fast X-ray transient.
Plasma x-ray radiation source.
Popkov, N F; Kargin, V I; Ryaslov, E A; Pikar', A S
1995-01-01
This paper gives the results of studies on a plasma x-ray source, which enables one to obtain a 2.5-krad radiation dose per pulse over an area of 100 cm2 in the quantum energy range from 20 to 500 keV. Pulse duration is 100 ns. Spectral radiation distributions from a diode under various operation conditions of a plasma are obtained. A Marx generator served as an initial energy source of 120 kJ with a discharge time of T/4 = 10-6 s. A short electromagnetic pulse (10-7 s) was shaped using plasma erosion opening switches.
NuSTAR Hard X-Ray Survey of the Galactic Center Region. II. X-Ray Point Sources
DEFF Research Database (Denmark)
Hong, JaeSub; Mori, Kaya; Hailey, Charles J.
2016-01-01
persistent luminous X-ray binaries (XBs) and the likely run-away pulsar called the Cannonball. New source-detection significance maps reveal a cluster of hard (>10 keV) X-ray sources near the Sgr. A diffuse complex with no clear soft X-ray counterparts. The severe extinction observed in the Chandra spectra...
High-Energy Cosmic Ray Self-Confinement Close to Extra-Galactic Sources.
Blasi, Pasquale; Amato, Elena; D'Angelo, Marta
2015-09-18
The ultrahigh-energy cosmic rays observed on the Earth are most likely accelerated in extra-Galactic sources. For the typical luminosities invoked for such sources, the electric current associated to the flux of cosmic rays that leave them is large. The associated plasma instabilities create magnetic fluctuations that can efficiently scatter particles. We argue that this phenomenon forces cosmic rays to be self-confined in the source proximity for energies Esources for energies Esource luminosity in units of 10^{44} erg/s.
Liquid-metal-jet anode electron-impact x-ray source
International Nuclear Information System (INIS)
Hemberg, O.; Otendal, M.; Hertz, H.M.
2003-01-01
We demonstrate an anode concept, based on a liquid-metal jet, for improved brightness in compact electron-impact x-ray sources. The source is demonstrated in a proof-of-principle experiment where a 50 keV, ∼100 W electron beam is focused on a 75 μm liquid-solder jet. The generated x-ray flux and brightness is quantitatively measured in the 7-50 keV spectral region and found to agree with theory. Compared to rotating-anode sources, whose brightness is limited by intrinsic thermal properties, the liquid-jet anode could potentially be scaled to achieve a brightness >100x higher than current state-of-the-art sources. Applications such as mammography, angiography, and diffraction would benefit from such a compact high-brightness source
International Nuclear Information System (INIS)
Yamaguchi, N.; Takahashi, Z.; Nishimura, Y.; Watanabe, K.; Okamoto, Y.; Sakata, A.; Azuma, H.; Hara, T.
2005-01-01
A laboratory-sized X-ray photoelectron microscope was constructed using a compact X-ray source produced by line-focused laser irradiation. The system is a scanning type photoelectron microscope where X-ray beam is micro-focused via Schwarzschild optics. A compact laser-plasma X-ray source has been developed with a YAG laser, a line-focus lens assembly, an Al tape-target driver and a debris prevention system. The 13.1 nm X-ray was delivered along line plasma whose length was 0.6 or 11 mm with higher intensity than that from a point-focused source. The Schwarzschild optics having the designed demagnification of 224, which was coated with Mo/Si multilayers for 13.1 nm X-ray, was set on the beamline 1 m distant from the source. The electron energy analyser was a spherical capacitor analyser with the photoelectron image detection system that was suited for detection of vast photoelectrons excited by an X-ray pulse of ns-order duration. The spatial resolution less than 5 μm has been confirmed from the variation of As 3d electron intensity along the position of the GaAs sample coated with a photo-resist test pattern
Environments of High Luminosity X-Ray Sources in the Antennae Galaxies
Clark, D. M.; Eikenberry, S. S.; Brandl, B. R.; Wilson, J. C.; Carson, J. C.; Henderson, C. P.; Hayward, T. P.; Barry, D. J.; Houck, J. R.; Ptak, A.; Colbert, E.
2003-12-01
We use deep J (1.25 μ m) and Ks (2.15 μ m) images of the Antennae (NGC 4038/9) obtained with the Wide-field InfraRed Camera on the Palomar 200-inch telescope, together with the Chandra X-ray source list of Zezas et al. (2001), to establish an X-ray/IR astrometric frame tie with ˜ 0.5 ″ RMS residuals over a ˜ 5 ‧ field. We find 13 ``strong" IR counterparts 99.9% confidence), and that the X-ray/IR matches are concentrated in the spiral arms and ``bridge" regions of the Antennae. This implies that these X-ray sources lie in the most ``super" of the Antennae's Super Star Clusters, and thus trace the recent massive star formation history here. Based on the NH inferred from the X-ray sources without IR counterparts, we determine that the absence of most of the ``missing" IR counterparts is not due to extinction, but that these sources are intrinsically less luminous in the IR, implying that they trace a different (older?) stellar population. We find no clear correlation between X-ray luminosity classes and IR properties of the sources, though small number statistics hamper this analysis. Finally, we find a Ks = 16.2 mag counterpart to the Ultra-Luminous X-ray (ULX) source X-37 within <0.5 ″ , eliminating the need for the ``runaway binary" hypothesis proposed by previous authors for this object. We discuss some of the implications of this detection for models of ULX emission. This work is funded by an NSF CAREER grant.
Limits on the space density of gamma-ray burst sources
International Nuclear Information System (INIS)
Epstein, R.I.
1985-01-01
Gamma-ray burst spectra which extend to several MeV without significant steepening indicate that there is negligible degradation due to two-photon pair production. The inferred low rate of photon-photon reactions is used to give upper limits to the distances to the sources and to the intensity of the radiation from the sources. These limits are calculated under the assumptions that the bursters are neutron stars which emit uncollimated gamma rays. The principal results are that the space density of the gamma-ray burst sources exceeds approx.10 -6 pc -3 if the entire surface of the neutron star radiates and exceeds approx.10 -3 pc -3 if only a small cap or thin strip in the stellar surface radiates. In the former case the density of gamma-ray bursters is approx.1% of the inferred density of extinct pulsars, and in the latter case the mean mass density of burster sources is a few percent of the density of unidentified dark matter in the solar neighborhood. In both cases the X-ray intensity of the sources is far below the Rayleigh-Jeans limit, and the total flux is at most comparable to the Eddington limit. This implies that low-energy self-absorption near 10 keV is entirely negligible and that radiation-driven explosions are just barely possible
Ghosal, B.; Singh, K. K.; Yadav, K. K.; Tickoo, A. K.; Rannot, R. C.; Chandra, P.; Kothari, M.; Gaur, K. K.; Goyal, H. C.; Goyal, A.; Kumar, N.; Marandi, P.; Chanchalani, K.; Agarwal, N. K.; Dhar, V. K.; Koul, M. K.; Koul, R.; Venugopal, K.; Bhat, C. K.; Chouhan, N.; Borwankar, C.; Kaul, S. R.; Bhatt, H.; Agarwal, A.; Gupta, A. C.
2018-04-01
Non-blazar active galactic nuclei like radio galaxies have emerged as a new class of γ-ray sources in the sky. Observations of very high energy (VHE) γ-rays from radio galaxies with misaligned jets offer a unique tool to understand the physical processes involved in these type of objects. In this work, we present the results of our observations of the nearby peculiar radio galaxy IC 310 (z = 0.0189) with TACTIC telescope for nearly 95.5 hours from 03 December, 2012 to 19 January, 2015 (MJD 56265 - 57041). Detailed analysis of the data reveals absence of a statistically significant γ-ray signal from the source direction (both on the overall period and on yearly basis). Our results suggest that the source was possibly in a low-TeV emission state (below the TACTIC sensitivity level) during the above mentioned observation period and the resulting 3σ upper limit on the integral flux above 850 GeV has been estimated to be 4.99 ×10-12phcm-2s-1 (23% of the Crab Nebula flux). Analysis of the contemporaneous data collected by Fermi-LAT in the 30 - 300 GeV energy range, also indicate the absence of a statistically significant γ-ray signal, therefore 2σ upper limit on the integral flux above 30 GeV has been estimated on yearly basis. We also report the results from dedicated optical observations in B, V and R bands from ARIES observatory carried out from December, 2014 to March, 2015.
Milagro Contributions to XXVI International Cosmic Ray Conference
Energy Technology Data Exchange (ETDEWEB)
Hoffman, C.M.; Haines, T.J.; Sinnis, G.; Miller, R.S.; Thompson, N.T.
1999-08-01
Milagrito, a prototype for the Milagro detector, operated for 15 months in 1997--8 and collected 8.9 x 10{sup 9} events. It was the first extensive air shower (EAS) array sensitive to showers initiated by primaries with energy below 1 TeV. The shadows of the sun and moon observed with cosmic rays can be used to study systematic pointing shifts and measure the angular resolution of EAS arrays. Below a few TeV, the paths of cosmic rays coming toward the earth are bent by the helio- and geo-magnetic fields. This is expected to distort and displace the shadows of the sun and the moon. The moon shadow, offset from the nominal (unreflected) position, has been observed with high statistical significance in Milagrito. This can be used to establish energy calibrations, as well as to search for the anti-matter content of the VHE cosmic ray flux. The shadow of the sun has also been observed with high significance.
Chi, Zhijun; Du, Yingchao; Huang, Wenhui; Tang, Chuanxiang
2017-12-01
The necessity for compact and relatively low cost x-ray sources with monochromaticity, continuous tunability of x-ray energy, high spatial coherence, straightforward polarization control, and high brightness has led to the rapid development of Thomson scattering x-ray sources. To meet the requirement of in-situ monochromatic computed tomography (CT) for large-scale and/or high-attenuation materials based on this type of x-ray source, there is an increasing demand for effective algorithms to correct the energy-angle correlation. In this paper, we take advantage of the parametrization of the x-ray attenuation coefficient to resolve this problem. The linear attenuation coefficient of a material can be decomposed into a linear combination of the energy-dependent photoelectric and Compton cross-sections in the keV energy regime without K-edge discontinuities, and the line integrals of the decomposition coefficients of the above two parts can be determined by performing two spectrally different measurements. After that, the line integral of the linear attenuation coefficient of an imaging object at a certain interested energy can be derived through the above parametrization formula, and monochromatic CT can be reconstructed at this energy using traditional reconstruction methods, e.g., filtered back projection or algebraic reconstruction technique. Not only can monochromatic CT be realized, but also the distributions of the effective atomic number and electron density of the imaging object can be retrieved at the expense of dual-energy CT scan. Simulation results validate our proposal and will be shown in this paper. Our results will further expand the scope of application for Thomson scattering x-ray sources.
Speckle-based at-wavelength metrology of x-ray optics at Diamond Light Source
Wang, Hongchang; Zhou, Tunhe; Kashyap, Yogesh; Sawhney, Kawal
2017-08-01
To achieve high resolution and sensitivity on the nanometer scale, further development of X-ray optics is required. Although ex-situ metrology provides valuable information about X-ray optics, the ultimate performance of X-ray optics is critically dependent on the exact nature of the working conditions. Therefore, it is equally important to perform in-situ metrology at the optics' operating wavelength (`at-wavelength' metrology) to optimize the performance of X-ray optics and correct and minimize the collective distortions of the upstream beamline optics, e.g. monochromator, windows, etc. Speckle-based technique has been implemented and further improved at Diamond Light Source. We have demonstrated that the angular sensitivity for measuring the slope error of an optical surface can reach an accuracy of two nanoradians. The recent development of the speckle-based at-wavelength metrology techniques will be presented. Representative examples of the applications of the speckle-based technique will also be given - including optimization of X-ray mirrors and characterization of compound refraction lenses. Such a high-precision metrology technique will be extremely beneficial for the manufacture and in-situ alignment/optimization of X-ray mirrors for next-generation synchrotron beamlines.
Intensity-Modulated Advanced X-ray Source (IMAXS) for Homeland Security Applications
International Nuclear Information System (INIS)
Langeveld, Willem G. J.; Johnson, William A.; Owen, Roger D.; Schonberg, Russell G.
2009-01-01
X-ray cargo inspection systems for the detection and verification of threats and contraband require high x-ray energy and high x-ray intensity to penetrate dense cargo. On the other hand, low intensity is desirable to minimize the radiation footprint. A collaboration between HESCO/PTSE Inc., Schonberg Research Corporation and Rapiscan Laboratories, Inc. has been formed in order to design and build an Intensity-Modulated Advanced X-ray Source (IMAXS). Such a source would allow cargo inspection systems to achieve up to two inches greater imaging penetration capability, while retaining the same average radiation footprint as present fixed-intensity sources. Alternatively, the same penetration capability can be obtained as with conventional sources with a reduction of the average radiation footprint by about a factor of three. The key idea is to change the intensity of the source for each x-ray pulse based on the signal strengths in the inspection system detector array during the previous pulse. In this paper we describe methods to accomplish pulse-to-pulse intensity modulation in both S-band (2998 MHz) and X-band (9303 MHz) linac sources, with diode or triode (gridded) electron guns. The feasibility of these methods has been demonstrated. Additionally, we describe a study of a shielding design that would allow a 6 MV X-band source to be used in mobile applications.
Crystallization and preliminary X-ray analysis of Escherichia coli RNase G
International Nuclear Information System (INIS)
Fang, Pengfei; Wang, Jing; Li, Xu; Guo, Min; Xing, Li; Cao, Xu; Zhu, Yi; Gao, Yan; Niu, Liwen; Teng, Maikun
2009-01-01
Full-length E. coli RNase G was overexpressed, purified and crystallized. Diffraction data were collected to a resolution of 3.4 Å. The homologous RNases RNase E and RNase G are widely distributed in bacteria and function in many important physiological processes, including mRNA degradation, rRNA maturation and so on. In this study, the crystallization and preliminary X-ray analysis of RNase G from Escherichia coli is described. Purified recombinant E. coli RNase G, which has 497 amino acids, was crystallized in the cubic space group F432, with unit-cell parameters a = b = c = 219.84 Å. X-ray diffraction data were collected to a resolution of 3.4 Å
Nanomaterial-based x-ray sources
Cole, Matthew T.; Parmee, R. J.; Milne, William I.
2016-02-01
Following the recent global excitement and investment in the emerging, and rapidly growing, classes of one and two-dimensional nanomaterials, we here present a perspective on one of the viable applications of such materials: field electron emission based x-ray sources. These devices, which have a notable history in medicine, security, industry and research, to date have almost exclusively incorporated thermionic electron sources. Since the middle of the last century, field emission based cathodes were demonstrated, but it is only recently that they have become practicable. We outline some of the technological achievements of the past two decades, and describe a number of the seminal contributions. We explore the foremost market hurdles hindering their roll-out and broader industrial adoption and summarise the recent progress in miniaturised, pulsed and multi-source devices.
Galactic sources of high energy neutrinos: Expectation from gamma-ray data
Directory of Open Access Journals (Sweden)
Sahakyan N.
2016-01-01
Full Text Available The recent results from ground based γ-ray detectors (HESS, MAGIC, VERITAS provide a population of TeV galactic γ-ray sources which are potential sources of High Energy (HE neutrinos. Since the γ-rays and ν-s are produced from decays of neutral and charged pions, the flux of TeV γ-rays can be used to estimate the upper limit of ν flux and vice versa; the detectability of ν flux implies a minimum flux of the accompanying γ-rays (assuming the internal and the external absorption of γ-rays is negligible. Using this minimum flux, it is possible to find the sources which can be detected with cubic-kilometer telescopes. I will discuss the possibility to detect HE neutrinos from powerful galactic accelerators, such as Supernova Remnants (SNRs and Pulsar Wind Nebulae (PWNe and show that likely only RX J1713.7-3946, RX J0852.0-4622 and Vela X can be detected by current generation of instruments (IceCube and Km3Net. It will be shown also, that galactic binary systems could be promising sources of HE ν-s. In particular, ν-s and γ-rays from Cygnus X-3 will be discussed during recent gamma-ray activity, showing that in the future such kind of activities could produce detectable flux of HE ν-s.
Sources of the X-rays Based on Compton Scattering
International Nuclear Information System (INIS)
Androsov, V.; Bulyak, E.; Gladkikh, P.; Karnaukhov, I.; Mytsykov, A.; Telegin, Yu.; Shcherbakov, A.; Zelinsky, A.
2007-01-01
The principles of the intense X-rays generation by laser beam scattering on a relativistic electron beam are described and description of facilities assigned to produce the X-rays based on Compton scattering is presented. The possibilities of various types of such facilities are estimated and discussed. The source of the X-rays based on a storage ring with low beam energy is described in details and advantages of the sources of such type are discussed.The results of calculation and numerical simulation carried out for laser electron storage ring NESTOR that is under development in NSC KIPT show wide prospects of the accelerator facility of such type
Miniaturized High-Speed Modulated X-Ray Source
Gendreau, Keith C. (Inventor); Arzoumanian, Zaven (Inventor); Kenyon, Steven J. (Inventor); Spartana, Nick Salvatore (Inventor)
2015-01-01
A miniaturized high-speed modulated X-ray source (MXS) device and a method for rapidly and arbitrarily varying with time the output X-ray photon intensities and energies. The MXS device includes an ultraviolet emitter that emits ultraviolet light, a photocathode operably coupled to the ultraviolet light-emitting diode that emits electrons, an electron multiplier operably coupled to the photocathode that multiplies incident electrons, and an anode operably coupled to the electron multiplier that is configured to produce X-rays. The method for modulating MXS includes modulating an intensity of an ultraviolet emitter to emit ultraviolet light, generating electrons in response to the ultraviolet light, multiplying the electrons to become more electrons, and producing X-rays by an anode that includes a target material configured to produce X-rays in response to impact of the more electrons.
High intensity line source for x-ray spectrometer calibration
International Nuclear Information System (INIS)
Thoe, R.S.
1986-06-01
A high intensity electron-impact x-ray source using a one-dimensional Pierce lens has been built for the purpose of calibrating a bent crystal x-ray spectrometer. This source focuses up to 100 mA of 20-keV electrons to a line on a liquid-cooled anode. The line (which can serve as a virtual slit for the spectrometer) measures approximately 800 μ x 2 cm. The source is portable and therefore adaptable to numerous types of spectrometer applications. One particular application, the calibration of a high resolution (r = 10 4 ) time-resolved cyrstal spectrometer, will be discussed in detail
Gamma ray energy spectrum of a buried radioactive source
Energy Technology Data Exchange (ETDEWEB)
Massey, N B
1957-07-01
Because of current attempts to utilize airborne gamma-ray scintillation spectrometers as a means of detecting and identifying buried radioactive mineral deposits, it has become important to study the effects of multiple scattering on the gamma-ray energy spectrum of a source buried in a semi-infinite medium. A series of ten experiments was made. First a scintillation detector was located in air at a fixed distance above a 250 microcurie cobalt-60 source suspended in a large tank. The level of water was raised from 25 cm below the source to 50 cm above, and the gamma-ray energy spectrum was observed. It was found that the high energy portion of the cobalt-60 spectrum remained identifiable even when the source was submerged more than five half-lengths. Further, the ratio of the counting rate of the total incident gamma radiation to the counting rate of the primary 1.33 MeV radiation was found to be very nearly linearly proportional to the depth of water cover. This leads to an empirical method for determining the depth of burial of a cobalt-60 point source. (author)
Matching microlensing events with X-ray sources
Sartore, N.; Treves, A.
2012-03-01
Aims: The detection of old neutron stars and stellar mass black holes in isolation is one of the most sought after goals of compact object astrophysics. Microlensing surveys may help in achieving this aim because the lensing mechanism is independent of the emission properties of the lens. Several black hole candidates have indeed been detected by means of microlensing observations have been reported in the literature. The identification of counterparts, especially in the X-rays, would be a strong argument in favor of the compact nature of these lenses. Methods: We perform a cross-correlation between the catalogs of microlensing events produced by the OGLE, MACHO, and MOA teams, and those of X-rays sources from the data acquired by the XMM-Newton and Chandra satellites. On the basis of our previous work, we select only microlensing events with durations longer than one hundred days, which should contain a large fraction of lenses as compact objects. Our matching criterion takes into account the positional coincidence on the sky. Results: We find a single match between a microlensing event, OGLE-2004-BLG-081 (tE ~ 103 days), and the X-ray source 2XMM J180540.5-273427. The angular separation is ~0.5 arcsec, i.e. well within the 90% error box of the X-ray source. The hardness ratios reported in the 2XMM catalog imply that it has a hard spectrum with a peak between 2 keV and 4.5 keV or it has a softer but highly absorbed spectrum. Moreover, the microlensing event is not fully constrained, and other authors propose a possible association of the source star with either a flaring cataclysmic variable or a RS Canum Venaticorum-like star. Conclusions: The very small angular separation (within uncertainties) is a strong indicator that 2XMM J180540.5-273427 is the X-ray counterpart of the OGLE event. However, the uncertainties in the nature of both the lensed system and the lens itself challenge the interpretation of 2XMM J180540.5-273427 as the first confirmed isolated black
Towards a Unified Source-Propagation Model of Cosmic Rays
Taylor, M.; Molla, M.
2010-07-01
It is well known that the cosmic ray energy spectrum is multifractal with the analysis of cosmic ray fluxes as a function of energy revealing a first “knee” slightly below 1016 eV, a second knee slightly below 1018 eV and an “ankle” close to 1019 eV. The behaviour of the highest energy cosmic rays around and above the ankle is still a mystery and precludes the development of a unified source-propagation model of cosmic rays from their source origin to Earth. A variety of acceleration and propagation mechanisms have been proposed to explain different parts of the spectrum the most famous of course being Fermi acceleration in magnetised turbulent plasmas (Fermi 1949). Many others have been proposd for energies at and below the first knee (Peters & Cimento (1961); Lagage & Cesarsky (1983); Drury et al. (1984); Wdowczyk & Wolfendale (1984); Ptuskin et al. (1993); Dova et al. (0000); Horandel et al. (2002); Axford (1991)) as well as at higher energies between the first knee and the ankle (Nagano & Watson (2000); Bhattacharjee & Sigl (2000); Malkov & Drury (2001)). The recent fit of most of the cosmic ray spectrum up to the ankle using non-extensive statistical mechanics (NESM) (Tsallis et al. (2003)) provides what may be the strongest evidence for a source-propagation system deviating significantly from Boltmann statistics. As Tsallis has shown (Tsallis et al. (2003)), the knees appear as crossovers between two fractal-like thermal regimes. In this work, we have developed a generalisation of the second order NESM model (Tsallis et al. (2003)) to higher orders and we have fit the complete spectrum including the ankle with third order NESM. We find that, towards the GDZ limit, a new mechanism comes into play. Surprisingly it also presents as a modulation akin to that in our own local neighbourhood of cosmic rays emitted by the sun. We propose that this is due to modulation at the source and is possibly due to processes in the shell of the originating supernova. We
Table-top laser-driven ultrashort electron and X-ray source: the CIBER-X source project
Girardeau-Montaut, Jean-Pierre; Kiraly, Bélà; Girardeau-Montaut, Claire; Leboutet, Hubert
2000-09-01
We report on the development of a new laser-driven table-top ultrashort electron and X-ray source, also called the CIBER-X source . X-ray pulses are produced by a three-step process which consists of the photoelectron emission from a thin metallic photocathode illuminated by 16 ps duration laser pulses at 213 nm. The e-gun is a standard Pierce diode electrode type, in which electrons are accelerated by a cw electric field of ˜11 MV/m up to a hole made in the anode. The photoinjector produces a train of 70-80 keV electron pulses of ˜0.5 nC and 20 A peak current at a repetition rate of 10 Hz. The electrons are then transported outside the diode along a path of 20 cm length, and are focused onto a target of thullium by magnetic fields produced by two electromagnetic coils. X-rays are then produced by the impact of electrons on the target. Simulations of geometrical, electromagnetic fields and energetic characteristics of the complete source were performed previously with the assistance of the code PIXEL1 also developed at the laboratory. Finally, experimental electron and X-ray performances of the CIBER-X source as well as its application to very low dose imagery are presented and discussed. source Compacte d' Impulsions Brèves d' Electrons et de Rayons X
On the nature of the galactic 2CG γ-ray sources
International Nuclear Information System (INIS)
Buccheri, R.; Morini, M.; Sacco, B.
1981-01-01
The identification of two γ-ray sources of the COS-B catalogue with radio pulsars is used as an important hint for the identification of the rest of the population. The relevant distributions of γ-ray pulsars visible at the Sun within the limiting sensitivity of COS-B are derived on the following assumptions: (i) the γ-ray luminosity is a decreasing power law of the pulsar age, as indicated by current models; (ii) the scale height of pulsars at creation is equal to that of the supernova remnants; (iii) the pulsars' birth rate and spatial distribution are those published by Taylor and Manchester (1977). As a preliminary result it is shown that 10 to 20 γ-ray pulsars may be visible from the Earth with distributional parameters not distinguishable from those of the 2CG γ-ray sources. It is suggested therefore that a significant fraction of the unidentified galactic γ-ray sources are pulsars. (author)
Tire inspection system with shielded x-ray source
International Nuclear Information System (INIS)
Heisner, D.N.; Palermo, A. Jr.; Loyer, P.K.
1976-01-01
An automated tire inspection system is described which employs a penetrative radiation, such as x-radiation, to inspect the integrity of portions of tires fed sequentially along a feed path through a centering station and into a shielded enclosure where an inspection station is defined. Features of the system include a continuously operating x-ray source movable between inspection and retracted positions, and an x-ray shield for covering the source when it is retracted to permit the doors of the shielded enclosure to be opened without danger from escaping radiation. 19 Claims, 38 Drawing Figures
Energy Technology Data Exchange (ETDEWEB)
Sun, Xuepeng; Liu, Zhiguo [The Key Laboratory of Beam Technology and Materials Modification of the Ministry of Education, Beijing Normal University, Beijing 100875 (China); College of Nuclear Science and Technology, Beijing Normal University, Beijing 100875 (China); Beijing Radiation Center, Beijing 100875 (China); Sun, Tianxi, E-mail: stx@bnu.edu.cn [The Key Laboratory of Beam Technology and Materials Modification of the Ministry of Education, Beijing Normal University, Beijing 100875 (China); College of Nuclear Science and Technology, Beijing Normal University, Beijing 100875 (China); Beijing Radiation Center, Beijing 100875 (China); Yi, Longtao; Sun, Weiyuan; Li, Fangzuo; Jiang, Bowen [The Key Laboratory of Beam Technology and Materials Modification of the Ministry of Education, Beijing Normal University, Beijing 100875 (China); College of Nuclear Science and Technology, Beijing Normal University, Beijing 100875 (China); Beijing Radiation Center, Beijing 100875 (China); Ma, Yongzhong [Center for Disease Control and Prevention of Beijing, Beijing 100013 (China); Ding, Xunliang [The Key Laboratory of Beam Technology and Materials Modification of the Ministry of Education, Beijing Normal University, Beijing 100875 (China); College of Nuclear Science and Technology, Beijing Normal University, Beijing 100875 (China); Beijing Radiation Center, Beijing 100875 (China)
2015-12-01
Two combined optic systems based on polycapillary X-ray optics and single-bounce monocapillary optics (SBMO) were designed for focusing the X-rays from a conventional laboratory X-ray source. One was based on a polycapillary focusing X-ray lens (PFXRL) and a single-bounce ellipsoidal capillary (SBEC), in which the output focal spot with the size of tens of micrometers of the PFXRL was used as the “virtual” X-ray source for the SBEC. The other system was based on a polycapillary parallel X-ray lens (PPXRL) and a single-bounce parabolic capillary (SBPC), in which the PPXRL transformed the divergent X-ray beam from an X-ray source into a quasi-parallel X-ray beam with the divergence of sever milliradians as the incident illumination of the SBPC. The experiment results showed that the combined optic systems based on PFXRL and SBEC with a Mo rotating anode X-ray generator with the focal spot with a diameter of 300 μm could obtain a focal spot with the total gain of 14,300 and focal spot size of 37.4 μm, and the combined optic systems based on PPXRL and SBPC with the same X-ray source mentioned above could acquire a focal spot with the total gain of 580 and focal spot size of 58.3 μm, respectively. The two combined optic systems have potential applications in micro X-ray diffraction, micro X-ray fluorescence, micro X-ray absorption near edge structure, full field X-ray microscopes and so on.
Development of a sub-MeV X-ray source via Compton backscattering
International Nuclear Information System (INIS)
Kawase, K.; Kando, M.; Hayakawa, T.; Daito, I.; Kondo, S.; Homma, T.; Kameshima, T.; Kotaki, H.; Chen, L.-M.; Fukuda, Y.; Faenov, A.; Shizuma, T.; Shimomura, T.; Yoshida, H.; Hajima, R.; Fujiwara, M.; Bulanov, S.V.; Kimura, T.; Tajima, T.
2011-01-01
At the Kansai Photon Science Institute of the Japan Atomic Energy Agency, we have developed a Compton backscattered X-ray source in the energy region of a few hundred keV. The X-ray source consists of a 150-MeV electron beam, with a pulse duration of 10 ps (rms), accelerated by a Microtron accelerator and an Nd:YAG laser, with a pulse duration of 10 ns (FWHM). In the first trial experiment, the X-ray flux is estimated to be (2.2±1.0)x10 2 photons/pulse. For the actual application of an X-ray source, it is important to increase the generated X-ray flux as much as possible. Thus, for the purpose of increasing the X-ray flux, we have developed the pulse compression system for the Nd:YAG laser via stimulated Brillouin scattering (SBS). The SBS pulse compression has the great advantages of a high conversion efficiency and a simple structure. In this article, we review the present status of the Compton backscattered X-ray source and describe the SBS pulse compression system.
Dense plasma focus x-ray source for sub-micron lithography
International Nuclear Information System (INIS)
Prasad, R.R.; Krishnan, M.; Mangano, J.; Greene, P.; Qi, Niansheng
1993-01-01
A discharge driven, dense plasma focus in neon is under development at SRL for use as a point x-ray source for sub-micron lithography. This source is presently capable of delivering ∼ 13j/pulse of neon K-shell x-rays (8--14 angstrom) into 4π steradians with 2 kj of electrical energy stored in the capacitor bank charged to 9 kV at a pulse repetition rate of 2 Hz. The discharge is produced by a ≤4 kj, ≤12 kV, capacitor bank circuit, which has a fixed inductance of 12 nH and drives ≤450 kA currents into the DPF load, with ∼1.1 μs rise-times. X-rays are produced when a dense pinch of neon is formed along the axis of the DPF electrodes. A new rail-gap switched capacitor bank and DPF have been built, designed for continuous operation at 2 Hz and burst mode operation at 20 Hz. This paper will present measurements of the x-ray output at a repetition rate of 2 Hz using the new capacitor bank. It will also describe measurements of the spot size (0.3--0.8 mm) and the spectrum (8--14 angstrom) of the DPF source. The dependence of these parameters on the DPF head geometry, bank energy and operating pressure will be discussed. The x-ray output has been measured using filtered pin diodes, x-ray diodes, and absolutely calibrated x-ray crystal spectra. Results from the source operating at 2 Hz will be presented. A novel concept of a windowless beamline has also been developed. The results of preliminary experiments to test the concept will be discussed. At a pulse repetition rate of 20 Hz, this source should produce 200--400 W of x-ray power in the 8-14 angstrom wavelength band, with an input power of 40--60 kW
DISCOVERY OF X-RAY EMISSION FROM THE GALACTIC SUPERNOVA REMNANT G32.8-0.1 WITH SUZAKU
Energy Technology Data Exchange (ETDEWEB)
Bamba, Aya; Sawada, Makoto [Department of Physics and Mathematics, Aoyama Gakuin University 5-10-1 Fuchinobe Chuo-ku, Sagamihara, Kanagawa 252-5258 (Japan); Terada, Yukikatsu [Department of Physics, Science, Saitama University, Sakura, Saitama 338-8570 (Japan); Hewitt, John; Petre, Robert; Angelini, Lorella [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Safi-Harb, Samar [Department of Physics and Astronomy, University of Manitoba, Winnipeg MB R3T 2N2 (Canada); Zhou, Ping [Department of Astronomy, Nanjing University, Nanjing 210093 (China); Bocchino, Fabrizio [INAF—Osservatorio Astronomico di Palermo, Piazza del Parlamento 1, I-90134, Palermo (Italy)
2016-02-10
We present the first dedicated X-ray study of the supernova remnant (SNR) G32.8−0.1 (Kes 78) with Suzaku. X-ray emission from the whole SNR shell has been detected for the first time. The X-ray morphology is well correlated with the emission from the radio shell, while anti-correlated with the molecular cloud found in the SNR field. The X-ray spectrum shows not only conventional low-temperature (kT ∼ 0.6 keV) thermal emission in a non-equilibrium ionization state, but also a very high-temperature (kT ∼ 3.4 keV) component with a very low ionization timescale (∼2.7 × 10{sup 9} cm{sup −3} s), or a hard nonthermal component with a photon index Γ ∼ 2.3. The average density of the low-temperature plasma is rather low, of the order of 10{sup −3}–10{sup −2} cm{sup −3}, implying that this SNR is expanding into a low-density cavity. We discuss the X-ray emission of the SNR, also detected in TeV with H.E.S.S., together with multi-wavelength studies of the remnant and other gamma-ray emitting SNRs, such as W28 and RCW 86. Analysis of a time-variable source, 2XMM J185114.3−000004, found in the northern part of the SNR, is also reported for the first time. Rapid time variability and a heavily absorbed hard-X-ray spectrum suggest that this source could be a new supergiant fast X-ray transient.
Energy Technology Data Exchange (ETDEWEB)
Gotthelf, E. V.; Halpern, J. P.; Hailey, J. C. [Columbia Astrophysics Laboratory, Columbia University, 550 West 120th Street, New York, NY 10027-6601 (United States); Tomsick, J. A.; Boggs, S. E.; Craig, W. W. [Space Sciences Laboratory, University of California, Berkeley, CA 94720 (United States); Gelfand, J. D. [NYU Abu Dhabi, PO Box 129188, Abu Dhabi (United Arab Emirates); Harrison, F. A. [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Christensen, F. E. [DTU Space-National Space Institute, Technical University of Denmark, Elektrovej 327, 2800 Lyngby (Denmark); Kaspi, V. M. [Department of Physics, McGill University, Montreal, QC H3A 2T8 (Canada); Stern, D. K. [Jet Propulsion Laboratory, California Institute of Technology, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States); Zhang, W. W., E-mail: eric@astro.columbia.edu [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States)
2014-06-20
We report the discovery of a 206 ms pulsar associated with the TeV γ-ray source HESS J1640–465 using the Nuclear Spectroscopic Telescope Array (NuSTAR) X-ray observatory. PSR J1640–4631 lies within the shell-type supernova remnant (SNR) G338.3–0.0, and coincides with an X-ray point source and putative pulsar wind nebula (PWN) previously identified in XMM-Newton and Chandra images. It is spinning down rapidly with period derivative P-dot = 9.758(44) × 10{sup –13}, yielding a spin-down luminosity E-dot = 4.4 × 10{sup 36} erg s{sup –1}, characteristic age τ{sub c}≡P/2 P-dot = 3350 yr, and surface dipole magnetic field strength B{sub s} = 1.4 × 10{sup 13} G. For the measured distance of 12 kpc to G338.3–0.0, the 0.2-10 TeV luminosity of HESS J1640–465 is 6% of the pulsar's present E-dot . The Fermi source 1FHL J1640.5–4634 is marginally coincident with PSR J1640–4631, but we find no γ-ray pulsations in a search using five years of Fermi Large Area Telescope (LAT) data. The pulsar energetics support an evolutionary PWN model for the broadband spectrum of HESS J1640–465, provided that the pulsar's braking index is n ≈ 2, and that its initial spin period was P {sub 0} ∼ 15 ms.
ROSAT EUV and soft X-ray studies of atmospheric composition and structure in G191-B2B
Barstow, M. A.; Fleming, T. A.; Finley, D. S.; Koester, D.; Diamond, C. J.
1993-01-01
Previous studies of the hot DA white dwarf GI91-B2B have been unable to determine whether the observed soft X-ray and EUV opacity arises from a stratified hydrogen and helium atmosphere or from the presence of trace metals in the photosphere. New EUV and soft X-ray photometry of this star, made with the ROSAT observatory, when analyzed in conjunction with the earlier data, shows that the stratified models cannot account for the observed fluxes. Consequently, we conclude that trace metals must be a substantial source of opacity in the photosphere of G191-B2B.
Optical Counterparts for Low-Luminosity X-ray Sources in Omega Centauri
Cool, Adrienne
2002-07-01
We propose to use narrow-band HAlpha imaging with ACS to search for the optical counterparts of low-luminosity X-ray sources {Lx 2 x 10^30 - 5 x 10^32 erg/s} in the globular cluster Omega Centauri. With 9 WFC fields, we will cover the inner two core radii of the cluster, and encompass about 90 of the faint sources we have identified with Chandra. Approximately 30-50 of these sources should be cluster members, the remainder being mostly background galaxies plus a smaller number of foreground stars. This large population of low-Lx cluster X-ray sources is second only to the more than 100 faint sources recently discovered in 47 Tuc with Chandra {Grindlay et al. 2001a}, which have been identified as a mixture of cataclysmic variables, quiescent low-mass X-ray binaries, millisecond pulsars, and coronally active main-sequence binaries. Our Cycle 6 WFPC2 program successfully identified 2 of the 3 then-known faint X-ray sources in the core of Omega Cen using H-alpha imaging. We now propose to expand the areal coverage by a factor of about 18 to encompass the much larger number of sources that have since been discovered with Chandra. The extreme crowding in the central regions of Omega Cen requires the resolution of HST to obtain optical IDs. These identifications are key to making meaningful comparisons between the populations of faint X-ray sources in different clusters, in an effort to understand their origins and role in cluster dynamics.
LIGHT SOURCE: A simulation study of Tsinghua Thomson scattering X-ray source
Tang, Chuan-Xiang; Li, Ren-Kai; Huang, Wen-Hui; Chen, Huai-Bi; Du, Ying-Chao; Du, Qiang; Du, Tai-Bin; He, Xiao-Zhong; Hua, Jian-Fei; Lin, Yu-Zhen; Qian, Hou-Jun; Shi, Jia-Ru; Xiang, Dao; Yan, Li-Xin; Yu, Pei-Cheng
2009-06-01
Thomson scattering X-ray sources are compact and affordable facilities that produce short duration, high brightness X-ray pulses enabling new experimental capacities in ultra-fast science studies, and also medical and industrial applications. Such a facility has been built at the Accelerator Laboratory of Tsinghua University, and upgrade is in progress. In this paper, we present a proposed layout of the upgrade with design parameters by simulation, aiming at high X-ray pulses flux and brightness, and also enabling advanced dynamics studies and applications of the electron beam. Design and construction status of main subsystems are also presented.
Broad Band Observations of Gravitationally Lensed Blazar during a Gamma-Ray Outburst
Directory of Open Access Journals (Sweden)
Julian Sitarek
2016-09-01
Full Text Available QSO B0218+357 is a gravitationally lensed blazar located at a cosmological redshift of 0.944. In July 2014 a GeV flare was observed by Fermi-LAT, triggering follow-up observations with the MAGIC telescopes at energies above 100 GeV. The MAGIC observations at the expected time of arrival of the trailing component resulted in the first detection of QSO B0218+357 in Very-High-Energy (VHE, >100 GeV gamma rays. We report here the observed multiwavelength emission during the 2014 flare.
Neutron beam design for low intensity neutron and gamma-ray radioscopy using small neutron sources
Matsumoto, T
2003-01-01
Two small neutron sources of sup 2 sup 5 sup 2 Cf and sup 2 sup 4 sup 1 Am-Be radioisotopes were used for design of neutron beams applicable to low intensity neutron and gamma ray radioscopy (LINGR). In the design, Monte Carlo code (MCNP) was employed to generate neutron and gamma ray beams suited to LINGR. With a view to variable neutron spectrum and neutron intensity, various arrangements were first examined, and neutron-filter, gamma-ray shield and beam collimator were verified. Monte Carlo calculations indicated that with a suitable filter-shield-collimator arrangement, thermal neutron beam of 3,900 ncm sup - sup 2 s sup - sup 1 with neutron/gamma ratio of 7x10 sup 7 , and 25 ncm sup - sup 2 s sup - sup 1 with very large neutron/gamma ratio, respectively, could be produced by using sup 2 sup 5 sup 2 Cf(122 mu g) and a sup 2 sup 4 sup 1 Am-Be(37GBq)radioisotopes at the irradiation port of 35 cm from the neutron sources.
Baloković, M.; Madejski, G.; Furniss, A.; Chiang, J.; Ajello, M.; Alexander, D.M.; Barret, D.; Blandford, R.; Boggs, S.E.; Christensen, F.E.; Craig, W.W.; Forster, K.; Giommi, P.; Grefenstette, B.W.; Hailey, C.J.; Harrison, F.A.; Hornstrup, A.; Kitaguchi, T.; Koglin, J.E.; Madsen, K.K.; Mao, P.H.; Miyasaka, H.; Mori, K.; Perri, M.; Pivovaroff, M.J.; Puccetti, S.; Rana, V.; Stern, D.; Tagliaferri, G.; Urry, C.M.; Westergaard, N.J.; Zhang, W.W.; Zoglauer, A.; Archambault, S.; Archer, A.A.; Barnacka, A.; Benbow, W.; Bird, R.; Buckley, J.; Bugaev, V.; Cerruti, M.; Chen, X.; Ciupik, L.; Connolly, M.P.; Cui, W.; Dickinson, H.J.; Dumm, J.; Eisch, J.D.; Falcone, A.; Feng, Q.; Finley, J.P.; Fleischhack, H.; Fortson, L.; Griffin, S.; Griffiths, S.T.; Grube, J.; Gyuk, G.; Huetten, M.; Haakansson, N.; Holder, J.; Humensky, T.B.; Johnson, C.A.; Kaaret, P.; Kertzman, M.; Khassen, Y.; Kieda, D.; Krause, M.; Krennrich, F.; Lang, M.J.; Maier, G.; McArthur, S.; Meagher, K.; Moriarty, P.; Nelson, T.; Nieto, D.; Ong, R.A.; Park, N.; Pohl, M.; Popkow, A.; Pueschel, E.; Reynolds, P.T.; Richards, G.T.; Roache, E.; Santander, M.; Sembroski, G.H.; Shahinyan, K.; Smith, A.W.; Staszak, D.; Telezhinsky, I.; Todd, N.W.; Tucci, J.V.; Tyler, J.; Vincent, S.; Weinstein, A.; Wilhelm, A.; Williams, D.A.; Zitzer, B.; Ahnen, M.L.; Ansoldi, S.; Antonelli, L.A.; Antoranz, P.; Babic, A.; Banerjee, B.; Bangale, P.; Barres de Almeida, U.; Barrio, J.; Becerra González, J.; Bednarek, W.; Bernardini, E.; Biasuzzi, B.; Biland, A.; Blanch, O.; Bonnefoy, S.; Bonnoli, G.; Borracci, F.; Bretz, T.; Carmona, E.; Carosi, A.; Chatterjee, A.; Clavero, R.; Colin, P.; Colombo, E.; Contreras, J.L.; Cortina, J.; Covino, S.; Da Vela, P.; Dazzi, F.; de Angelis, A.; De Lotto, B.; Wilhelmi, E. D. de Oña; Delgado Mendez, C.; Di Pierro, F.; Dominis Prester, D.; Dorner, D.; Doro, M.; Einecke, S.; Elsaesser, D.; Fernández-Barral, A.; Fidalgo, D.; Fonseca, M.V.; Font, L.; Frantzen, K.; Fruck, C.; Galindo, D.; López, R. J. García; Garczarczyk, M.; Garrido Terrats, D.; Gaug, M.; Giammaria, P.; Eisenacher, D.; Godinović, N.; González Muñoz, A.; Guberman, D.; Hahn, A.; Hanabata, Y.; Hayashida, M.; Herrera, J.; Hose, J.; Hrupec, D.; Hughes, G.; Idec, W.; Kodani, K.; Konno, Y.; Kubo, H.; Kushida, J.; La Barbera, A.; Lelas, D.; Lindfors, E.; Lombardi, S.; Longo, F.; López, M.; López-Coto, R.; López-Oramas, A.; Lorenz, E.; Majumdar, P.; Makariev, M.; Mallot, K.; Maneva, G.; Manganaro, M.; Mannheim, K.; Maraschi, L.; Marcote, B.; Mariotti, M.; Martínez, M.; Mazin, D.; Menzel, U.; Miranda, J.M.; Mirzoyan, R.; Moralejo, A.; Moretti, E.; Nakajima, D.; Neustroev, V.; Niedzwiecki, A.; Nievas-Rosillo, M.; Nilsson, K.; Nishijima, K.; Noda, K.; Orito, R.; Overkemping, A.; Paiano, S.; Palacio, S.; Palatiello, M.; Paoletti, R.; Paredes, J.M.; Paredes-Fortuny, X.; Persic, M.; Poutanen, J.; Prada Moroni, P. G.; Prandini, E.; Puljak, I.; Rhode, W.; Ribó, M.; Rico, J.; Garcia, J. Rodriguez; Saito, T.; Satalecka, K.; Scapin, V.; Schultz, C.; Schweizer, T.; Shore, S.N.; Sillanpää, A.; Sitarek, J.; Snidaric, I.; Sobczynska, D.; Stamerra, A.; Steinbring, T.; Strzys, M.; Takalo, L.O.; Takami, H.; Tavecchio, F.; Temnikov, P.; Terzić, T.; Tescaro, D.; Teshima, M.; Thaele, J.; Torres, D.F.; Toyama, T.; Treves, A.; Verguilov, V.; Vovk, I.; Ward, J.E.; Will, M.; Wu, M.H.; Zanin, R.; Perkins, J.; Verrecchia, F.; Leto, C.; Böttcher, M.; Villata, M.; Raiteri, C.M.; Acosta-Pulido, J.A.; Bachev, R.; Berdyugin, A.; Blinov, D.A.; Carnerero, M.I.; Chen, W.P.; Chinchilla, P.; Damljanovic, G.; Eswaraiah, C.; Grishina, T.S.; Ibryamov, S.; Jordan, B.; Jorstad, S.G.; Joshi, M.; Kopatskaya, E.N.; Kurtanidze, O.M.; Kurtanidze, S.O.; Larionova, E.G.; Larionova, L.V.; Larionov, V.M.; Latev, G.; Lin, H.C.; Marscher, A.P.; Mokrushina, A.A.; Morozova, D.A.; Nikolashvili, M.G.; Semkov, E.; Strigachev, A.; Troitskaya, Yu. V.; Troitsky, I.S.; Vince, O.; Barnes, J.; Güver, T.; Moody, J.W.; Sadun, A.C.; Sun, S.; Hovatta, T.; Richards, J.L.; Max-Moerbeck, W.; Readhead, A.C.; Lähteenmäki, A.; Tornikoski, M.; Tammi, J.; Ramakrishnan, V.; Reinthal, R.; Angelakis, E.; Fuhrmann, L.; Myserlis, I.; Karamanavis, V.; Sievers, A.; Ungerechts, H.; Zensus, J.A.
2016-01-01
We present coordinated multiwavelength observations of the bright, nearby BL Lac object Mrk 421 taken in 2013 January-March, involving GASP-WEBT, Swift, NuSTAR, Fermi-LAT, MAGIC, VERITAS, and other collaborations and instruments, providing data from radio to very-high-energy (VHE) gamma-ray bands. NuSTAR yielded previously unattainable sensitivity in the 3-79 keV range, revealing that the spectrum softens when the source is dimmer until the X-ray spectral shape saturates into a steep power law with a photon index of approximately 3, with no evidence for an exponential cutoff or additional hard components up to about 80 keV. For the first time, we observed both the synchrotron and the inverse-Compton peaks of the spectral energy distribution (SED) simultaneously shifted to frequencies below the typical quiescent state by an order of magnitude. The fractional variability as a function of photon energy shows a double-bump structure which relates to the two bumps of the broadband SED. In each bump, the variabilit...
Prospects for Cherenkov Telescope Array Observations of the Young Supernova Remnant RX J1713.7−3946
Energy Technology Data Exchange (ETDEWEB)
Acero, F. [CEA/IRFU/SAp, CEA Saclay, Bat 709, Orme des Merisiers, F-91191 Gif-sur-Yvette (France); Aloisio, R.; Amato, E. [Osservatorio Astrofisico di Arcetri, Largo E. Fermi, 5, I-50125 Firenze (Italy); Amans, J. [LUTH and GEPI, Observatoire de Paris, CNRS, PSL Research University, 5 place Jules Janssen, F-92190, Meudon (France); Antonelli, L. A. [INAF—Osservatorio Astronomico di Roma, Via di Frascati 33, I-00040, Monteporzio Catone (Italy); Aramo, C. [INFN Sezione di Napoli, Via Cintia, ed. G, I-80126 Napoli (Italy); Armstrong, T. [Department of Physics and Centre for Advanced Instrumentation, Durham University, South Road, Durham DH1 3LE (United Kingdom); Arqueros, F.; Barrio, J. A. [Grupo de Altas Energías, Universidad Complutense de Madrid., Av Complutense s/n, E-28040 Madrid (Spain); Asano, K. [Institute for Cosmic Ray Research, University of Tokyo, 5-1-5, Kashi-wanoha, Kashiwa, Chiba 277-8582 (Japan); Ashley, M. [School of Physics, University of New South Wales, Sydney NSW 2052 (Australia); Backes, M. [University of Namibia, Department of Physics, 340 Mandume Ndemufayo Ave., Pioneerspark Windhoek (Namibia); Balazs, C. [School of Physics and Astronomy, Monash University, Melbourne, Victoria 3800 (Australia); Balzer, A. [Astronomical Institute Anton Pannekoek, University of Amsterdam, Science Park 904 1098 XH Amsterdam (Netherlands); Bamba, A. [Department of Physics, Graduate School of Science, University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-0033 (Japan); Barkov, M. [Riken, Institute of Physical and Chemical Research, 2-1 Hirosawa, Wako, Saitama, 351-0198 (Japan); Benbow, W. [Harvard-Smithsonian Center for Astrophysics, 60 Garden St., Cambridge, MA 02180 (United States); Bernlöhr, K., E-mail: sano@a.phys.nagoya-u.ac.jp, E-mail: nakamori@sci.kj.yamagata-u.ac.jp [Max-Planck-Institut für Kernphysik, Saupfercheckweg 1, D-69117 Heidelberg (Germany); and others
2017-05-10
We perform simulations for future Cherenkov Telescope Array (CTA) observations of RX J1713.7−3946, a young supernova remnant (SNR) and one of the brightest sources ever discovered in very high energy (VHE) gamma rays. Special attention is paid to exploring possible spatial (anti)correlations of gamma rays with emission at other wavelengths, in particular X-rays and CO/H i emission. We present a series of simulated images of RX J1713.7−3946 for CTA based on a set of observationally motivated models for the gamma-ray emission. In these models, VHE gamma rays produced by high-energy electrons are assumed to trace the nonthermal X-ray emission observed by XMM-Newton , whereas those originating from relativistic protons delineate the local gas distributions. The local atomic and molecular gas distributions are deduced by the NANTEN team from CO and H i observations. Our primary goal is to show how one can distinguish the emission mechanism(s) of the gamma rays (i.e., hadronic versus leptonic, or a mixture of the two) through information provided by their spatial distribution, spectra, and time variation. This work is the first attempt to quantitatively evaluate the capabilities of CTA to achieve various proposed scientific goals by observing this important cosmic particle accelerator.
Guidelines for the calibration of low energy photon sources at beta-ray brachytherapy sources
International Nuclear Information System (INIS)
2000-01-01
Kerma Rate. In this document the latter recommendation is adopted. Both of the quantities give the same numerical value for the source strength and differ only in the units they are expressed. The recommended dose calculation method is discussed further in the text. Sealed beta-ray sources for brachytherapy treatments have been in use for few decades already. An example is application of 90 Sr/ 90 Y planar sources for ophthalmic brachytherapy treatments. For these types of treatments, a precise dose distribution within the eye globe is needed. Modern diagnostic techniques permit the determination of all volumes of interest in the eye, i.e. tumor and critical structures such as optic disc and iris with a high precision. It is therefore of importance to optimize the treatment by limiting the dose to these critical structures. A relatively new and rapidly developing field in brachytherapy is the use of beta-ray sources for prevention of restenosis, i.e. re-closing of artery, following coronary and peripheral artery interventional procedures such as angioplasty, atherectomy and stent implantation. The dosimetry of beta-ray sources for therapeutic applications is particularly difficult due to the short distances involved, being at the millimeter range, and the high dose gradients at such short distances. Further difficulties are caused by the non-uniform distribution of activity in the source itself, causing a highly irregular dose distribution. The aim of this report is to recommend methods for calibration of low energy photon sources and beta-ray sources used in brachytherapy treatments and to propose suitable detectors for this purpose. Dose calculation methods are given both for the photon sources and beta-ray sources covered in this report. The present report has been developed in close collaboration with the ICRU Report Committee on this subject. The ICRU is planning to publish a report on the calibration of the type of sources discussed here. The present report is to
A CENSUS OF THE SUPERSOFT X-RAY SOURCES IN M31
International Nuclear Information System (INIS)
Orio, Marina; Nelson, Thomas; Bianchini, Antonio; Di Mille, Francesco; Harbeck, Daniel
2010-01-01
We examined X-ray, ultraviolet, and optical archival data of 89 supersoft X-ray sources (SSS) in M31. We studied the timescales of X-ray variability and searched UV and optical counterparts. Almost a third of the SSS are known classical or recurrent novae, and at least half of the others exhibit the same temporal behavior as post-outburst novae. Non-stellar objects among SSS seem to be rare: less than 10% of the classified SSS turned out to be supernova remnants, and only one source has been identified with an active galactic nucleus in the background. Not more than 20% of the SSS that are not coincident with observed novae are persistent or recurrent X-ray sources. A few of these long-lasting sources show characteristics in common with other SSS identified as white dwarf (WD) close binaries in the Magellanic Clouds and in the Galaxy, including variability on timescales of minutes, possibly indicating the spin period of a WD. Such objects are likely to be low-mass X-ray binaries with a massive WD. A third of the non-nova SSS are in regions of recent star formation, often at the position of an O or B star, and we suggest that they may be high-mass X-ray binaries. If these sources host a massive hydrogen-burning WD, as it seems likely, they may become Type Ia supernovae (SNe Ia), constituting the star formation dependent component of the SNe Ia rate.
Comparison of X-ray source concepts for radiographic purposes at OMEGA
International Nuclear Information System (INIS)
Jacquet, L.; Primout, M.; Villette, B.; Girard, F.; Oudot, G.
2013-01-01
As multi-keV X-ray sources, seven targets including thick and thin foils, metal-lined halfraums and a foil combined with a plastic cylinder, have been shot on Omega in September 2011. Titanium was used as X-ray emitting material for all the sources. Using experimental data and FCI 2 simulation results, we have, for each source type, characterized the emission lobes and determined the spatial directions of maximum multi-keV energy. These results demonstrate the benefit of using a laser drive with a prepulse for both thick and thin foils. The favorable effect of a confinement cylinder for the X-ray emitted from front side by a thin foil has also been experimentally found but is not yet confirmed by the simulations. The temporal waveforms of the X-ray power obtained from the different sources as well as the emission spots at the times of maximum emission are also compared. (authors)
Simulation of single grid-based phase-contrast x-ray imaging (g-PCXI)
Energy Technology Data Exchange (ETDEWEB)
Lim, H.W.; Lee, H.W. [Department of Radiation Convergence Engineering, iTOMO Group, Yonsei University, 1 Yonseidae-gil, Wonju, Gangwon-do 26493 (Korea, Republic of); Cho, H.S., E-mail: hscho1@yonsei.ac.kr [Department of Radiation Convergence Engineering, iTOMO Group, Yonsei University, 1 Yonseidae-gil, Wonju, Gangwon-do 26493 (Korea, Republic of); Je, U.K.; Park, C.K.; Kim, K.S.; Kim, G.A.; Park, S.Y.; Lee, D.Y.; Park, Y.O.; Woo, T.H. [Department of Radiation Convergence Engineering, iTOMO Group, Yonsei University, 1 Yonseidae-gil, Wonju, Gangwon-do 26493 (Korea, Republic of); Lee, S.H.; Chung, W.H.; Kim, J.W.; Kim, J.G. [R& D Center, JPI Healthcare Co., Ltd., Ansan 425-833 (Korea, Republic of)
2017-04-01
Single grid-based phase-contrast x-ray imaging (g-PCXI) technique, which was recently proposed by Wen et al. to retrieve absorption, scattering, and phase-gradient images from the raw image of the examined object, seems a practical method for phase-contrast imaging with great simplicity and minimal requirements on the setup alignment. In this work, we developed a useful simulation platform for g-PCXI and performed a simulation to demonstrate its viability. We also established a table-top setup for g-PCXI which consists of a focused-linear grid (200-lines/in strip density), an x-ray tube (100-μm focal spot size), and a flat-panel detector (48-μm pixel size) and performed a preliminary experiment with some samples to show the performance of the simulation platform. We successfully obtained phase-contrast x-ray images of much enhanced contrast from both the simulation and experiment and the simulated contract seemed similar to the experimental contrast, which shows the performance of the developed simulation platform. We expect that the simulation platform will be useful for designing an optimal g-PCXI system. - Highlights: • It is proposed for the single grid-based phase-contrast x-ray imaging (g-PCXI) technique. • We implemented for a numerical simulation code. • The preliminary experiment with several samples to compare is performed. • It is expected to be useful to design an optimal g-PCXI system.
Uncovering extreme AGN variability in serendipitous X-ray source surveys
Moran, Edward C.; Garcia Soto, Aylin; LaMassa, Stephanie; Urry, Meg
2018-01-01
Constraints on the duty cycle and duration of accretion episodes in active galactic nuclei (AGNs) are vital for establishing how most AGNs are fueled, which is essential for a complete picture of black hole/galaxy co-evolution. Perhaps the best handle we have on these activity parameters is provided by AGNs that have displayed dramatic changes in their bolometric luminosities and, in some cases, spectroscopic classifications. Given that X-ray emission is directly linked to black-hole accretion, X-ray surveys should provide a straightforward means of identifying AGNs that have undergone dramatic changes in their accretion states. However, it appears that such events are very rare, so wide-area surveys separated in time by many years are needed to maximize discovery rates. We have cross-correlated the Einstein IPC Two-Sigma Catalog with the ROSAT All-Sky Survey Faint Source Catalog to identify a sample of soft X-ray sources that varied by factors ranging from 7 to more than 100 over a ten year timescale. When possible, we have constructed long-term X-ray light curves for the sources by combining the Einstein and RASS fluxes with those obtained from serendipitous pointed observations by ROSAT, Chandra,XMM, and Swift. Optical follow-up observations indicate that many of the extremely variable sources in our sample are indeed radio-quiet AGNs. Interestingly, the majority of objects that dimmed between ~1980 and ~1990 are still (or are again) broad-line AGNs rather than“changing-look” candidates that have more subtle AGN signatures in their spectra — despite the fact that none of the sources examined thus far has returned to its highest observed luminosity. Future X-ray observations will provide the opportunity to characterize the X-ray behavior of these anonymous, extreme AGNs over a four decade span.
An ultrasoft X-ray source in Coma Berenices
International Nuclear Information System (INIS)
Margon, B.; Malina, R.; Bowyer, S.; Cruddace, R.; Lampton, M.
1976-01-01
We have observed an intense soft X-ray source with an extraordinary spectrum in Coma Berenices, 4 0 northeast of and unassociated with the Coma cluster of galaxies. Two spectra, obtained at different times in a sounding rocket flight, indicate that the source temperature in thermal models is less than 10 6 K; a power-law model requires photon power-law indices steeper than n=-3. The intensity in the 44--165 A band is of the order of 5x10 -10 ergs cm -2 s -1 , but no flux is present at energies 0.3--2.1 keV to a limit of 1x10 -10 ergs cm -2 s -1 . The lack of bright stars or a supernova remnant in the error box implies that this may be a new class of soft X-ray sources
Hard X-ray Sources for the Mexican Synchrotron Project
International Nuclear Information System (INIS)
Reyes-Herrera, Juan
2016-01-01
One of the principal tasks for the design of the Mexican synchrotron was to define the storage ring energy. The main criteria for choosing the energy come from studying the electromagnetic spectrum that can be obtained from the synchrotron, because the energy range of the spectrum that can be obtained will determine the applications available to the users of the future light source. Since there is a public demand of hard X-rays for the experiments in the synchrotron community users from Mexico, in this work we studied the emission spectra from some hard X-ray sources which could be the best options for the parameters of the present Mexican synchrotron design. The calculations of the flux and the brightness for one Bending Magnet and four Insertion Devices are presented; specifically, for a Superconducting Bending Magnet (SBM), a Superconducting Wiggler (SCW), an In Vacuum Short Period Undulator (IV-SPU), a Superconducting Undulator (SCU) and for a Cryogenic Permanent Magnet Undulator (CPMU). Two commonly available synchrotron radiation programs were used for the computation (XOP and SRW). From the results, it can be concluded that the particle beam energy from the current design is enough to have one or more sources of hard X-rays. Furthermore, a wide range of hard X-ray region can be covered by the analyzed sources, and the choice of each type should be based on the specific characteristics of the X-ray beam to perform the experiments at the involved beamline. This work was done within the project Fomix Conacyt-Morelos ”Plan Estrategico para la construccion y operación de un Sincrotron en Morelos” (224392). (paper)
Hard X-ray Sources for the Mexican Synchrotron Project
Reyes-Herrera, Juan
2016-10-01
One of the principal tasks for the design of the Mexican synchrotron was to define the storage ring energy. The main criteria for choosing the energy come from studying the electromagnetic spectrum that can be obtained from the synchrotron, because the energy range of the spectrum that can be obtained will determine the applications available to the users of the future light source. Since there is a public demand of hard X-rays for the experiments in the synchrotron community users from Mexico, in this work we studied the emission spectra from some hard X-ray sources which could be the best options for the parameters of the present Mexican synchrotron design. The calculations of the flux and the brightness for one Bending Magnet and four Insertion Devices are presented; specifically, for a Superconducting Bending Magnet (SBM), a Superconducting Wiggler (SCW), an In Vacuum Short Period Undulator (IV-SPU), a Superconducting Undulator (SCU) and for a Cryogenic Permanent Magnet Undulator (CPMU). Two commonly available synchrotron radiation programs were used for the computation (XOP and SRW). From the results, it can be concluded that the particle beam energy from the current design is enough to have one or more sources of hard X-rays. Furthermore, a wide range of hard X-ray region can be covered by the analyzed sources, and the choice of each type should be based on the specific characteristics of the X-ray beam to perform the experiments at the involved beamline. This work was done within the project Fomix Conacyt-Morelos ”Plan Estrategico para la construccion y operación de un Sincrotron en Morelos” (224392).
Supernova Remnants as the Sources of Galactic Cosmic Rays
Vink, J.
2013-01-01
The origin of cosmic rays holds still manymysteries hundred years after they were first discovered. Supernova remnants have for long been the most likely sources of Galactic cosmic rays. I discuss here some recent evidence that suggests that supernova remnants can indeed efficiently accelerate
Development and characterization of a laser-based hard x-ray source
International Nuclear Information System (INIS)
Tillman, C.
1996-11-01
A laser-produced plasma was generated by focusing 100 fs laser pulses, with an energy of 150 mJ, onto metal targets. The laser intensity was expected to reach 10 17 W/cm -2 . Radiation was emitted from the created plasma, with photon energies up to the MeV region. The laser-based X-ray source was optimized, with the purpose of making it a realistic source of hard X-rays (>10 keV). Dedicated equipment was developed for efficient generation and utilization of the hard X-rays. The X-ray source was characterized with respect to its spatial extent and the X-ray yield. Measurements were made of the spectral distribution, by the use of single-photon-counting detectors in different geometries, crystal spectrometers and dose measurements in combination with absorption filters. Ablation of the target material in the laser produced plasma was investigated. Imaging applications have been demonstrated, including ultrafast (picosecond) X-ray imaging, magnification imaging of up to x80, differential imaging in the spectral domain, and imaging of various biological and technical objects. The biological response of ultra-intense X-ray pulses was assessed in cell-culture exposures. The results indicate that the biological response from ultra-intense X-ray exposures is similar to the response with conventional X-ray tubes. 82 refs., 14 figs
Development and characterization of a laser-based hard x-ray source
Energy Technology Data Exchange (ETDEWEB)
Tillman, C.
1996-11-01
A laser-produced plasma was generated by focusing 100 fs laser pulses, with an energy of 150 mJ, onto metal targets. The laser intensity was expected to reach 10{sup 17} W/cm{sup -2}. Radiation was emitted from the created plasma, with photon energies up to the MeV region. The laser-based X-ray source was optimized, with the purpose of making it a realistic source of hard X-rays (>10 keV). Dedicated equipment was developed for efficient generation and utilization of the hard X-rays. The X-ray source was characterized with respect to its spatial extent and the X-ray yield. Measurements were made of the spectral distribution, by the use of single-photon-counting detectors in different geometries, crystal spectrometers and dose measurements in combination with absorption filters. Ablation of the target material in the laser produced plasma was investigated. Imaging applications have been demonstrated, including ultrafast (picosecond) X-ray imaging, magnification imaging of up to x80, differential imaging in the spectral domain, and imaging of various biological and technical objects. The biological response of ultra-intense X-ray pulses was assessed in cell-culture exposures. The results indicate that the biological response from ultra-intense X-ray exposures is similar to the response with conventional X-ray tubes. 82 refs., 14 figs.
Precision linac and laser technologies for nuclear photonics gamma-ray sources
Energy Technology Data Exchange (ETDEWEB)
Albert, F.; Hartemann, F. V.; Anderson, S. G.; Cross, R. R.; Gibson, D. J.; Hall, J.; Marsh, R. A.; Messerly, M.; Wu, S. S.; Siders, C. W.; Barty, C. P. J. [Lawrence Livermore National Laboratory, NIF and Photon Science, 7000 East Avenue, Livermore, California 94550 (United States)
2012-05-15
Tunable, high precision gamma-ray sources are under development to enable nuclear photonics, an emerging field of research. This paper focuses on the technological and theoretical challenges related to precision Compton scattering gamma-ray sources. In this scheme, incident laser photons are scattered and Doppler upshifted by a high brightness electron beam to generate tunable and highly collimated gamma-ray pulses. The electron and laser beam parameters can be optimized to achieve the spectral brightness and narrow bandwidth required by nuclear photonics applications. A description of the design of the next generation precision gamma-ray source currently under construction at Lawrence Livermore National Laboratory is presented, along with the underlying motivations. Within this context, high-gradient X-band technology, used in conjunction with fiber-based photocathode drive laser and diode pumped solid-state interaction laser technologies, will be shown to offer optimal performance for high gamma-ray spectral flux, narrow bandwidth applications.
OSO-7 observations of high galactic latitude x-ray sources
International Nuclear Information System (INIS)
Markert, T.H.; Canizares, C.R.; Clark, G.W.; Li, F.K.; Northridge, P.L.; Sprott, G.F.; Wargo, G.F.
1976-01-01
Six hundred days of observations by the MIT X-ray detectors aboard OSO-7 have been analyzed. All-sky maps of X-ray intensity have been constructed from these data. A sample map is displayed. Seven sources with galactic latitude vertical-barb/subi//subi/vertical-bar>10degree, discovered during the mapping process, are reported, and upper limits are set on other high-latitude sources. The OSO-7 results are compared with those of Uhuru and an implication of this comparison, that many of the high-latitude sources may be variable, is discussed
Radio measurements in the fields of gamma-ray sources. Pt. 1
International Nuclear Information System (INIS)
Sieber, W.; Schlickeiser, R.
1982-01-01
The γ-ray source CG 195+04 has been searched for radio counterparts at wavelengths between 2.8 cm and 18 cm with the 100-m telescope of the Max-Planck-Institut fuer Radioastronomie, Bonn. We have detected a number of sources and measured their spectra. Our positions may form the basis for future surveys in other frequency ranges. Different physical emission models suggest compactness of the γ-ray source. (orig.)
Sixth symposium on x- and gamma ray sources and applications. Abstracts
International Nuclear Information System (INIS)
1985-01-01
Abstracts are provided for technical presentations in the areas of: gamma and x-ray sources, kinds of detectors, characterization of detectors and detector systems, models and data analysis, gamma spectroscopy, instrumentation, x-ray fluorescence, tomography, x-ray absorption, and pion induced x-ray emission
Assembling x-ray sources by carbon nanotubes
Sessa, V.; Lucci, M.; Toschi, F.; Orlanducci, S.; Tamburri, E.; Terranova, M. L.; Ciorba, A.; Rossi, M.; Hampai, D.; Cappuccio, G.
2007-05-01
By the use of a chemical vapour deposition technique a series of metal wires (W, Ta, Steel ) with differently shaped tips have been coated by arrays of single wall carbon nanotubes (SWNT). The field emission properties of the SWNT deposits have been measured by a home made apparatus working in medium vacuum (10 -6- 10 -7 mbar) and the SWNT-coated wires have been used to fabricate tiny electron sources for X-ray tubes. To check the efficiency of the nanotube coated wires for X-ray generation has, a prototype X-ray tube has been designed and fabricated. The X-ray tube works at pressures about 10 -6 mbar. The target ( Al film) is disposed on a hole in the stainless steel sheath: this configuration makes unnecessary the usual Be window and moreover allows us to use low accelerating potentials (< 6 kV).
Production of hollow atoms by high brightness x-ray sources and its applications
International Nuclear Information System (INIS)
Moribayashi, Kengo
2004-01-01
We study x-ray emissions from the (multi-)inner-shell states and hollow atoms of Si ions excited by high intensity x-ray sources. It is found that the x-ray number from multi-inner-shell excited states (1s 2 2s 2 2p k 3s 2 3p 2 , k=1-4) and hollow atoms (1s 2 2s 2 3p 2 ) is affected greatly by the high intensity short-pulse x-rays and little by weak intensity post-long pulse x-rays. The ratio of the x-ray intensities from hollow atoms to those from the multi-inner-shell excited states becomes almost independent of the pulses and dependent on the intensities of x-ray sources. This ratio may be used for the measurement of intensities of high intensity short pulse x-ray sources. (author)
THE 2012 FLARE OF PG 1553+113 SEEN WITH H.E.S.S. AND FERMI-LAT
Energy Technology Data Exchange (ETDEWEB)
Abramowski, A. [Universität Hamburg, Institut für Experimentalphysik, Luruper Chaussee 149, D-22761 Hamburg (Germany); Aharonian, F.; Benkhali, F. Ait [Max-Planck-Institut für Kernphysik, P.O. Box 103980, D-69029 Heidelberg (Germany); Akhperjanian, A. G. [National Academy of Sciences of the Republic of Armenia, Marshall Baghramian Avenue, 24, 0019 Yerevan, Republic of Armenia (Armenia); Angüner, E. O. [Institut für Physik, Humboldt-Universität zu Berlin, Newtonstr. 15, D-12489 Berlin (Germany); Backes, M. [University of Namibia, Department of Physics, Private Bag 13301, Windhoek (Namibia); Balenderan, S. [University of Durham, Department of Physics, South Road, Durham DH1 3LE (United Kingdom); Balzer, A. [GRAPPA, Anton Pannekoek Institute for Astronomy, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Barnacka, A. [Obserwatorium Astronomiczne, Uniwersytet Jagielloński, ul. Orla 171, 30-244 Kraków (Poland); Becherini, Y. [Department of Physics and Electrical Engineering, Linnaeus University, SE-351 95 Växjö (Sweden); Tjus, J. Becker [Institut für Theoretische Physik, Lehrstuhl IV: Weltraum und Astrophysik, Ruhr-Universität Bochum, D-44780 Bochum (Germany); Berge, D. [GRAPPA, Anton Pannekoek Institute for Astronomy and Institute of High-Energy Physics, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Bernhard, S. [Institut für Astro- und Teilchenphysik, Leopold-Franzens-Universität Innsbruck, A-6020 Innsbruck (Austria); Collaboration: Collaboration; and others
2015-03-20
Very high energy (VHE, E > 100 GeV) γ-ray flaring activity of the high-frequency peaked BL Lac object PG 1553+113 has been detected by the H.E.S.S. telescopes. The flux of the source increased by a factor of 3 during the nights of 2012 April 26 and 27 with respect to the archival measurements with a hint of intra-night variability. No counterpart of this event has been detected in the Fermi-Large Area Telescope data. This pattern is consistent with VHE γ-ray flaring being caused by the injection of ultrarelativistic particles, emitting γ-rays at the highest energies. The dataset offers a unique opportunity to constrain the redshift of this source at z = 0.49 ± 0.04 using a novel method based on Bayesian statistics. The indication of intra-night variability is used to introduce a novel method to probe for a possible Lorentz invariance violation (LIV), and to set limits on the energy scale at which Quantum Gravity (QG) effects causing LIV may arise. For the subluminal case, the derived limits are E{sub QG,1} > 4.10 × 10{sup 17} GeV and E{sub QG,2} > 2.10 × 10{sup 10} GeV for linear and quadratic LIV effects, respectively.
THE 2012 FLARE OF PG 1553+113 SEEN WITH H.E.S.S. AND FERMI-LAT
International Nuclear Information System (INIS)
Abramowski, A.; Aharonian, F.; Benkhali, F. Ait; Akhperjanian, A. G.; Angüner, E. O.; Backes, M.; Balenderan, S.; Balzer, A.; Barnacka, A.; Becherini, Y.; Tjus, J. Becker; Berge, D.; Bernhard, S.
2015-01-01
Very high energy (VHE, E > 100 GeV) γ-ray flaring activity of the high-frequency peaked BL Lac object PG 1553+113 has been detected by the H.E.S.S. telescopes. The flux of the source increased by a factor of 3 during the nights of 2012 April 26 and 27 with respect to the archival measurements with a hint of intra-night variability. No counterpart of this event has been detected in the Fermi-Large Area Telescope data. This pattern is consistent with VHE γ-ray flaring being caused by the injection of ultrarelativistic particles, emitting γ-rays at the highest energies. The dataset offers a unique opportunity to constrain the redshift of this source at z = 0.49 ± 0.04 using a novel method based on Bayesian statistics. The indication of intra-night variability is used to introduce a novel method to probe for a possible Lorentz invariance violation (LIV), and to set limits on the energy scale at which Quantum Gravity (QG) effects causing LIV may arise. For the subluminal case, the derived limits are E QG,1 > 4.10 × 10 17 GeV and E QG,2 > 2.10 × 10 10 GeV for linear and quadratic LIV effects, respectively
Table-top laser-driven ultrashort electron and X-ray source: the CIBER-X source project
Energy Technology Data Exchange (ETDEWEB)
Girardeau-Montaut, J.-P. E-mail: jean-pierre.girardeau@univ-lyonl.fr; Kiraly, Bela; Girardeau-Montaut, Claire; Leboutet, Hubert
2000-09-21
We report on the development of a new laser-driven table-top ultrashort electron and X-ray source, also called the CIBER-X source . X-ray pulses are produced by a three-step process which consists of the photoelectron emission from a thin metallic photocathode illuminated by 16 ps duration laser pulses at 213 nm. The e-gun is a standard Pierce diode electrode type, in which electrons are accelerated by a cw electric field of {approx}11 MV/m up to a hole made in the anode. The photoinjector produces a train of 70-80 keV electron pulses of {approx}0.5 nC and 20 A peak current at a repetition rate of 10 Hz. The electrons are then transported outside the diode along a path of 20 cm length, and are focused onto a target of thulium by magnetic fields produced by two electromagnetic coils. X-rays are then produced by the impact of electrons on the target. Simulations of geometrical, electromagnetic fields and energetic characteristics of the complete source were performed previously with the assistance of the code PIXEL1 also developed at the laboratory. Finally, experimental electron and X-ray performances of the CIBER-X source as well as its application to very low dose imagery are presented and discussed.
Armas Padilla, M.
2013-01-01
The discovery of the first X-ray binary, Scorpius X-1, by Giacconi et al. (1962), marked the birth of X-ray astronomy. Following that discovery, many additional X-ray sources where found with the first generation of X-ray rockets and observatories (e.g., UHURU and Einstein). The short-timescale
van den Berg, M.; Verbunt, F.
2001-03-01
Optical spectra show that two proposed counterparts for X-ray sources detected near 1E 2259+58.6 are late G stars, and a proposed counterpart for a source near 4U 0142+61 is a dMe star. The X-ray luminosities are as expected for such stars. We thus confirm the optical identification of the three X-ray objects, and thereby the correctness of the accurate positions for 1E 2259+58.6 and 4U 0142+61 based on them. Based on observations made with the William Herschel Telescope operated on the island of La Palma by the Isaac Newton Group in the Spanish Observatorio del Roque de los Muchachos of the Instituto de Astrofisica de Canarias.
Use of β-ray source for measurement of adsorption
International Nuclear Information System (INIS)
Kawakami, Hirokane; Nishimura, Keigo; Oshima, Takayoshi
1987-01-01
A research project has been carried out with the goal of determining the mass of a neutrino from β-decay measurements. During a study seeking the development of a β-ray source for this purpose, it was found that the amount of residual gas adsorbed on a cooled β-ray source can be measured successfully. Electrons emitted from a β-ray source is measured by an electron spectrometer. A sharp, nearly symmetric peak is obtained if all electrons have the same energy. If gas is adsorbed on the surface of the source, on the other hand, the resultant spectrum has a rather different profile due to energy loss caused by the gas. The difference between the energy loss spectrum and the original spectrum must be proportional to the amount of the adsorbed gas. In this study, a 109 Cd source with an electron energy peak at 18 keV is selected and the number of molecules adsorbed on the source, cooled to -35 deg C at 5 x 10 -7 Torr, is determined. Assuming that the gas is water vapor, it is shown that the adsorbed layer is of a two-molecular thickness on the average. It is also found that the thickness is reversible at varrying temperatures and does not change for two days. This gas amount is 7,500 time as large as that in the case of physical adsorption of water. (Nogami, K.)
Radio Observations of Ultra-Luminous X-Ray Sources and their Implication for Models
Koerding, E. G.; Colbert, E. J. M.; Falcke, H.
2004-05-01
We present the results of a radio monitoring campaign to search for radio emission from nearby ultra-luminous X-ray sources (ULXs). These intriguing sources are bright off-nuclear X-ray point sources with luminosities exceeding LX > 1039 erg/sec. Assuming isotropic emission the Eddington Limit suggests that they harbor intermediate mass black holes. Due to the problems of this explanation also other possibilities are currently discussed, among them are anisotropic emission, super-Eddington accretion flows or relativistically beamed emission from microquasars. Detections of compact radio cores at the positions of ULXs would be a direct hint to jet-emission. However, as the ULX phenomenom is connected to star formation we have to assume that they are strongly accreting objects. Thus, similar to their nearest Galactic cousins, the very high state X-ray binaries (see e.g., GRS 1915), ULXs may show radio flares. A well-defined sample of the 9 nearest ULXs has been monitored eight times during 5 months with the Very Large Array in A and B configuration. Our limiting sensitivity is 0.15 mJy (4 σ ) for flares and 68 μ Jy for continuous emission. In M82 some ULXs seem to be connected to radio supernova remnants. Besides that no flare or continuous emission has been detected. As the timescales of radio flares in ULXs are highly uncertain, it could well be that we have undersampled the lightcurve. However, upper bounds for the probability to detect a flare can be given. The upper limits for the continuous emission are compared with the emission found in NGC 5408 X-1 and with quasars and microquasars. We show that these limits are well in agreement with the microblazar model using the Radio/X-ray correlation of XRBs and AGN. Thus, it could well be that ULXs are microblazers which may be radio loud.
Shielded radiography with a laser-driven MeV-energy X-ray source
Energy Technology Data Exchange (ETDEWEB)
Chen, Shouyuan; Golovin, Grigory [Department of Physics and Astronomy, University of Nebraska-Lincoln, Lincoln, NE 68588 (United States); Miller, Cameron [Department of Nuclear Engineering and Radiological Sciences, University of Michigan, Ann Arbor, MI 48109 (United States); Haden, Daniel; Banerjee, Sudeep; Zhang, Ping; Liu, Cheng; Zhang, Jun; Zhao, Baozhen [Department of Physics and Astronomy, University of Nebraska-Lincoln, Lincoln, NE 68588 (United States); Clarke, Shaun; Pozzi, Sara [Department of Nuclear Engineering and Radiological Sciences, University of Michigan, Ann Arbor, MI 48109 (United States); Umstadter, Donald, E-mail: donald.umstadter@unl.edu [Department of Physics and Astronomy, University of Nebraska-Lincoln, Lincoln, NE 68588 (United States)
2016-01-01
We report the results of experimental and numerical-simulation studies of shielded radiography using narrowband MeV-energy X-rays from a compact all-laser-driven inverse-Compton-scattering X-ray light source. This recently developed X-ray light source is based on a laser-wakefield accelerator with ultra-high-field gradient (GeV/cm). We demonstrate experimentally high-quality radiographic imaging (image contrast of 0.4 and signal-to-noise ratio of 2:1) of a target composed of 8-mm thick depleted uranium shielded by 80-mm thick steel, using a 6-MeV X-ray beam with a spread of 45% (FWHM) and 10{sup 7} photons in a single shot. The corresponding dose of the X-ray pulse measured in front of the target is ∼100 nGy/pulse. Simulations performed using the Monte-Carlo code MCNPX accurately reproduce the experimental results. These simulations also demonstrate that the narrow bandwidth of the Compton X-ray source operating at 6 and 9 MeV leads to a reduction of deposited dose as compared to broadband bremsstrahlung sources with the same end-point energy. The X-ray beam’s inherently low-divergence angle (∼mrad) is advantageous and effective for interrogation at standoff distance. These results demonstrate significant benefits of all-laser driven Compton X-rays for shielded radiography.
A JEM-X catalog of X-ray sources
DEFF Research Database (Denmark)
Westergaard, Niels Jørgen Stenfeldt; Chenevez, Jerome; Lund, Niels
2007-01-01
The JEM-X catalog of X-ray sources presented here is based on detections in individual science windows with a sensitivity limit of about 10 mCrab (5-15 keV). It contains 127 sources and only those that can be identified from the existing reference catalog. The input data are taken from the, up...
[Experimental investigation of laser plasma soft X-ray source with gas target].
Ni, Qi-liang; Gong, Yan; Lin, Jing-quan; Chen, Bo; Cao, Jian-lin
2003-02-01
This paper describes a debris-free laser plasma soft X-ray source with a gas target, which has high operating frequency and can produce strong soft X-ray radiation. The valve of this light source is drived by a piezoelectrical ceramic whose operating frequency is up to 400 Hz. In comparison with laser plasma soft X-ray sources using metal target, the light source is debris-free. And it has higher operating frequency than gas target soft X-ray sources whose nozzle is controlled by a solenoid valve. A channel electron multiplier (CEM) operating in analog mode is used to detect the soft X-ray generated by the laser plasma source, and the CEM's output is fed to to a charge-sensitive preamplifier for further amplification purpose. Output charges from the CEM are proportional to the amplitude of the preamplifier's output voltage. Spectra of CO2, Xe and Kr at 8-14 nm wavelength which can be used for soft X-ray projection lithography are measured. The spectrum for CO2 consists of separate spectral lines originate mainly from the transitions in Li-like and Be-like ions. The Xe spectrum originating mainly from 4d-5f, 4d-4f, 4d-6p and 4d-5p transitions in multiply charged xenon ions. The spectrum for Kr consists of separate spectral lines and continuous broad spectra originating mainly from the transitions in Cu-, Ni-, Co- and Fe-like ions.
Multi-keV X-ray area source intensity at SGII laser facility
Wang, Rui-rong; An, Hong-hai; Xie, Zhi-yong; Wang, Wei
2018-05-01
Experiments for investigating the feasibility of multi-keV backlighters for several different metallic foil targets were performed at the Shenguang II (SGII) laser facility in China. Emission spectra in the energy range of 1.65-7.0 keV were measured with an elliptically bent crystal spectrometer, and the X-ray source size was measured with a pinhole camera. The X-ray intensity near 4.75 keV and the X-ray source size for titanium targets at different laser intensity irradiances were studied. By adjusting the total laser energy at a fixed focal spot size, laser intensity in the range of 1.5-5.0 × 1015 W/cm2, was achieved. The results show that the line emission intensity near 4.75 keV and the X-ray source size are dependent on the laser intensity and increase as the laser intensity increases. However, an observed "peak" in the X-ray intensity near 4.75 keV occurs at an irradiance of 4.0 × 1015 W/cm2. For the employed experimental conditions, it was confirmed that the laser intensity could play a significant role in the development of an efficient multi-keV X-ray source. The experimental results for titanium indicate that the production of a large (˜350 μm in diameter) intense backlighter source of multi-keV X-rays is feasible at the SGII facility.
Energy Technology Data Exchange (ETDEWEB)
Loisel, G., E-mail: gploise@sandia.gov; Lake, P.; Gard, P.; Dunham, G.; Nielsen-Weber, L.; Wu, M. [Sandia National Laboratories, Albuquerque, New Mexico 87185 (United States); Norris, E. [Missouri University of Science and Technology, Rolla, Missouri 65409 (United States)
2016-11-15
At Sandia National Laboratories, the x-ray generator Manson source model 5 was upgraded from 10 to 25 kV. The purpose of the upgrade is to drive higher characteristics photon energies with higher throughput. In this work we present characterization studies for the source size and the x-ray intensity when varying the source voltage for a series of K-, L-, and M-shell lines emitted from Al, Y, and Au elements composing the anode. We used a 2-pinhole camera to measure the source size and an energy dispersive detector to monitor the spectral content and intensity of the x-ray source. As the voltage increases, the source size is significantly reduced and line intensity is increased for the three materials. We can take advantage of the smaller source size and higher source throughput to effectively calibrate the suite of Z Pulsed Power Facility crystal spectrometers.
Loisel, G; Lake, P; Gard, P; Dunham, G; Nielsen-Weber, L; Wu, M; Norris, E
2016-11-01
At Sandia National Laboratories, the x-ray generator Manson source model 5 was upgraded from 10 to 25 kV. The purpose of the upgrade is to drive higher characteristics photon energies with higher throughput. In this work we present characterization studies for the source size and the x-ray intensity when varying the source voltage for a series of K-, L-, and M-shell lines emitted from Al, Y, and Au elements composing the anode. We used a 2-pinhole camera to measure the source size and an energy dispersive detector to monitor the spectral content and intensity of the x-ray source. As the voltage increases, the source size is significantly reduced and line intensity is increased for the three materials. We can take advantage of the smaller source size and higher source throughput to effectively calibrate the suite of Z Pulsed Power Facility crystal spectrometers.
Apparatus with a cooled X-ray source and a high voltage generator
Energy Technology Data Exchange (ETDEWEB)
1977-02-01
Apparatus, especially for a dental application, with an X-ray source and a high voltage generator, whereby the X-ray source and a high voltage generator are contained in a housing, which is filled with a coolant medium, characterised by the housing being divided into two chambers, whereby the X-ray source is in the first chamber and the high voltage generator is in the second chamber and between the chambers a dividing wall is placed for the screening of the X-ray irradiation from the first chamber from the second, whereby at least one of the walls of the second chamber is elastic to accommodate the expansion of the coolant medium.
Identification of Hard X-ray Sources in Galactic Globular Clusters: Simbol-X Simulations
Servillat, M.
2009-05-01
Globular clusters harbour an excess of X-ray sources compared to the number of X-ray sources in the Galactic plane. It has been proposed that many of these X-ray sources are cataclysmic variables that have an intermediate magnetic field, i.e. intermediate polars, which remains to be confirmed and understood. We present here several methods to identify intermediate polars in globular clusters from multiwavelength analysis. First, we report on XMM-Newton, Chandra and HST observations of the very dense Galactic globular cluster NGC 2808. By comparing UV and X-ray properties of the cataclysmic variable candidates, the fraction of intermediate polars in this cluster can be estimated. We also present the optical spectra of two cataclysmic variables in the globular cluster M 22. The HeII (4868 Å) emission line in these spectra could be related to the presence of a magnetic field in these objects. Simulations of Simbol-X observations indicate that the angular resolution is sufficient to study X-ray sources in the core of close, less dense globular clusters, such as M 22. The sensitivity of Simbol-X in an extended energy band up to 80 keV will allow us to discriminate between hard X-ray sources (such as magnetic cataclysmic variables) and soft X-ray sources (such as chromospherically active binaries).
Time-resolved materials science opportunities using synchrotron x-ray sources
International Nuclear Information System (INIS)
Larson, B.C.; Tischler, J.Z.
1995-06-01
The high brightness, high intensity, and pulsed time-structure of synchrotron sources provide new opportunities for time-resolved x-ray diffraction investigations. With third generation synchrotron sources coming on line, high brilliance and high brightness are now available in x-ray beams with the highest flux. In addition to the high average flux, the instantaneous flux available in synchrotron beams is greatly enhanced by the pulsed time structure, which consists of short bursts of x-rays that are separated by ∼tens to hundreds of nanoseconds. Time-resolved one- and two-dimensional position sensitive detection techniques that take advantage of synchrotron radiation for materials science x-ray diffraction investigations are presented, and time resolved materials science applications are discussed in terms of recent diffraction and spectroscopy results and materials research opportunities
Energy Technology Data Exchange (ETDEWEB)
Acciari, V.A.; /Harvard-Smithsonian Ctr. Astrophys.; Aliu, E.; /Delaware U., Bartol Inst.; Arlen, T.; /UCLA; Aune, T.; /UC, Santa Cruz; Bautista, M.; /McGill U.; Beilicke, M. /Washington U., St. Louis; Benbow, W.; /Harvard-Smithsonian Ctr. Astrophys.; Bottcher, M.; /Ohio U.; Boltuch, D.; /Delaware U., Bartol Inst.; Bradbury, S.M.; /Leeds U.; Buckley, J.H.; /Washington U., St. Louis; Bugaev, V.; /Washington U., St. Louis; Byrum, K.; /Argonne; Cannon, A.; /University Coll., Dublin; Cesarini, A.; /Natl. U. of Ireland, Galway; Chow, Y.C.; /UCLA; Ciupik, L.; /Roosevelt U., Chicago; Cogan, P.; /McGill U.; Cui, W.; /Purdue U.; Duke, C.; /Grinnell Coll.; Falcone, A.; /Penn State U. /Purdue U. /Utah U. /Roosevelt U., Chicago /Harvard-Smithsonian Ctr. Astrophys. /Purdue U. /Natl. U. of Ireland, Galway /Utah U. /University Coll., Dublin /McGill U. /Roosevelt U., Chicago /McGill U. /Delaware U., Bartol Inst. /Utah U. /Chicago U., EFI /Iowa State U. /Roosevelt U., Chicago /DePauw U. /Utah U. /Pittsburg State U. /Washington U., St. Louis /Iowa State U. /Natl. U. of Ireland, Galway /Utah U. /McGill U. /Washington U., St. Louis /McGill U. /McGill U. /Purdue U. /Anderson U. /Galway-Mayo Inst. of Tech. /Iowa State U. /UCLA; /more authors..
2012-04-05
We report the first detection of very-high-energy (VHE) gamma-ray emission above 140GeV from PKS 1424+240, a BL Lac object with an unknown redshift. The photon spectrum above 140GeV measured by VERITAS is well described by a power law with a photon index of 3.8 {+-}0.5{sub stat} {+-} 0.3{sub syst} and a flux normalization at 200 GeV of (5.1 {+-} 0.9{sub stat} {+-} 0.5{sub syst}) x 10{sup -11} TeV{sup -1} cm{sup -2} s{sup -1}, where stat and syst denote the statistical and systematical uncertainty, respectively. The VHE flux is steady over the observation period between MJD 54881 and 55003 (2009 February 19 to June 21). Flux variability is also not observed in contemporaneous high energy observations with the Fermi Large Area Telescope (LAT). Contemporaneous X-ray and optical data were also obtained from the Swift XRT and MDM observatory, respectively. The broadband spectral energy distribution (SED) is well described by a one-zone synchrotron self-Compton (SSC) model favoring a redshift of less than 0.1. Using the photon index measured with Fermi in combination with recent extragalactic background light (EBL) absorption models it can be concluded from the VERITAS data that the redshift of PKS 1424+240 is less than 0.66.
Low-Energy Microfocus X-Ray Source for Enhanced Testing Capability in the Stray Light Facility
Gaskin, Jessica; O'Dell, Stephen; Kolodziejczak, Jeff
2015-01-01
Research toward high-resolution, soft x-ray optics (mirrors and gratings) necessary for the next generation large x-ray observatories requires x-ray testing using a low-energy x-ray source with fine angular size (energy microfocus (approximately 0.1 mm spot) x-ray source from TruFocus Corporation that mates directly to the Stray Light Facility (SLF). MSFC X-ray Astronomy team members are internationally recognized for their expertise in the development, fabrication, and testing of grazing-incidence optics for x-ray telescopes. One of the key MSFC facilities for testing novel x-ray instrumentation is the SLF. This facility is an approximately 100-m-long beam line equipped with multiple x-ray sources and detectors. This new source adds to the already robust compliment of instrumentation, allowing MSFC to support additional internal and community x-ray testing needs.
Gamma ray burst source locations with the Ulysses/Compton/PVO Network
International Nuclear Information System (INIS)
Cline, T.L.; Hurley, K.C.; Boer, M.; Sommer, M.; Niel, M.; Fishman, G.J.; Kouveliotou, C.; Meegan, C.A.; Paciesas, W.S.; Wilson, R.B.; Laros, J.G.; Klebesadel, R.W.
1991-01-01
The new interplanetary gamma-ray burst network will determine source fields with unprecedented accuracy. The baseline of the Ulysses mission and the locations of Pioneer-Venus Orbiter and of Mars Observer will ensure precision to a few tens of arc seconds. Combined with the event phenomenologies of the Burst and Transient Source Experiment on Compton Observatory, the source locations to be achieved with this network may provide a basic new understanding of the puzzle of gamma ray bursts
Nuclear Physics Meets the Sources of the Ultra-High Energy Cosmic Rays.
Boncioli, Denise; Fedynitch, Anatoli; Winter, Walter
2017-07-07
The determination of the injection composition of cosmic ray nuclei within astrophysical sources requires sufficiently accurate descriptions of the source physics and the propagation - apart from controlling astrophysical uncertainties. We therefore study the implications of nuclear data and models for cosmic ray astrophysics, which involves the photo-disintegration of nuclei up to iron in astrophysical environments. We demonstrate that the impact of nuclear model uncertainties is potentially larger in environments with non-thermal radiation fields than in the cosmic microwave background. We also study the impact of nuclear models on the nuclear cascade in a gamma-ray burst radiation field, simulated at a level of complexity comparable to the most precise cosmic ray propagation code. We conclude with an isotope chart describing which information is in principle necessary to describe nuclear interactions in cosmic ray sources and propagation.
Development of a Novel Tunable X-Ray Source for the RPI-LINAC
International Nuclear Information System (INIS)
Danon, Y.; Block, R.C.
2004-01-01
This document summarizes the results of a three year effort to develop a parametric x-ray (PXR) source. The emphasis of this research was to demonstrate production of high yield monoenergetic x-rays. Production of PXR is accomplished by placing a crystal in a relativistic electron beam. The process was first demonstrated in 1985 in Russia. Numerous papers were written about the characteristics of PXR from both experimental and theoretical perspectives. The advantage of PXR over other monoenergetic x-ray sources is that it is produced at large angle relative to the electron beam and at high intensity. None of the previous work described in the literature capitalized on this effect to study what is required in order to generate an effective monoenergetic x-ray source that can be used for practical applications. The work summarized here describes the process done in order to optimize the PXR production process by selecting an appropriate crystal and the optimal conditions. The research focused on production of 18 keV x-rays which are suitable for mammography however the results are not limited to this application or energy range. We are the first group to demonstrate x-ray imaging using PXR. Such sources can improve current medical imaging modalities. More research is required in order to design a prototype of a compact source
Development of a Novel Tunable X-Ray Source for the RPI-LINAC
Energy Technology Data Exchange (ETDEWEB)
Y. Danon; R.C. Block
2004-11-30
This document summarizes the results of a three year effort to develop a parametric x-ray (PXR) source. The emphasis of this research was to demonstrate production of high yield monoenergetic x-rays. Production of PXR is accomplished by placing a crystal in a relativistic electron beam. The process was first demonstrated in 1985 in Russia. Numerous papers were written about the characteristics of PXR from both experimental and theoretical perspectives. The advantage of PXR over other monoenergetic x-ray sources is that it is produced at large angle relative to the electron beam and at high intensity. None of the previous work described in the literature capitalized on this effect to study what is required in order to generate an effective monoenergetic x-ray source that can be used for practical applications. The work summarized here describes the process done in order to optimize the PXR production process by selecting an appropriate crystal and the optimal conditions. The research focused on production of 18 keV x-rays which are suitable for mammography however the results are not limited to this application or energy range. We are the first group to demonstrate x-ray imaging using PXR. Such sources can improve current medical imaging modalities. More research is required in order to design a prototype of a compact source.
DISCOVERY OF TeV GAMMA-RAY EMISSION TOWARD SUPERNOVA REMNANT SNR G78.2+2.1
Energy Technology Data Exchange (ETDEWEB)
Aliu, E. [Department of Physics and Astronomy, Barnard College, Columbia University, NY 10027 (United States); Archambault, S. [Physics Department, McGill University, Montreal, QC H3A 2T8 (Canada); Arlen, T.; Aune, T. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Beilicke, M.; Buckley, J. H.; Bugaev, V.; Dickherber, R. [Department of Physics, Washington University, St. Louis, MO 63130 (United States); Benbow, W. [Fred Lawrence Whipple Observatory, Harvard-Smithsonian Center for Astrophysics, Amado, AZ 85645 (United States); Bird, R.; Cannon, A.; Collins-Hughes, E. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Bouvier, A. [Santa Cruz Institute for Particle Physics and Department of Physics, University of California, Santa Cruz, CA 95064 (United States); Bradbury, S. M. [School of Physics and Astronomy, University of Leeds, Leeds, LS2 9JT (United Kingdom); Byrum, K. [Argonne National Laboratory, 9700 S. Cass Avenue, Argonne, IL 60439 (United States); Cesarini, A.; Connolly, M. P. [School of Physics, National University of Ireland Galway, University Road, Galway (Ireland); Ciupik, L. [Astronomy Department, Adler Planetarium and Astronomy Museum, Chicago, IL 60605 (United States); Cui, W. [Department of Physics, Purdue University, West Lafayette, IN 47907 (United States); Duke, C., E-mail: amandajw@iastate.edu [Department of Physics, Grinnell College, Grinnell, IA 50112-1690 (United States); and others
2013-06-20
We report the discovery of an unidentified, extended source of very-high-energy gamma-ray emission, VER J2019+407, within the radio shell of the supernova remnant SNR G78.2+2.1, using 21.4 hr of data taken by the VERITAS gamma-ray observatory in 2009. These data confirm the preliminary indications of gamma-ray emission previously seen in a two-year (2007-2009) blind survey of the Cygnus region by VERITAS. VER J2019+407, which is detected at a post-trials significance of 7.5 standard deviations in the 2009 data, is localized to the northwestern rim of the remnant in a region of enhanced radio and X-ray emission. It has an intrinsic extent of 0.23 Degree-Sign .23 {+-} 0. Degree-Sign 03{sub stat-0 Degree-Sign .02sys}{sup +0 Degree-Sign .04} and its spectrum is well-characterized by a differential power law (dN/dE = N{sub 0} Multiplication-Sign (E/TeV){sup -{Gamma}}) with a photon index of {Gamma} = 2.37 {+-} 0.14{sub stat} {+-} 0.20{sub sys} and a flux normalization of N{sub 0} = 1.5 {+-} 0.2{sub stat} {+-} 0.4{sub sys} Multiplication-Sign 10{sup -12} photon TeV{sup -1} cm{sup -2} s{sup -1}. This yields an integral flux of 5.2 {+-} 0.8{sub stat} {+-} 1.4{sub sys} Multiplication-Sign 10{sup -12} photon cm{sup -2} s{sup -1} above 320 GeV, corresponding to 3.7% of the Crab Nebula flux. We consider the relationship of the TeV gamma-ray emission with the GeV gamma-ray emission seen from SNR G78.2+2.1 as well as that seen from a nearby cocoon of freshly accelerated cosmic rays. Multiple scenarios are considered as possible origins for the TeV gamma-ray emission, including hadronic particle acceleration at the SNR shock.
Compact X-ray Light Source Workshop Report
Energy Technology Data Exchange (ETDEWEB)
Thevuthasan, Suntharampillai; Evans, James E.; Terminello, Louis J.; Koppenaal, David W.; Manke, Kristin L.; Plata, Charity
2012-12-01
This report, produced jointly by EMSL and FCSD, is the result of a workshop held in September 2011 that examined the utility of a compact x-ray light source (CXLS) in addressing many scientific challenges critical to advancing energy science and technology.
Believability of signals from cosmic ray sources
International Nuclear Information System (INIS)
Goodman, M.
1990-11-01
This paper discusses some of the criteria by which an observer judges whether to believe a signal or limit that has been reported for a cosmic ray source. The importance of specifying the test before looking at the data is emphasized. 5 refs
Nuclear Malaysia Plasma Focus Device as a X-ray Source For Radiography Applications
International Nuclear Information System (INIS)
Rokiah Mohd Sabri; Abdul Halim Baijan; Siti Aiasah Hashim; Mohd Rizal Mohd Chulan; Wah, L.K.; Mukhlis Mokhtar; Azaman Ahmad; Rosli Che Ros
2013-01-01
A 3.375 kJ plasma focus is designed to operate at 13.5 kV for the purpose of studying x-ray source for radiography in Argon discharge. X-rays is detected by using x-ray film from the mammography radiographic plate. The feasibility of the plasma focus as a high intensity flash x-ray source for good contrast in radiography image is presented. (author)
High Brightness, Laser-Driven X-ray Source for Nanoscale Metrology and Femtosecond Dynamics
Energy Technology Data Exchange (ETDEWEB)
Siders, C W; Crane, J K; Semenov, V; Betts, S; Kozioziemski, B; Wharton, K; Wilks, S; Barbee, T; Stuart, B; Kim, D E; An, J; Barty, C
2007-02-26
This project developed and demonstrated a new, bright, ultrafast x-ray source based upon laser-driven K-alpha generation, which can produce an x-ray flux 10 to 100 times greater than current microfocus x-ray tubes. The short-pulse (sub-picosecond) duration of this x-ray source also makes it ideal for observing time-resolved dynamics of atomic motion in solids and thin films.
Development of multi-pixel x-ray source using oxide-coated cathodes.
Kandlakunta, Praneeth; Pham, Richard; Khan, Rao; Zhang, Tiezhi
2017-07-07
Multiple pixel x-ray sources facilitate new designs of imaging modalities that may result in faster imaging speed, improved image quality, and more compact geometry. We are developing a high-brightness multiple-pixel thermionic emission x-ray (MPTEX) source based on oxide-coated cathodes. Oxide cathodes have high emission efficiency and, thereby, produce high emission current density at low temperature when compared to traditional tungsten filaments. Indirectly heated micro-rectangular oxide cathodes were developed using carbonates, which were converted to semiconductor oxides of barium, strontium, and calcium after activation. Each cathode produces a focal spot on an elongated fixed anode. The x-ray beam ON and OFF control is performed by source-switching electronics, which supplies bias voltage to the cathode emitters. In this paper, we report the initial performance of the oxide-coated cathodes and the MPTEX source.
Special issue on compact x-ray sources
Hooker, Simon; Midorikawa, Katsumi; Rosenzweig, James
2014-04-01
Journal of Physics B: Atomic, Molecular and Optical Physics is delighted to announce a forthcoming special issue on compact x-ray sources, to appear in the winter of 2014, and invites you to submit a paper. The potential for high-brilliance x- and gamma-ray sources driven by advanced, compact accelerators has gained increasing attention in recent years. These novel sources—sometimes dubbed 'fifth generation sources'—will build on the revolutionary advance of the x-ray free-electron laser (FEL). New radiation sources of this type have widespread applications, including in ultra-fast imaging, diagnostic and therapeutic medicine, and studies of matter under extreme conditions. Rapid advances in compact accelerators and in FEL techniques make this an opportune moment to consider the opportunities which could be realized by bringing these two fields together. Further, the successful development of compact radiation sources driven by compact accelerators will be a significant milestone on the road to the development of high-gradient colliders able to operate at the frontiers of particle physics. Thus the time is right to publish a peer-reviewed collection of contributions concerning the state-of-the-art in: advanced and novel acceleration techniques; sophisticated physics at the frontier of FELs; and the underlying and enabling techniques of high brightness electron beam physics. Interdisciplinary research connecting two or more of these fields is also increasingly represented, as exemplified by entirely new concepts such as plasma based electron beam sources, and coherent imaging with fs-class electron beams. We hope that in producing this special edition of Journal of Physics B: Atomic, Molecular and Optical Physics (iopscience.iop.org/0953-4075/) we may help further a challenging mission and ongoing intellectual adventure: the harnessing of newly emergent, compact advanced accelerators to the creation of new, agile light sources with unprecedented capabilities
Ultra-luminous X-ray sources and intermediate-mass black holes
International Nuclear Information System (INIS)
Cseh, David
2012-01-01
More than ten years ago, the discovery of Ultra-luminous X-ray sources (ULXs) has opened up an entirely new field in astrophysics. Many ideas were developed to explain the nature of these sources, like their emission mechanism, mass, and origin, without any strong conclusions. Their discovery boosted the fields of X-ray binaries, accretion physics, stellar evolution, cosmology, black hole formation and growth, due to the concept of intermediate-mass black holes (IMBHs). Since their discovery is related to the domain of X-ray astrophysics, there have been very few studies made in other wavelengths. This thesis focuses on the multiwavelength nature of Ultra-luminous X-ray sources and intermediate-mass black holes from various aspects, which help to overcome some difficulties we face today. First, I investigated the accretion signatures of a putative intermediate-mass black hole in a particular globular cluster. To this purpose, I characterized the nature of the innermost X-ray sources in the cluster. Then I calculated an upper limit on the mass of the black hole by studying possible accretion efficiencies and rates based on the dedicated X-ray and radio observations. The accreting properties of the source was described with standard spherical accretion and in the context of inefficient accretion. Secondly, I attempted to dynamically measure the mass of the black hole in a particular ULX via optical spectroscopy. I discovered that a certain emission line has a broad component that markedly shifts in wavelength. I investigated the possibility whether this line originates in the accretion disk, and thus might trace the orbital motion of the binary system. I also characterized the parameters of the binary system, such as the mass function, possible orbital separation, the size of the line-emitting region, and an upper limit on the mass of the black hole. Then I studied the environment of a number of ULXs that are associated with large-scale optical and radio nebulae. I
Multiwavelength Picture of the Blazar S5 0716+714 during Its Brightest Outburst
Directory of Open Access Journals (Sweden)
Marina Manganaro
2016-11-01
Full Text Available S5 0716+714 is a well known BL Lac object, and one of the brightest and most active blazars. The discovery in the Very High Energy band (VHE, E > 100 GeV by MAGIC happened in 2008. In January 2015, the source went through the brightest optical state ever observed, triggering MAGIC follow-up and a VHE detection with ∼ 13 σ significance (ATel ♯ 6999 . Rich multiwavelength coverage of the flare allowed us to construct the broad-band spectral energy distribution of S5 0716+714 during its brightest outburst. In this work, we will present the preliminary analysis of MAGIC and Fermi-LAT data of the flaring activity in January and February 2015 for the HE (0.1 < HE < 300 GeV and VHE band, together with radio (Metsähovi, OVRO, VLBA, Effelsberg, sub-millimeter (SMA, optical (Tuorla, Perkins, Steward, AZT-8+ST7, LX-200, Kanata, X-ray and UV (Swift-XRT and UVOT, in the same time-window and discuss the time variability of the multiwavelength light curves during this impressive outburst.
International Nuclear Information System (INIS)
Yang, C.Y.; Penner-Hahn, J.E.; Stefan, P.M.
1989-01-01
Characterization of the X-19A beamline at the National Synchrotron Light Source (NSLS) is described. The beamline is designed for high resolution x-ray absorption spectroscopy over a wide energy range. All of the beamline optical components are compatible with ultrahigh vacuum (UHV) operation. This permits measurements to be made in a window-less mode, thereby facilitating lower energy (<4 KeV) studies. To upgrade the beamline performance, several possible improvements in instrumentation and practice are discussed to increase photon statistics with an optimum energy resolution, while decreasing the harmonic contamination and noise level. A special effort has been made to improve the stability and UHV compatibility of the monochromator system. Initial x-ray absorption results demonstrate the capabilities of this beamline for x-ray absorption studies of low Z elements (e.g. S) in highly dilute systems. The future use of this beamline for carrying out various x-ray absorption experiments is presented. 10 refs., 4 figs
Performance of the IBM synchrotron X-ray source for lithography
International Nuclear Information System (INIS)
Archie, C.
1993-01-01
The compact superconducting synchrotron X-ray source at the IBM Advanced Lithography Facility in East Fishkill, New York has been in service to customers since the start of 1992. It availability during scheduled time is greater than 90%, with recent months frequently surpassing 95%. Data on the long-term behavior of the X-ray source properties and subsystem performance are now available. The full system continues to meet all specifications and even to surpass them in key areas. Measured electron beam properties such as beam size, short- and long-term positional stability, and beam life are presented. Lifetimes greater than 20 hours for typical stored beams have significantly simplified operations and increased availability compared to projections. This paper also describes some unique features of this X-ray source and goes beyond a discussion of downtime to describe the efforts behind the scenes to maintain and operate it
Point source search techniques in ultra high energy gamma ray astronomy
International Nuclear Information System (INIS)
Alexandreas, D.E.; Biller, S.; Dion, G.M.; Lu, X.Q.; Yodh, G.B.; Berley, D.; Goodman, J.A.; Haines, T.J.; Hoffman, C.M.; Horch, E.; Sinnis, C.; Zhang, W.
1993-01-01
Searches for point astrophysical sources of ultra high energy (UHE) gamma rays are plagued by large numbers of background events from isotropic cosmic rays. Some of the methods that have been used to estimate the expected number of background events coming from the direction of a possible source are found to contain biases. Search techniques that avoid this problem are described. There is also a discussion of how to optimize the sensitivity of a search to emission from a point source. (orig.)
Modification of the TASMIP x-ray spectral model for the simulation of microfocus x-ray sources
Energy Technology Data Exchange (ETDEWEB)
Sisniega, A.; Vaquero, J. J., E-mail: juanjose.vaquero@uc3m.es [Departamento de Bioingeniería e Ingeniería Aeroespacial, Universidad Carlos III de Madrid, Madrid ES28911 (Spain); Instituto de Investigación Sanitaria Gregorio Marañón, Madrid ES28007 (Spain); Desco, M. [Departamento de Bioingeniería e Ingeniería Aeroespacial, Universidad Carlos III de Madrid, Madrid ES28911 (Spain); Instituto de Investigación Sanitaria Gregorio Marañón, Madrid ES28007 (Spain); Centro de Investigación Biomédica en Red de Salud Mental (CIBERSAM), Madrid ES28029 (Spain)
2014-01-15
Purpose: The availability of accurate and simple models for the estimation of x-ray spectra is of great importance for system simulation, optimization, or inclusion of photon energy information into data processing. There is a variety of publicly available tools for estimation of x-ray spectra in radiology and mammography. However, most of these models cannot be used directly for modeling microfocus x-ray sources due to differences in inherent filtration, energy range and/or anode material. For this reason the authors propose in this work a new model for the simulation of microfocus spectra based on existing models for mammography and radiology, modified to compensate for the effects of inherent filtration and energy range. Methods: The authors used the radiology and mammography versions of an existing empirical model [tungsten anode spectral model interpolating polynomials (TASMIP)] as the basis of the microfocus model. First, the authors estimated the inherent filtration included in the radiology model by comparing the shape of the spectra with spectra from the mammography model. Afterwards, the authors built a unified spectra dataset by combining both models and, finally, they estimated the parameters of the new version of TASMIP for microfocus sources by calibrating against experimental exposure data from a microfocus x-ray source. The model was validated by comparing estimated and experimental exposure and attenuation data for different attenuating materials and x-ray beam peak energy values, using two different x-ray tubes. Results: Inherent filtration for the radiology spectra from TASMIP was found to be equivalent to 1.68 mm Al, as compared to spectra obtained from the mammography model. To match the experimentally measured exposure data the combined dataset required to apply a negative filtration of about 0.21 mm Al and an anode roughness of 0.003 mm W. The validation of the model against real acquired data showed errors in exposure and attenuation in
Modification of the TASMIP x-ray spectral model for the simulation of microfocus x-ray sources
International Nuclear Information System (INIS)
Sisniega, A.; Vaquero, J. J.; Desco, M.
2014-01-01
Purpose: The availability of accurate and simple models for the estimation of x-ray spectra is of great importance for system simulation, optimization, or inclusion of photon energy information into data processing. There is a variety of publicly available tools for estimation of x-ray spectra in radiology and mammography. However, most of these models cannot be used directly for modeling microfocus x-ray sources due to differences in inherent filtration, energy range and/or anode material. For this reason the authors propose in this work a new model for the simulation of microfocus spectra based on existing models for mammography and radiology, modified to compensate for the effects of inherent filtration and energy range. Methods: The authors used the radiology and mammography versions of an existing empirical model [tungsten anode spectral model interpolating polynomials (TASMIP)] as the basis of the microfocus model. First, the authors estimated the inherent filtration included in the radiology model by comparing the shape of the spectra with spectra from the mammography model. Afterwards, the authors built a unified spectra dataset by combining both models and, finally, they estimated the parameters of the new version of TASMIP for microfocus sources by calibrating against experimental exposure data from a microfocus x-ray source. The model was validated by comparing estimated and experimental exposure and attenuation data for different attenuating materials and x-ray beam peak energy values, using two different x-ray tubes. Results: Inherent filtration for the radiology spectra from TASMIP was found to be equivalent to 1.68 mm Al, as compared to spectra obtained from the mammography model. To match the experimentally measured exposure data the combined dataset required to apply a negative filtration of about 0.21 mm Al and an anode roughness of 0.003 mm W. The validation of the model against real acquired data showed errors in exposure and attenuation in
S-band linac-based X-ray source with {pi}/2-mode electron linac
Energy Technology Data Exchange (ETDEWEB)
Deshpande, Abhay, E-mail: abhay@post.kek.jp [Department of Accelerator Science, School of High Energy Accelerator Science, Graduate University for Advanced Studies, Shonan International Village, Hayama, Miura, Kanagawa 240-0193 (Japan); Society for Applied Microwave Electronic Engineering and Research (SAMEER), R and D Laboratory of the Government of India, IIT Campus, Powai, Mumbai 400 076 (India); Araki, Sakae [High Energy Accelerator Research Organization, 1-1 Oho, Tsukuba, Ibaraki 305-0801 (Japan); Dixit, Tanuja [Society for Applied Microwave Electronic Engineering and Research (SAMEER), R and D Laboratory of the Government of India, IIT Campus, Powai, Mumbai 400 076 (India); Fukuda, Masafumi [High Energy Accelerator Research Organization, 1-1 Oho, Tsukuba, Ibaraki 305-0801 (Japan); Krishnan, R; Pethe, Sanjay [Society for Applied Microwave Electronic Engineering and Research (SAMEER), R and D Laboratory of the Government of India, IIT Campus, Powai, Mumbai 400 076 (India); Sakaue, Kazuyuki [Waseda University, Shinjuku-ku, Tokyo 169-8555 (Japan); Terunuma, Nobuhiro; Urakawa, Junji [High Energy Accelerator Research Organization, 1-1 Oho, Tsukuba, Ibaraki 305-0801 (Japan); Washio, Masakazu [Waseda University, Shinjuku-ku, Tokyo 169-8555 (Japan)
2011-05-01
The activities with the compact X-ray source are attracting more attention, particularly for the applications of the source in medical fields. We propose the fabrication of a compact X-ray source using the SAMEER electron linear accelerator and the KEK laser undulator X-ray source (LUCX) technologies. The linac developed at SAMEER is a standing wave side-coupled S-band linac operating in the {pi}/2 mode. In the proposed system, a photocathode RF gun will inject bunches of electrons in the linac to accelerate and achieve a high-energy, low-emittance beam. This beam will then interact with the laser in the laser cavity to produce X-rays of a type well suited for various applications. The side-coupled structure will make the system more compact, and the {pi}/2 mode of operation will enable a high repetition rate operation, which will help to increase the X-ray yield.
A quasi-monochromatic X-rays source for art painting pigments investigation
Energy Technology Data Exchange (ETDEWEB)
Albertin, F.; Franconieri, A.; Gambaccini, M.; Petrucci, F.; Chiozzi, S. [University of Ferrara, Department of Physics and INFN, Ferrara (Italy); Moro, D. [University of Padova, Department of Physics, Padova (Italy); LNL - INFN, Legnaro, Padova (Italy)
2009-08-15
Monochromatic X-ray sources can be used for several applications, like in medicine or in studying our cultural heritage. We are investigating imaging systems based on a tuneable energy band X-ray source, to obtain an element mapping of painting layers using the K-edge technique. The narrow energy band beams are obtained with conventional X-ray source via Bragg diffraction on a mosaic crystal; such an analysis has been performed at different diffraction angles, tuning the energy to investigate spectra of interest from the artistic point of view, like zinc and copper. In this paper the characteristics of the system in terms of fluence rate are reported, and first results of this technique on canvas samples and painting are presented. (orig.)
Measuring the black hole mass in ultraluminous X-ray sources with the X-ray scaling method
Jang, I.; Gliozzi, M.; Satyapal, S.; Titarchuk, L.
2018-01-01
In our recent work, we demonstrated that a novel X-ray scaling method, originally introduced for Galactic black holes (BH), could be reliably extended to estimate the mass of supermassive black holes accreting at moderate to high level. Here, we apply this X-ray scaling method to ultraluminous X-ray sources (ULXs) to constrain their MBH. Using 49 ULXs with multiple XMM-Newton observations, we infer that ULXs host both stellar mass BHs and intermediate mass BHs. The majority of the sources of our sample seem to be consistent with the hypothesis of highly accreting massive stellar BHs with MBH ∼ 100 M⊙. Our results are in general agreement with the MBH values obtained with alternative methods, including model-independent variability methods. This suggests that the X-ray scaling method is an actual scale-independent method that can be applied to all BH systems accreting at moderate-high rate.
Characteristics of a molybdenum X-pinch X-ray source as a probe source for X-ray diffraction studies
International Nuclear Information System (INIS)
Zucchini, F.; Chauvin, C.; Combes, P.; Sol, D.; Loyen, A.; Roques, B.; Grunenwald, J.; Bland, S. N.
2015-01-01
X-ray emission from a molybdenum X-pinch has been investigated as a potential probe for the high pressure states made in dynamic compression experiments. Studies were performed on a novel 300 kA, 400 ns generator which coupled the load directly to a low inductance capacitor and switch combination. The X-pinch load consisted of 4 crossed molybdenum wires of 13 μm diameter, crossed at an angle of 62°. The load height was 10 mm. An initial x-ray burst generated at the wire crossing point, radiated in the soft x-ray range (hυ < 10 keV). This was followed, 2–5 ns later, by at least one harder x-ray burst (hυ > 10 keV) whose power ranged from 1 to 7 MW. Time integrated spectral measurements showed that the harder bursts were dominated by K-alpha emission; though, a lower level, wide band continuum up to at least 30 keV was also present. Initial tests demonstrated that the source was capable of driving Laue diffraction experiments, probing uncompressed samples of LiF and aluminium
Chandra Resolves Cosmic X-ray Glow and Finds Mysterious New Sources
2000-01-01
While taking a giant leap towards solving one of the greatest mysteries of X-ray astronomy, NASA's Chandra X-ray Observatory also may have revealed the most distant objects ever seen in the universe and discovered two puzzling new types of cosmic objects. Not bad for being on the job only five months. Chandra has resolved most of the X-ray background, a pervasive glow of X-rays throughout the universe, first discovered in the early days of space exploration. Before now, scientists have not been able to discern the background's origin, because no X-ray telescope until Chandra has had both the angular resolution and sensitivity to resolve it. "This is a major discovery," said Dr. Alan Bunner, Director of NASA's Structure andEvolution of the universe science theme. "Since it was first observed thirty-seven years ago, understanding the source of the X-ray background has been aHoly Grail of X-ray astronomy. Now, it is within reach." The results of the observation will be discussed today at the 195th national meeting of the American Astronomical Society in Atlanta, Georgia. An article describing this work has been submitted to the journal Nature by Dr. Richard Mushotzky, of NASA Goddard Space Flight Center, Greenbelt, Md., Drs. Lennox Cowie and Amy Barger at the University of Hawaii, Honolulu, and Dr. Keith Arnaud of the University of Maryland, College Park. "We are all very excited by this finding," said Mushotzky. "The resolution of most of the hard X-ray background during the first few months of the Chandra mission is a tribute to the power of this observatory and bodes extremely well for its scientific future," Scientists have known about the X-ray glow, called the X-ray background, since the dawn of X-ray astronomy in the early 1960s. They have been unable to discern its origin, however, for no X-ray telescope until Chandra has had both the angular resolution and sensitivity to resolve it. The German-led ROSAT mission, now completed, resolved much of the lower
Soft X-ray production by photon scattering in pulsating binary neutron star sources
International Nuclear Information System (INIS)
Bussard, R.W.; Meszaros, P.; Alexander, S.
1985-01-01
A new mechanism is proposed as a source of soft (less than 1 keV) radiation in binary pulsating X-ray sources, in the form of photon scattering which leaves the electron in an excited Landau level. In a plasma with parameters typical of such sources, the low-energy X-ray emissivity of this mechanism far exceeds that of bremsstrahlung. This copious source of soft photons is quite adequate to provide the seed photons needed to explain the power-law hard X-ray spectrum by inverse Comptonization on the hot electrons at the base of the accretion column. 13 references
Laser-produced multi-charged heavy ions as efficient soft x-ray sources
International Nuclear Information System (INIS)
Higashiguchi, Takeshi; Suzuki, Yuhei; Kawasaki, Masato
2016-01-01
We demonstrate EUV and soft x-ray sources in the 2 to 7 nm spectral region related to the beyond EUV (BEUV) question at 6x nm and a water window source based on laser-produced high-Z plasmas. Resonance emission from multiply charged ions merges to produce intense unresolved transition arrays (UTAs), extending below the carbon K edge (4.37 nm). An outline of a microscope design for single-shot live cell imaging is proposed based on a high-Z plasma UTA source, coupled to x-ray optics. We will discuss the progress and Z-scaling of UTA emission spectra to achieve lab-scale table-top, efficient, high-brightness high-Z plasma EUV-soft x-ray sources for in vivo bio-imaging applications. (author)
Long-term spectral and temporal behavior of the high-frequency peaked BL LAC object 1ES 1959+650
Backes, M.; Uellenbeck, M.; Hayashida, M.; Satalecka, K.; Tescaro, D.; Terzić, T.; MAGIC Collaboration; Fuhrmann, L.; Nestoras, I.; F-GAMMA project; Lähteenmäki, A.; Tornikoski, M.; Nieppola, E.; Metsähovi; Böttcher, M.; Collmar, W.; Weidinger, M.
2012-12-01
The high-frequency peaked BL Lac object 1ES 1959+650 is well-known for an exceptional outburst, which was observed at very high energy (VHE) γ-rays by the Whipple 10m and HEGRA telescopes in 2002. Remarkably, this outburst lacked associated X-ray emission (a socalled "orphan flare") and by this cannot easily be described by standard Synchrotron Self Compton (SSC) models. Models based on hadronic emission processes have also been proposed to explain the observed behavior. Subsequent multi-wavelength observations during a low flux state at TeV energies in 2006 can, instead, be explained by a standard single-zone SSC model. In this context, 1ES 1959+650 has been regularly monitored by the MAGIC telescope since 2005. During these years, no significant variation in the VHE γ-ray flux has been observed. The low energy part of this is in very good agreement with the high-energy part of the time-integrated energy spectrum as measured by Fermi-LAT. Based on this constant flux level in VHE γ-rays, we assembled the time-integrated spectral energy distribution (SED) of 1ES 1959+650 from radio to VHE γ-rays. Despite the non-variability at very high energies, significant flux and spectral variations have been observed at optical and X-ray frequencies in the meanwhile. Furthermore, the shape of the SED at high energy γ-rays as measured by Fermi-LAT is essentially flat which cannot be explained by either conventional single-zone SSC models, or models invoking external radiation fields (EC).
Gamma-ray imaging of the Quinby sources
International Nuclear Information System (INIS)
Gregor, J.; Hensley, D.C.
1996-01-01
The Quinby sources are alumina cylinders 7 inches in diameter and 8 inches high doped with weapons grade plutonium. We describe a computer tomography system for reconstructing three-dimensional images of these sources. Each reconstruction maps the spatial distribution of the internal [sup 241]Am gamma ray activity and is computed using an iterative, expectation-maximization algorithm with detection efficiencies based both on geometric model of the experimental setup and attenuation corrections. Constructed about a decade ago, the Quinby sources were to contain uniformly distributed material. However, for some of the sources we have found regions where the plutonium solution, tends to be concentrated. The ultimate goal of this work is to provide the basis for self-shielding corrections when analyzing differential dieaway neutron measurements
Quasars as Sources of Ultrahigh-Energy Cosmic Rays
International Nuclear Information System (INIS)
Glushkov, A.V.
2005-01-01
The results are presented that were obtained by analyzing arrival directions for cosmic rays that the Yakutsk array for studying extensive air showers recorded between 1974 and 2002 in the energy region E 0 ≥5x10 17 eV for zenith angles in the region θ ≤60 deg. . It is shown that quasars for which the redshift lies in the region z≤2.5 can be sources of these cosmic rays. Ordered structures are observed in the disposition of quasars and in the cosmic-ray arrival directions. These structures can be associated in one way or another with the large-scale structure of the Universe
Multiband Diagnostics of Unidentified 1FGL Sources with Suzaku and Swift X-Ray Observations
Takeuchi, Y.; Kataoka, J.; Maeda, K.; Takahashi, Y.; Nakamori, T.; Tahara, M.
2013-10-01
We have analyzed all the archival X-ray data of 134 unidentified (unID) gamma-ray sources listed in the first Fermi/LAT (1FGL) catalog and subsequently followed up by the Swift/XRT. We constructed the spectral energy distributions (SEDs) from radio to gamma-rays for each X-ray source detected, and tried to pick up unique objects that display anomalous spectral signatures. In these analyses, we target all the 1FGL unID sources, using updated data from the second Fermi/LAT (2FGL) catalog on the Large Area Telescope (LAT) position and spectra. We found several potentially interesting objects, particularly three sources, 1FGL J0022.2-1850, 1FGL J0038.0+1236, and 1FGL J0157.0-5259, which were then more deeply observed with Suzaku as a part of an AO-7 program in 2012. We successfully detected an X-ray counterpart for each source whose X-ray spectra were well fitted by a single power-law function. The positional coincidence with a bright radio counterpart (currently identified as an active galactic nucleus, AGN) in the 2FGL error circles suggests these sources are definitely the X-ray emission from the same AGN, but their SEDs show a wide variety of behavior. In particular, the SED of 1FGL J0038.0+1236 is not easily explained by conventional emission models of blazars. The source 1FGL J0022.2-1850 may be in a transition state between a low-frequency peaked and a high-frequency peaked BL Lac object, and 1FGL J0157.0-5259 could be a rare kind of extreme blazar. We discuss the possible nature of these three sources observed with Suzaku, together with the X-ray identification results and SEDs of all 134 sources observed with the Swift/XRT.
Fricke dosimetry: the difference between G(Fe3+) for 60Co gamma-rays and high-energy x-rays.
Klassen, N V; Shortt, K R; Seuntjens, J; Ross, C K
1999-07-01
A calibration of the Fricke dosimeter is a measurement of epsilon G(Fe3+). Although G(Fe3+) is expected to be approximately energy independent for all low-LET radiation, existing data are not adequate to rule out the possibility of changes of a few per cent with beam quality. When a high-precision Fricke dosimeter, which has been calibrated for one particular low-LET beam quality, is used to measure the absorbed dose for another low-LET beam quality, the accuracy of the absorbed dose measurement is limited by the uncertainty in the value of G(Fe3+). The ratio of G(Fe3+) for high-energy x-rays (20 and 30 MV) to G(Fe3+) for 60Co gamma-rays, G(Fe3+)MV(Co), was measured to be 1.007(+/-0.003) (confidence level of 68%) using two different types of water calorimeter, a stirred-water calorimeter (20 MV) and a sealed-water calorimeter (20, 30 MV). This value is consistent with our calculations based on the LET dependence of G(primary products) and, as well, with published measurements and theoretical treatments of G(Fe3+).
Atomic properties of the elements and cosmic ray composition at the source
International Nuclear Information System (INIS)
Casse, M.; Goret, P.; Cesarsky, C.J.
1975-01-01
Possible correlations between the abundances of cosmic rays at the source and the solar system abundances are discussed. Cosmic ray source abundances could be explained if the particles are accelerated to injection energies in a dilute, moderately hot plasma, from which they escape in a rigidity dependant fashion [fr
A nanotube-based field emission x-ray source for microcomputed tomography
International Nuclear Information System (INIS)
Zhang, J.; Cheng, Y.; Lee, Y.Z.; Gao, B.; Qiu, Q.; Lin, W.L.; Lalush, D.; Lu, J.P.; Zhou, O.
2005-01-01
Microcomputed tomography (micro-CT) is a noninvasive imaging tool commonly used to probe the internal structures of small animals for biomedical research and for the inspection of microelectronics. Here we report the development of a micro-CT scanner with a carbon nanotube- (CNT-) based microfocus x-ray source. The performance of the CNT x-ray source and the imaging capability of the micro-CT scanner were characterized
Source composition of cosmic rays at high energy
International Nuclear Information System (INIS)
Juliusson, E.; Cesarsky, C.J.; Meneguzzi, M.; Casse, M.
1975-01-01
The source composition of the cosmic ray is usually calculated at an energy of a few GeV per nucleon. Recent measurements have however indicated that the source composition may be energy dependent. In order to give a quantitative answer to this question the source composition at 50GeV/nucleon has been calculated using an exponential distribution of path lengths and in the slab approximation. The results obtained at high energy agree very well with the source composition obtained at lower energies, except the abundance of carbon which is significantly lower than the generally accepted value of low energies [fr
Toward a fourth-generation X-ray source
International Nuclear Information System (INIS)
Monction, D. E.
1999-01-01
The field of synchrotron radiation research has grown rapidly over the last 25 years due to both the push of the accelerator and magnet technology that produces the x-ray beams and the pull of the extraordinary scientific research that is possible with them. Three successive generations of synchrotrons radiation facilities have resulted in beam brilliances 11 to 12 orders of magnitude greater than the standard laboratory x-ray tube. However, greater advances can be easily imagined given the fact that x-ray beams from present-day facilities do not exhibit the coherence or time structure so familiar with the optical laser. Theoretical work over the last ten years or so has pointed to the possibility of generating hard x-ray beams with laser-like characteristics. The concept is based on self-amplified spontaneous emission (SASE) in flee-electron lasers. A major facility of this type based upon a superconducting linac could produce a cost-effective facility that spans wave-lengths from the ultraviolet to the hard x-ray regime, simultaneously servicing large numbers experimenters from a wide range of disciplines. As with each past generation of synchrotrons facilities, immense new scientific opportunities would result from fourth-generation sources.
Energy Technology Data Exchange (ETDEWEB)
Massaro, F.; Funk, S. [SLAC National Laboratory and Kavli Institute for Particle Astrophysics and Cosmology, 2575 Sand Hill Road, Menlo Park, CA 94025 (United States); D' Abrusco, R.; Paggi, A. [Harvard-Smithsonian Astrophysical Observatory, 60 Garden Street, Cambridge, MA 02138 (United States); Giroletti, M. [INAF Istituto di Radioastronomia, via Gobetti 101, I-40129 Bologna (Italy); Masetti, N. [INAF-Istituto di Astrofisica Spaziale e Fisica Cosmica di Bologna, via Gobetti 101, I-40129 Bologna (Italy); Tosti, G. [Dipartimento di Fisica, Universita degli Studi di Perugia, I-06123 Perugia (Italy); Nori, M. [Department of Physics and Astronomy, University of Bologna, viale Berti Pichat 6/2, I-40127 Bologna (Italy)
2013-07-01
About one-third of the {gamma}-ray sources listed in the second Fermi Large Area Telescope catalog (2FGL) have no firmly established counterpart at lower energies and so are classified as unidentified gamma-ray sources (UGSs). Here, we propose a new approach to find candidate counterparts for the UGSs based on the 325 MHz radio survey performed with the Westerbork Synthesis Radio Telescope in the northern hemisphere. First, we investigate the low-frequency radio properties of blazars, the largest known population of {gamma}-ray sources; then we search for sources with similar radio properties combining the information derived from the Westerbork Northern Sky Survey (WENSS) with those of the NRAO Very Large Array Sky Survey. We present a list of candidate counterparts for 32 UGSs with at least one counterpart in the WENSS. We also performed an extensive research in the literature to look for infrared and optical counterparts of the {gamma}-ray blazar candidates selected using the low-frequency radio observations to confirm their nature. On the basis of our multifrequency research, we identify 23 new {gamma}-ray blazar candidates out of the 32 UGSs investigated. Comparison with previous results on the UGSs is also presented. Finally, we speculate on the advantages of using low-frequency radio observations to associate UGSs and to search for {gamma}-ray pulsar candidates.
Stationary scanning x-ray source based on carbon nanotube field emitters
International Nuclear Information System (INIS)
Zhang, J.; Yang, G.; Cheng, Y.; Gao, B.; Qiu, Q.; Lee, Y.Z.; Lu, J.P.; Zhou, O.
2005-01-01
We report a field emission x-ray source that can generate a scanning x-ray beam to image an object from multiple projection angles without mechanical motion. The key component of the device is a gated carbon nanotube field emission cathode with an array of electron emitting pixels that are individually addressable via a metal-oxide-semiconductor field effect transistor-based electronic circuit. The characteristics of this x-ray source are measured and its imaging capability is demonstrated. The device can potentially lead to a fast data acquisition rate for laminography and tomosynthesis with a simplified experimental setup
Hitomi X-ray observation of the pulsar wind nebula G21.5-0.9
Aharonian, Felix; Akamatsu, Hiroki; Akimoto, Fumie; Allen, Steven W.; Angelini, Lorella; Audard, Marc; Awaki, Hisamitsu; Axelsson, Magnus; Bamba, Aya; Bautz, Marshall W.; Blandford, Roger; Brenneman, Laura W.; Brown, Gregory V.; Bulbul, Esra; Cackett, Edward M.; Chernyakova, Maria; Chiao, Meng P.; Coppi, Paolo S.; Costantini, Elisa; de Plaa, Jelle; de Vries, Cor P.; den Herder, Jan-Willem; Done, Chris; Dotani, Tadayasu; Ebisawa, Ken; Eckart, Megan E.; Enoto, Teruaki; Ezoe, Yuichiro; Fabian, Andrew C.; Ferrigno, Carlo; Foster, Adam R.; Fujimoto, Ryuichi; Fukazawa, Yasushi; Furuzawa, Akihiro; Galeazzi, Massimiliano; Gallo, Luigi C.; Gandhi, Poshak; Giustini, Margherita; Goldwurm, Andrea; Gu, Liyi; Guainazzi, Matteo; Haba, Yoshito; Hagino, Kouichi; Hamaguchi, Kenji; Harrus, Ilana M.; Hatsukade, Isamu; Hayashi, Katsuhiro; Hayashi, Takayuki; Hayashida, Kiyoshi; Hiraga, Junko S.; Hornschemeier, Ann; Hoshino, Akio; Hughes, John P.; Ichinohe, Yuto; Iizuka, Ryo; Inoue, Hajime; Inoue, Yoshiyuki; Ishida, Manabu; Ishikawa, Kumi; Ishisaki, Yoshitaka; Iwai, Masachika; Kaastra, Jelle; Kallman, Tim; Kamae, Tsuneyoshi; Kataoka, Jun; Katsuda, Satoru; Kawai, Nobuyuki; Kelley, Richard L.; Kilbourne, Caroline A.; Kitaguchi, Takao; Kitamoto, Shunji; Kitayama, Tetsu; Kohmura, Takayoshi; Kokubun, Motohide; Koyama, Katsuji; Koyama, Shu; Kretschmar, Peter; Krimm, Hans A.; Kubota, Aya; Kunieda, Hideyo; Laurent, Philippe; Lee, Shiu-Hang; Leutenegger, Maurice A.; Limousin, Olivier; Loewenstein, Michael; Long, Knox S.; Lumb, David; Madejski, Greg; Maeda, Yoshitomo; Maier, Daniel; Makishima, Kazuo; Markevitch, Maxim; Matsumoto, Hironori; Matsushita, Kyoko; McCammon, Dan; McNamara, Brian R.; Mehdipour, Missagh; Miller, Eric D.; Miller, Jon M.; Mineshige, Shin; Mitsuda, Kazuhisa; Mitsuishi, Ikuyuki; Miyazawa, Takuya; Mizuno, Tsunefumi; Mori, Hideyuki; Mori, Koji; Mukai, Koji; Murakami, Hiroshi; Mushotzky, Richard F.; Nakagawa, Takao; Nakajima, Hiroshi; Nakamori, Takeshi; Nakashima, Shinya; Nakazawa, Kazuhiro; Nobukawa, Kumiko K.; Nobukawa, Masayoshi; Noda, Hirofumi; Odaka, Hirokazu; Ohashi, Takaya; Ohno, Masanori; Okajima, Takashi; Ota, Naomi; Ozaki, Masanobu; Paerels, Frits; Paltani, Stéphane; Petre, Robert; Pinto, Ciro; Porter, Frederick S.; Pottschmidt, Katja; Reynolds, Christopher S.; Safi-Harb, Samar; Saito, Shinya; Sakai, Kazuhiro; Sasaki, Toru; Sato, Goro; Sato, Kosuke; Sato, Rie; Sawada, Makoto; Schartel, Norbert; Serlemtsos, Peter J.; Seta, Hiromi; Shidatsu, Megumi; Simionescu, Aurora; Smith, Randall K.; Soong, Yang; Stawarz, Łukasz; Sugawara, Yasuharu; Sugita, Satoshi; Szymkowiak, Andrew; Tajima, Hiroyasu; Takahashi, Hiromitsu; Takahashi, Tadayuki; Takeda, Shin'ichiro; Takei, Yoh; Tamagawa, Toru; Tamura, Takayuki; Tanaka, Takaaki; Tanaka, Yasuo; Tanaka, Yasuyuki T.; Tashiro, Makoto S.; Tawara, Yuzuru; Terada, Yukikatsu; Terashima, Yuichi; Tombesi, Francesco; Tomida, Hiroshi; Tsuboi, Yohko; Tsujimoto, Masahiro; Tsunemi, Hiroshi; Tsuru, Takeshi Go; Uchida, Hiroyuki; Uchiyama, Hideki; Uchiyama, Yasunobu; Ueda, Shutaro; Ueda, Yoshihiro; Uno, Shin'ichiro; Urry, C. Megan; Ursino, Eugenio; Watanabe, Shin; Werner, Norbert; Wilkins, Dan R.; Williams, Brian J.; Yamada, Shinya; Yamaguchi, Hiroya; Yamaoka, Kazutaka; Yamasaki, Noriko Y.; Yamauchi, Makoto; Yamauchi, Shigeo; Yaqoob, Tahir; Yatsu, Yoichi; Yonetoku, Daisuke; Zhuravleva, Irina; Zoghbi, Abderahmen; Sato, Toshiki; Nakaniwa, Nozomu; Murakami, Hiroaki; Guest, Benson
2018-04-01
We present results from the Hitomi X-ray observation of a young composite-type supernova remnant (SNR) G21.5-0.9, whose emission is dominated by the pulsar wind nebula (PWN) contribution. The X-ray spectra in the 0.8-80 keV range obtained with the Soft X-ray Spectrometer (SXS), Soft X-ray Imager, and Hard X-ray Imager (HXI) show a significant break in the continuum as previously found with the NuSTAR observation. After taking into account all known emissions from the SNR other than the PWN itself, we find that the Hitomi spectra can be fitted with a broken power law with photon indices of Γ1 = 1.74 ± 0.02 and Γ2 = 2.14 ± 0.01 below and above the break at 7.1 ± 0.3 keV, which is significantly lower than the NuSTAR result (˜9.0 keV). The spectral break cannot be reproduced by time-dependent particle injection one-zone spectral energy distribution models, which strongly indicates that a more complex emission model is needed, as suggested by recent theoretical models. We also search for narrow emission or absorption lines with the SXS, and perform a timing analysis of PSR J1833-1034 with the HXI and the Soft Gamma-ray Detector. No significant pulsation is found from the pulsar. However, unexpectedly, narrow absorption line features are detected in the SXS data at 4.2345 keV and 9.296 keV with a significance of 3.65 σ. While the origin of these features is not understood, their mere detection opens up a new field of research and was only possible with the high resolution, sensitivity, and ability to measure extended sources provided by an X-ray microcalorimeter.
Bright X-ray source from a laser-driven micro-plasma-waveguide
Yi, Longqing
2016-01-01
Bright tunable x-ray sources have a number of applications in basic science, medicine and industry. The most powerful sources are synchrotrons, where relativistic electrons are circling in giant storage rings. In parallel, compact laser-plasma x-ray sources are being developed. Owing to the rapid progress in laser technology, very high-contrast femtosecond laser pulses of relativistic intensities become available. These pulses allow for interaction with micro-structured solid-density plasma without destroying the structure by parasitic pre-pulses. The high-contrast laser pulses as well as the manufacturing of materials at micro- and nano-scales open a new realm of possibilities for laser interaction with photonic materials at the relativistic intensities. Here we demonstrate, via numerical simulations, that when coupling with a readily available 1.8 Joule laser, a micro-plasma-waveguide (MPW) may serve as a novel compact x-ray source. Electrons are extracted from the walls by the laser field and form a dense ...
X-ray Measurements of Black Hole X-ray Binary Source GRS 1915+ ...
Indian Academy of Sciences (India)
tribpo
March 30th, 1997 during a quiescent phase of the source. .... The field of view ... tagged with a 25µsec resolution and transmitted to ground on a 40 Kbit PCM/FM ... only composite model fits for the soft and hard X ray band are used and the ...
Multisource inverse-geometry CT. Part II. X-ray source design and prototype
Energy Technology Data Exchange (ETDEWEB)
Neculaes, V. Bogdan, E-mail: neculaes@ge.com; Caiafa, Antonio; Cao, Yang; De Man, Bruno; Edic, Peter M.; Frutschy, Kristopher; Gunturi, Satish; Inzinna, Lou; Reynolds, Joseph; Vermilyea, Mark; Wagner, David; Zhang, Xi; Zou, Yun [GE Global Research, Niskayuna, New York 12309 (United States); Pelc, Norbert J. [Department of Radiology, Stanford University, Stanford, California 94305 (United States); Lounsberry, Brian [Healthcare Science Technology, GE Healthcare, West Milwaukee, Wisconsin 53219 (United States)
2016-08-15
Purpose: This paper summarizes the development of a high-power distributed x-ray source, or “multisource,” designed for inverse-geometry computed tomography (CT) applications [see B. De Man et al., “Multisource inverse-geometry CT. Part I. System concept and development,” Med. Phys. 43, 4607–4616 (2016)]. The paper presents the evolution of the source architecture, component design (anode, emitter, beam optics, control electronics, high voltage insulator), and experimental validation. Methods: Dispenser cathode emitters were chosen as electron sources. A modular design was adopted, with eight electron emitters (two rows of four emitters) per module, wherein tungsten targets were brazed onto copper anode blocks—one anode block per module. A specialized ceramic connector provided high voltage standoff capability and cooling oil flow to the anode. A matrix topology and low-noise electronic controls provided switching of the emitters. Results: Four modules (32 x-ray sources in two rows of 16) have been successfully integrated into a single vacuum vessel and operated on an inverse-geometry computed tomography system. Dispenser cathodes provided high beam current (>1000 mA) in pulse mode, and the electrostatic lenses focused the current beam to a small optical focal spot size (0.5 × 1.4 mm). Controlled emitter grid voltage allowed the beam current to be varied for each source, providing the ability to modulate beam current across the fan of the x-ray beam, denoted as a virtual bowtie filter. The custom designed controls achieved x-ray source switching in <1 μs. The cathode-grounded source was operated successfully up to 120 kV. Conclusions: A high-power, distributed x-ray source for inverse-geometry CT applications was successfully designed, fabricated, and operated. Future embodiments may increase the number of spots and utilize fast read out detectors to increase the x-ray flux magnitude further, while still staying within the stationary target inherent
Compact alpha-excited sources of low energy x-rays
International Nuclear Information System (INIS)
Amlauer, K.; Tuohy, I.
1976-01-01
A discussion is given of the use of alpha emitting isotopes, such as 210 Po and 244 Cm, for the production of low energy x-rays (less than 5.9 keV). The design of currently available sources is described, and x-ray fluxes observed from various target materials are presented. Commercial applications of the alpha excitation technique are briefly discussed
Plasma instability control toward high fluence, high energy x-ray continuum source
Poole, Patrick; Kirkwood, Robert; Wilks, Scott; Blue, Brent
2017-10-01
X-ray source development at Omega and NIF seeks to produce powerful radiation with high conversion efficiency for material effects studies in extreme fluence environments. While current K-shell emission sources can achieve tens of kJ on NIF up to 22 keV, the conversion efficiency drops rapidly for higher Z K-alpha energies. Pulsed power devices are efficient generators of MeV bremsstrahlung x-rays but are unable to produce lower energy photons in isolation, and so a capability gap exists for high fluence x-rays in the 30 - 100 keV range. A continuum source under development utilizes instabilities like Stimulated Raman Scattering (SRS) to generate plasma waves that accelerate electrons into high-Z converter walls. Optimizing instabilities using existing knowledge on their elimination will allow sufficiently hot and high yield electron distributions to create a superior bremsstrahlung x-ray source. An Omega experiment has been performed to investigate the optimization of SRS and high energy x-rays using Au hohlraums with parylene inner lining and foam fills, producing 10× greater x-ray yield at 50 keV than conventional direct drive experiments on the facility. Experiment and simulation details on this campaign will be presented. This work was performed under the auspices of the US DoE by LLNL under Contract No. DE-AC52-07NA27344.
A compact soft X-ray microscope using an electrode-less Z-pinch source
Horne, S. F.; Silterra, J.; Holber, W.
2009-09-01
Soft X-rays (medical interest both for imaging and microdosimetry applications. X-ray sources at this low energy present a technological challenge. Synchrotrons, while very powerful and flexible, are enormously expensive national research facilities. Conventional X-ray sources based on electron bombardment can be compact and inexpensive, but low x-ray production efficiencies at low electron energies restrict this approach to very low power applications. Laser-based sources tend to be expensive and unreliable. Energetiq Technology, Inc. (Woburn, MA, USA) markets a 92 eV, 10W(2pi sr) electrode-less Z-pinch source developed for advanced semiconductor lithography. A modified version of this commercial product has produced 400 mW at 430 eV (2pi sr), appropriate for water window soft X-ray microscopy. The US NIH has funded Energetiq to design and construct a demonstration microscope using this source, coupled to a condenser optic, as the illumination system. The design of the condenser optic matches the unique characteristics of the source to the illumination requirements of the microscope, which is otherwise a conventional design. A separate program is underway to develop a microbeam system, in conjunction with the RARAF facility at Columbia University, NY, USA. The objective is to develop a focused, sub-micron beam capable of delivering > 1 Gy/second to the nucleus of a living cell. While most facilities of this type are coupled to a large and expensive particle accelerator, the Z-pinch X-ray source enables a compact, stand-alone design suitable to a small laboratory. The major technical issues in this system involve development of suitable focusing X-ray optics. Current status of these programs will be reported. (Supported by NIH grants 5R44RR022488-03 and 5R44RR023753-03)
Chandra Discovers X-ray Source at the Center of Our Galaxy
2000-01-01
Culminating 25 years of searching by astronomers, researchers at Massachusetts Institute of Technology say that a faint X-ray source, newly detected by NASA's Chandra X-ray Observatory, may be the long-sought X-ray emission from a known supermassive black hole at the center of our galaxy. Frederick K. Baganoff and colleagues from Pennsylvania State University, University Park, and the University of California, Los Angeles, will present their findings today in Atlanta at the 195th national meeting of the American Astronomical Society. Baganoff, lead scientist for the Chandra X-ray Observatory's Advanced CCD Imaging Spectrometer (ACIS) team's "Sagittarius A* and the Galactic Center" project and postdoctoral research associate at MIT, said that the precise positional coincidence between the new X-ray source and the radio position of a long-known source called Sagittarius A* "encourages us to believe that the two are the same." Sagittarius A* is a point-like, variable radio source at the center of our galaxy. It looks like a faint quasar and is believed to be powered by gaseous matter falling into a supermassive black hole with 2.6 million times the mass of our Sun. Chandra's remarkable detection of this X-ray source has placed astronomers within a couple of years of a coveted prize: measuring the spectrum of energy produced by Sagittarius A* to determine in detail how the supermassive black hole that powers it works. "The race to be the first to detect X-rays from Sagittarius A* is one of the hottest and longest-running in all of X-ray astronomy," Baganoff said. "Theorists are eager to hear the results of our observation so they can test their ideas." But now that an X-ray source close to Sagittarius A* has been found, it has taken researchers by surprise by being much fainter than expected. "There must be something unusual about the environment around this black hole that affects how it is fed and how the gravitational energy released from the infalling matter is
Supply and distribution for γ-ray sources
International Nuclear Information System (INIS)
Yamamoto, Takeo
1997-01-01
Japan Atomic energy Research Institute (JAERI) is the only facility to supply and distribute radioisotopes (RI) in Japan. The γ-ray sources for medical use are 192 Ir and 169 Yb for non-destructive examination and 192 Ir, 198 Au and 153 Gd for clinical use. All of these demands in Japan are supplied with domestic products at present. Meanwhile, γ-ray sources imported are 60 Co sources for medical and industrial uses including sterilization of medical instruments, 137 Cs for irradiation to blood and 241 Am for industrial measurements. The major overseas suppliers are Nordion International Inc. and Amersham International plc. RI products on the market are divided into two groups; one is the primary products which are supplied in liquid or solid after chemical or physical treatments of radioactive materials obtained from reactor and the other is the secondary product which is a final product after various processing. Generally these secondary products are used in practice. In Japan, both of the domestic and imported products are supplied to the users via JRIA (Japan Radioisotope Association). The association participates in the sales and the distributions of the secondary products and also in the processings of the primary ones to their sealed sources. Furthermore, stable supplying systems for these products are almost established according to the half life of each nuclide only if there is no accident in the reactor. (M.N.)
Statistical measurement of the gamma-ray source-count distribution as a function of energy
Zechlin, H.-S.; Cuoco, A.; Donato, F.; Fornengo, N.; Regis, M.
2017-01-01
Photon counts statistics have recently been proven to provide a sensitive observable for characterizing gamma-ray source populations and for measuring the composition of the gamma-ray sky. In this work, we generalize the use of the standard 1-point probability distribution function (1pPDF) to decompose the high-latitude gamma-ray emission observed with Fermi-LAT into: (i) point-source contributions, (ii) the Galactic foreground contribution, and (iii) a diffuse isotropic background contribution. We analyze gamma-ray data in five adjacent energy bands between 1 and 171 GeV. We measure the source-count distribution dN/dS as a function of energy, and demonstrate that our results extend current measurements from source catalogs to the regime of so far undetected sources. Our method improves the sensitivity for resolving point-source populations by about one order of magnitude in flux. The dN/dS distribution as a function of flux is found to be compatible with a broken power law. We derive upper limits on further possible breaks as well as the angular power of unresolved sources. We discuss the composition of the gamma-ray sky and capabilities of the 1pPDF method.
Linear polarization observations of some X-ray sources
International Nuclear Information System (INIS)
Shakhovskoy, N.M.; Efimov, Yu.S.
1975-01-01
Multicolour linear polarization of optical radiation of the X-ray sources Sco X-1, Cyg X-2, Cyg X-1 and Her X-1 was measured at the Crimean Astrophysical Observatory in 1970-1973. These observations indicate that polarization of Sco X-1 in the ultraviolet, blue and red spectral regions appears to be variable. No statistically significant variations of polarization were found for the other three sources observed. (Auth.)
The Advanced Gamma-Ray Imaging System (AGIS)
Otte, Nepomuk
The Advanced Gamma-ray Imaging System (AGIS) is a concept for the next generation of imag-ing atmospheric Cherenkov telescope arrays. It has the goal of providing an order of magnitude increase in sensitivity for Very High Energy Gamma-ray ( 100 GeV to 100 TeV) astronomy compared to currently operating arrays such as CANGAROO, HESS, MAGIC, and VERITAS. After an overview of the science such an array would enable, we discuss the development of the components of the telescope system that are required to achieve the sensitivity goal. AGIS stresses improvements in several areas of IACT technology including component reliability as well as exploring cost reduction possibilities in order to achieve its goal. We discuss alterna-tives for the telescopes and positioners: a novel Schwarzschild-Couder telescope offering a wide field of view with a relatively smaller plate scale, and possibilities for rapid slewing in order to address the search for and/or study of Gamma-ray Bursts in the VHE gamma-ray regime. We also discuss options for a high pixel count camera system providing the necessary finer solid angle per pixel and possibilities for a fast topological trigger that would offer improved realtime background rejection and lower energy thresholds.
X-ray system with coupled source drive and detector drive
International Nuclear Information System (INIS)
1976-01-01
An electronic coupling replacing the (more expensive) mechanical coupling which controls the speed of two sets of two electric motors, one driving an X-ray source and the other an X-ray detector, is described. Source and detector are kept rotating in parallel planes with a fairly constant velocity ratio. The drives are controlled by an electronic system comprising a comparator circuit comparing the position-indicative signals, a process control circuit and an inverter switch. The control system regulates the speed of the electric motors. The signal processing is described
Providing Bright-Hard X-ray Beams from a Lower Energy Light Source
Robin, David
2002-04-01
At the Advanced Light Source (ALS) there had been an increasing demand for more high brightness harder X-ray sources in the 7 to 40 KeV range. In response to that demand, the ALS storage ring was modified in August 2001. Three 1.3 Tesla normal conducting bending magnets were removed and replaced with three 5 Tesla superconducting magnets (Superbends). The radiation produced by these Superbends is an order of magnitude higher in photon brightness and flux at 12 keV than the 1.3 Tesla bends, making them excellent sources of harder x-rays for protein crystallography and other harder x-ray applications. At the same time the Superbends do not compromise the performance of the facility in the UV and Soft X-ray regions of the spectrum. The Superbends will eventually feed 12 new x-ray beam lines greatly enhancing the facility's capacity in the hard x-ray region. The Superbend project is the biggest upgrade to the ALS storage ring since the ring was commissioned in 1993. In this paper we present, a history of the project, details of the magnet, installation, commissioning, and resulting performance of the ALS with Superbends.
Analysis of hard X-ray emission from selected very high energy γ-ray sources observed with INTEGRAL
International Nuclear Information System (INIS)
Hoffmann, Agnes Irene Dorothee
2009-01-01
limit, dependent on orbital phase, were determined for the energy range 25-200 keV. For the inferior conjunction phase, also a spectrum was obtained and found to be well described by a power law with a photon index of Γ = 2.0 ± 0.2. Our main result is that the hard X-ray emission is modulated with the orbit and this modulation is comparatively in phase with the TeV emission. Although the results of the INTEGRAL analysis are not able to distinguish between the microquasar and the pulsar scenario, they rule out a simple explanation of the TeV variability as a consequence of pure photon-photon absorption. In our work we, therefore, discuss possible alternatives like adiabatic cooling of the electrons as a reason for the correlated modulation. In this case the variability is simply a result of the orbital motion and the larger factor of modulation in the TeV range is caused by additional processes like γ-γ absorption and anisotropic inverse Compton scattering. In the second part of this thesis, the keV - TeV connection of three rotationpowered pulsar wind nebulae (RPWN) is studied. The analysis is focussed on RPWN which have been detected as TeV plerions and two mosaics are created which include PSR J0835-4510 (Vela), PSR J1513-5908 (MSH 15-52) and PSR J1420-6048 (Kookaburra). Only a few per cent of the RPWN observed by INTEGRAL have been identified with young or middle-aged pulsars. The analysis of archival INTEGRAL data, in addition to the already known INTEGRAL sources, reveals an evidence of hard X-ray emission at the position of PSR J1420-6048 from the ''Kookaburra'' TeV plerion G313.3+0.6. The pulsar PSR J1420-6048 belongs to the class of middle-aged pulsars where the RPWN interacts with the reverse shock of the supernova remnant. Altogether, this analysis indicates a deeper link between these TeV plerions and INTEGRAL detected pulsar wind nebulae. The last part of the thesis is devoted to a systematic analysis of the mosaic obtained for the region around LS 5039
Energy Technology Data Exchange (ETDEWEB)
Hoffmann, Agnes Irene Dorothee
2009-11-13
flux limit, dependent on orbital phase, were determined for the energy range 25-200 keV. For the inferior conjunction phase, also a spectrum was obtained and found to be well described by a power law with a photon index of {gamma} = 2.0 {+-} 0.2. Our main result is that the hard X-ray emission is modulated with the orbit and this modulation is comparatively in phase with the TeV emission. Although the results of the INTEGRAL analysis are not able to distinguish between the microquasar and the pulsar scenario, they rule out a simple explanation of the TeV variability as a consequence of pure photon-photon absorption. In our work we, therefore, discuss possible alternatives like adiabatic cooling of the electrons as a reason for the correlated modulation. In this case the variability is simply a result of the orbital motion and the larger factor of modulation in the TeV range is caused by additional processes like {gamma}-{gamma} absorption and anisotropic inverse Compton scattering. In the second part of this thesis, the keV - TeV connection of three rotationpowered pulsar wind nebulae (RPWN) is studied. The analysis is focussed on RPWN which have been detected as TeV plerions and two mosaics are created which include PSR J0835-4510 (Vela), PSR J1513-5908 (MSH 15-52) and PSR J1420-6048 (Kookaburra). Only a few per cent of the RPWN observed by INTEGRAL have been identified with young or middle-aged pulsars. The analysis of archival INTEGRAL data, in addition to the already known INTEGRAL sources, reveals an evidence of hard X-ray emission at the position of PSR J1420-6048 from the ''Kookaburra'' TeV plerion G313.3+0.6. The pulsar PSR J1420-6048 belongs to the class of middle-aged pulsars where the RPWN interacts with the reverse shock of the supernova remnant. Altogether, this analysis indicates a deeper link between these TeV plerions and INTEGRAL detected pulsar wind nebulae. The last part of the thesis is devoted to a systematic analysis of the
TH-F-209-01: Pitfalls: Reliability and Performance of Diagnostic X-Ray Sources
International Nuclear Information System (INIS)
Behling, R.
2016-01-01
Purpose: Performance and reliability of medical X-ray tubes for imaging are crucial from an ethical, clinical and economic perspective. This lecture will deliver insight into the aspects to consider during the decision making process to invest in X-ray imaging equipment. Outdated metric still hampers realistic product comparison. It is time to change this and to comply with latest standards, which consider current technology. Failure modes and ways to avoid down-time of the equipment shall be discussed. In view of the increasing number of interventional procedures and the hazards associated with ionizing radiation, toxic contrast agents, and the combination thereof, the aspect of system reliability is of paramount importance. Methods: A comprehensive picture of trends for different modalities (CT, angiography, general radiology) has been drawn and led to the development of novel X-ray tube technology. Results: Recent X-ray tubes feature enhanced reliability and unprecedented performance. Relevant metrics for product comparison still have to be implemented in practice. Conclusion: The speed of scientific and industrial development of new diagnostic and therapeutic X-ray sources remains tremendous. Still, users suffer from gaps between desire and reality in day-to-day diagnostic routine. X-ray sources are still limiting cutting-edge medical procedures. Side-effects of wear and tear, limitations of the clinical work flow, costs, the characteristics of the X-ray spectrum and others topics need to be further addressed. New applications and modalities, like detection-based color-resolved X-ray and phase-contrast / dark-field imaging will impact the course of new developments of X-ray sources. Learning Objectives: Understand the basic requirements on medical diagnostic X-ray sources per modality Learn to select the optimal equipment employing state-of-the-art metric Know causes of failures, depending on the way X-ray sources are operated Understand methods to remediate
TH-F-209-00: Pitfalls: Reliability and Performance of Diagnostic X-Ray Sources
International Nuclear Information System (INIS)
2016-01-01
Purpose: Performance and reliability of medical X-ray tubes for imaging are crucial from an ethical, clinical and economic perspective. This lecture will deliver insight into the aspects to consider during the decision making process to invest in X-ray imaging equipment. Outdated metric still hampers realistic product comparison. It is time to change this and to comply with latest standards, which consider current technology. Failure modes and ways to avoid down-time of the equipment shall be discussed. In view of the increasing number of interventional procedures and the hazards associated with ionizing radiation, toxic contrast agents, and the combination thereof, the aspect of system reliability is of paramount importance. Methods: A comprehensive picture of trends for different modalities (CT, angiography, general radiology) has been drawn and led to the development of novel X-ray tube technology. Results: Recent X-ray tubes feature enhanced reliability and unprecedented performance. Relevant metrics for product comparison still have to be implemented in practice. Conclusion: The speed of scientific and industrial development of new diagnostic and therapeutic X-ray sources remains tremendous. Still, users suffer from gaps between desire and reality in day-to-day diagnostic routine. X-ray sources are still limiting cutting-edge medical procedures. Side-effects of wear and tear, limitations of the clinical work flow, costs, the characteristics of the X-ray spectrum and others topics need to be further addressed. New applications and modalities, like detection-based color-resolved X-ray and phase-contrast / dark-field imaging will impact the course of new developments of X-ray sources. Learning Objectives: Understand the basic requirements on medical diagnostic X-ray sources per modality Learn to select the optimal equipment employing state-of-the-art metric Know causes of failures, depending on the way X-ray sources are operated Understand methods to remediate
TH-F-209-01: Pitfalls: Reliability and Performance of Diagnostic X-Ray Sources
Energy Technology Data Exchange (ETDEWEB)
Behling, R. [Philips Medical Systems DMC GmbH (United States)
2016-06-15
Purpose: Performance and reliability of medical X-ray tubes for imaging are crucial from an ethical, clinical and economic perspective. This lecture will deliver insight into the aspects to consider during the decision making process to invest in X-ray imaging equipment. Outdated metric still hampers realistic product comparison. It is time to change this and to comply with latest standards, which consider current technology. Failure modes and ways to avoid down-time of the equipment shall be discussed. In view of the increasing number of interventional procedures and the hazards associated with ionizing radiation, toxic contrast agents, and the combination thereof, the aspect of system reliability is of paramount importance. Methods: A comprehensive picture of trends for different modalities (CT, angiography, general radiology) has been drawn and led to the development of novel X-ray tube technology. Results: Recent X-ray tubes feature enhanced reliability and unprecedented performance. Relevant metrics for product comparison still have to be implemented in practice. Conclusion: The speed of scientific and industrial development of new diagnostic and therapeutic X-ray sources remains tremendous. Still, users suffer from gaps between desire and reality in day-to-day diagnostic routine. X-ray sources are still limiting cutting-edge medical procedures. Side-effects of wear and tear, limitations of the clinical work flow, costs, the characteristics of the X-ray spectrum and others topics need to be further addressed. New applications and modalities, like detection-based color-resolved X-ray and phase-contrast / dark-field imaging will impact the course of new developments of X-ray sources. Learning Objectives: Understand the basic requirements on medical diagnostic X-ray sources per modality Learn to select the optimal equipment employing state-of-the-art metric Know causes of failures, depending on the way X-ray sources are operated Understand methods to remediate
TH-F-209-00: Pitfalls: Reliability and Performance of Diagnostic X-Ray Sources
Energy Technology Data Exchange (ETDEWEB)
NONE
2016-06-15
Purpose: Performance and reliability of medical X-ray tubes for imaging are crucial from an ethical, clinical and economic perspective. This lecture will deliver insight into the aspects to consider during the decision making process to invest in X-ray imaging equipment. Outdated metric still hampers realistic product comparison. It is time to change this and to comply with latest standards, which consider current technology. Failure modes and ways to avoid down-time of the equipment shall be discussed. In view of the increasing number of interventional procedures and the hazards associated with ionizing radiation, toxic contrast agents, and the combination thereof, the aspect of system reliability is of paramount importance. Methods: A comprehensive picture of trends for different modalities (CT, angiography, general radiology) has been drawn and led to the development of novel X-ray tube technology. Results: Recent X-ray tubes feature enhanced reliability and unprecedented performance. Relevant metrics for product comparison still have to be implemented in practice. Conclusion: The speed of scientific and industrial development of new diagnostic and therapeutic X-ray sources remains tremendous. Still, users suffer from gaps between desire and reality in day-to-day diagnostic routine. X-ray sources are still limiting cutting-edge medical procedures. Side-effects of wear and tear, limitations of the clinical work flow, costs, the characteristics of the X-ray spectrum and others topics need to be further addressed. New applications and modalities, like detection-based color-resolved X-ray and phase-contrast / dark-field imaging will impact the course of new developments of X-ray sources. Learning Objectives: Understand the basic requirements on medical diagnostic X-ray sources per modality Learn to select the optimal equipment employing state-of-the-art metric Know causes of failures, depending on the way X-ray sources are operated Understand methods to remediate
Characterization of a pulsed x-ray source for fluorescent lifetime measurements
International Nuclear Information System (INIS)
Blankespoor, S.C.; Derenzo, S.E.; Moses, W.W.; Rossington, C.S.; Ito, M.; Oba, K.
1994-01-01
To search for new, fast, inorganic scintillators, the authors have developed a bench-top pulsed x-ray source for determining fluorescent lifetimes and wavelengths of compounds in crystal or powdered form. This source uses a light-excited x-ray tube which produces x-rays when light from a laser diode strikes its photocathode. The x-ray tube has a tungsten anode, a beryllium exit window, a 30 kV maximum tube bias, and a 50 μA maximum average cathode current. The laser produces 3 x 10 7 photons at 650 nm per ∼100 ps pulse, with up to 10 7 pulses/sec. The time spread for the laser diode, x-ray tube, and a microchannel plate photomultiplier tube is less than 120 ps fwhm. The mean x-ray energy at tube biases of 20, 25, and 30 kV is 9.4, 10.3, and 11.1 keV, respectively. The authors measured 140, 230, and 330 x-ray photons per laser diode pulse per steradian, at tube biases of 20, 25, and 30 kV, respectively. Background x-rays due to dark current occur at a rate of 1 x 10 6 and 3 x 10 6 photons/sec/steradian at biases of 25 and 30 kV, respectively. Data characterizing the x-ray output with an aluminum filter in the x-ray beam are also presented
A preliminary study of synchrotron light sources for x-ray lithography
International Nuclear Information System (INIS)
Hoffmann, C.R.; Bigham, C.B.; Ebrahim, N.A.; Sawicki, J.A.; Taylor, T.
1989-02-01
A preliminary study of synchrotron light sources has been made, primarily oriented toward x-ray lithography. X-ray lithography is being pursued vigorously in several countries, with a goal of manufacturing high-density computer chips (0.25 μm feature sizes), and may attain commercial success in the next decade. Many other applications of soft x-rays appear worthy of investigation as well. The study group visited synchrotron radiation facilities and had discussions with members of the synchrotron radiation community, particularly Canadians. It concluded that accelerator technology for a conventional synchrotron light source appropriate for x-ray lithography is well established and is consistent with skills and experience at Chalk River Nuclear Laboratories. Compact superconducting systems are being developed also. Their technical requirements overlap with capabilities at Chalk River. (32 refs)
In-situ X-ray diffraction system using sources and detectors at fixed angular positions
Gibson, David M [Voorheesville, NY; Gibson, Walter M [Voorheesville, NY; Huang, Huapeng [Latham, NY
2007-06-26
An x-ray diffraction technique for measuring a known characteristic of a sample of a material in an in-situ state. The technique includes using an x-ray source for emitting substantially divergent x-ray radiation--with a collimating optic disposed with respect to the fixed source for producing a substantially parallel beam of x-ray radiation by receiving and redirecting the divergent paths of the divergent x-ray radiation. A first x-ray detector collects radiation diffracted from the sample; wherein the source and detector are fixed, during operation thereof, in position relative to each other and in at least one dimension relative to the sample according to a-priori knowledge about the known characteristic of the sample. A second x-ray detector may be fixed relative to the first x-ray detector according to the a-priori knowledge about the known characteristic of the sample, especially in a phase monitoring embodiment of the present invention.
A Study on Mono-energetic Beam Source Using Characteristic X-ray for Substance Identification System
International Nuclear Information System (INIS)
Lee, Hwan Soo
2009-02-01
A new mono-energetic beam source was developed by using characteristic X-ray for improving performance of the substance identification system. Most of inspection systems use X-ray tubes for their source modules. However, the broad energy spectrum of X-ray tube causes an increase of uncertainty. In this study, it was found that mono-energetic beam sources can be generated by using X-ray tube and the designed target filter assembly. In order to investigate the monoenergetic beam source, the sensitivity study was conducted with a series of different X-ray tube potentials, radiator and filter materials using Monte Carlo simulation. The developed beam sources have a mono-energy peak at 69 keV, 78 keV and 99 keV, and they are named as characteristic X-ray beam BEAM69, BEAM78 and BEAM99, respectively. The characteristic X-ray beam intensity was over thirty three times more than that of hardening beam used previous work at Hanyang University. And BEAM69 and BEAM99 were applied to the substance identification system as a source. The relative error between results of characteristic X-ray beams and 69 keV and 99 keV photons was about 2% on the average for five unknown materials. In comparison with experiment results by using hardening beam, characteristic X-ray beam achieves better accuracy which is about 6.46 % on the average. Hence, it is expected that the developed characteristic X-ray beam source helps lower uncertainty of the inspection system, and the inspection time will be reduced considerably due to its high beam intensity
Toward Femtosecond X-ray Spectroscopy at the Advanced Light Source
International Nuclear Information System (INIS)
Chong, Henry Herng Wei
2004-01-01
The realization of tunable, ultrashort pulse x-ray sources promises to open new venues of science and to shed new light on long-standing problems in condensed matter physics and chemistry. Fundamentally new information can now be accessed. Used in a pump-probe spectroscopy, ultrashort x-ray pulses provide a means to monitor atomic rearrangement and changes in electronic structure in condensed-matter and chemical systems on the physically-limiting time-scales of atomic motion. This opens the way for the study of fast structural dynamics and the role they play in phase transitions, chemical reactions and the emergence of exotic properties in materials with strongly interacting degrees of freedom. The ultrashort pulse x-ray source developed at the Advanced Light Source at the Lawrence Berkeley Laboratory is based on electron slicing in storage rings, and generates ∼100 femtosecond pulses of synchrotron radiation spanning wavelengths from the far-infrared to the hard x-ray region of the electromagnetic spectrum. The tunability of the source allows for the adaptation of a broad range of static x-ray spectroscopies to useful pump-probe measurements. Initial experiments are attempted on transition metal complexes that exhibit relatively large structural changes upon photo-excitation and which have excited-state evolution determined by strongly interacting structural, electronic and magnetic degrees of freedom. Specifically, iron(II) complexes undergo a spin-crossover transition upon optical irradiation. The dynamics of the transition involve a metal-to-ligand charge transfer, a ΔS = 2 change in magnetic moment and 10% bond dilation in the first coordination shell of the iron. Studies of the electronic dynamics are studied with time-resolved optical absorption measurements. The current progress of time-resolved structural studies to complete the picture of the spin-crossover transition is presented
Recent status on cobalt-60 gamma ray radiation sources production and its application in China
International Nuclear Information System (INIS)
Cao Zhijian; Song Yunjiang; Zhang Chunhua; Li Maoling
1993-01-01
This paper describes the status of Co-60 γ ray radiation sources and their application in China. At present, the production capacity of Co-60 γ ray radiation sources in China is about 11.1 PBq (0.3 MCi) per year. 5 years later, it is increased to 37 PBq (1 MCi) per year. The radioactivity of each source is 370 TBq - 740 TBq (1000-2000 Ci). There are over 150 Co-60 γ ray radiation facilities with total design capacity of over 370 PBq (10 MCi) and practical capacity of about 92.5 PBq (2.5 MCi) in operation. The number of Co-60 γ ray radiation facilities with practical capacity of over 3.7 PBq (0.1 MCi) is 14. The main applications of the Co-60 γ ray sources are radiation crosslinking, radiation sterilization of disposable medical supplies and food irradiation. The prospects for Co-60 γ ray radiation source application in China are good. (author)
International Nuclear Information System (INIS)
Sun Yuanming; Li Jin; Wang Qin; Tang Weisheng; Wang Zhiquan
2002-01-01
Objective: FISH is the most effective way of detecting chromosome aberration and many factors affect its accuracy. G-banding is used to verify the results of early X-ray workers' chromosome translocation examined by FISH. Methods: The chromosome translocations of early X-ray workers have been analysed by FISH (fluorescence in situ hybridization) and G-banding, yields of translocation treated with statistics. Results: The chromosome aberrations frequencies by tow methods are closely related. Conclusion: FISH is a feasible way to analyse chromosome aberrations of X-ray workers and reconstruct dose
Insights into the Galactic Cosmic-ray Source from the TIGER Experiment
Link, Jason T.; Barbier, L. M.; Binns, W. R.; Christian, E. R.; Cummings, J. R.; Geier, S.; Israel, M. H.; Lodders, K.; Mewaldt,R. A.; Mitchell, J. W.;
2009-01-01
We report results from 50 days of data accumulated in two Antarctic flights of the Trans-Iron Galactic Element Recorder (TIGER). With a detector system composed of scintillators, Cherenkov detectors, and scintillating optical fibers, TIGER has a geometrical acceptance of 1.7 sq m sr and a charge resolution of 0.23 cu at Iron. TIGER has obtained abundance measurements of some of the rare galactic cosmic rays heavier than iron, including Zn, Ga, Ge, Se, and Sr, as well as the more abundant lighter elements (down to Si). The heavy elements have long been recognized as important probes of the nature of the galactic cosmic-ray source and accelerator. After accounting for fragmentation of cosmic-ray nuclei as they propagate through the Galaxy and the atmosphere above the detector system, the TIGER source abundances are consistent with a source that is a mixture of about 20% ejecta from massive stars and 80% interstellar medium with solar system composition. This result supports a model of cosmic-ray origin in OB associations previously inferred from ACE-CRIS data of more abundant lighter elements. These TIGER data also support a cosmic-ray acceleration model in which elements present in interstellar grains are accelerated preferentially compared with those found in interstellar gas.
Hard X-ray balloon observations of compact galactic and extragalactic X-ray sources
International Nuclear Information System (INIS)
Staubert, R.; Kendziorra, E.; Pietsch, W.; Proctor, R.J.; Reppin, C.; Steinle, H.; Truemper, J.; Voges, W.
1981-01-01
A balloon program in hard X-ray astronomy (20-200 keV) is jointly pursued by the Astronomisches Institut der Universitaet Tuebingen (AIT) and the Max Planck-Institut fuer Extraterrestrische Physik in Garching (MPE). Since 1973 nine succussful balloon flights have been performed from Texas and Australia. Here results on Centaurus A and on several galactic binary X-ray sources are summarized. In particular the high energy photon spectrum of Hercules X-1 and the evidence for the cyclotron line feature which was discovered by us in 1976 is reviewed. (orig.)
SEARCHING FOR OVERIONIZED PLASMA IN THE GAMMA-RAY-EMITTING SUPERNOVA REMNANT G349.7+0.2
Energy Technology Data Exchange (ETDEWEB)
Ergin, T.; Sezer, A. [TUBITAK Space Technologies Research Institute, ODTU Campus, 06531, Ankara (Turkey); Saha, L.; Majumdar, P. [Saha Institute of Nuclear Physics, Kolkata, West Bengal 700064 (India); Gök, F. [Akdeniz University, Faculty of Education, Department of Secondary Science and Mathematics Education, Antalya, 07058 (Turkey); Ercan, E. N., E-mail: tulun.ergin@tubitak.gov.tr [Bogazici University, Physics Department, Bebek, 34342, Istanbul (Turkey)
2015-05-10
G349.7+0.2 is a supernova remnant (SNR) expanding in a dense medium of molecular clouds and interacting with clumps of molecular material emitting gamma-rays. We analyzed the gamma-ray data of the Large Area Telescope on board the Fermi Gamma-Ray Space Telescope and detected G349.7+0.2 in the energy range of 0.2–300 GeV with a significance of ∼13σ, showing no extended morphology. Modeling of the gamma-ray spectrum revealed that the GeV gamma-ray emission dominantly originates from the decay of neutral pions, where the protons follow a broken power-law distribution with a spectral break at ∼12 GeV. To search for features of radiative recombination continua in the eastern and western regions of the remnant, we analyzed the Suzaku data of G349.7+0.2 and found no evidence for overionized plasma. In this paper, we discuss possible scenarios to explain the hadronic gamma-ray emission in G349.7+0.2 and the mixed morphology nature of this SNR.
The Einstein objective grating spectrometer survey of galactic binary X-ray sources
Vrtilek, S. D.; Mcclintock, J. E.; Seward, F. D.; Kahn, S. M.; Wargelin, B. J.
1991-01-01
The results of observations of 22 bright Galactic X-ray point sources are presented, and the most reliable measurements to date of X-ray column densities to these sources are derived. The results are consistent with the idea that some of the objects have a component of column density intrinsic to the source in addition to an interstellar component. The K-edge absorption due to oxygen is clearly detected in 10 of the sources and the Fe L and Ne K edges are detected in a few. The spectra probably reflect emission originating in a collisionally excited region combined with emission from a photoionized region excited directly by the central source.
The superconducting x-ray lithography source program at Brookhaven
Energy Technology Data Exchange (ETDEWEB)
Williams, G. P.; Heese, R. N.; Vignola, G.; Murphy, J. B.; Godel, J. B.; Hsieh, H.; Galayda, J.; Seifert, A.; Knotek, M. L.
1989-07-01
A compact electron storage ring with superconducting dipole magnets, is being developed at the National Synchrotron Light Source at Brookhaven. The parameters of the source have been optimized for its future use as an x-ray source for lithography. This first ring is a prototype which will be used to study the operating characteristics of machines of this type with particular attention being paid to low-energy injection and long beam lifetime.
Pulsars as the sources of high energy cosmic ray positrons
International Nuclear Information System (INIS)
Hooper, Dan; Blasi, Pasquale; Serpico, Pasquale Dario
2009-01-01
Recent results from the PAMELA satellite indicate the presence of a large flux of positrons (relative to electrons) in the cosmic ray spectrum between approximately 10 and 100 GeV. As annihilating dark matter particles in many models are predicted to contribute to the cosmic ray positron spectrum in this energy range, a great deal of interest has resulted from this observation. Here, we consider pulsars (rapidly spinning, magnetized neutron stars) as an alternative source of this signal. After calculating the contribution to the cosmic ray positron and electron spectra from pulsars, we find that the spectrum observed by PAMELA could plausibly originate from such sources. In particular, a significant contribution is expected from the sum of all mature pulsars throughout the Milky Way, as well as from the most nearby mature pulsars (such as Geminga and B0656+14). The signal from nearby pulsars is expected to generate a small but significant dipole anisotropy in the cosmic ray electron spectrum, potentially providing a method by which the Fermi gamma-ray space telescope would be capable of discriminating between the pulsar and dark matter origins of the observed high energy positrons
Phase contrast imaging using a micro focus x-ray source
Zhou, Wei; Majidi, Keivan; Brankov, Jovan G.
2014-09-01
Phase contrast x-ray imaging, a new technique to increase the imaging contrast for the tissues with close attenuation coefficients, has been studied since mid 1990s. This technique reveals the possibility to show the clear details of the soft tissues and tumors in small scale resolution. A compact and low cost phase contrast imaging system using a conventional x-ray source is described in this paper. Using the conventional x-ray source is of great importance, because it provides the possibility to use the method in hospitals and clinical offices. Simple materials and components are used in the setup to keep the cost in a reasonable and affordable range.Tungsten Kα1 line with the photon energy 59.3 keV was used for imaging. Some of the system design details are discussed. The method that was used to stabilize the system is introduced. A chicken thigh bone tissue sample was used for imaging followed by the image quality, image acquisition time and the potential clinical application discussion. High energy x-ray beam can be used in phase contrast imaging. Therefore the radiation dose to the patients can be greatly decreased compared to the traditional x-ray radiography.
International Nuclear Information System (INIS)
Rodriguez, Jerome
2010-01-01
In this HDR (Accreditation to supervise research) report, the author proposes an overview of his research works in the field of accretion of X-ray binaries. After a presentation of X-ray binaries, neutron stars and black holes, micro-quasars, and of the main issues regarding X-ray binaries, the author presents and comments his activities in X-ray astronomy and gamma-ray astronomy (the INTEGRAL observatory, the discovery of new sources of X and gamma radiation, studies of new sources at different wavelengths). The second part addresses the understanding of source accretion: phenomenological studies in astronomy, relationships between accretion and ejection. The third part presents and comments several studies of the physics of phenomena related to matter accretion and ejection. (author) [fr
X-ray micro-Tomography at the Advanced Light Source
The X-ray micro-Tomography Facility at the Advanced Light Source has been in operation since 2004. The source is a superconducting bend magnet of critical energy 10.5KeV; photon energy coverage is 8-45 KeV in monochromatic mode, and a filtered white light option yields useful photons up to 50 KeV. A...
Microfocus x-ray imaging of traceable pointlike {sup 22}Na sources for quality control
Energy Technology Data Exchange (ETDEWEB)
Hasegawa, T.; Oda, K.; Sato, Y.; Ito, H.; Masuda, S.; Yamada, T.; Matsumoto, M.; Murayama, H.; Takei, H. [Allied Health Sciences, Kitasato University Kitasato 1-15-1, Minami-ku, Sagamihara-shi, Kanagawa 252-0373 (Japan); Positron Medical Center, Tokyo Metropolitan Institute of Gerontology Sakaecho 35-2, Itabashi-ku, Tokyo 173-0015 (Japan); Advanced Industrial Science and Technology (AIST) Central 2, Umezono 1-1-1, Tsukuba-shi, Ibaraki 305-8568 (Japan); Kanagawa Industrial Technology Center (KITC) Shimoimazumi 705-1, Ebina-shi, Kanagawa 243-0435 (Japan); Japan Radioisotope Association (JRIA) Komagome 2-28-45, Bunkyo-ku, Tokyo 113-8941 (Japan); Molecular Imaging Center, National Institute of Radiological Sciences Anagawa 4-9-1, Inage, Chiba 263-8555 (Japan); Graduate School of Medical Sciences, Kitasato University Kitasato 1-15-1, Minami-ku, Sagamihara-shi, Kanagawa 252-0373 (Japan)
2012-07-15
Purpose: The purpose of this study is to propose a microfocus x-ray imaging technique for observing the internal structure of small radioactive sources and evaluating geometrical errors quantitatively, and to apply this technique to traceable pointlike {sup 22}Na sources, which were designed for positron emission tomography calibration, for the purpose of quality control of the pointlike sources. Methods: A microfocus x-ray imaging system with a focus size of 0.001 mm was used to obtain projection x-ray images and x-ray CT images of five pointlike source samples, which were manufactured during 2009-2012. The obtained projection and tomographic images were used to observe the internal structure and evaluate geometrical errors quantitatively. Monte Carlo simulation was used to evaluate the effect of possible geometrical errors on the intensity and uniformity of 0.511 MeV annihilation photon pairs emitted from the sources. Results: Geometrical errors were evaluated with sufficient precision using projection x-ray images. CT images were used for observing the internal structure intuitively. As a result, four of the five examined samples were within the tolerance to maintain the total uncertainty below {+-}0.5%, given the source radioactivity; however, one sample was found to be defective. Conclusions: This quality control procedure is crucial and offers an important basis for using the pointlike {sup 22}Na source as a basic calibration tool. The microfocus x-ray imaging approach is a promising technique for visual and quantitative evaluation of the internal geometry of small radioactive sources.
Discovery of a highly variable dipping ultraluminous X-ray source in M94
Energy Technology Data Exchange (ETDEWEB)
Lin, Dacheng; Irwin, Jimmy A. [Department of Physics and Astronomy, University of Alabama, Box 870324, Tuscaloosa, AL 35487 (United States); Webb, Natalie A.; Barret, Didier [CNRS, IRAP, 9 avenue du Colonel Roche, BP 44346, F-31028 Toulouse Cedex 4 (France); Remillard, Ronald A., E-mail: dlin@ua.edu [MIT Kavli Institute for Astrophysics and Space Research, MIT, 70 Vassar Street, Cambridge, MA 02139-4307 (United States)
2013-12-20
We report the discovery of a new ultraluminous X-ray source (ULX) 2XMM J125048.6+410743 within the spiral galaxy M94. The source has been observed by ROSAT, Chandra, and XMM-Newton on several occasions, exhibiting as a highly variable persistent source or a recurrent transient with a flux variation factor of ≳100, a high duty cycle (at least ∼70%), and a peak luminosity of L {sub X} ∼ 2 × 10{sup 39} erg s{sup –1} (0.2-10 keV, absorbed). In the brightest observation, the source is similar to typical low-luminosity ULXs, with the spectrum showing a high-energy cutoff but harder than that from a standard accretion disk. There are also sporadical short dips, accompanied by spectral softening. In a fainter observation with L {sub X} ∼ 3.6 × 10{sup 38} erg s{sup –1}, the source appears softer and is probably in the thermal state seen in Galactic black hole X-ray binaries (BHBs). In an even fainter observation (L {sub X} ∼ 9 × 10{sup 37} erg s{sup –1}), the spectrum is harder again, and the source might be in the steep-power-law state or the hard state of BHBs. In this observation, the light curve might exhibit ∼7 hr (quasi-)periodic large modulations over two cycles. The source also has a possible point-like optical counterpart from Hubble Space Telescope images. In terms of the colors and the luminosity, the counterpart is probably a G8 supergiant or a compact red globular cluster containing ∼2 × 10{sup 5} K dwarfs, with some possible weak UV excess that might be ascribed to accretion activity. Thus, our source is a candidate stellar-mass BHB with a supergiant companion or with a dwarf companion residing in a globular cluster. Our study supports that some low-luminosity ULXs are supercritically accreting stellar-mass BHBs.
Soft x-ray source by laser produced Xe plasma
International Nuclear Information System (INIS)
Amano, Sho; Masuda, Kazuya; Miyamoto, Shuji; Mochizuki, Takayasu
2010-01-01
The laser plasma soft X-ray source in the wavelength rage of 5-17 nm was developed, which consisted of the rotating drum system supplying cryogenic Xe target and the high repetition rate pulse Nd:YAG slab laser. We found the maximum conversion efficiency of 30% and it demonstrated the soft X-ray generation with the high repetition rate pulse of 320 pps and the high average power of 20 W. The soft X-ray cylindrical mirror was developed and successfully focused the soft X-ray with an energy intensity of 1.3 mJ/cm 2 . We also succeeded in the plasma debris mitigation with Ar gas. This will allow a long lifetime of the mirror and a focusing power intensity of 400 mW/cm 2 with 320 pps. The high power soft X-ray is useful for various applications. (author)
A discussion of the eccentric binary hypothesis for transient X-ray sources
International Nuclear Information System (INIS)
Avni, Y.; Goldman, I.
1979-01-01
The eccentric binary hypothesis for transient x-ray sources in the framework of the gradual acceleration stellar wind model proposed by Barlow and Cohen is examined. It is found that a consideration of the ratio of maximum to minimum luminosities and of the ratio of the durations of the high and low states, for a typical transient x-ray source, yields a rather high eccentricity, despite the gradual acceleration of the wind. When typical physical parameters for the binary members are taken into account, we find that a consistent description is possible only for very eccentric orbits (e>=0.9), thus the model is inadequate as a general explanation of the x-ray transient phenomenon. The recurrent transient x-ray source 4U 1630-47, which was considered in ihe past to be a realization of the eccentric binary model is studied and it is demonstrated that it cannot be described consistently within the framework of the model, unless the optical primary is very peculiar. (author)
Design Considerations of a Virtual Laboratory for Advanced X-ray Sources
Luginsland, J. W.; Frese, M. H.; Frese, S. D.; Watrous, J. J.; Heileman, G. L.
2004-11-01
The field of scientific computation has greatly advanced in the last few years, resulting in the ability to perform complex computer simulations that can predict the performance of real-world experiments in a number of fields of study. Among the forces driving this new computational capability is the advent of parallel algorithms, allowing calculations in three-dimensional space with realistic time scales. Electromagnetic radiation sources driven by high-voltage, high-current electron beams offer an area to further push the state-of-the-art in high fidelity, first-principles simulation tools. The physics of these x-ray sources combine kinetic plasma physics (electron beams) with dense fluid-like plasma physics (anode plasmas) and x-ray generation (bremsstrahlung). There are a number of mature techniques and software packages for dealing with the individual aspects of these sources, such as Particle-In-Cell (PIC), Magneto-Hydrodynamics (MHD), and radiation transport codes. The current effort is focused on developing an object-oriented software environment using the Rational© Unified Process and the Unified Modeling Language (UML) to provide a framework where multiple 3D parallel physics packages, such as a PIC code (ICEPIC), a MHD code (MACH), and a x-ray transport code (ITS) can co-exist in a system-of-systems approach to modeling advanced x-ray sources. Initial software design and assessments of the various physics algorithms' fidelity will be presented.
Open-Source Based Testbed for Multioperator 4G/5G Infrastructure Sharing in Virtual Environments
Directory of Open Access Journals (Sweden)
Ricardo Marco Alaez
2017-01-01
Full Text Available Fourth-Generation (4G mobile networks are based on Long-Term Evolution (LTE technologies and are being deployed worldwide, while research on further evolution towards the Fifth Generation (5G has been recently initiated. 5G will be featured with advanced network infrastructure sharing capabilities among different operators. Therefore, an open-source implementation of 4G/5G networks with this capability is crucial to enable early research in this area. The main contribution of this paper is the design and implementation of such a 4G/5G open-source testbed to investigate multioperator infrastructure sharing capabilities executed in virtual architectures. The proposed design and implementation enable the virtualization and sharing of some of the components of the LTE architecture. A testbed has been implemented and validated with intensive empirical experiments conducted to validate the suitability of virtualizing LTE components in virtual infrastructures (i.e., infrastructures with multitenancy sharing capabilities. The impact of the proposed technologies can lead to significant saving of both capital and operational costs for mobile telecommunication operators.
New hard X-ray sources at 380 declination
International Nuclear Information System (INIS)
Ubertini, P.; Bazzano, A.; La Padula, C.; Polcaro, V.F.
1981-01-01
We report the detection of three new hard X-rays sources emitting in the range 15-150 KeV. Their observation was carried out by means of a balloon borne payload, consisting of two large area high spectral resolution Multiwire Spectroscopic Proportional Counters. (orig.)
VizieR Online Data Catalog: ChaMP X-ray point source catalog (Kim+, 2007)
Kim, M.; Kim, D.-W.; Wilkes, B. J.; Green, P. J.; Kim, E.; Anderson, C. S.; Barkhouse, W. A.; Evans, N. R.; Ivezic, Z.; Karovska, M.; Kashyap, V. L.; Lee, M. G.; Maksym, P.; Mossman, A. E.; Silverman, J. D.; Tananbaum, H. D.
2009-01-01
We present the Chandra Multiwavelength Project (ChaMP) X-ray point source catalog with ~6800 X-ray sources detected in 149 Chandra observations covering ~10deg2. The full ChaMP catalog sample is 7 times larger than the initial published ChaMP catalog. The exposure time of the fields in our sample ranges from 0.9 to 124ks, corresponding to a deepest X-ray flux limit of f0.5-8.0=9x10-16ergs/cm2/s. The ChaMP X-ray data have been uniformly reduced and analyzed with ChaMP-specific pipelines and then carefully validated by visual inspection. The ChaMP catalog includes X-ray photometric data in eight different energy bands as well as X-ray spectral hardness ratios and colors. To best utilize the ChaMP catalog, we also present the source reliability, detection probability, and positional uncertainty. (10 data files).
X-ray stress measurement by use of synchrotron radiation source
International Nuclear Information System (INIS)
Yoshioka, Yasuo; Matsui, Hisaaki; Moro-oka, Toshimasa; Hasegawa, Ken-ichi; Nakajima, Tetsuo.
1986-01-01
In the field of X-ray stress measurement of polycrystalline materials, a diffraction plane at higher Bragg angle has to be selected in order to obtain the precise value of stress. However, the stress measurement on an optional (hkl) plane desired is not always possible because the X-ray beam exited from a metal target has a dispersive wave length. Recently, we have been able to use the synchrotron radiation source (SR) as an excellent X-ray source. In Japan, the facility of synchrotron radiation (Photon Factory, PF) was constructed in the National Laboratory for High Energy Physics (KEK) at Tsukuba academic city. The use of this SR enables the stress measurements on many (hkl) planes with high accuracy in the higher Bragg angle region by providing an X-ray beam having an optional wave length. We have started the X-ray stress analysis by use of the synchrotron radiation source. This paper reports the system of measurement and some results of preliminaly experiments. Since a monochromatic X-ray beam is required for the stress measurement, we used a beam line which consists of a double crystal monochrometer and a focusing mirror. X-rays between 4 KeV (λ = 0.31 nm) and 10 KeV (λ = 0.12 nm) are available with this optical system. We adopted a constant Bragg angle of 2θ = 154 deg for all the diffraction planes. A PSPC having a carbon fiber anode is made and used as a detector with the use of a fast digital signal processor. We could observe the diffraction profiles from (200), (211), (220), (310) and (321) crystal plane of alpha iron, respectively, and the residual stresses in these planes except the (200) plane were measured with high accuracy in a short time. Such feature especially suits the stress analysis of the material which has preferred orientation or stress gradient. (author)
From laser-plasma accelerators to femtosecond X-ray sources: study, development and applications
International Nuclear Information System (INIS)
Corde, S.
2012-01-01
During the relativistic interaction between a short and intense laser pulse and an underdense plasma, electrons can be injected and accelerated up to hundreds of MeV in an accelerating structure formed in the wake of the pulse: this is the so-called laser-plasma accelerator. One of the major perspectives for laser-plasma accelerators resides in the realization of compact sources of femtosecond x-ray beams. In this thesis, two x-ray sources was studied and developed. The betatron radiation, intrinsic to laser-plasma accelerators, comes from the transverse oscillations of electrons during their acceleration. Its characterization by photon counting revealed an x-ray beam containing 10"9 photons, with energies extending above 10 keV. We also developed an all-optical Compton source producing photons with energies up to hundreds of keV, based on the collision between a photon beam and an electron beam. The potential of these x-ray sources was highlighted by the realization of single shot phase contrast imaging of a biological sample. Then, we showed that the betatron x-ray radiation can be a powerful tool to study the physics of laser-plasma acceleration. We demonstrated the possibility to map the x-ray emission region, which gives a unique insight into the interaction, permitting us for example to locate the region where electrons are injected. The x-ray angular and spectral properties allow us to gain information on the transverse dynamics of electrons during their acceleration. (author)
Energy Technology Data Exchange (ETDEWEB)
Doert, Marlene [Technische Universitaet Dortmund (Germany); Ruhr-Universitaet Bochum (Germany); Einecke, Sabrina [Technische Universitaet Dortmund (Germany); Errando, Manel [Barnard College, Columbia University, New York City (United States)
2015-07-01
The second Fermi-LAT source catalog (2FGL) is the deepest all-sky survey of the gamma-ray sky currently available to the community. Out of the 1873 catalog sources, 576 remain unassociated. We present a search for active galactic nuclei (AGN) among these unassociated objects, which aims at a reduction of the number of unassociated gamma-ray sources and a more complete characterization of the population of gamma-ray emitting AGN. Our study uses two complimentary machine learning algorithms which are individually trained on the gamma-ray properties of associated 2FGL sources and thereafter applied to the unassociated sample. The intersection of the two methods yields a high-confidence sample of 231 AGN candidate sources. We estimate the performance of the classification by taking inherent differences between the samples of associated and unassociated 2FGL sources into account. A search for infra-red counterparts and first results from follow-up studies in the X-ray band using Swift satellite data for a subset of our AGN candidates are also presented.
Line x-ray source for diffraction enhanced imaging in clinical and industrial applications
Wang, Xiaoqin
Mammography is one type of imaging modalities that uses a low-dose x-ray or other radiation sources for examination of breasts. It plays a central role in early detection of breast cancers. The material similarity of tumor-cell and health cell, breast implants surgery and other factors, make the breast cancers hard to visualize and detect. Diffraction enhanced imaging (DEI), first proposed and investigated by D. Chapman is a new x-ray radiographic imaging modality using monochromatic x-rays from a synchrotron source, which produced images of thick absorbing objects that are almost completely free of scatter. It shows dramatically improved contrast over standard imaging when applied to the same phantom. The contrast is based not only on attenuation but also on the refraction and diffraction properties of the sample. This imaging method may improve image quality of mammography, other medical applications, industrial radiography for non-destructive testing and x-ray computed tomography. However, the size, and cost, of a synchrotron source limits the application of the new modality to be applicable at clinical levels. This research investigates the feasibility of a designed line x-ray source to produce intensity compatible to synchrotron sources. It is composed of a 2-cm in length tungsten filament, installed on a carbon steel filament cup (backing plate), as the cathode and a stationary oxygen-free copper anode with molybdenum coating on the front surface serves as the target. Characteristic properties of the line x-ray source were computationally studied and the prototype was experimentally investigated. SIMIION code was used to computationally study the electron trajectories emanating from the filament towards the molybdenum target. A Faraday cup on the prototype device, proof-of-principle, was used to measure the distribution of electrons on the target, which compares favorably to computational results. The intensities of characteristic x-ray for molybdenum
kHz femtosecond laser-plasma hard X-ray and fast ion source
International Nuclear Information System (INIS)
Thoss, A.; Korn, G.; Stiel, H.; Voigt, U.; Elsaesser, T.; Richardson, M.C.; Siders, C.W.; Faubel, M.
2002-01-01
We describe the first demonstration of a new stable, kHz femtosecond laser-plasma source of hard x-ray continuum and K α emission using a thin liquid metallic jet target. kHz femtosecond x-ray sources will find many applications in time-resolved x-ray diffraction and microscopy studies. As high intensity lasers become more compact and operate at increasingly high repetition-rates, they require a target configuration that is both repeatable from shot-to-shot and is debris-free. We have solved this requirement with the use of a fine (10-30 μm diameter) liquid metal jet target that provides a pristine, unperturbed filament surface at rates >100 kHz. A number of liquid metal targets are considered. We will show hard x-ray spectra recorded from liquid Ga targets that show the generation of the 9.3 keV and 10.3 keV, K α and K β lines superimposed on a multi-keV Bremsstrahlung continuum. This source was generated by a 50fs duration, 1 kHz, 2W, high intensity Ti:Sapphire laser. We will discuss the extension of this source to higher powers and higher repetition rates, providing harder x-ray emission, with the incorporation of pulse-shaping and other techniques to enhance the x-ray conversion efficiency. Using the same liquid target technology, we have also demonstrated the generation of forward-going sub-MeV protons from a 10 μm liquid water target at 1 kHz repetition rates. kHz sources of high energy ions will find many applications in time-resolved particle interaction studies, as well as lead to the efficient generation of short-lived isotopes for use in nuclear medicine and other applications. The protons were detected with CR-39 track detectors both in the forward and backward directions up to energies of ∼500 keV. As the intensity of compact high repetition-rate lasers sources increase, we can expect improvements in the energy, conversion efficiency and directionality to occur. The impact of these developments on a number of fields will be discussed. As compact
ANALYSIS OF A STATE CHANGING SUPERSOFT X-RAY SOURCE IN M31
Energy Technology Data Exchange (ETDEWEB)
Patel, B. [Department of Physics and Astronomy Rutgers, State University of New Jersey, Piscataway, NJ 08854-8019 (United States); Di Stefano, R.; Primini, F. A.; Liu, J.; Scoles, S. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Nelson, T. [Department of Physics, 1000 Hilltop Circle, University of Maryland at Baltimore, Baltimore, MD 21250 (United States)
2013-07-01
We report on observations of a luminous supersoft X-ray source (SSS) in M31, r1-25, that has exhibited spectral changes to harder X-ray states. We document these spectral changes. In addition, we show that they have important implications for modeling the source. Quasisoft states in a source that has been observed as an SSS represent a newly discovered phenomenon. We show how such state changers could prove to be examples of unusual black hole or neutron star accretors. Future observations of this and other state changers can provide the information needed to determine the nature(s) of these intriguing new sources.
Design and construction of the gamma ray transmission tomographer g-TAC-02
International Nuclear Information System (INIS)
Pavon Hernandez, Noriel; Ravelo Sanchez, Alberto; Idel, Pedro; Macias Perez, Rafael; Garcia Trapaga, Cesar; Campos Montenegro, Augusto
2000-01-01
An equipment for gamma ray transmission tomographer was designed and constructed in the Higher Institute of Nuclear Sciences and Technology. It was the g-TAC-01, based on a nuclear instrumentation, a mechanic instrumentation, and the control of the system from a personal computer. This first version permitted to obtain the know how of the technology of construction of equipment for tomography. The present work describes the second version of the gamma ray transmission tomographer: the g-TAC-02, with very important upgrading in the control session. Now the control system is a microcontroller based, electronic control system, designed to work in multiples forms: manual, automatic and with the computer
Development of Compact Soft X-ray Source Based on Laser Undulator
Kuroda, Ryunosuke; Minamiguchi, S; Saitô, T; Ueyama, D; Washio, Masakazu
2004-01-01
A compact soft X-ray source is required in various research fields such as material and biological science. The laser undulator based on backward Compton scattering has been developed as a compact soft X-ray source for the biological observation at Waseda University. It is performed in a water window region (250eV - 500 eV) using the interaction between 1047 nm Nd:YLF laser and 4 MeV high quality electron beam generated from rf gun system. The range of energy in the water window region has K-shell absorption edges of Oxygen, Carbon and Nitrogen, which mainly constitute of living body. Since the absorption coefficient of water is much smaller than the proteins coefficient in this range, a dehydration of the specimens is not necessary. As a preliminary experiment, about 300 eV X-ray generation was carried out. As next step, soft X-ray optics with zone plate was proposed for Soft X-ray microscopy. In this conference, we will report details and results of the experiment.
Long-term monitoring of blazars - the DWARF network
Backes, Michael; Biland, Adrian; Boller, Andrea; Braun, Isabel; Bretz, Thomas; Commichau, Sebastian; Commichau, Volker; Dorner, Daniela; von Gunten, Hanspeter; Gendotti, Adamo; Grimm, Oliver; Hildebrand, Dorothée; Horisberger, Urs; Krähenbühl, Thomas; Kranich, Daniel; Lustermann, Werner; Mannheim, Karl; Neise, Dominik; Pauss, Felicitas; Renker, Dieter; Rhode, Wolfgang; Rissi, Michael; Rollke, Sebastian; Röser, Ulf; Stark, Luisa Sabrina; Stucki, Jean-Pierre; Viertel, Gert; Vogler, Patrick; Weitzel, Quirin
The variability of the very high energy (VHE) emission from blazars seems to be connected with the feeding and propagation of relativistic jets and with their origin in supermassive black hole binaries. The key to understanding their properties is measuring well-sampled gamma-ray lightcurves, revealing the typical source behavior unbiased by prior knowledge from other wavebands. Using ground-based gamma-ray observatories with exposures limited by dark-time, a global network of several telescopes is needed to carry out fulltime measurements. Obviously, such observations are time-consuming and, therefore, cannot be carried out with the present state of the art instruments. The DWARF telescope on the Canary Island of La Palma is dedicated to monitoring observations. It is currently being set up, employing a costefï¬cient and robotic design. Part of this project is the future construction of a distributed network of small telescopes. The physical motivation of VHE long-term monitoring will be outlined in detail and the perspective for a network for 24/7 observations will be presented.
Three-dimensional imagery by encoding sources of X rays
International Nuclear Information System (INIS)
Magnin, Isabelle
1987-01-01
This research thesis addresses the theoretical and practical study of X ray coded sources, and thus notably aims at exploring whether it would be possible to transform a standard digital radiography apparatus (as those operated in radiology hospital departments) into a low cost three-dimensional imagery system. The author first recalls the principle of conventional tomography and improvement attempts, and describes imagery techniques based on the use of encoding openings and source encoding. She reports the modelling of an imagery system based on encoded sources of X ray, and addresses the original notion of three-dimensional response for such a system. The author then addresses the reconstruction method by considering the reconstruction of a plane object, of a multi-plane object, and of real three-dimensional object. The frequency properties and the tomographic capacities of various types of source codes are analysed. She describes a prototype tomography apparatus, and presents and discusses three-dimensional actual phantom reconstructions. She finally introduces a new principle of dynamic three-dimensional radiography which implements an acquisition technique by 'gating code'. The acquisition principle should allow the reconstruction of volumes animated by periodic deformations, such as the heart for example [fr
Crystallization and preliminary X-ray analysis of Chandipura virus glycoprotein G
International Nuclear Information System (INIS)
Baquero, Eduard; Buonocore, Linda; Rose, John K.; Bressanelli, Stéphane; Gaudin, Yves; Albertini, Aurélie A.
2012-01-01
Chandipura virus glycoprotein ectodomain (Gth) was purified and crystallized at pH 7.5. X-ray diffraction data set was collected to a resolution of 3.1 Å. Fusion in members of the Rhabdoviridae virus family is mediated by the G glycoprotein. At low pH, the G glycoprotein catalyzes fusion between viral and endosomal membranes by undergoing a major conformational change from a pre-fusion trimer to a post-fusion trimer. The structure of the G glycoprotein from vesicular stomatitis virus (VSV G), the prototype of Vesiculovirus, has recently been solved in its trimeric pre-fusion and post-fusion conformations; however, little is known about the structural details of the transition. In this work, a soluble form of the ectodomain of Chandipura virus G glycoprotein (CHAV G th ) was purified using limited proteolysis of purified virus; this soluble ectodomain was also crystallized. This protein shares 41% amino-acid identity with VSV G and thus its structure could provide further clues about the structural transition of rhabdoviral glycoproteins induced by low pH. Crystals of CHAV G th obtained at pH 7.5 diffracted X-rays to 3.1 Å resolution. These crystals belonged to the orthorhombic space group P2 1 2 1 2, with unit-cell parameters a = 150.3, b = 228.2, c = 78.8 Å. Preliminary analysis of the data based on the space group and the self-rotation function indicated that there was no trimeric association of the protomers. This unusual oligomeric status could result from the presence of fusion intermediates in the crystal
Development of a compact x-ray source via laser compton scattering at KEK-LUCX
International Nuclear Information System (INIS)
Sakaue, Kazuyuki; Washio, Masakazu; Aryshev, Alexander; Araki, Sakae; Urakawa, Junji; Terunuma, Nobuhiro; Fukuda, Masafumi; Miyoshi, Toshinobu; Takeda, Ayaki
2013-01-01
The compact X-ray source based on Laser-Compton scattering (LCS) has been developed at LUCX (Laser Undulator Compact X-ray source) facility in KEK. The multi-bunch high quality electron beam produced by a standing wave 3.6 cell RF Gun and accelerated by the followed S-band normal conducting 12 cells standing wave 'Booster' linear accelerator is scattered off the laser beam stored in the optical cavity. The 4-mirror planar optical cavity with finesse 335 is used. The MCP (Micro-Channer Plate) detector as well as SOI (Silicon-On-Insulator) pixel sensor was used for scattered X-ray detection. The SOI pixel sensor has been used for LCS X-ray detection for the first time and has demonstrated high spatial resolution and high SN ratio X-ray detection that in turn lead to clearest X-ray images achieved by LCS X-ray. We have also achieved generation of 6.38x10 6 ph./sec., which is more than 30 times larger LCS X-ray flux in comparison with our previous results. The complete details of LUCX LCS X-ray source, specifications of both electron and laser beams, and the results of LCS X-ray generation experiments are reported in this paper. (author)
Revisiting the Gamma-Ray Source 2FGL J1823.8+4312
Stern, Daniel; Assef, Roberto J.
2013-02-01
One of the great challenges of gamma-ray astronomy is identifying the lower energy counterparts to these high-energy sources. Recently, in this journal, Massaro et al. attempted to find the counterpart of 2FGL J1823.8+4312, a gamma-ray active galactic nucleus (AGN) of uncertain type from the Second Fermi Large Area Telescope catalog. After considering mid-infrared data in the field from the Wide-field Infrared Survey Explorer (WISE), those authors conclude that the preferred identification of 2FGL J1823.8+4312 is WISE J182352.33+431452.5, despite the fact that the mid-infrared source is undetected at radio energies. They claim that WISE J182352.33+431452.5 constitutes the discovery of a new class of extragalactic X-ray source, either a radio-faint blazar or the prototype of a new class of active galaxy with an enigmatic spectral energy distribution. This conclusion is claimed to be independent of whether or not the WISE source is the actual counterpart to 2FGL J1823.8+4312. Based on a re-analysis of public data in this field and new spectroscopy from Palomar, we conclude that WISE J182352.33+431452.5 is a dust-reddened quasar at z = 0.560, a representative example of a very common extragalactic AGN class. Were WISE J182352.33+431452.5 to be associated with the gamma-ray emission, this would be an unusual and exciting discovery. However, we argue that 2FGL J1823.8+4312 is more likely associated with either WISE J182409.25+431404.7 or, more likely, WISE J182419.04+430949.6, two radio-loud sources in the field. The former is a radio-loud quasar and the latter is an optically variable source with a featureless blue spectrum.
XMM-Newton 13H deep field - I. X-ray sources
Loaring, N. S.; Dwelly, T.; Page, M. J.; Mason, K.; McHardy, I.; Gunn, K.; Moss, D.; Seymour, N.; Newsam, A. M.; Takata, T.; Sekguchi, K.; Sasseen, T.; Cordova, F.
2005-10-01
We present the results of a deep X-ray survey conducted with XMM-Newton, centred on the UK ROSAT13H deep field area. This region covers 0.18 deg2, and is the first of the two areas covered with XMM-Newton as part of an extensive multiwavelength survey designed to study the nature and evolution of the faint X-ray source population. We have produced detailed Monte Carlo simulations to obtain a quantitative characterization of the source detection procedure and to assess the reliability of the resultant sourcelist. We use the simulations to establish a likelihood threshold, above which we expect less than seven (3 per cent) of our sources to be spurious. We present the final catalogue of 225 sources. Within the central 9 arcmin, 68 per cent of source positions are accurate to 2 arcsec, making optical follow-up relatively straightforward. We construct the N(>S) relation in four energy bands: 0.2-0.5, 0.5-2, 2-5 and 5-10 keV. In all but our highest energy band we find that the source counts can be represented by a double power law with a bright-end slope consistent with the Euclidean case and a break around 10-14yergcm-2s-1. Below this flux, the counts exhibit a flattening. Our source counts reach densities of 700, 1300, 900 and 300 deg-2 at fluxes of 4.1 × 10-16,4.5 × 10-16,1.1 × 10-15 and 5.3 × 10-15ergcm-2s-1 in the 0.2-0.5, 0.5-2, 2-5 and 5-10 keV energy bands, respectively. We have compared our source counts with those in the two Chandra deep fields and Lockman hole, and found our source counts to be amongst the highest of these fields in all energy bands. We resolve >51 per cent (>50 per cent) of the X-ray background emission in the 1-2 keV (2-5 keV) energy bands.
Ultraluminous supersoft X-ray sources
Liu, Jifeng; Bai, Yu; Wang, Song; Justham, Stephen; Lu, You-Jun; Gu, Wei-Min; Liu, Qing-Zhong; di Stefano, Rosanne; Guo, Jin-Cheng; Cabrera-Lavers, Antonio; Álvarez, Pedro; Cao, Yi; Kulkarni, Shri
2017-06-01
While ultraluminous supersoft X-ray sources (ULSs) bear features for intermediate mass black holes or very massive white dwarfs possibly close to Chandrasekhar mass limit, our recent discovery of processing relativistic baryonic jets from a prototype ULS in M81 demonstrate that they are not IMBHs or WDs, but black holes accreting at super-Eddington rates. This discovery strengthens the recent ideas that ULXs are stellar black holes with supercritical accretion, and provides a vivid manifestation of what happens when a black hole devours too much, that is, it will generate thick disk winds and fire out sub-relativistic baryonic jets along the funnel as predicted by recent numerical simulations.
Imaging x-ray sources at a finite distance in coded-mask instruments
International Nuclear Information System (INIS)
Donnarumma, Immacolata; Pacciani, Luigi; Lapshov, Igor; Evangelista, Yuri
2008-01-01
We present a method for the correction of beam divergence in finite distance sources imaging through coded-mask instruments. We discuss the defocusing artifacts induced by the finite distance showing two different approaches to remove such spurious effects. We applied our method to one-dimensional (1D) coded-mask systems, although it is also applicable in two-dimensional systems. We provide a detailed mathematical description of the adopted method and of the systematics introduced in the reconstructed image (e.g., the fraction of source flux collected in the reconstructed peak counts). The accuracy of this method was tested by simulating pointlike and extended sources at a finite distance with the instrumental setup of the SuperAGILE experiment, the 1D coded-mask x-ray imager onboard the AGILE (Astro-rivelatore Gamma a Immagini Leggero) mission. We obtained reconstructed images of good quality and high source location accuracy. Finally we show the results obtained by applying this method to real data collected during the calibration campaign of SuperAGILE. Our method was demonstrated to be a powerful tool to investigate the imaging response of the experiment, particularly the absorption due to the materials intercepting the line of sight of the instrument and the conversion between detector pixel and sky direction
Exosat observations of the supernova remnant G109.1-1.0 and the X-ray pulsar 1E 2259+586
International Nuclear Information System (INIS)
Morini, M.; Robba, N.R.; Smith, A.; Van Der Klis, M.
1988-01-01
Exosat observations of the SNR G109.1-1.0 and the X-ray pulsar 1E 2259+586 obtained in December 1984 show a similar spatial distribution of the X-ray emission to that found by the Einstein Observatory, but different spectra for the various source components. A pulsar period of 6.978725 s was found for this epoch. The results indicate that the remnant is in the adiabatic phase, with an age of the order of 10,000 yr, and a SN energy in the range 10 to the 51st-10 to the 52nd ergs. Interpretations for the jet emission as either thermal or nonthermal are considered. 30 references
Compact sources as the origin of the soft gamma-ray emission of the Milky Way
DEFF Research Database (Denmark)
Lebrun, F.; Terrier, R.; Bazzano, A.
2004-01-01
The Milky Way is known to be an abundant source of gamma-ray photons(1), now determined to be mainly diffuse in nature and resulting from interstellar processes(2). In the soft gamma-ray domain, point sources are expected to dominate, but the lack of sensitive high-resolution observations did...... the origin of the soft gamma-rays is therefore necessary to determine the dominant particle acceleration processes and to gain insights into the physical and chemical equilibrium of the interstellar medium(7). Here we report observations in the soft gamma-ray domain that reveal numerous compact sources. We...
Total-reflection x-ray fluorescence with a brillant undulator x-ray source
International Nuclear Information System (INIS)
Sakurai, K.; Eba, H.; Numako, C.; Suzuki, M.; Inoue, K.; Yagi, N.
2000-01-01
Total-reflection x-ray fluorescence (TXRF) is a highly sensitive technique for analyzing trace elements, because of the very low background from the sample support. Use of third-generation synchrotron x-ray source could further enhance the detection power. However, while such high sensitivity permits the detection of signals from trace elements of interest, it also means that one can observe weak parasitic x-rays as well. If the sample surface becomes even slightly contaminated, owing to air particulates near the beamline, x-ray fluorescence lines of iron, zinc, copper, nickel, chromium, and titanium can be observed even for a blank sample. Another critical problem is the low-energy-side tail of the scattering x-rays, which ultimately restricts the detection capability of the technique using a TXRF spectrometer based on a Si(Li) detector. The present paper describes our experiments with brilliant undulator x-ray beams at BL39XU and BL40XU, at the SPring-8, Harima, Japan. The emphasis is on the development of instruments to analyze a droplet of 0.1 μl containing trace elements of ppb level. Although the beamline is not a clean room, we have employed equipment for preparing a clean sample and also for avoiding contamination during transferring the sample into the spectrometer. We will report on the successful detection of the peak from 0.8 ppb selenium in a droplet (absolute amount 80 fg). We will also present the results of recent experiments obtained from a Johansson spectrometer rather than a Si(Li) detector. (author)
Optical observations of binary X-ray sources
International Nuclear Information System (INIS)
Charles, P.
1982-01-01
Here I shall consider only those systems where the compact object is a neutron star (or in a few cases perhaps a black hole). Since van Paradijs (1982) has recently produced an excellent and comprehensive review of optical observations of compact galactic X-ray sources I shall summarise the basic properties of the optical counterparts and discuss a few representative systems in some detail. (orig./WL)
KD901G X-ray system to reject contaminants
International Nuclear Information System (INIS)
Shinohara, Hachiro
1995-01-01
Among the complaints to the foods that consumers bought, the proportion of the mixing of alien substances is more than 20%. The number of the cases classified by the kinds of alien substances, and that of minerals and animal substances are shown. The causes of the mixing of alien substances are classified into those due to the mixing in raw materials, production places, processing machines and workers. In case of using primary products as raw materials, the alien substances closely related to those raw materials are difficult to detect, such as bones and hairs in animal meat, fish bones, egg shells and fruit seeds. There are problems and limitation in the inspection of alien substance mixing by visual or touching inspection, metal detectors and the visual inspection of X-ray radiographs. The judgement of the presence of alien substances by automatically processing X-ray radiograph information has been tried one or two-dimensionally. The X-ray alien substance detector KD901G adopted the one-dimensional line sensor type, and its features are shown. The effective introduction of the X-ray alien substance detector, its comparison with metal detectors, and the safety of workers against radiation exposure and the safety of inspected foods are discussed. (K.I.)
Laboratory source based full-field x-ray microscopy at 9 keV
Energy Technology Data Exchange (ETDEWEB)
Fella, C.; Balles, A.; Wiest, W. [Lehrstuhl für Röntgenmikroskopie, Julius-Maximilians-Universität, 97074 Würzburg (Germany); Zabler, S.; Hanke, R. [Lehrstuhl für Röntgenmikroskopie, Julius-Maximilians-Universität, 97074 Würzburg (Germany); Fraunhofer Development Center X-Ray Technology (EZRT), Flugplatzstrasse 75, 90768 Fürth (Germany)
2016-01-28
In the past decade, hard x-ray transmission microscopy experienced tremendous developments. With the avail-ability of efficient Fresnel zone plates, even set-ups utilizing laboratory sources were developed [1]. In order to improve the performance of these x-ray microscopes, novel approaches to fabricate optical elements [2] and brighter x-ray tubes [3] are promising candidates. We are currently building a laboratory transmission x-ray microscope for 9.25 keV, using an electron impact liquid-metal-jet anode source. Up to now, the further elements of our setup are: a polycapillary condenser, a tungsten zone plate, and a scintillator which is optically coupled to a CMOS camera. However, further variations in terms of optical elements are intended. Here we present the current status of our work, as well as first experimental results.
High Energy Cosmic Electrons: Messengers from Nearby Cosmic Ray Sources or Dark Matter?
Moiseev, Alexander
2011-01-01
This slide presentation reviews the recent discoveries by the Large Area Telescope (LAT) and the Gamma-ray Burst Monitor (GBM) on board the Fermi Gamma-Ray Telescope in reference to high energy cosmic electrons, and whether their source is cosmic rays or dark matter. Specific interest is devoted to Cosmic Ray electrons anisotropy,
Qian, Xin; Tucker, Andrew; Gidcumb, Emily; Shan, Jing; Yang, Guang; Calderon-Colon, Xiomara; Sultana, Shabana; Lu, Jianping; Zhou, Otto; Spronk, Derrek; Sprenger, Frank; Zhang, Yiheng; Kennedy, Don; Farbizio, Tom; Jing, Zhenxue
2012-04-01
The purpose of this study is to investigate the feasibility of increasing the system spatial resolution and scanning speed of Hologic Selenia Dimensions digital breast tomosynthesis (DBT) scanner by replacing the rotating mammography x-ray tube with a specially designed carbon nanotube (CNT) x-ray source array, which generates all the projection images needed for tomosynthesis reconstruction by electronically activating individual x-ray sources without any mechanical motion. The stationary digital breast tomosynthesis (s-DBT) design aims to (i) increase the system spatial resolution by eliminating image blurring due to x-ray tube motion and (ii) reduce the scanning time. Low spatial resolution and long scanning time are the two main technical limitations of current DBT technology. A CNT x-ray source array was designed and evaluated against a set of targeted system performance parameters. Simulations were performed to determine the maximum anode heat load at the desired focal spot size and to design the electron focusing optics. Field emission current from CNT cathode was measured for an extended period of time to determine the stable life time of CNT cathode for an expected clinical operation scenario. The source array was manufactured, tested, and integrated with a Selenia scanner. An electronic control unit was developed to interface the source array with the detection system and to scan and regulate x-ray beams. The performance of the s-DBT system was evaluated using physical phantoms. The spatially distributed CNT x-ray source array comprised 31 individually addressable x-ray sources covering a 30 angular span with 1 pitch and an isotropic focal spot size of 0.6 mm at full width at half-maximum. Stable operation at 28 kV(peak) anode voltage and 38 mA tube current was demonstrated with extended lifetime and good source-to-source consistency. For the standard imaging protocol of 15 views over 14, 100 mAs dose, and 2 × 2 detector binning, the projection
THE HIGH-ENERGY, ARCMINUTE-SCALE GALACTIC CENTER GAMMA-RAY SOURCE
International Nuclear Information System (INIS)
Chernyakova, M.; Malyshev, D.; Aharonian, F. A.; Crocker, R. M.; Jones, D. I.
2011-01-01
Employing data collected during the first 25 months of observations by the Fermi-LAT, we describe and subsequently seek to model the very high energy (>300 MeV) emission from the central few parsecs of our Galaxy. We analyze the morphological, spectral, and temporal characteristics of the central source, 1FGL J1745.6-2900. The data show a clear, statistically significant signal at energies above 10 GeV, where the Fermi-LAT has angular resolution comparable to that of HESS at TeV energies. This makes a meaningful joint analysis of the data possible. Our analysis of the Fermi data (alone) does not uncover any statistically significant variability of 1FGL J1745.6-2900 at GeV energies on the month timescale. Using the combination of Fermi data on 1FGL J1745.6-2900 and HESS data on the coincident, TeV source HESS J1745-290, we show that the spectrum of the central gamma-ray source is inflected with a relatively steep spectral region matching between the flatter spectrum found at both low and high energies. We model the gamma-ray production in the inner 10 pc of the Galaxy and examine cosmic ray (CR) proton propagation scenarios that reproduce the observed spectrum of the central source. We show that a model that instantiates a transition from diffusive propagation of the CR protons at low energy to almost rectilinear propagation at high energies can explain well the spectral phenomenology. We find considerable degeneracy between different parameter choices which will only be broken with the addition of morphological information that gamma-ray telescopes cannot deliver given current angular resolution limits. We argue that a future analysis performed in combination with higher-resolution radio continuum data holds out the promise of breaking this degeneracy.
Observations of Ultra-Luminous X-ray Sources, and Implications
Colbert, E. J. M.
2004-05-01
I will review observations of Ultra-Luminous X-ray Sources (ULXs; Lx > 1E39 erg/s), in particular those observations that have helped reveal the nature of these curious objects. Some recent observations suggest that ULXs are a heterogenous class. Although ULX phenomenology is not fully understood, I will present some examples from the (possibly overlapping) sub-classes. Since ULXs are the most luminous objects in starburst galaxies, they, and ``normal'' luminous black-hole high-mass X-ray binaries are intimately tied to the global galaxian X-ray-star-formation connection. Further work is needed to understand how ULXs form, and how they are associated with the putative population of intermediate-mass black holes.
Hitomi X-ray Observation of the Pulsar Wind Nebula G21.5$-$0.9
Hitomi Collaboration; Aharonian, Felix; Akamatsu, Hiroki; Akimoto, Fumie; Allen, Steven W.; Angelini, Lorella; Audard, Marc; Awaki, Hisamitsu; Axelsson, Magnus; Bamba, Aya; Bautz, Marshall W.; Blandford, Roger; Brenneman, Laura W.; Brown, Gregory V.; Bulbul, Esra
2018-01-01
We present results from the Hitomi X-ray observation of a young composite-type supernova remnant (SNR) G21.5$-$0.9, whose emission is dominated by the pulsar wind nebula (PWN) contribution. The X-ray spectra in the 0.8-80 keV range obtained with the Soft X-ray Spectrometer (SXS), Soft X-ray Imager (SXI) and Hard X-ray Imager (HXI) show a significant break in the continuum as previously found with the NuSTAR observation. After taking into account all known emissions from the SNR other than the...
DIFFERENT TYPES OF ULTRALUMINOUS X-RAY SOURCES IN NGC 4631
International Nuclear Information System (INIS)
Soria, Roberto; Ghosh, Kajal K.
2009-01-01
We have re-examined the most luminous X-ray sources in the starburst galaxy NGC 4631, using XMM-Newton, Chandra, and ROSAT data. The most interesting source is a highly variable supersoft ultraluminous X-ray source (ULX). We suggest that its bolometric luminosity ∼ a few 10 39 erg s -1 in the high/supersoft state: this is an order of magnitude lower than estimated in previous studies, thus reducing the need for extreme or exotic scenarios. Moreover, we find that this source was in a noncanonical low/soft (kT ∼ 0.1-0.3 keV) state during the Chandra observation. By comparing the high and low state, we argue that the spectral properties may not be consistent with the expected behavior of an accreting intermediate-mass black hole. We suggest that recurrent super-Eddington outbursts with photospheric expansion from a massive white dwarf (M wd ∼> 1.3 M sun ), powered by nonsteady nuclear burning, may be a viable possibility, in alternative to the previously proposed scenario of a super-Eddington outflow from an accreting stellar-mass black hole. The long-term average accretion rate required for nuclear burning to power such white-dwarf outbursts in this source and perhaps in other supersoft ULXs is ∼(5-10) x 10 -6 M sun yr -1 : this is comparable to the thermal-timescale mass transfer rate invoked to explain the most luminous hard-spectrum ULXs (powered by black hole accretion). The other four most luminous X-ray sources in NGC 4631 (three of which can be classified as ULXs) appear to be typical accreting black holes, in four different spectral states: high/soft, convex-spectrum, power-law with soft excess, and simple power-law. None of them require masses ∼>50 M sun .
Characteristics of a multi-keV monochromatic point x-ray source
Indian Academy of Sciences (India)
Temporal, spatial and spectral characteristics of a multi-keV monochromatic point x-ray source based on vacuum diode with laser-produced plasma as cathode are presented. Electrons from a laser-produced aluminium plasma were accelerated towards a conical point tip titanium anode to generate K-shell x-ray radiation.
Exotic sources of x-rays for iodine K-edge angiography
International Nuclear Information System (INIS)
Carr, R.
1993-08-01
Digital Subtractive Angiography (DSA) has been performed to image human coronary arteries using wiggler radiation from electron storage rings. The significant medical promise of this procedure motivates the development of smaller and less costly x-ray sources. Several exotic sources are candidates for consideration, using effects such as Cherenkov, channeling, coherent bremsstrahlung, laser backscattering, microundulator, parametric, Smith-Purcell, and transition radiation. In this work we present an analysis of these effects as possible sources of intense x-rays at the iodine K-edge at 33.169 key. The criteria we use are energy, efficiency, flux, optical properties, and technical realizability. For each of the techniques, we find that they suffer either from low flux, a low energy cutoff, target materials heating, too high electron beam energy requirement, optical mismatch to angiography, or a combination of these. We conclude that the foreseeable state-of-the-art favors a compact storage ring design
Quasimonochromatic x-ray source using photoabsorption-edge transition radiation
International Nuclear Information System (INIS)
Piestrup, M.A.; Boyers, D.G.; Pincus, C.I.; Harris, J.L.; Maruyama, X.K.; Bergstrom, J.C.; Caplan, H.S.; Silzer, R.M.; Skopik, D.M.
1991-01-01
By designing transition radiators to emit x rays at the foil material's K-, L-, or M-shell photoabsorption edge, the x-ray spectrum is narrowed. The source is quasimonochromatic, directional, and intense and uses an electron beam whose energy is considerably lower than that needed for synchrotron sources. Depending upon the selection of foil material, the radiation can be produced wherever there is a photoabsorption edge. In this paper we report the results of the measurement of the x-ray spectrum from a transition radiator composed of 10 foils of 2-μm titanium and exposed to low-current, 90.2-MeV electrons. The measured band of emission was from 3.2 to 5 keV. In addition, a measurment was performed of the total power from a transition radiator composed of 18 foils of 2.0-μm copper exposed to a high-average-current electron beam of 40 μA and at energies of 135, 172, and 200 MeV. The maximum measured power was 4.0 mW. The calculated band of emission was from 4 to 9 keV
At-wavelength metrology of x-ray optics at Diamond Light Source
Wang, Hongchang; Berujon, Sebastien; Sutter, John; Alcock, Simon G.; Sawhney, Kawal
2014-09-01
Modern, third-generation synchrotron radiation sources provide coherent and extremely bright beams of X-ray radiation. The successful exploitation of such beams depends to a significant extent on imperfections and misalignment of the optics employed on the beamlines. This issue becomes even more critical with the increasing use of active optics, and the desire to achieve diffraction-limited and coherence-preserving X-ray beams. In recent years, significant progress has been made to improve optic testing and optimization techniques, especially those using X-rays for so-called atwavelength metrology. These in-situ and at-wavelength metrology methods can be used not only to optimize the performance of X-ray optics, but also to correct and minimize the collective distortions of upstream beamline optics, including monochromators, and transmission windows. An overview of at-wavelength metrology techniques implemented at Diamond Light Source is presented, including grating interferometry and X-ray near-field speckle based techniques. Representative examples of the application of these techniques are also given, including in-situ and atwavelength calibration and optimization of: active, piezo bimorph mirrors; Kirkpatrick-Baez (KB) mirrors; and refractive optics such as compound refractive lenses.
An update on carbon nanotube-enabled X-ray sources for biomedical imaging.
Puett, Connor; Inscoe, Christina; Hartman, Allison; Calliste, Jabari; Franceschi, Dora K; Lu, Jianping; Zhou, Otto; Lee, Yueh Z
2018-01-01
A new imaging technology has emerged that uses carbon nanotubes (CNT) as the electron emitter (cathode) for the X-ray tube. Since the performance of the CNT cathode is controlled by simple voltage manipulation, CNT-enabled X-ray sources are ideal for the repetitive imaging steps needed to capture three-dimensional information. As such, they have allowed the development of a gated micro-computed tomography (CT) scanner for small animal research as well as stationary tomosynthesis, an experimental technology for large field-of-view human imaging. The small animal CT can acquire images at specific points in the respiratory and cardiac cycles. Longitudinal imaging therefore becomes possible and has been applied to many research questions, ranging from tumor response to the noninvasive assessment of cardiac output. Digital tomosynthesis (DT) is a low-dose and low-cost human imaging tool that captures some depth information. Known as three-dimensional mammography, DT is now used clinically for breast imaging. However, the resolution of currently-approved DT is limited by the need to swing the X-ray source through space to collect a series of projection views. An array of fixed and distributed CNT-enabled sources provides the solution and has been used to construct stationary DT devices for breast, lung, and dental imaging. To date, over 100 patients have been imaged on Institutional Review Board-approved study protocols. Early experience is promising, showing an excellent conspicuity of soft-tissue features, while also highlighting technical and post-acquisition processing limitations that are guiding continued research and development. Additionally, CNT-enabled sources are being tested in miniature X-ray tubes that are capable of generating adequate photon energies and tube currents for clinical imaging. Although there are many potential applications for these small field-of-view devices, initial experience has been with an X-ray source that can be inserted into the
Gamma-Rays from Galactic Compact Sources
Kaaret, Philip
2007-04-01
Recent discoveries have revealed many sources of TeV photons in our Mikly Way galaxy powered by compact objects, either neutron stars or black holes. These objects must be powerful particle accelerators, some with peak energies of at least 100 TeV, and may be neutrino, as well as photon, sources. Future TeV observations will enable us to address key questions concerning particle acceleration by compact objects including the fraction of energy which accreting black holes channel into relativstic jet production, whether the compact object jets are leptonic or hadronic, and the mechanism by which pulsar winds accelerate relativistic particles. We report on work done related to compact Galactic objects in preparation of a White Paper on the status and future of ground-based gamma-ray astronomy requested by the Division of Astrophysics of the American Physical Society.
Diffuse gamma-ray emission from self-confined cosmic rays around Galactic sources
D'Angelo, Marta; Morlino, Giovanni; Amato, Elena; Blasi, Pasquale
2018-02-01
The propagation of particles accelerated at supernova remnant shocks and escaping the parent remnants is likely to proceed in a strongly non-linear regime, due to the efficient self-generation of Alfvén waves excited through streaming instability near the sources. Depending on the amount of neutral hydrogen present in the regions around the sites of supernova explosions, cosmic rays may accumulate an appreciable grammage in the same regions and get self-confined for non-negligible times, which in turn results in an enhanced rate of production of secondaries. Here we calculate the contribution to the diffuse gamma-ray background due to the overlap along lines of sight of several of these extended haloes as due to pion production induced by self-confined cosmic rays. We find that if the density of neutrals is low, the haloes can account for a substantial fraction of the diffuse emission observed by Fermi-Large Area Telescope (LAT), depending on the orientation of the line of sight with respect to the direction of the Galactic Centre.
Source apportionment of aerosol particles using polycapillary slightly focusing X-ray lens
Energy Technology Data Exchange (ETDEWEB)
Sun Tianxi [Key Laboratory of Beam Technology and Materials Modification of Ministry of Education, Beijing Normal University, Beijing 100875 (China) and Institute of Low Energy Nuclear Physics, Beijing Normal University, Beijing 100875 (China) and Beijing Radiation Center, Beijing 100875 (China)], E-mail: stxbeijing@163.com; Liu Zhiguo [Key Laboratory of Beam Technology and Materials Modification of Ministry of Education, Beijing Normal University, Beijing 100875 (China) and Institute of Low Energy Nuclear Physics, Beijing Normal University, Beijing 100875 (China) and Beijing Radiation Center, Beijing 100875 (China)], E-mail: liuzgbeijing@163.com; Zhu Guanghua; Liu Hui [Key Laboratory of Beam Technology and Materials Modification of Ministry of Education, Beijing Normal University, Beijing 100875 (China); Institute of Low Energy Nuclear Physics, Beijing Normal University, Beijing 100875 (China); Beijing Radiation Center, Beijing 100875 (China); Ma Yongzhong [Center for Disease Control and Prevention of Beijing, Beijing 100013 (China); Xu Qing [Institute of High Energy Physics, Chinese Academy of Science, Beijing 100039 (China); Li Yude; Wang Guangpu; Luo Ping; Pan Qiuli; Ding Xunliang [Key Laboratory of Beam Technology and Materials Modification of Ministry of Education, Beijing Normal University, Beijing 100875 (China); Institute of Low Energy Nuclear Physics, Beijing Normal University, Beijing 100875 (China); Beijing Radiation Center, Beijing 100875 (China)
2009-06-11
A micro-X-ray fluorescence (Micro-XRF) spectrometer based on a polycapillary slightly focusing X-ray lens (PSFXRL) and laboratory X-ray source was designed to carry out the source apportionment of aerosol particles. In the distribution curve of the X-ray intensity in the focal spot of PSFXRL, there was a plateau with a diameter of about 65 {mu}m. The uniformity of this plateau was about 3%. This was helpful in measuring the XRF spectrum of a single aerosol particle in which the element distributions are not uniform. The minimum detection limit (MDL) of this Micro-XRF spectrometer was 15 ppm for the Fe-K{sub {alpha}}. The origins of the aerosol particles at the exit of a subway station and a construction site were apportioned. This Micro-XRF spectrometer has potential applications in analysis of single aerosol particles.
How to Model Super-Soft X-ray Sources?
Rauch, Thomas
2012-07-01
During outbursts, the surface temperatures of white dwarfs in cataclysmic variables exceed by far half a million Kelvin. In this phase, they may become the brightest super-soft sources (SSS) in the sky. Time-series of high-resolution, high S/N X-ray spectra taken during rise, maximum, and decline of their X-ray luminosity provide insights into the processes following such outbursts as well as in the surface composition of the white dwarf. Their analysis requires adequate NLTE model atmospheres. The Tuebingen Non-LTE Model-Atmosphere Package (TMAP) is a powerful tool for their calculation. We present the application of TMAP models to SSS spectra and discuss their validity.
Microfocus X-ray sources for 3D microtomography
International Nuclear Information System (INIS)
Flynn, M.J.; Hames, S.M.; Reimann, D.A.; Wilderman, S.J.
1994-01-01
An analytic model for the performance of cone beam microtomography is described. The maximum power of a microfocus X-ray source is assumed to be approximately proportional to the focal spot size. Radiation flux penetrating the specimen is predicted by a semi-empirical relation which is valid for X-ray energies less than 20 keV. Good signal to noise ratio is predicted for bone specimens of 0.1 to 10 mm when scanned at the optimal energy. A flux of about 1x10 10 photons/mm 2 /s is identified for 0.2 mm specimens. Cone beam volumetric microtomography is found to compare favorably with synchrotron based methods. ((orig.))
Cold cathode diode X-ray source
International Nuclear Information System (INIS)
Cooperstein, G.; Lanza, R.C.; Sohval, A.R.
1983-01-01
A cold cathode diode X-ray source for radiation imaging, especially computed tomography, comprises a rod-like anode and a generally cylindrical cathode, concentric with the anode. The spacing between anode and cathode is so chosen that the diode has an impedance in excess of 100 ohms. The anode may be of tungsten, or of carbon with a tungsten and carbon coating. An array of such diodes may be used with a closely packed array of detectors to produce images of rapidly moving body organs, such as the beating heart. (author)
A spherical model for the transient x-ray source A0620-00
International Nuclear Information System (INIS)
Dilworth, C.; Maraschi, L.; Perola, G.C.
1977-01-01
The continuum spectrum of the transient X-ray source A0620-00, from infrared to X-ray frequencies, is interpreted as emission from a uniform spherical cloud of hot gas in which the free-free spectrum is modified by Thomson scattering. On this basis, the radius and the density of the cloud, and the distance of the source, are derived. The change of the spectrum with the time indicates a decrease of both radius and density with decreasing luminosity. Considering the production of X-rays to be due to impulsive accretion in a low-mass binary system, these results open the question as to whether the accreting object is a white dwarf rather than a neutron star. (author)
Spatially resolving the very high energy emission from MGRO J2019+37 with VERITAS
International Nuclear Information System (INIS)
Aliu, E.; Errando, M.; Aune, T.; Behera, B.; Chen, X.; Federici, S.; Beilicke, M.; Buckley, J. H.; Bugaev, V.; Benbow, W.; Cerruti, M.; Berger, K.; Bird, R.; Bouvier, A.; Ciupik, L.; Connolly, M. P.; Cui, W.; Dumm, J.; Dwarkadas, V. V.; Falcone, A.
2014-01-01
We present very high energy (VHE) imaging of MGRO J2019+37 obtained with the VERITAS observatory. The bright extended (∼2°) unidentified Milagro source is located toward the rich star formation region Cygnus-X. MGRO J2019+37 is resolved into two VERITAS sources. The faint, point-like source VER J2016+371 overlaps CTB 87, a filled-center remnant (SNR) with no evidence of a supernova remnant shell at the present time. Its spectrum is well fit in the 0.65-10 TeV energy range by a power-law model with photon index 2.3 ± 0.4. VER J2019+378 is a bright extended (∼1°) source that likely accounts for the bulk of the Milagro emission and is notably coincident with PSR J2021+3651 and the star formation region Sh 2–104. Its spectrum in the range 1-30 TeV is well fit with a power-law model of photon index 1.75 ± 0.3, among the hardest values measured in the VHE band, comparable to that observed near Vela-X. We explore the unusual spectrum and morphology in the radio and X-ray bands to constrain possible emission mechanisms for this source.
Soft x-ray microradiography and lithograph using a laser produced plasma source
International Nuclear Information System (INIS)
Cheng, P.C.
1992-01-01
Considering the hardware characteristics of the laser-induced plasma X-ray source and the limitations of the conventional cone-beam reconstruction algorithm, a general cone-beam reconstruction algorithm has been developed at our laboratory, in which the motion locus of the X-ray source is an arbitrary curve corresponding to at least a 2π continuous horizontal angular displacement in the coordinate system of the specimen. The preliminary simulation shows that the general cone-beam reconstruction algorithm consistently results in visually satisfactory images
THE HIGHEST-ENERGY COSMIC RAYS CANNOT BE DOMINANTLY PROTONS FROM STEADY SOURCES
Energy Technology Data Exchange (ETDEWEB)
Fang, Ke [Department of Astronomy, University of Maryland, College Park, MD 20742-2421 (United States); Kotera, Kumiko [Sorbonne Universités, UPMC Univ. Paris 6 et CNRS, UMR 7095, Institut d’Astrophysique de Paris, 98 bis bd Arago, F-75014 Paris (France)
2016-11-20
The bulk of observed ultrahigh-energy cosmic rays could be light or heavier elements and originate from an either steady or transient population of sources. This leaves us with four general categories of sources. Energetic requirements set a lower limit on single-source luminosities, while the distribution of particle arrival directions in the sky sets a lower limit on the source number density. The latter constraint depends on the angular smearing in the skymap due to the magnetic deflections of the charged particles during their propagation from the source to the Earth. We contrast these limits with the luminosity functions from surveys of existing luminous steady objects in the nearby universe and strongly constrain one of the four categories of source models, namely, steady proton sources. The possibility that cosmic rays with energy >8 × 10{sup 19} eV are dominantly pure protons coming from steady sources is excluded at 95% confidence level, under the safe assumption that protons experience less than 30° magnetic deflection on flight.
Direct intensity calibration of X-ray grazing-incidence microscopes with home-lab source
Li, Yaran; Xie, Qing; Chen, Zhiqiang; Xin, Qiuqi; Wang, Xin; Mu, Baozhong; Wang, Zhanshan; Liu, Shenye; Ding, Yongkun
2018-01-01
Direct intensity calibration of X-ray grazing-incidence microscopes is urgently needed in quantitative studies of X-ray emission from laser plasma sources in inertial confinement fusion. The existing calibration methods for single reflecting mirrors, crystals, gratings, filters, and X-ray detectors are not applicable for such X-ray microscopes due to the specific optical structure and the restrictions of object-image relation. This article presents a reliable and efficient method that can be performed using a divergent X-ray source and an energy dispersive Si-PIN (silicon positive-intrinsic-negative) detector in an ordinary X-ray laboratory. The transmission theory of X-ray flux in imaging diagnostics is introduced, and the quantities to be measured are defined. The calibration method is verified by a W/Si multilayer-coated Kirkpatrick-Baez microscope with a field of view of ˜95 μm at 17.48 keV. The mirror reflectance curve in the 1D coordinate is drawn with a peak value of 20.9% and an uncertainty of ˜6.0%.
A new high quality X-ray source for Cultural Heritage
International Nuclear Information System (INIS)
Walter, Ph.; Variola, A.; Zomer, F.; Jaquet, M.
2009-01-01
Compton based photon sources have generated much interest since the rapid advance in laser and accelerator technologies has allowed envisaging their utilisation for ultra-compact radiation sources. These should provide X-ray short pulses with a relatively high average flux. Moreover, the univocal dependence between the scattered photon energy and its angle gives the possibility of obtaining a quasi-monochromatic beam with a simple diaphragm system. For the most ambitious projects the expected performance takes into account a rate of 10 12 - 10 13 photons/s, with an angular divergence of few mrad, an X-ray energy cut-off of few tens of keV and a bandwidth ΔE/E ∼ 1-10 %. Even if the integrated rate cannot compete with synchrotron radiation sources, the cost and the compactness of these Compton based machines make them attractive for a wide spectrum of applications. We explore here the interest of these systems for Cultural Heritage preservation. (authors)
Active Galactic Nuclei: Sources for ultra high energy cosmic rays?
Energy Technology Data Exchange (ETDEWEB)
Biermann, Peter L. [MPI for Radioastronomy, Bonn (Germany); Dept. of Phys. and Astron., Univ. of Bonn (Germany); Dept. of Phys. and Astr., Univ. of Alabama, Tuscaloosa, AL (United States); Dept. of Phys., Univ. of Alabama at Huntsville, AL (United States); Inst. Nucl. Phys. FZ, Karlsruhe Inst. of Techn. (KIT) (Germany); Becker, Julia K. [Institution foer Fysik, Goeteborgs Univ. (Sweden); Dept. of Phys., Univ. Dortmund, Dortmund (Germany); Caramete, Laurentiu [MPI for Radioastronomy, Bonn (Germany); Institute for Space Studies, Bucharest (Romania); Curutiu, Alex [MPI for Radioastronomy, Bonn (Germany); Engel, Ralph [Inst. Nucl. Phys. FZ, Karlsruhe Inst. of Techn. (KIT) (Germany); Falcke, Heino [Dept. of Astrophys., IMAP, Radboud Univ., Nijmegen (Netherlands); ASTRON, Dwingeloo (Netherlands); Gergely, Laszlo A. [Dept. Appl. Sci., London South Bank University (United Kingdom); Dept. of Theoret. and Exp. Phys., Univ. of Szeged, Szeged (Hungary); Isar, P. Gina [Inst. Nucl. Phys. FZ, Karlsruhe Inst. of Techn. (KIT) (Germany); Institute for Space Studies, Bucharest (Romania); Maris, Ioana C. [Inst. Nucl. Phys. FZ, Karlsruhe Inst. of Techn. (KIT) (Germany); Meli, Athina [Physik. Inst. Univ. Erlangen-Nuernberg (Germany); Kampert, Karl-Heinz [Phys. Dept., Univ. Wuppertal (Germany); Stanev, Todor [Bartol Research Inst., Univ. of Delaware, Newark, DE (United States); Tascau, Oana [Phys. Dept., Univ. Wuppertal (Germany); Zier, Christian [MPI for Radioastronomy, Bonn (Germany); Raman Res. Inst., Bangalore (India)
2009-05-15
The origin of ultra high energy cosmic rays promises to lead us to a deeper understanding of the structure of matter. This is possible through the study of particle collisions at center-of-mass energies in interactions far larger than anything possible with the Large Hadron Collider, albeit at the substantial cost of no control over the sources and interaction sites. For the extreme energies we have to identify and understand the sources first, before trying to use them as physics laboratories. Here we describe the current stage of this exploration. The most promising contenders as sources are radio galaxies and gamma ray bursts. The sky distribution of observed events yields a hint favoring radio galaxies. Key in this quest are the intergalactic and galactic magnetic fields, whose strength and structure are not yet fully understood. Current data and statistics do not yet allow a final judgement. We outline how we may progress in the near future.
A new high quality X-ray source for Cultural Heritage
Walter, Philippe; Variola, Alessandro; Zomer, Fabian; Jaquet, Marie; Loulergue, Alexandre
2009-09-01
Compton based photon sources have generated much interest since the rapid advance in laser and accelerator technologies has allowed envisaging their utilisation for ultra-compact radiation sources. These should provide X-ray short pulses with a relatively high average flux. Moreover, the univocal dependence between the scattered photon energy and its angle gives the possibility of obtaining a quasi-monochromatic beam with a simple diaphragm system. For the most ambitious projects the expected performance takes into account a rate of 10-10 photons/s, with an angular divergence of few mrad, an X-ray energy cut-off of few tens of keV and a bandwidth ΔE/E˜1-10%. Even if the integrated rate cannot compete with synchrotron radiation sources, the cost and the compactness of these Compton based machines make them attractive for a wide spectrum of applications. We explore here the interest of these systems for Cultural Heritage preservation. To cite this article: P. Walter et al., C. R. Physique 10 (2009).
Active Galactic Nuclei: Sources for ultra high energy cosmic rays?
International Nuclear Information System (INIS)
Biermann, Peter L.; Becker, Julia K.; Caramete, Laurentiu; Curutiu, Alex; Engel, Ralph; Falcke, Heino; Gergely, Laszlo A.; Isar, P. Gina; Maris, Ioana C.; Meli, Athina; Kampert, Karl-Heinz; Stanev, Todor; Tascau, Oana; Zier, Christian
2009-01-01
The origin of ultra high energy cosmic rays promises to lead us to a deeper understanding of the structure of matter. This is possible through the study of particle collisions at center-of-mass energies in interactions far larger than anything possible with the Large Hadron Collider, albeit at the substantial cost of no control over the sources and interaction sites. For the extreme energies we have to identify and understand the sources first, before trying to use them as physics laboratories. Here we describe the current stage of this exploration. The most promising contenders as sources are radio galaxies and gamma ray bursts. The sky distribution of observed events yields a hint favoring radio galaxies. Key in this quest are the intergalactic and galactic magnetic fields, whose strength and structure are not yet fully understood. Current data and statistics do not yet allow a final judgement. We outline how we may progress in the near future.
Sea level characterization of a 1100 g sapphire bolometer
Pécourt, S; Bobin, C; Coron, N; Jesus, M D; Hadjout, J P; Leblanc, J W; Marcillac, P D
1999-01-01
A first characterization of a 1100 g sapphire bolometer, performed at sea level and at a working temperature of 40 mK, is presented. Despite perturbations coming from the high-radioactive background and cosmic rays, calibration spectra could be achieved with an internal alpha source and a sup 5 sup 7 Co gamma-ray source: the experimental threshold is 25 keV, while the FWHM resolution is 17.4 keV for the 122 keV peak. Possible heat release effects are discussed, and a new limit of 9x10 sup - sup 1 sup 4 W/g is obtained for sapphire.
Real world issues for the new soft x-ray synchrotron sources
International Nuclear Information System (INIS)
Kincaid, B.M.
1991-05-01
A new generation of synchrotron radiation light sources covering the VUV, soft x-ray and hard x-ray spectral regions is under construction in several countries. They are designed specifically to use periodic magnetic undulators and low-emittance electron or positron beams to produce high-brightness near-diffraction-limited synchrotron radiation beams. An introduction to the properties of undulator radiation is followed by a discussion of some of the challenges to be faced at the new facilities. Examples of predicted undulator output from the Advanced Light Source, a third generation 1--2 GeV storage ring optimized for undulator use, are used to highlight differences from present synchrotron radiation sources, including high beam power, partial coherence, harmonics, and other unusual spectral and angular properties of undulator radiation. 8 refs., 2 figs
DISCOVERY OF X-RAY EMISSION FROM AND DISTANCE TO THE SUPERNOVA REMNANT G84.2-0.8
Energy Technology Data Exchange (ETDEWEB)
Leahy, Denis A.; Green, Kaylie S., E-mail: leahy@ucalgary.ca, E-mail: ksgreen@ucalgary.ca [Department of Physics and Astronomy, University of Calgary, Calgary, Alberta, T2N 1N4 (Canada)
2012-11-20
We analyze X-ray and radio observations of the supernova remnant G84.2-0.8. 1420 MHz atomic hydrogen (H I) line and radio continuum data yield H I absorption spectra and a new H I absorption distance of 5.8-6.2 kpc. Archival X-ray observations from ROSAT and Chandra which cover the area including G84.2-0.8 are analyzed to show extended X-ray emission from G84.2-0.8. Fits to X-ray spectra from Chandra, with the new H I distance of 5.8-6.2 kpc, are used to determine the Sedov parameters of the supernova remnant. G84.2-0.8 is large (16-18 pc radius), middle aged ({approx}9000 yr), expanding in low-density interstellar medium (0.02 cm{sup -3}), and consistent with a low explosion energy (0.8-6.5 Multiplication-Sign 10{sup 50} erg).
Sun, Xuepeng; zhang, Xiaoyun; Zhu, Yu; Wang, Yabing; Shang, Hongzhong; Zhang, Fengshou; Liu, Zhiguo; Sun, Tianxi
2018-04-01
A new type of monocapillary X-ray optic, called 'two bounces monocapillary X-ray optics' (TBMXO), is proposed for generating a small focal spot with high power-density gain for micro X-ray analysis, using a common laboratory X-ray source. TBMXO is consists of two parts: an ellipsoidal part and a tapered part. Before experimental testing, the TBMXO was simulated by the ray tracing method in MATLAB. The simulated results predicted that the proposed TBMXO would produce a smaller focal spot with higher power-density gain than the ellipsoidal monocapillary X-ray optic (EMXO). In the experiment, the TBMXO performance was tested by both an optical device and a Cu target X-ray tube with focal spot of 100 μm. The results indicated that the TBMXO had a slope error of 57.6 μrad and a 13.1 μm focal spot and a 1360 gain in power density were obtained.
Spatial coherence properties of a compact and ultrafast laser-produced plasma keV x-ray source
International Nuclear Information System (INIS)
Boschetto, D.; Mourou, G.; Rousse, A.; Mordovanakis, A.; Hou, Bixue; Nees, J.; Kumah, D.; Clarke, R.
2007-01-01
The authors use Fresnel diffraction from knife-edges to demonstrate the spatial coherence of a tabletop ultrafast x-ray source produced by laser-plasma interaction. Spatial coherence is achieved in the far field by producing micrometer-scale x-ray spot dimensions. The results show an x-ray source size of 6 μm that leads to a transversal coherence length of 20 μm at a distance of 60 cm from the source. Moreover, they show that the source size is limited by the spatial spread of the absorbed laser energy
Contribution from individual nearby sources to the spectrum of high-energy cosmic-ray electrons
International Nuclear Information System (INIS)
Sedrati, R.; Attallah, R.
2014-01-01
In the last few years, very important data on high-energy cosmic-ray electrons and positrons from high-precision space-born and ground-based experiments have attracted a great deal of interest. These particles represent a unique probe for studying local comic-ray accelerators because they lose energy very rapidly. These energy losses reduce the lifetime so drastically that high-energy cosmic-ray electrons can attain the Earth only from rather local astrophysical sources. This work aims at calculating, by means of Monte Carlo simulation, the contribution from some known nearby astrophysical sources to the cosmic-ray electron/positron spectra at high energy (≥10GeV). The background to the electron energy spectrum from distant sources is determined with the help of the GALPROP code. The obtained numerical results are compared with a set of experimental data
Contribution from individual nearby sources to the spectrum of high-energy cosmic-ray electrons
Energy Technology Data Exchange (ETDEWEB)
Sedrati, R., E-mail: rafik.sedrati@univ-annaba.org; Attallah, R.
2014-04-01
In the last few years, very important data on high-energy cosmic-ray electrons and positrons from high-precision space-born and ground-based experiments have attracted a great deal of interest. These particles represent a unique probe for studying local comic-ray accelerators because they lose energy very rapidly. These energy losses reduce the lifetime so drastically that high-energy cosmic-ray electrons can attain the Earth only from rather local astrophysical sources. This work aims at calculating, by means of Monte Carlo simulation, the contribution from some known nearby astrophysical sources to the cosmic-ray electron/positron spectra at high energy (≥10GeV). The background to the electron energy spectrum from distant sources is determined with the help of the GALPROP code. The obtained numerical results are compared with a set of experimental data.
Energy Technology Data Exchange (ETDEWEB)
O' Neill, J.P.; Flint, K.B.
The cytotoxic and mutagenic effect of X-irradiation was determined with Chinese hamster ovary cells arrested in the G0/G1 phase of the cell cycle through 9 days incubation in serum-free medium. In comparison with exponential phase cultures, the arrested cells showed increased cytotoxicity and mutation induction over the dose range of 50-800 rad. Exponential cultures showed a linear mutant frequency-survival relationship while the arrested cells showed a biphasic linear relationship. A post irradiation holding period 24 h does not result in any change in the mutant frequency. The increased sensitivity of the arrested cells to the mutagenic effects of X-rays appears to be a cell-cycle phase phenomenon. Upon readdition of serum, the arrested cells re-enter the cell cycle in a synchronous manner, reaching S phase at 10-12 h. Cells irradiated at 5 h after serum addition, i.e. in G1, show a similar dose response for mutant frequency, while those irradiated at 10 h or later, i.e. in late G1, S or G2, show lower mutation induction. These observations are consistent with a chromosome interchange mechanism of mutation induction by X-rays, possibly through interactions between repairing regions of the DNA. Irradiation of cells in the G0/G1 phase allow more time for such interactions in the absence of semiconservative DNA replication. (orig.).
Energy Technology Data Exchange (ETDEWEB)
Stoupin, Stanislav, E-mail: sstoupin@aps.anl.gov; Shvyd’ko, Yuri; Trakhtenberg, Emil; Liu, Zunping; Lang, Keenan; Huang, Xianrong; Wieczorek, Michael; Kasman, Elina; Hammonds, John; Macrander, Albert; Assoufid, Lahsen [Advanced Photon Source, Argonne National Laboratory, Argonne, IL 60439 (United States)
2016-07-27
We report progress on implementation and commissioning of sequential X-ray diffraction topography at 1-BM Optics Testing Beamline of the Advanced Photon Source to accommodate growing needs of strain characterization in diffractive crystal optics and other semiconductor single crystals. The setup enables evaluation of strain in single crystals in the nearly-nondispersive double-crystal geometry. Si asymmetric collimator crystals of different crystallographic orientations were designed, fabricated and characterized using in-house capabilities. Imaging the exit beam using digital area detectors permits rapid sequential acquisition of X-ray topographs at different angular positions on the rocking curve of a crystal under investigation. Results on sensitivity and spatial resolution are reported based on experiments with high-quality Si and diamond crystals. The new setup complements laboratory-based X-ray topography capabilities of the Optics group at the Advanced Photon Source.
A radio monitoring survey of ultra-luminous X-ray sources
Körding, E.; Colbert, E.; Falcke, H.
2005-06-01
We present the results of a radio monitoring campaign to search for radio emission from nearby ultra-luminous X-ray sources (ULXs). These sources are bright off-nuclear X-ray point sources with luminosities exceeding LX > 1039 erg s-1. A well-defined sample of the 9 nearest ULXs has been monitored eight times over 5 months with the Very Large Array in A and B configuration. Our limiting sensitivity is ≈0.15 mJy (4σ) for radio flares and ≈60 μJy for continuous emission. In M 82 two ULXs seem to have coincident compact radio sources, which are probably supernova remnants. No continuous or flaring radio emission has been detected from any other ULX. Thus, ULXs do not generally emit steady-state radio emission above radio powers of 1.5 × 1017 W/Hz. The non-detections of the continuous emission are consistent with beamed or unbeamed radio emission from accreting black holes of ≤ 103 M⊙ based on the radio/X-ray correlation. Other published radio detections (M 82, NGC 5408) are also discussed in this context. Both detections are significantly above our detection limit. If ULXs have flaring radio emission above 4 × 1017 W/Hz we can give an upper limit on the duty cycle of the flares of 6%. This upper limit is in agreement with the observed number of flares in Galactic radio transients. Additionally we present a yet unreported radio double structure in the nearby low-luminosity AGN NGC 4736.
X-Band Linac Beam-Line for Medical Compton Scattering X-Ray Source
Dobashi, Katsuhiro; Ebina, Futaro; Fukasawa, Atsushi; Hayano, Hitoshi; Higo, Toshiyasu; Kaneyasu, Tatsuo; Ogino, Haruyuki; Sakamoto, Fumito; Uesaka, Mitsuru; Urakawa, Junji; Yamamoto, Tomohiko
2005-01-01
Compton scattering hard X-ray source for 10~80 keV are under construction using the X-band (11.424 GHz) electron linear accelerator and YAG laser at Nuclear Engineering Research laboratory, University of Tokyo. This work is a part of the national project on the development of advanced compact medical accelerators in Japan. National Institute for Radiological Science is the host institute and U. Tokyo and KEK are working for the X-ray source. Main advantage is to produce tunable monochromatic hard ( 10-80
Bright x-ray stainless steel K-shell source development at the National Ignition Facility
Energy Technology Data Exchange (ETDEWEB)
May, M. J.; Fournier, K. B.; Colvin, J. D.; Barrios, M. A.; Dewald, E. L.; Moody, J.; Patterson, J. R.; Schneider, M.; Widmann, K. [Lawrence Livermore National Laboratory, P.O. Box 808 L170, Livermore, California 94551 (United States); Hohenberger, M.; Regan, S. P. [Laboratory for Laser Energetics, University of Rochester, Rochester, New York 14623 (United States)
2015-06-15
High x-ray conversion efficiency (XRCE) K-shell sources are being developed for high energy density experiments for use as backlighters and for the testing of materials exposed to high x-ray fluxes and fluences. Recently, sources with high XRCE in the K-shell x-ray energy range of iron and nickel were investigated at the National Ignition Facility (NIF). The x-ray conversion efficiency in the 5–9 keV spectral range was determined to be 6.8% ± 0.3%. These targets were 4.1 mm diameter, 4 mm tall hollow epoxy tubes having a 50 μm thick wall supporting a tube of 3 to 3.5 μm thick stainless steel. The NIF laser deposited ∼460 kJ of 3ω light into the target in a 140 TW, 3.3 ns square pulse. The absolute x-ray emission of the source was measured by two calibrated Dante x-ray spectrometers. Time resolved images filtered for the Fe K-shell were recorded to follow the heating of the target. Time integrated high-resolution spectra were recorded in the K-shell range.
Experimental Comparison of 2-3MV X-Ray Sources for Flash Radiography
International Nuclear Information System (INIS)
MENGE, PETER RICHARD; JOHNSON, DAVID LEE; MAENCHEN, JOHN E.; OLSON, CRAIG L.; ROVANG, DEAN C.; DROEMER, D.; HUNT, E.; OLIVER, BRYAN VELTEN; ROSE, DAVID VINCENT; WELCH, DALE ROBERT
2002-01-01
High-brightness flash x-ray sources are needed for penetrating dynamic radiography for a variety of applications. Various bremsstrahlung source experiments have been conducted on the TriMeV accelerator (3MV, 60 Ω 20 ns) to determine the best diode and focusing configuration in the 2-3 MV range. Three classes of candidate diodes were examined: gas cell focusing, magnetically immersed, and rod pinch. The best result for the gas cell diode was 6 rad at 1 meter from the source with a 5 mm diameter x-ray spot. Using a 0.5 mm diameter cathode immersed in a 17 T solenoidal magnetic field, the best shot produced 4.1 rad with a 2.9 mm spot. The rod pinch diode demonstrated very reproducible radiographic spots between 0.75 and 0.8 mm in diameter, producing 1.2 rad. This represents a factor of eight improvement in the TriMeV flash radiographic capability above the original gas cell diode to a figure of merit (dose/spot diameter) > 1.8 rad/mm. These results clearly show the rod pinch diode to be the choice x-ray source for flash radiography at 2-3 M V
Discovery of a Nonblazar Gamma-Ray Transient Source Near the Galactic Plane: GRO J1838-04
Tavani, M.; Oliversen, Ronald (Technical Monitor)
2001-01-01
We report the discovery of a remarkable gamma-ray transient source near the Galactic plane, GRO J1838-04. This source was serendipitously discovered by EGRET in 1995 June with a peak intensity of approx. (4 +/- 1) x 10(exp -6) photons/sq cm s (for photon energies larger than 100 MeV) and a 5.9 sigma significance. At that time, GRO J1838-04 was the second brightest gamma-ray source in the sky. A subsequent EGRET pointing in 1995 late September detected the source at a flux smaller than its peak value by a factor of approx. 7. We determine that no radio-loud spectrally flat blazar is within the error box of GRO J1838-04. We discuss the origin of the gamma-ray transient source and show that interpretations in terms of active galactic nuclei or isolated pulsars are highly problematic. GRO J1838-04 provides strong evidence for the existence of a new class of variable gamma-ray sources.
Compact X-ray source based on Compton backscattering
Bulyak, E V; Zelinsky, A; Karnaukhov, I; Kononenko, S; Lapshin, V G; Mytsykov, A; Telegin, Yu P; Khodyachikh, A; Shcherbakov, A; Molodkin, V; Nemoshkalenko, V; Shpak, A
2002-01-01
The feasibility study of an intense X-ray source based on the interaction between the electron beam in a compact storage ring and the laser pulse accumulated in an optical resonator is carried out. We propose to reconstruct the 160 MeV electron storage ring N-100, which was shutdown several years ago. A new magnetic lattice will provide a transverse of electron beam size of approx 35 mu m at the point of electron beam-laser beam interaction. The proposed facility is to generate X-ray beams of intensity approx 2.6x10 sup 1 sup 4 s sup - sup 1 and spectral brightness approx 10 sup 1 sup 2 phot/0.1%bw/s/mm sup 2 /mrad sup 2 in the energy range from 10 keV up to 0.5 MeV. These X-ray beam parameters meet the requirements for most of technological and scientific applications. Besides, we plan to use the new facility for studying the laser cooling effect.
Compact X-ray source based on Compton backscattering
Energy Technology Data Exchange (ETDEWEB)
Bulyak, E.; Gladkikh, P.; Zelinsky, A. E-mail: zelinsky@kipt.kharkov.ua; Karnaukhov, I.; Kononenko, S.; Lapshin, V.; Mytsykov, A.; Telegin, Yu.; Khodyachikh, A.; Shcherbakov, A.; Molodkin, V.; Nemoshkalenko, V.; Shpak, A
2002-07-21
The feasibility study of an intense X-ray source based on the interaction between the electron beam in a compact storage ring and the laser pulse accumulated in an optical resonator is carried out. We propose to reconstruct the 160 MeV electron storage ring N-100, which was shutdown several years ago. A new magnetic lattice will provide a transverse of electron beam size of {approx}35 {mu}m at the point of electron beam-laser beam interaction. The proposed facility is to generate X-ray beams of intensity {approx}2.6x10{sup 14} s{sup -1} and spectral brightness {approx}10{sup 12} phot/0.1%bw/s/mm{sup 2}/mrad{sup 2} in the energy range from 10 keV up to 0.5 MeV. These X-ray beam parameters meet the requirements for most of technological and scientific applications. Besides, we plan to use the new facility for studying the laser cooling effect.
Compact FEL-driven inverse compton scattering gamma-ray source
Energy Technology Data Exchange (ETDEWEB)
Placidi, M. [Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States); Di Mitri, S., E-mail: simone.dimitri@elettra.eu [Elettra - Sincrotrone Trieste S.C.p.A., 34149 Basovizza, Trieste (Italy); Pellegrini, C. [SLAC National Accelerator Laboratory, Menlo Park, CA 94025 (United States); University of California, Los Angeles, CA 90095 (United States); Penn, G. [Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States)
2017-05-21
Many research and applications areas require photon sources capable of producing gamma-ray beams in the multi-MeV energy range with reasonably high fluxes and compact footprints. Besides industrial, nuclear physics and security applications, a considerable interest comes from the possibility to assess the state of conservation of cultural assets like statues, columns etc., via visualization and analysis techniques using high energy photon beams. Computed Tomography scans, widely adopted in medicine at lower photon energies, presently provide high quality three-dimensional imaging in industry and museums. We explore the feasibility of a compact source of quasi-monochromatic, multi-MeV gamma-rays based on Inverse Compton Scattering (ICS) from a high intensity ultra-violet (UV) beam generated in a free-electron laser by the electron beam itself. This scheme introduces a stronger relationship between the energy of the scattered photons and that of the electron beam, resulting in a device much more compact than a classic ICS for a given scattered energy. The same electron beam is used to produce gamma-rays in the 10–20 MeV range and UV radiation in the 10–15 eV range, in a ~4×22 m{sup 2} footprint system.
Energy Technology Data Exchange (ETDEWEB)
Gebauer, Iris; Bentele, Rosemarie [Karlsruhe Institute of Technology, Karlsruhe (Germany)
2016-07-01
The rise in the positron fraction as observed by AMS and previously by PAMELA, cannot be explained by the standard paradigm of cosmic ray transport in which positrons are produced by cosmic-ray-gas interactions in the interstellar medium. Possible explanations are pulsars, which produce energetic electron-positron pairs in their rotating magnetic fields, or the annihilation of dark matter. Here we assume that these positrons originate from a single close-by point source, producing equal amounts of electrons and positrons. The propagation and energy losses of these electrons and positrons are calculated numerically using the DRAGON code, the source properties are optimized to best describe the AMS data. Using the FERMI-LAT limits on a possible dipole anisotropy in electron and positron arrival directions, we put a limit on the minimum distance of such a point source. The energy losses that these energetic electrons and positrons suffer on their way through the galaxy create gamma ray photons through bremsstrahlung and Inverse Compton scattering. Using the measurement of diffuse gamma rays from Fermi-LAT we put a limit on the maximum distance of such a point source. We find that a single electron positron point source powerful enough to explain the locally observed positron fraction must reside between 225 pc and 3.7 kpc distance from the sun and compare to known pulsars.
X-ray microscopy resource center at the Advanced Light Source
International Nuclear Information System (INIS)
Meyer-Ilse, W.; Koike, M.; Beguiristain, R.; Maser, J.; Attwood, D.
1992-07-01
An x-ray microscopy resource center for biological x-ray imaging vvill be built at the Advanced Light Source (ALS) in Berkeley. The unique high brightness of the ALS allows short exposure times and high image quality. Two microscopes, an x-ray microscope (XM) and a scanning x-ray microscope (SXM) are planned. These microscopes serve complementary needs. The XM gives images in parallel at comparable short exposure times, and the SXM is optimized for low radiation doses applied to the sample. The microscopes extend visible light microscopy towards significantly higher resolution and permit images of objects in an aqueous medium. High resolution is accomplished by the use of Fresnel zone plates. Design considerations to serve the needs of biological x-ray microscopy are given. Also the preliminary design of the microscopes is presented. Multiple wavelength and multiple view images will provide elemental contrast and some degree of 3D information
Influence of Bernstein modes on the efficiency of electron cyclotron resonance x-ray source
International Nuclear Information System (INIS)
Andreev, V. V.; Nikitin, G.V.; Savanovich, V.Yu.; Umnov, A.M.; Elizarov, L.I.; Serebrennikov, K.S.; Vostrikova, E.A.
2006-01-01
The article considers the factors influencing the temperature of hot electron component in an electron cyclotron resonance (ECR) x-ray source. In such sources the electron heating occurs often due to extraordinary electromagnetic wave propagating perpendicularly to the magnetic field. In this case the possibility of the absorption of Bernstein modes is regarded as an additional mechanism of electron heating. The Bernstein modes in an ECR x-ray source can arise due to either linear transformation or parametric instability of external transversal wave. The article briefly reviews also the further experiments which will be carried out to study the influence of Bernstein modes on the increase of hot electron temperature and consequently of x-ray emission
International Nuclear Information System (INIS)
Malcolm, Andrew A.; Liu, Tong; Ng, Ivan Kee Beng; Teng, Wei Yuen; Yap, Tsi Tung; Wan, Siew Ping; Kong, Chun Jeng
2013-01-01
X-ray Computed Tomography (CT) allows visualisation of the physical structures in the interior of an object without physically opening or cutting it. This technology supports a wide range of applications in the non-destructive testing, failure analysis or performance evaluation of industrial products and components. Of the numerous factors that influence the performance characteristics of an X-ray CT system the energy level in the X-ray spectrum to be used is one of the most significant. The ability of the X-ray beam to penetrate a given thickness of a specific material is directly related to the maximum available energy level in the beam. Higher energy levels allow penetration of thicker components made of more dense materials. In response to local industry demand and in support of on-going research activity in the area of 3D X-ray imaging for industrial inspection the Singapore Institute of Manufacturing Technology (SIMTech) engaged in the design, development and integration of large scale multiple source X-ray computed tomography system based on X-ray sources operating at higher energies than previously available in the Institute. The system consists of a large area direct digital X-ray detector (410 x 410 mm), a multiple-axis manipulator system, a 225 kV open tube microfocus X-ray source and a 450 kV closed tube millifocus X-ray source. The 225 kV X-ray source can be operated in either transmission or reflection mode. The body of the 6-axis manipulator system is fabricated from heavy-duty steel onto which high precision linear and rotary motors have been mounted in order to achieve high accuracy, stability and repeatability. A source-detector distance of up to 2.5 m can be achieved. The system is controlled by a proprietary X-ray CT operating system developed by SIMTech. The system currently can accommodate samples up to 0.5 x 0.5 x 0.5 m in size with weight up to 50 kg. These specifications will be increased to 1.0 x 1.0 x 1.0 m and 100 kg in future
Einstein X-ray survey of the Pleiades - The dependence of X-ray emission on stellar age
Micela, G.; Sciortino, S.; Serio, S.; Vaiana, G. S.; Bookbinder, J.; Golub, L.; Harnden, F. R., Jr.; Rosner, R.
1985-01-01
The data obtained with two pointed observations of 1 deg by 1 deg fields of the Pleiades region have been analyzed, and the results are presented. The maximum-likelihood X-ray luminosity functions for the Pleiades G and K stars in the cluster are derived, and it is shown that, for the G stars, the Pleiades X-ray luminosity function is significantly brighter than the corresponding function for Hyades G dwarf stars. This finding indicates a dependence of X-ray luminosity on stellar age, which is confirmed by comparison of the same data with median X-ray luminosities of pre-main sequence and local disk population dwarf G stars. It is suggested that the significantly larger number of bright X-ray sources associated with G stars than with K stars, the lack of detection of M stars, and the relatively rapid rotation of the Pleiades K stars can be explained in terms of the onset of internal differential rotation near the convective envelope-radidative core interface after the spin-up phase during evolution to the main sequence.
Nuclear and x-ray spectroscopy with radioactive sources
International Nuclear Information System (INIS)
Fink, R.W.
1977-01-01
Research in nuclear chemistry for 1977 is reviewed. The greatest part of the effort was directed to nuclear spectroscopy (systematics, models, experimental studies), but some work was also done involving fast neutrons and x rays from radioactive sources. Isotopes of Tl, Hg, Au, and Eu were studied in particular. Personnel and publications lists are also included. 5 figures, 1 table
High resolution hard x-ray microscope on a second generation synchrotron source
International Nuclear Information System (INIS)
Tian Yangchao; Li Wenjie; Chen Jie; Liu Longhua; Liu Gang; Tian Jinping; Xiong Ying; Tkachuk, Andrei; Gelb, Jeff; Hsu, George; Yun Wenbing
2008-01-01
A full-field, transmission x-ray microscope (TXM) operating in the energy range of 7-11 keV has been installed at the U7A beamline at the National Synchrotron Radiation Laboratory, a second generation synchrotron source operating at 0.8 GeV. Although the photon flux at sample position in the operating energy range is significantly low due to its relatively large emittance, the TXM can get high quality x-ray images with a spatial resolution down to 50 nm with acceptable exposure time. This TXM operates in either absorption or Zernike phase contrast mode with similar resolution. This TXM is a powerful analytical tool for a wide range of scientific areas, especially studies on nanoscale phenomena and structural imaging in biology, materials science, and environmental science. We present here the property of the x-ray source, beamline design, and the operation and key optical components of the x-ray TXM. Plans to improve the throughput of the TXM will be discussed.
Multiband counterparts of two eclipsing ultraluminous X-ray sources in M 51
Urquhart, R.; Soria, R.; Johnston, H. M.; Pakull, M. W.; Motch, C.; Schwope, A.; Miller-Jones, J. C. A.; Anderson, G. E.
2018-04-01
We present the discovery and interpretation of ionized nebulae around two ultraluminous X-ray sources in M 51; both sources share the rare property of showing X-ray eclipses by their companion stars and are therefore prime targets for follow-up studies. Using archival Hubble Space Telescope images, we found an elongated, 100-pc-long emission-line structure associated with one X-ray source (CXOM51 J132940.0+471237; ULX-1 for simplicity), and a more circular, ionized nebula at the location of the second source (CXOM51 J132939.5+471244; ULX-2 for simplicity). We observed both nebulae with the Large Binocular Telescope's Multi-Object Double Spectrograph. From our analysis of the optical spectra, we argue that the gas in the ULX-1 bubble is shock-ionized, consistent with the effect of a jet with a kinetic power of ≈2 × 1039 erg s-1. Additional X-ray photoionization may also be present, to explain the strength of high-ionization lines such as He II λ4686 and [Ne V] λ3426. On the other hand, the emission lines from the ULX-2 bubble are typical for photoionization by normal O stars suggesting that the nebula is actually an H II region not physically related to the ULX but is simply a chance alignment. From archival Very Large Array data, we also detect spatially extended, steep-spectrum radio emission at the location of the ULX-1 bubble (consistent with its jet origin), but no radio counterpart for ULX-2 (consistent with the lack of shock-ionized gas around that source).
Development and application of sub-nanosecond pulse-repeatable hard X-ray source
International Nuclear Information System (INIS)
Quan Lin; Fan Yajun; Tu Jing
2013-01-01
A multipurpose X-ray source was developed to meet the needs of multitask application such as radiation detection, radiation imaging and so on. The multipurpose X-ray source has characteristic of adjustable width and energy, pulse-repetition operation, ultra-short pulse and fine stability. Its rising time is close to 98.6 ps, the operation voltage reaches 425 kV, and the peak fluence rate exceeds 2.07 × 10 18 cm -2 · s -1 at 10 cm, which provides an ideal radiation environment for relevant application. (authors)
Rockets for Extended Source Soft X-ray Spectroscopy
McEntaffer, Randall
The soft X-ray background surrounds our local galactic environment yet very little is known about the physical characteristics of this plasma. A high-resolution spectrum could unlock the properties of this million degree gas but the diffuse, low intensity nature of the background have made it difficult to observe, especially with a dispersive spectrograph. Previous observations have relied on X-ray detector energy resolution which produces poorly defined spectra that are poorly fit by complex plasma models. Here we propose a series of suborbital rocket flights that will begin the characterization of this elusive source through high-resolution X-ray grating spectroscopy. The rocket-based spectrograph can resolve individual emission lines over the soft X-ray band and place tight constraints on the temperature, density, abundance, ionization state and age of the plasma. These payloads will draw heavily from the heritage gained from previous rocket missions, while also benefiting from related NASA technology development programs. The Pennsylvania State University (PSU) team has a history of designing and flying spectrometer components onboard rockets while also being scientific leaders in the field of diffuse soft X-ray astronomy. The PSU program will provide hands-on training of young scientists in the techniques of instrumental and observational X-ray astronomy. The proposed rocket program will also expose these researchers to a full experiment cycle: design, fabrication, tolerance analysis, assembly, flight-qualification, calibration, integration, launch, and data analysis; using a combination of technologies suitable for adaptation to NASA's major missions. The PSU program in suborbital X-ray astronomy represents an exciting mix of compelling science, heritage, cutting-edge technology development, and training of future scientists.
A Fieldable-Prototype Large-Area Gamma-ray Imager for Orphan Source Search
Energy Technology Data Exchange (ETDEWEB)
Ziock, Klaus-Peter [ORNL; Fabris, Lorenzo [ORNL; Carr, Dennis [Lawrence Livermore National Laboratory (LLNL); Collins, Jeff [Lawrence Livermore National Laboratory (LLNL); Cunningham, Mark F [Lawrence Livermore National Laboratory (LLNL); Habte Ghebretatios, Frezghi [ORNL; Karnowski, Thomas Paul [ORNL; Marchant, William [University of California, Berkeley
2008-01-01
We have constructed a unique instrument for use in the search for orphan sources. The system uses gamma-ray imaging to "see through" the natural background variations that effectively limit the search range of normal devices to ~10 m. The imager is mounted in a 4.9- m-long trailer and can be towed by a large personal vehicle. Source locations are determined both in range and along the direction of travel as the vehicle moves. A fully inertial platform coupled to a Global Positioning System receiver is used to map the gamma-ray images onto overhead geospatial imagery. The resulting images provide precise source locations, allowing rapid follow-up work. The instrument simultaneously searches both sides of the street to a distance of 50 m (100-m swath) for milliCurieclass sources with near-perfect performance.
Optimization of in-line phase contrast particle image velocimetry using a laboratory x-ray source
International Nuclear Information System (INIS)
Ng, I.; Fouras, A.; Paganin, D. M.
2012-01-01
Phase contrast particle image velocimetry (PIV) using a laboratory x-ray microfocus source is investigated using a numerical model. Phase contrast images of 75 μm air bubbles, embedded within water exhibiting steady-state vortical flow, are generated under the paraxial approximation using a tungsten x-ray spectrum at 30 kVp. Propagation-based x-ray phase-contrast speckle images at a range of source-object and object-detector distances are generated, and used as input into a simulated PIV measurement. The effects of source-size-induced penumbral blurring, together with the finite dynamic range of the detector, are accounted for in the simulation. The PIV measurement procedure involves using the cross-correlation between temporally sequential speckle images to estimate the transverse displacement field for the fluid. The global error in the PIV reconstruction, for the set of simulations that was performed, suggests that geometric magnification is the key parameter for designing a laboratory-based x-ray phase-contrast PIV system. For the modeled system, x-ray phase-contrast PIV data measurement can be optimized to obtain low error ( 15 μm) of the detector, high geometric magnification (>2.5) is desired, while for large source size system (FWHM > 30 μm), low magnification (<1.5) would be suggested instead. The methods developed in this paper can be applied to optimizing phase-contrast velocimetry using a variety of laboratory x-ray sources.
High-voltage transistor converter for pulsed x-ray sources
International Nuclear Information System (INIS)
Krasil'nikov, S.B.; Kristalinskii, A.L.; Lozovoi, L.N.; Markov, S.N.; Sindalovskii, E.I.
1986-01-01
A 24-V/12-kV converter for MIRA-2D and NORA pulsed x-ray sources is described. When the low-voltage supply varies within 20-26 V, the frequency stability of the x-ray pulses is higher by a factor of 3 ≅ 3 than when the PRIMA converter is used. For 14-24 V, the average output power of the converter is independent of the load impedance and increases linearly with an increase in supply voltage. The efficiency of the converter reaches 60%. The converter operates in the temperature range of -40 to +60 0 C
X-ray holographic microscopy experiments at the Brookhaven synchrotron light source
International Nuclear Information System (INIS)
Howells, M.R.; Iarocci, M.; Kenney, J.; Kirz, J.; Rarback, H.
1983-01-01
Soft x-ray holographic microscopy is discussed from an experimental point of view. Three series of measurements have been carried out using the Brookhaven 750 MeV storage ring as an x-ray source. Young slits fringes, Gabor (in line) holograms and various data pertaining to the soft x-ray performance of photographic plates are reported. The measurements are discussed in terms of the technique for recording them and the experimental limitations in effect. Some discussion is also given of the issues involved in reconstruction using visible light
Synchrotron x-ray sources and new opportunities in the soil and environmental sciences
International Nuclear Information System (INIS)
Schulze, D.; Anderson, S.; Mattigod, S.
1990-07-01
This report contains the following papers: characteristics of the advanced photon source and comparison with existing synchrotron facilities; x-ray absorption spectroscopy: EXAFS and XANES -- A versatile tool to study the atomic and electronic structure of materials; applications of x-ray spectroscopy and anomalous scattering experiments in the soil and environmental sciences; X-ray fluorescence microprobe and microtomography
The spherical pinch as a soft x-ray source for microlithography and other industrial applications
International Nuclear Information System (INIS)
Aithal, S.; Lamari, M.; Panarella, E.
1992-01-01
In the course of the past several years, an R and D program has been carried out at ALFT in order to exploit the Spherical Pinch concept of plasma heating to create a hot plasma of radiation emission characteristics of interest for industrial X-ray microlithography. The program has been successful and a prototype machine has now been built. The plasma is generated by inductively discharging 30 kJ of electrical energy from a condenser bank in a spherically shaped coil. Since the energy transfer efficiency is ∼ 25%, in excess of 7 kJ of energy is deposited into the plasma. The strong implosion thus generated, on compressing a preformed central plasma, creates a source of soft X-rays having the following characteristics: X-ray energy, 1--3, keV; X-ray energy per pulse, ∼ 50, J; Source size, ∼ 1, mm; X-ray flux at--20 cm from source, ∼10, mJ/cm 2 /shot; position reproducibility, 0.1, Hz. These characteristics are very close to what is required by the semiconductor industries for microlithography. For this reason, a commercial unit is now being designed and manufactured and will be available for marketing by the end of 1992. This source of soft X-rays has recently found another industrial application, paper radiography for quality evaluation and control in the paper industry. The possibility of imaging by means of soft X-rays the microstructure of paper on production line enables the operator to adjust the paper manufacturing configuration through variations of the relative speed of the jet compared to that of the wire. A compact X-ray source for paper radiography is now being designed and manufactured, and a prototype machine will be ready by the beginning of 1993. The Spherical Pinch plasma source is a good radiation emitter also in the UV and the deep UV range of the spectrum
Micro-fresnel structures for microscopy of laser generated bright x-ray sources
International Nuclear Information System (INIS)
Ceglio, N.M.; Shavers, D.C.; Flanders, D.C.; Smith, H.I.
1979-01-01
A brief parametric survey of the x-ray characteristics of a gold micro-disk irradiated at 3 x 10 14 watt/cm 2 by a 1 nsec Nd-glass laser pulse has been provided as an example of a laser generated bright x-ray source. It was shown that a simple phenomenological model of the laser generated x-ray source as a microscopic equilibrium plasma radiating as a blackbody for a finite time determined by its hydrodynamic disassembly and radiation losses, serves to provide an adequate approximation to the x-ray characteristics of such sources. The current state of x-ray microscopy within the LLL laser fusion program was briefly reviewed. Kirpatrick--Baez grazing incidence reflection x-ray microscopes are being used to provide 3 to 5 μm resolution, broadband images (ΔE/E approx. 0.3) over a spectral range from .6 keV to 3.5 keV. Zone Plate Coded Imaging is used to provide 5 to 10 μm resolution, broadband (ΔE/E approx. 0.5) images over a spectral range from 3 keV to 50 keV. Efficient x-ray lensing elements with anticipated submicron resolution are being developed for narrowband (ΔE/E approx. 10 -2 ) imaging applications over a spectral range .1 keV to 8 keV. The x-ray lens design is that of a transmission blazed Fresnel phase plate. Micro--Fresnel zone plates with 3200 A minimum linewidth have been fabricated and preliminary resolution tests begun. The first resolution test pattern, having minimum linewidth of 2.5 μm, was imaged in lambda = 8.34 A light with no difficulty. Newer test patterns with submicron minimum line are being prepared for the next stage of resolution testing. An off-axis Fresnel zone plate with 1600 A minimum linewidth is presently being fabricated for use as an imaging spectrometer in order to provide spatially separated, chromatically distinct images of characteristic line emissions from laser fusion targets
A free-electron laser fourth-generation X-ray source
International Nuclear Information System (INIS)
Moncton, D. E.
1999-01-01
The field of synchrotrons radiation research has grown rapidly over the last 25 years due to both the push of the accelerator and magnet technology that produces the x-ray beams and the pull of the extraordinary scientific research those beams make possible. Three successive generations of synchrotrons radiation facilities have resulted in beam brilliances 11 to 12 orders of magnitude greater than the standard laboratory x-ray tube. However, greater advances can be easily imagined given the fact that x-ray beams from present-day facilities do not exhibit the coherence or time structure so familiar with the.optical laser. Theoretical work over the last ten years or so has pointed to the possibility of generating hard x-ray beams with laser-like characteristics. The concept is based on self-amplified spontaneous emission in free electron lasers. The use of a superconducting linac could produce a major, cost-effective facility that spans wavelengths from the ultraviolet to the hard x-ray regime, simultaneously servicing large numbers experimenters from a wide range of disciplines. As with each past generation of synchrotron facilities, immense new scientific opportunities from fourth-generation sources
Flat Field Anomalies in an X-Ray CCD Camera Measured Using a Manson X-Ray Source
International Nuclear Information System (INIS)
Michael Haugh
2008-01-01
The Static X-ray Imager (SXI) is a diagnostic used at the National Ignition Facility (NIF) to measure the position of the X-rays produced by lasers hitting a gold foil target. It determines how accurately NIF can point the laser beams and is critical to proper NIF operation. Imagers are located at the top and the bottom of the NIF target chamber. The CCD chip is an X-ray sensitive silicon sensor, with a large format array (2k x 2k), 24 (micro)m square pixels, and 15 (micro)m thick. A multi-anode Manson X-ray source, operating up to 10kV and 2mA, was used to characterize and calibrate the imagers. The output beam is heavily filtered to narrow the spectral beam width, giving a typical resolution E/ΔE ∼ 12. The X-ray beam intensity was measured using an absolute photodiode that has accuracy better than 1% up to the Si K edge and better than 5% at higher energies. The X-ray beam provides full CCD illumination and is flat, within ±1.5% maximum to minimum. The spectral efficiency was measured at 10 energy bands ranging from 930 eV to 8470 eV. The efficiency pattern follows the properties of Si. The maximum quantum efficiency is 0.71. We observed an energy dependent pixel sensitivity variation that showed continuous change over a large portion of the CCD. The maximum sensitivity variation was >8% at 8470 eV. The geometric pattern did not change at lower energies, but the maximum contrast decreased and was less than the measurement uncertainty below 4 keV. We were also able to observe debris on the CCD chip. The debris showed maximum contrast at the lowest energy used, 930 eV, and disappeared by 4 keV. The Manson source is a powerful tool for characterizing the imaging errors of an X-ray CCD imager. These errors are quite different from those found in a visible CCD imager
Beam dynamics simulation in the X-ray Compton source
International Nuclear Information System (INIS)
Gladkikh, P.; Karnaukhov, I.; Telegin, Yu.; Shcherbakov, A.; Zelinsky, A.
2002-01-01
At the National Science Center 'Kharkov Institute of Physics and Technology' the X-ray source based on Compton scattering has been developed. The computer code for simulation of electron beam dynamics with taking into account the Compton scattering effect based on Monte Carlo method is described in this report. The first results of computer simulation of beam dynamics with electron-photon interaction, parameters of electron and photon beams are presented. Calculations were carried out with the lattice of synchrotron light source SRS-800 Ukrainian Synchrotron Center
Beam dynamics simulation in the X-ray Compton source
Gladkikh, P; Telegin, Yu P; Shcherbakov, A; Zelinsky, A
2002-01-01
At the National Science Center 'Kharkov Institute of Physics and Technology' the X-ray source based on Compton scattering has been developed. The computer code for simulation of electron beam dynamics with taking into account the Compton scattering effect based on Monte Carlo method is described in this report. The first results of computer simulation of beam dynamics with electron-photon interaction, parameters of electron and photon beams are presented. Calculations were carried out with the lattice of synchrotron light source SRS-800 Ukrainian Synchrotron Center.
Characterization of a novel x-ray source: The MIRRORCLE-6X system
International Nuclear Information System (INIS)
Gambaccini, M.; Marziani, M.; Taibi, A.; Cardarelli, P.; Di Domenico, G.; Mastella, E.
2012-01-01
MIRRORCLE is a tabletop synchrotron light source being investigated within an EC funded project named LABSYNC. To evaluate the potential of this novel x-ray source for medical imaging applications, a set of measurements was performed at the MIRRORCLE factory in Japan. In particular, the aim of this work was to characterize the proposed compact x-ray source by determining different parameters, such as the intensity of the broad spectra produced with thin wire targets, the size of the focal spot and its distribution. The average electron-beam impact current on wire targets was calculated by several methods and it was demonstrated to be in the range 0.5-1.0μA. By comparing these values with data available for conventional x-ray tubes, the current needed to achieve the same fluence as in a standard diagnostic examination was estimated to be about 0.1-0.5 mA. Finally, results from the measurements of the electron-beam impact cross-section on the target suggested that the diameter of the electron beam circulating in the storage ring is about 6 mm.
POLAR: A Space-borne X-Ray Polarimeter for Transient Sources
Orsi, S.; Polar Collaboration
2011-02-01
POLAR is a novel compact Compton X-ray polarimeter designed to measure the linear polarization of the prompt emission of Gamma Ray Bursts (GRB) and other strong transient sources such as soft gamma repeaters and solar flares in the energy range 50-500 keV. A detailed measurement of the polarization from astrophysical sources will lead to a better understanding of the source geometry and emission mechanisms. POLAR is expected to observe every year several GRBs with a minimum detectable polarization smaller than 10%, thanks to its large modulation factor, effective area, and field of view. POLAR consists of 1600 low-Z plastic scintillator bars, divided in 25 independent modular units, each read out by one flat-panel multi-anode photomultiplier. The design of POLAR is reviewed, and results of tests of one modular unit of the engineering and qualification model (EQM) of POLAR with synchrotron radiation are presented. After construction and testing of the full EQM, we will start building the flight model in 2011, in view of the launch foreseen in 2013.
Energy Technology Data Exchange (ETDEWEB)
Gibson, Alexander [SLAC National Accelerator Lab., Menlo Park, CA (United States)
2015-08-23
In my research, I analyzed how two gamma-ray source models interact with one another when optimizing to fit data. This is important because it becomes hard to distinguish between the two point sources when they are close together or looking at low energy photons. The reason for the first is obvious, the reason why they become harder to distinguish at lower photon energies is the resolving power of the Fermi Gamma-Ray Space Telescope gets worse at lower energies. When the two point sources are highly correlated (hard to distinguish between), we need to change our method of statistical analysis. What I did was show that highly correlated sources have larger uncertainties associated with them, caused by an optimizer not knowing which point source’s parameters to optimize. I also mapped out where their is high correlation for 2 different theoretical mass dark matter point sources so that people analyzing them in the future knew where they had to use more sophisticated statistical analysis.
Development of a fluorescent x-ray source for medical imaging
Toyofuku, F.; Tokumori, K.; Nishimura, K.; Saito, T.; Takeda, T.; Itai, Y.; Hyodo, K.; Ando, M.; Endo, M.; Naito, H.; Uyama, C.
1995-02-01
A fluorescent x-ray source for medical imaging, such as K-edge subtraction angiography and monochromatic x-ray CT, has been developed. Using a 6.5 GeV accumulation ring in Tsukuba, fluorescent x rays, which range from about 30 to 70 keV are generated by irradiating several target materials. Measurements have been made of output intensities and energy spectra for different target angles and extraction angles. The intensities of fluorescent x rays at a 30 mA beam current are on the order of 1-3×106 photons/mm2/s at 30 cm from the local spot where the incident beam is collimated to 1 mm2. A phantom which contains three different contrast media (iodine, barium, gadolinium) was used for the K-edge energy subtraction, and element selective CT images were obtained.
The Multi-Messenger Approach to High-Energy Gamma-Ray Sources
Paredes, Josep M; Torres, Diego F
2008-01-01
This book provides a theoretical and observational overview of the state of the art of gamma-ray astrophysics, and their impact and connection with the physics of cosmic rays and neutrinos. With the aim of shedding new and fresh light on the problem of the nature of the gamma-ray sources, particularly those yet unidentified, this book summarizes contributions to a workshop that continues with the series initiated by the meeting held at Tonantzintla in October 2000, and Hong-Kong in May 2004. This books will be of interest for all active researchers in the field of high energy astrophysics and astroparticle physics, as well as for graduate students entering into the subject.
Combination of probabilities in looking for cosmic ray sources
International Nuclear Information System (INIS)
Goodman, M.
1991-08-01
The use of small chance probabilities as evidence for sources of cosmic rays is examined, with particular emphasis upon issues involved when combining results from two experiments, two analyses, or two independent tests of the same data. Examples are given in which different methods of combining results should be used
Z-pinches as intense x-ray sources for high energy density physics application
International Nuclear Information System (INIS)
Matzen, M.K.
1997-01-01
Fast z-pinch implosions can convert more than 10% of the stored electrical energy in a pulsed-power accelerator into x rays. These x rays are produced when an imploding cylindrical plasma, driven by the magnetic field pressure associated with very large axial currents, stagnates upon the cylindrical axis of symmetry. On the Saturn pulsed-power accelerator at Sandia National Laboratories, for example, currents of 6 to 8 MA with a risetime of less than 50 ns are driven through cylindrically-symmetric loads, producing implosions velocities as high as 100 cm/μs and x-ray energies as high as 500 kJ. The keV component of the resulting x-ray spectrum has been used for many years 8 a radiation source for material response studies. Alternatively, the x-ray output can be thermalized into a near-Planckian x-ray source by containing it within a large cylindrical radiation case. These large volume, long-lived radiation sources have recently been used for ICF-relevant ablator physics experiments as well as astrophysical opacity and radiation-material interaction experiments. Hydromagnetic Rayleigh-Taylor instabilities and cylindrical load symmetry are critical, limiting factors in determining the assembled plasma densities and temperatures, and thus in the x-ray pulse widths that can be produced on these accelerators. In recent experiments on the Saturn accelerator, these implosion nonuniformities have been minimized by using uniform-fill gas puff loads or by using wire arrays with as many a 192 wires. These techniques produced significant improvements in the pinched plasma quality, Zn reproducibility, and x-ray output power. X-ray pulse widths of less than 5 ns and peak powers of 75±10 TW have been achieved with arrays of 120 tungsten wires. These powers represent greater than a factor of three in power amplification over the electrical power of the Saturn n accelerator, and are a record for x-ray powers in the laboratory
Extended gamma-ray sources around pulsars constrain the origin of the positron flux at Earth
Abeysekara, A. U.; Albert, A.; Alfaro, R.; Alvarez, C.; Álvarez, J. D.; Arceo, R.; Arteaga-Velázquez, J. C.; Rojas, D. Avila; Solares, H. A. Ayala; Barber, A. S.; Bautista-Elivar, N.; Becerril, A.; Belmont-Moreno, E.; BenZvi, S. Y.; Berley, D.
2017-01-01
The unexpectedly high flux of cosmic ray positrons detected at Earth may originate from nearby astrophysical sources, dark matter, or unknown processes of cosmic-ray secondary production. We report the detection, using the HighAltitude Water Cherenkov Observatory (HAWC), of extended tera-electron volt gamma-ray emission coincident with the locations of two nearby middle-aged pulsars (Geminga and PSR B0656+14). The HAWC observations demonstrate that these pulsars are indeed local sources of ac...
OASYS (OrAnge SYnchrotron Suite): an open-source graphical environment for x-ray virtual experiments
Rebuffi, Luca; Sanchez del Rio, Manuel
2017-08-01
The evolution of the hardware platforms, the modernization of the software tools, the access to the codes of a large number of young people and the popularization of the open source software for scientific applications drove us to design OASYS (ORange SYnchrotron Suite), a completely new graphical environment for modelling X-ray experiments. The implemented software architecture allows to obtain not only an intuitive and very-easy-to-use graphical interface, but also provides high flexibility and rapidity for interactive simulations, making configuration changes to quickly compare multiple beamline configurations. Its purpose is to integrate in a synergetic way the most powerful calculation engines available. OASYS integrates different simulation strategies via the implementation of adequate simulation tools for X-ray Optics (e.g. ray tracing and wave optics packages). It provides a language to make them to communicate by sending and receiving encapsulated data. Python has been chosen as main programming language, because of its universality and popularity in scientific computing. The software Orange, developed at the University of Ljubljana (SLO), is the high level workflow engine that provides the interaction with the user and communication mechanisms.
DABAM: an open-source database of X-ray mirrors metrology
Energy Technology Data Exchange (ETDEWEB)
Sanchez del Rio, Manuel, E-mail: srio@esrf.eu [ESRF - The European Synchrotron, 71 Avenue des Martyrs, 38000 Grenoble (France); Bianchi, Davide [AC2T Research GmbH, Viktro-Kaplan-Strasse 2-C, 2700 Wiener Neustadt (Austria); Cocco, Daniele [SLAC National Accelerator Laboratory, 2575 Sand Hill Road, Menlo Park, CA 94025 (United States); Glass, Mark [ESRF - The European Synchrotron, 71 Avenue des Martyrs, 38000 Grenoble (France); Idir, Mourad [NSLS II, Brookhaven National Laboratory, Upton, NY 11973-5000 (United States); Metz, Jim [InSync Inc., 2511C Broadbent Parkway, Albuquerque, NM 87107 (United States); Raimondi, Lorenzo; Rebuffi, Luca [Elettra-Sincrotrone Trieste SCpA, Basovizza (TS) (Italy); Reininger, Ruben; Shi, Xianbo [Advanced Photon Source, Argonne National Laboratory, Argonne, IL 60439 (United States); Siewert, Frank [BESSY II, Helmholtz Zentrum Berlin, Institute for Nanometre Optics and Technology, Albert-Einstein-Strasse 15, 12489 Berlin (Germany); Spielmann-Jaeggi, Sibylle [Swiss Light Source at Paul Scherrer Institut, CH-5232 Villigen PSI (Switzerland); Takacs, Peter [Instrumentation Division, Brookhaven National Laboratory, Upton, NY 11973-5000 (United States); Tomasset, Muriel [Synchrotron Soleil (France); Tonnessen, Tom [InSync Inc., 2511C Broadbent Parkway, Albuquerque, NM 87107 (United States); Vivo, Amparo [ESRF - The European Synchrotron, 71 Avenue des Martyrs, 38000 Grenoble (France); Yashchuk, Valeriy [Advanced Light Source, Lawrence Berkeley National Laboratory, MS 15-R0317, 1 Cyclotron Road, Berkeley, CA 94720-8199 (United States)
2016-04-20
DABAM, an open-source database of X-ray mirrors metrology to be used with ray-tracing and wave-propagation codes for simulating the effect of the surface errors on the performance of a synchrotron radiation beamline. An open-source database containing metrology data for X-ray mirrors is presented. It makes available metrology data (mirror heights and slopes profiles) that can be used with simulation tools for calculating the effects of optical surface errors in the performances of an optical instrument, such as a synchrotron beamline. A typical case is the degradation of the intensity profile at the focal position in a beamline due to mirror surface errors. This database for metrology (DABAM) aims to provide to the users of simulation tools the data of real mirrors. The data included in the database are described in this paper, with details of how the mirror parameters are stored. An accompanying software is provided to allow simple access and processing of these data, calculate the most usual statistical parameters, and also include the option of creating input files for most used simulation codes. Some optics simulations are presented and discussed to illustrate the real use of the profiles from the database.
Gamma Rays from the Inner Milky Way: Dark Matter or Point Sources?
CERN. Geneva
2015-01-01
Studies of data from the Fermi Gamma-Ray Space Telescope have revealed bright gamma-ray emission from the central regions of our galaxy, with a spatial and spectral profile consistent with annihilating dark matter. I will present a new model-independent analysis that suggests that rather than originating from dark matter, the GeV excess may arise from a surprising new population of as-yet-unresolved gamma-ray point sources in the heart of the Milky Way.
Phase-contrast imaging and tomography at 60 keV using a conventional x-ray tube source
International Nuclear Information System (INIS)
Donath, Tilman; Bunk, Oliver; Groot, Waldemar; Bednarzik, Martin; Gruenzweig, Christian; David, Christian; Pfeiffer, Franz; Hempel, Eckhard; Popescu, Stefan; Hoheisel, Martin
2009-01-01
Phase-contrast imaging at laboratory-based x-ray sources using grating interferometers has been developed over the last few years for x-ray energies of up to 28 keV. Here, we show first phase-contrast projection and tomographic images recorded at significantly higher x-ray energies, produced by an x-ray tube source operated at 100 kV acceleration voltage. We find our measured tomographic phase images in good agreement with tabulated data. The extension of phase-contrast imaging to this significantly higher x-ray energy opens up many applications of the technique in medicine and industrial nondestructive testing.
Energy Technology Data Exchange (ETDEWEB)
Ahnen, M. L.; Biland, A. [ETH Zurich, CH-8093 Zurich (Switzerland); Ansoldi, S.; Biasuzzi, B. [Università di Udine, and INFN Trieste, I-33100 Udine (Italy); Antonelli, L. A.; Bonnoli, G.; Carosi, A. [INAF National Institute for Astrophysics, I-00136 Rome (Italy); Antoranz, P. [Università di Siena, and INFN Pisa, I-53100 Siena (Italy); Babic, A. [Croatian MAGIC Consortium, Rudjer Boskovic Institute, University of Rijeka, University of Split and University of Zagreb (Croatia); Banerjee, B. [Saha Institute of Nuclear Physics, 1\\AF Bidhannagar, Salt Lake, Sector-1, Kolkata 700064 (India); Bangale, P.; Almeida, U. Barres de; Borracci, F. [Max-Planck-Institut für Physik, D-80805 München (Germany); Barrio, J. A.; Bonnefoy, S. [Universidad Complutense, E-28040 Madrid (Spain); Bednarek, W. [University of Łódź, PL-90236 Lodz (Poland); Bernardini, E. [Deutsches Elektronen-Synchrotron (DESY), D-15738 Zeuthen (Germany); Blanch, O. [IFAE, Campus UAB, E-08193 Bellaterra (Spain); Bretz, T. [Universität Würzburg, D-97074 Würzburg (Germany); Carmona, E., E-mail: fabrizio.tavecchio@brera.inaf.it, E-mail: miguelnievas@ucm.es, E-mail: manganaro@iac.es, E-mail: josefa.becerra@nasa.gov [Centro de Investigaciones Energéticas, Medioambientales y Tecnológicas, E-28040 Madrid (Spain); Collaboration: MAGIC Collaboration; Fermi-LAT Collaboration; and others
2015-12-20
The flat-spectrum radio quasar PKS 1441+25 at a redshift of z = 0.940 is detected between 40 and 250 GeV with a significance of 25.5σ using the MAGIC telescopes. Together with the gravitationally lensed blazar QSO B0218+357 (z = 0.944), PKS 1441+25 is the most distant very high energy (VHE) blazar detected to date. The observations were triggered by an outburst in 2015 April seen at GeV energies with the Large Area Telescope on board Fermi. Multi-wavelength observations suggest a subdivision of the high state into two distinct flux states. In the band covered by MAGIC, the variability timescale is estimated to be 6.4 ± 1.9 days. Modeling the broadband spectral energy distribution with an external Compton model, the location of the emitting region is understood as originating in the jet outside the broad-line region (BLR) during the period of high activity, while being partially within the BLR during the period of low (typical) activity. The observed VHE spectrum during the highest activity is used to probe the extragalactic background light at an unprecedented distance scale for ground-based gamma-ray astronomy.
International Nuclear Information System (INIS)
Samat, S.B.; Oi, Yoshihiro; Taki, Mitsumasa; Manabe, Iwao; Yoshida, Makoto; Minami, Kentaro
1995-03-01
Several types of calibration source having different density were prepared using one or combinations of those materials, namely foam cement, liquid, glass beads, polystyrene foam bead and hard plastic bead for gamma-ray spectrometry of the samples with different densities and shapes(variable height with constant base area). For each type of the source, a few sources were prepared to examine characteristics in such cases as (a) different heights but constant density, and (b) constant height and constant density. For the foam cement source, several sources with different densities and a constant height were prepared. All the sources were measured with a gamma-ray spectrometry system and the results were discussed. This report also presents the results obtained from the experiments for the evaluation of (1) the variation of detector efficiency-energy with gamma-ray energy, and (2) the variation of detector efficiency with density of the sources. (author)
Virtual Gamma Ray Radiation Sources through Neutron Radiative Capture
Energy Technology Data Exchange (ETDEWEB)
Scott Wilde, Raymond Keegan
2008-07-01
The countrate response of a gamma spectrometry system from a neutron radiation source behind a plane of moderating material doped with a nuclide of a large radiative neutron capture cross-section exhibits a countrate response analogous to a gamma radiation source at the same position from the detector. Using a planar, surface area of the neutron moderating material exposed to the neutron radiation produces a larger area under the prompt gamma ray peak in the detector than a smaller area of dimensions relative to the active volume of the gamma detection system.
Beam dynamics simulation in the X-ray Compton source
Energy Technology Data Exchange (ETDEWEB)
Gladkikh, P.; Karnaukhov, I.; Telegin, Yu.; Shcherbakov, A. E-mail: shcherbakov@kipt.kharkov.ua; Zelinsky, A
2002-05-01
At the National Science Center 'Kharkov Institute of Physics and Technology' the X-ray source based on Compton scattering has been developed. The computer code for simulation of electron beam dynamics with taking into account the Compton scattering effect based on Monte Carlo method is described in this report. The first results of computer simulation of beam dynamics with electron-photon interaction, parameters of electron and photon beams are presented. Calculations were carried out with the lattice of synchrotron light source SRS-800 Ukrainian Synchrotron Center.
Hornschemeier, A. E.; Heckman, T. M.; Ptak, A. F.; Tremonti, C. A.; Colbert, E. J. M.
2005-01-01
We have cross-correlated X-ray catalogs derived from archival Chandra X-Ray Observatory ACIS observations with a Sloan Digital Sky Survey Data Release 2 (DR2) galaxy catalog to form a sample of 42 serendipitously X-ray-detected galaxies over the redshift interval 0.03
A simple source preparation method for alpha-ray spectrometry of volcanic rock sample
International Nuclear Information System (INIS)
Takahashi, Masaomi; Kurihara, Yuichi; Sato, Jun
2006-01-01
A simple source preparation method was developed for the alpha-ray spectrometry to determine U and Th in volcanic rockes. Isolation of U and Th from volcanic rocks was made by use of UTEVA-Spec. resin, extraction chromatograph material. U and Th were extracted by TTA-benzene solution and organic phase was evaporated drop by drop on a hot stainless steel planchet to dryness. This method was found to be effective for the preparation of sources for alpha-ray spectrometry. (author)
International Nuclear Information System (INIS)
Sato, Isamu; Shintomi, Kazutaka; Hayakawa, Ken
2009-01-01
In Nihon University, the research and development of Parametric X-rays radiation (PXR) by the 100 MeV electron linac are advanced. It was proved by basic experiment that PXR was a source of coherent X-rays. Coherent X-rays have the characteristic that a refraction action is guided with an irradiation matter. According to this action, the contrast image pick-up of an irradiation matter is attained, and X-rays becomes possible to focus a point itself. Research of cancer medical treatment and diagnosis are advanced using the new source of X-ray. Miniaturization of the source is important for the spread of cancer medical new treatment and diagnoses. Recently, the tabletop type 100 MeV class cryogenic linac with energy recovery is under development. In symposium, we report progress of these research and development. (author)
Airborne system for mapping and tracking extended gamma ray sources
International Nuclear Information System (INIS)
Stuart, T.P.; Hendricks, T.J.; Wallace, G.G.; Cleland, J.R.
1976-01-01
An airborne system was developed for mapping and tracking extended sources of airborne or terrestrially distributed γ-ray emitters. The system records 300 channel γ-ray spectral data every three seconds on magnetic tape. Computer programs have been written to isolate the contribution from the particular radionuclide of interest. Aircraft position as sensed by a microwave ranging system is recorded every second on magnetic tape. Measurements of airborne stack releases of 41 A concentrations versus time or aircraft position agree well with computer code predictions
Observations of Intermediate-mass Black Holes and Ultra-Luminous X-ray sources
Colbert, E. J. M.
2003-12-01
I will review various observations that suggest that intermediate-mass black holes (IMBHs) with masses ˜102-104 M⊙ exist in our Universe. I will also discuss some of the limitations of these observations. HST Observations of excess dark mass in globular cluster cores suggest IMBHs may be responsible, and some mass estimates from lensing experiments are nearly in the IMBH range. The intriguing Ultra-Luminous X-ray sources (ULXs, or IXOs) are off-nuclear X-ray point sources with X-ray luminosities LX ≳ 1039 erg s-1. ULXs are typically rare (1 in every 5 galaxies), and the nature of their ultra-luminous emission is currently debated. I will discuss the evidence for IMBHs in some ULXs, and briefly outline some phenomenology. Finally, I will discuss future observations that can be made to search for IMBHs.
Pleiades: A Sub-picosecond Tunable X-ray Source at the LLNL Electron Linac
International Nuclear Information System (INIS)
Slaughter, Dennis; Springer, Paul; Le Sage, Greg; Crane, John; Ditmire, Todd; Cowan, Tom; Anderson, Scott G.; Rosenzweig, James B.
2002-01-01
The use of ultra fast laser pulses to generate very high brightness, ultra short (fs to ps) pulses of x-rays is a topic of great interest to the x-ray user community. In principle, femto-second-scale pump-probe experiments can be used to temporally resolve structural dynamics of materials on the time scale of atomic motion. The development of sub-ps x-ray pulses will make possible a wide range of materials and plasma physics studies with unprecedented time resolution. A current project at LLNL will provide such a novel x-ray source based on Thomson scattering of high power, short laser pulses with a high peak brightness, relativistic electron bunch. The system is based on a 5 mm-mrad normalized emittance photo-injector, a 100 MeV electron RF linac, and a 300 mJ, 35 fs solid-state laser system. The Thomson x-ray source produces ultra fast pulses with x-ray energies capable of probing into high-Z metals, and a high flux per pulse enabling single shot experiments. The system will also operate at a high repetition rate (∼ 10 Hz). (authors)
Wu, J.; Clark, C. J.; Pletsch, H. J.; Guillemot, L.; Johnson, T. J.; Torne, P.; Champion, D. J.; Deneva, J.; Ray, P. S.; Salvetti, D.; Kramer, M.; Aulbert, C.; Beer, C.; Bhattacharyya, B.; Bock, O.; Camilo, F.; Cognard, I.; Cuéllar, A.; Eggenstein, H. B.; Fehrmann, H.; Ferrara, E. C.; Kerr, M.; Machenschalk, B.; Ransom, S. M.; Sanpa-Arsa, S.; Wood, K.
2018-02-01
We report on the analysis of 13 gamma-ray pulsars discovered in the Einstein@Home blind search survey using Fermi Large Area Telescope (LAT) Pass 8 data. The 13 new gamma-ray pulsars were discovered by searching 118 unassociated LAT sources from the third LAT source catalog (3FGL), selected using the Gaussian Mixture Model machine-learning algorithm on the basis of their gamma-ray emission properties being suggestive of pulsar magnetospheric emission. The new gamma-ray pulsars have pulse profiles and spectral properties similar to those of previously detected young gamma-ray pulsars. Follow-up radio observations have revealed faint radio pulsations from two of the newly discovered pulsars and enabled us to derive upper limits on the radio emission from the others, demonstrating that they are likely radio-quiet gamma-ray pulsars. We also present results from modeling the gamma-ray pulse profiles and radio profiles, if available, using different geometric emission models of pulsars. The high discovery rate of this survey, despite the increasing difficulty of blind pulsar searches in gamma rays, suggests that new systematic surveys such as presented in this article should be continued when new LAT source catalogs become available.
UHE γ-rays from point sources based on GRAPES-I observations
International Nuclear Information System (INIS)
Gupta, S.K.; Sreekantan, B.V.; Srivatsan, R.; Tonwar, S.C.
1993-01-01
An experiment called GRAPES I (Gamma Ray Astronomy at PeV EnergieS) was set up in 1984 at Ooty in India, using 24 scintillation counters, to detect Extensive Air Showers (EAS) produced in the atmosphere by the primary cosmic radiation. The goal of the experiment has been to search for Ultra High Energy (UHE) γ-rays (E≥10 14 eV) from point sources in the sky. Here we discuss the results on X-ray binaries CYG X-3, HER X-1 and SCO X-1 obtained with GRAPES I experiment which covers the period 1984--87
A Compact 5 MeV S-Band Electron Linac Based X-Ray Source for Industrial Radiography
Auditore, Lucrezia; De Pasquale, Domenico; Emanuele, Umberto; Italiano, Antonio; Trifirò, Antonio; Trimarchi, Marina
2005-01-01
A compact and reliable X-ray source, based on a 5 MeV, 1 kW, S-band electron linac, has been set up at the Dipartimento di Fisica, Universit\\'a di Messina. This source, coupled with a GOS scintillator screen and a CCD camera, represents an innovative transportable system for industrial radiography and X-ray tomography. Optimization of the parameters influencing the e-gamma conversion and the X-ray beam characteristics have been studied by means of the MCNP-4C2 code. The converter choice is the result of the study of the e-gamma conversion performances for different materials and materials thicknesses. Also the converter position with respect to the linac exit window was studied. The chosen converter consists in a Ta-Cu target inserted close to the linac window. The Cu layer acts as a filter both on the electrons from the source and on the low energy X-rays. The X-ray beam angular profile was studied by means of GafChromic films with and without collimation. In the final source project, a collimation system pr...
[Outbreaks of viral hepatitis E in the Czech Republic?].
Trmal, Josef; Pavlík, Ivo; Vasícková, Petra; Matejícková, Ladislava; Simůnková, Lenka; Luks, Stanislav; Pazderková, Jana
2012-05-01
Until recently, viral hepatitis E (VHE) has typically been an imported infection, related to travel to developing countries. A number of travel-unrelated VHE cases currently diagnosed in the Czech Republic. Outcomes of the epidemiological investigations of two VHE outbreaks associated with the consumption of pork and pork products at pig-slaughtering feasts are presented. Thirteen cases have been reported in the first outbreak and eight cases in the second outbreak. The epidemiological investigations are described and the experience gained in analysing suspected biological specimens is presented. The source of infection has not been identified in the first outbreak while in the other one, a link between human cases and infection in farm pigs was revealed for the first time. Although the epidemiological investigation may not always lead to the detection of the VHE source, it must be conducted in any outbreak and can only be successful when done in cooperation of the public health authorities with the veterinary health agency.
Optical and X-ray luminosities of expanding nebulae around ultraluminous X-ray sources
Siwek, Magdalena; Sądowski, Aleksander; Narayan, Ramesh; Roberts, Timothy P.; Soria, Roberto
2017-09-01
We have performed a set of simulations of expanding, spherically symmetric nebulae inflated by winds from accreting black holes in ultraluminous X-ray sources (ULXs). We implemented a realistic cooling function to account for free-free and bound-free cooling. For all model parameters we considered, the forward shock in the interstellar medium becomes radiative at a radius ˜100 pc. The emission is primarily in optical and UV, and the radiative luminosity is about 50 per cent of the total kinetic luminosity of the wind. In contrast, the reverse shock in the wind is adiabatic so long as the terminal outflow velocity of the wind vw ≳ 0.003c. The shocked wind in these models radiates in X-rays, but with a luminosity of only ˜1035 erg s-1. For wind velocities vw ≲ 0.001c, the shocked wind becomes radiative, but it is no longer hot enough to produce X-rays. Instead it emits in optical and UV, and the radiative luminosity is comparable to 100 per cent of the wind kinetic luminosity. We suggest that measuring the optical luminosities and putting limits on the X-ray and radio emission from shock-ionized ULX bubbles may help in estimating the mass outflow rate of the central accretion disc and the velocity of the outflow.
International Nuclear Information System (INIS)
Tonon, G.F.; Colombant, Denis; Delmare, Claude; Rabeau, Maxime
A new detecting device is described. It allows one to get the frequency, the time and space resolution of pictures of U.V. and soft X ray emission of a laser created plasma in a single shot: X ray pictures of such a plasma are presented. After these preliminary results, it is possible to set up readily an X ray framing camera. A laser created plasma is an X ray source of special interest: the emitted power can be 10% of the laser intensity and the emitted spectrum is centered around 1A wavelength [fr
Computerized tomography using high resolution X-ray imaging system with a microfocus source
International Nuclear Information System (INIS)
Zaprazny, Z.; Korytar, D.; Konopka, P.; Ac, V.; Bielecki, J.
2011-01-01
In recent years there is an effort to image an internal structure of an object by using not only conventional 2D X-ray radiography but also using high resolution 3D tomography which is based on reconstruction of multiple 2D projections at various angular positions of the object. We have previously reported [1] the development and basic parameters of a high resolution x-ray imaging system with a microfocus source. We report the recent progress using this high resolution X-ray laboratory system in this work. These first findings show that our system is particularly suitable for light weight and nonmetallic objects such as biological objects, plastics, wood, paper, etc. where phase contrast helps to increase the visibility of the finest structures of the object. Phase-contrast X-ray Computerized Tomography is of our special interest because it is an emerging imaging technique that can be implemented at third generation synchrotron radiation sources and also in laboratory conditions using a microfocus X-ray tube or beam conditioning optics. (authors)
Plasma focus as an x-ray source for tailoring of radiation in different energy windows
International Nuclear Information System (INIS)
Zakaullah, M.; Alamgir, K.; Shafiq, M.; Sharif, M.
2001-01-01
A low energy (2.3 kj) plasma focus energized by a single 32 micro f capacitor charged at 12 kv with filling gases hydrogen, neon and argon is investigated as an X-ray source. Experiments are conducted with a copper and an aluminum anode. Specifically, attention in given to tailoring the radiation in different windows, e. g. 1.2-1.3 keV, 1.3-1.5 keV, 2.5-5 keV and Cu-Ka line radiation. The highest X-ray emission is observed with neon filling and the copper anode in the 1.2-1.3 keV window, which speculated to be generated due to recombination of hydrogen like neon ions with a few eV to a few 10s of eV electrons. The wall-plug efficiency of the device is found to be 4%. The other significant emission occurs with Hydrogen filling, which exhibits wall plug efficiency of 1.7% for over all x-ray emission and 0.35% for Cu- Ka line radiation. The emission is dominated by the interaction of electrons in the current sheath with the anode tip. The emission with the aluminum anode and hydrogen filling is up to 10 j, which corresponds to wall-plug efficiency of 0.4%. The X-ray emission with argon filling is less significant. (author)