WorldWideScience

Sample records for vhe g-ray source

  1. VHE and UHE gamma ray astronomy: transients and sources

    International Nuclear Information System (INIS)

    Fegan, D.J.

    1987-01-01

    The transient and sporadic nature of a number of Cosmic gamma ray sources is examined in relation to VHE (10 11 to 10 14 eV) observations of pulsars and X-ray binary systems. Transients are not all that common but when they occur they generally produce emission of sufficient intensity and duration to obtain statistically significant effects which are gradually helping to establish a source catalog. A brief review is also made of the staus of UHE (>10 14 eV) gamma ray astronomy

  2. Discovery of the hard spectrum VHE γ-ray source HESS J1641-463

    International Nuclear Information System (INIS)

    Abramowski, A.; Ait Benkhali, F.

    2014-10-01

    This letter reports the discovery of a remarkably hard spectrum source, HESS J1641.463, by the High Energy Stereoscopic System (H.E.S.S.) in the very high energy (VHE) domain. HESS J1641.463 remained unnoticed by the usual analysis techniques due to confusion with the bright nearby source HESS J1640.465. It emerged at a significance level of 8.5 standard deviations after restricting the analysis to events with energies above 4 TeV. It shows a moderate flux level of φ (E>1 TeV)=(3.64 ± 0.44 stat ± 0.73 sys ) x 10 -13 cm -2 s -1 , corresponding to 1.8% of the Crab Nebula flux above the same energy, and a hard spectrum with a photon index of Γ=2.07±0.11 stat ±0.20 sys . It is a point-like source, although an extension up to a Gaussian width of σ=3 arcmin cannot be discounted due to uncertainties in the H.E.S.S. point-spread function. The VHE γ-ray flux of HESS J1641.463 is found to be constant over the observed period when checking time binnings from the year-by-year to the 28 minute exposure timescales. HESS J1641.463 is positionally coincident with the radio supernova remnant SNR G338.5+0.1. No X-ray candidate stands out as a clear association; however, Chandra and XMM-Newton data reveal some potential weak counterparts. Various VHE γ-ray production scenarios are discussed. If the emission from HESS J1641.463 is produced by cosmic ray protons colliding with the ambient gas, then their spectrum must extend close to 1 PeV. This object may represent a source population contributing significantly to the galactic cosmic ray flux around the knee.

  3. DISCOVERY OF THE HARD SPECTRUM VHE γ-RAY SOURCE HESS J1641–463

    Energy Technology Data Exchange (ETDEWEB)

    Abramowski, A. [Institut für Experimentalphysik, Universität Hamburg, Luruper Chaussee 149, D-22761 Hamburg (Germany); Aharonian, F.; Ait Benkhali, F.; Bernlöhr, K. [Max-Planck-Institut für Kernphysik, PO Box 103980, D-69029 Heidelberg (Germany); Akhperjanian, A. G. [National Academy of Sciences of the Republic of Armenia, Marshall Baghramian Avenue, 24, 0019 Yerevan, Republic of Armenia (Armenia); Angüner, E. O.; Birsin, E. [Institut für Physik, Humboldt-Universität zu Berlin, Newtonstr. 15, D-12489 Berlin (Germany); Backes, M. [Department of Physics, University of Namibia, Private Bag 13301, Windhoek (Namibia); Balenderan, S. [Department of Physics, University of Durham, South Road, Durham DH1 3LE (United Kingdom); Balzer, A. [GRAPPA, Anton Pannekoek Institute for Astronomy, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Barnacka, A. [Obserwatorium Astronomiczne, Uniwersytet Jagielloński, ul. Orla 171, 30-244 Kraków (Poland); Becherini, Y. [Department of Physics and Electrical Engineering, Linnaeus University, 351 95 Växjö (Sweden); Becker Tjus, J. [Institut für Theoretische Physik, Lehrstuhl IV: Weltraum und Astrophysik, Ruhr-Universität Bochum, D-44780 Bochum (Germany); Berge, D. [GRAPPA, Anton Pannekoek Institute for Astronomy and Institute of High-Energy Physics, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Bernhard, S. [Institut für Astro- und Teilchenphysik, Leopold-Franzens-Universität Innsbruck, A-6020 Innsbruck (Austria); Biteau, J. [Laboratoire Leprince-Ringuet, Ecole Polytechnique, CNRS/IN2P3, F-91128 Palaiseau (France); Böttcher, M. [Centre for Space Research, North-West University, Potchefstroom 2520 (South Africa); Boisson, C., E-mail: sabrina.casanova@ifj.edu.pl, E-mail: sabrina.casanova@mpi-hd.mpg.de [LUTH, Observatoire de Paris, CNRS, Université Paris Diderot, 5 Place Jules Janssen, F-92190 Meudon (France); Collaboration: H.E.S.S. Collaboration; and others

    2014-10-10

    This Letter reports the discovery of a remarkably hard spectrum source, HESS J1641–463, by the High Energy Stereoscopic System (H.E.S.S.) in the very high energy (VHE) domain. HESS J1641–463 remained unnoticed by the usual analysis techniques due to confusion with the bright nearby source HESS J1640–465. It emerged at a significance level of 8.5 standard deviations after restricting the analysis to events with energies above 4 TeV. It shows a moderate flux level of φ(E>1 TeV) = (3.64 ± 0.44{sub stat} ± 0.73{sub sys}) × 10{sup –13} cm{sup –2} s{sup –1}, corresponding to 1.8% of the Crab Nebula flux above the same energy, and a hard spectrum with a photon index of Γ = 2.07 ± 0.11{sub stat} ± 0.20{sub sys}. It is a point-like source, although an extension up to a Gaussian width of σ = 3 arcmin cannot be discounted due to uncertainties in the H.E.S.S. point-spread function. The VHE γ-ray flux of HESS J1641–463 is found to be constant over the observed period when checking time binnings from the year-by-year to the 28 minute exposure timescales. HESS J1641–463 is positionally coincident with the radio supernova remnant SNR G338.5+0.1. No X-ray candidate stands out as a clear association; however, Chandra and XMM-Newton data reveal some potential weak counterparts. Various VHE γ-ray production scenarios are discussed. If the emission from HESS J1641–463 is produced by cosmic ray protons colliding with the ambient gas, then their spectrum must extend close to 1 PeV. This object may represent a source population contributing significantly to the galactic cosmic ray flux around the knee.

  4. Observations of VHE γ-Ray Sources with the MAGIC Telescope

    Science.gov (United States)

    Bartko, H.

    2008-10-01

    The MAGIC telescope with its 17m diameter mirror is today the largest operating single-dish Imaging Air Cherenkov Telescope (IACT). It is located on the Canary Island La Palma, at an altitude of 2200m above sea level, as part of the Roque de los Muchachos European Northern Observatory. The MAGIC telescope detects celestial very high energy γ-radiation in the energy band between about 50 GeV and 10 TeV. Since Autumn of 2004 MAGIC has been taking data routinely, observing various objects like supernova remnants (SNRs), γ-ray binaries, Pulsars, Active Galactic Nuclei (AGN) and Gamma-ray Bursts (GRB). We briefly describe the observational strategy, the procedure implemented for the data analysis, and discuss the results for individual sources. An outlook to the construction of the second MAGIC telescope is given.

  5. Study on the optimization of the water Cherenkov detector array of the LHAASO project for surveying VHE gamma ray sources

    Science.gov (United States)

    Li, Hui-Cai; Chen, Ming-Jun; Jia, Huan-Yu; Gao, Bo; Wu, Han-Rong; Yao, Zhi-Guo; Yuo, Xiao-Hao; Zhou, Bin; Zhu, Feng-Rong

    2014-01-01

    It is prpopsed that a water Cherenkov detector array, LHAASO-WCDA, is to be built at Shangri-la, Yunnan Province, China. As one of the major components of the LHAASO project, the main purpose of it is to survey the northern sky for gamma ray sources in the energy range of 100 GeV-30 TeV. In order to design the water Cherenkov array efficiently to economize the budget, a Monte Carlo simulation is carried out. With the help of the simulation, the cost performance of different configurations of the array are obtained and compared with each other, serving as a guide for the more detailed design of the experiment in the next step.

  6. Study on the optimization of the water Cherenkov detector array of the LHAASO project for surveying VHE gamma ray sources

    International Nuclear Information System (INIS)

    Li Huicai; Chen Mingjun; Gao Bo; Wu Hanrong; Yao Zhiguo; Zhou Bin; Jia Huanyu; Zhu Fengrong; You Xiaohao

    2014-01-01

    It is proposed that a water Cherenkov detector array, LHAASO-WCDA, is to be built at Shangri-la, Yunnan Province, China. As one of the major components of the LHAASO project, the main purpose of it is to survey the northern sky for gamma ray sources in the energy range of 100 GeV-30 TeV. In order to design the water Cherenkov array efficiently to economize the budget, a Monte Carlo simulation is carried out. With the help of the simulation, the cost performance of different configurations of the array are obtained and compared with each other, serving as a guide for the more detailed design of the experiment in the next step. (authors)

  7. Dicty_cDB: VHE138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE138 (Link to dictyBase) - - - Contig-U15767-1 VHE138P (Link... to Original site) VHE138F 569 VHE138Z 621 VHE138P 1170 - - Show VHE138 Library VH (Link to library) Clone ID VHE138 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...FVDNQAGDSXSAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQGF NDVSYP--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICT...rsi*i**fkllpn*rtrf q*ckls--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTPVDCG ANDEDKCKTWSCDPTKGG

  8. Early warning for VHE gamma-ray flares with the ARGO-YBJ detector

    Energy Technology Data Exchange (ETDEWEB)

    Bartoli, B. [Dipartimento di Fisica dell' Universita di Napoli ' Federico II' , Complesso Universitario di Monte Sant' Angelo, via Cinthia, 80126 Napoli (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Napoli, Complesso Universitario di Monte Sant' Angelo, via Cinthia, 80126 Napoli (Italy); Bernardini, P. [Dipartimento di Fisica dell' Universita del Salento, via per Arnesano, 73100 Lecce (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Lecce, via per Arnesano, 73100 Lecce (Italy); Bi, X.J. [Key Laboratory of Particle Astrophysics, Institute of High Energy Physics, Chinese Academy of Sciences, P.O. Box 918, 100049 Beijing (China); Bleve, C. [Dipartimento di Fisica dell' Universita del Salento, via per Arnesano, 73100 Lecce (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Lecce, via per Arnesano, 73100 Lecce (Italy); Bolognino, I. [Dipartimento di Fisica Nucleare e Teorica dell' Universita di Pavia, via Bassi 6, 27100 Pavia (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Pavia, via Bassi 6, 27100 Pavia (Italy); Branchini, P.; Budano, A. [Istituto Nazionale di Fisica Nucleare, Sezione di Roma Tre, via della Vasca Navale 84, 00146 Roma (Italy); Calabrese Melcarne, A.K. [Istituto Nazionale di Fisica Nucleare - CNAF, Viale Berti-Pichat 6/2, 40127 Bologna (Italy); Camarri, P. [Dipartimento di Fisica dell' Universita di Roma ' Tor Vergata' , via della Ricerca Scientifica 1, 00133 Roma (Italy); Istituto Nazionale di Fisica Nucleare, Sezione di Roma Tor Vergata, via della Ricerca Scientifica 1, 00133 Roma (Italy); Cao, Z. [Key Laboratory of Particle Astrophysics, Institute of High Energy Physics, Chinese Academy of Sciences, P.O. Box 918, 100049 Beijing (China); and others

    2011-12-11

    Detecting and monitoring emissions from flaring gamma-ray sources in the very-high-energy (VHE, > 100 GeV) band is a very important topic in gamma-ray astronomy. The ARGO-YBJ detector is characterized by a high duty cycle and a wide field of view. Therefore, it is particularly capable of detecting flares from extragalactic objects. Based on fast reconstruction and analysis, real-time monitoring of 33 selected VHE extragalactic sources is implemented. Flares exceeding a specific threshold are reported timely, hence enabling the follow-up observation of these objects using more sensitive detectors, such as Cherenkov telescopes.

  9. Dicty_cDB: VHE867 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE867 (Link to dictyBase) - G02701 DDB0204977 Contig-U14789-1... - (Link to Original site) VHE867F 383 - - - - - - Show VHE867 Library VH (Link to library) Clone ID VHE867 (Link to dict...yBase) Atlas ID - NBRP ID G02701 dictyBase ID DDB0204977 Link to Contig Contig-U14789-1 Original site URL http://dict...one) Salmo salar clone ssal-rgb2-599-16... 116 2e-25 DQ363469_1( DQ363469 |pid:none) Ict...m_ : 1.00 40.0 %: cytoplasmic 36.0 %: nuclear 12.0 %: cytoskeletal 8.0 %: mitochondrial 4.0 %: peroxisomal >> predict

  10. VHE Gamma-ray Supernova Remnants

    Energy Technology Data Exchange (ETDEWEB)

    Funk, Stefan; /KIPAC, Menlo Park

    2007-01-22

    Increasing observational evidence gathered especially in X-rays and {gamma}-rays during the course of the last few years support the notion that Supernova remnants (SNRs) are Galactic particle accelerators up to energies close to the ''knee'' in the energy spectrum of Cosmic rays. This review summarizes the current status of {gamma}-ray observations of SNRs. Shell-type as well as plerionic type SNRs are addressed and prospect for observations of these two source classes with the upcoming GLAST satellite in the energy regime above 100 MeV are given.

  11. Extended VHE γ-ray emission towards SGR1806-20, LBV 1806-20, and stellar cluster Cl* 1806-20

    Science.gov (United States)

    H.E.S.S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Akhperjanian, A. G.; Angüner, E. O.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Birsin, E.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Bulik, T.; Capasso, M.; Carr, J.; Casanova, S.; Chakraborty, N.; Chalme-Calvet, R.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Chrétien, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Couturier, C.; Cui, Y.; Davids, I. D.; Degrange, B.; Deil, C.; deWilt, P.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dubus, G.; Dutson, K.; Dyks, J.; Dyrda, M.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gajdus, M.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Grudzińska, M.; Hadasch, D.; Hahn, J.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hervet, O.; Hillert, A.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holler, M.; Horns, D.; Ivascenko, A.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jogler, T.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katz, U.; Kerszberg, D.; Khélifi, B.; Kieffer, M.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krayzel, F.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; Lypova, I.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Menzler, U.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Morå, K.; Moulin, E.; Murach, T.; de Naurois, M.; Niederwanger, F.; Niemiec, J.; Oakes, L.; Odaka, H.; Öttl, S.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Paz Arribas, M.; Pekeur, N. W.; Pelletier, G.; Petrucci, P.-O.; Peyaud, B.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Reimer, A.; Reimer, O.; Renaud, M.; de Reyes, R.; Rieger, F.; Romoli, C.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Stycz, K.; Sushch, I.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tluczykont, M.; Trichard, C.; Tuffs, R.; van der Walt, J.; van Eldik, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zabalza, V.; Zaborov, D.; Zacharias, M.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Żywucka, N.

    2018-04-01

    Using the High Energy Spectroscopic System (H.E.S.S.) telescopes we have discovered a steady and extended very high-energy (VHE) γ-ray source towards the luminous blue variable candidate LBV 1806-20, massive stellar cluster Cl* 1806-20, and magnetar SGR 1806-20. The new VHE source, HESS J1808-204, was detected at a statistical significance of >6σ (post-trial) with a photon flux normalisation (2.9 ± 0.4stat ± 0.5sys) × 10-13 ph cm-2 s-1 TeV-1 at 1 TeV and a power-law photon index of 2.3 ± 0.2stat ± 0.3sys. The luminosity of this source (0.2 to 10 TeV; scaled to distance d = 8.7 kpc) is LVHE 1.6 × 1034(d/8.7 kpc)2 erg s-1. The VHE γ-ray emission is extended and is well fit by a single Gaussian with statistical standard deviation of 0.095° ± 0.015°. This extension is similar to that of the synchrotron radio nebula G10.0-0.3, which is thought to be powered by LBV 1806-20. The VHE γ-ray luminosity could be provided by the stellar wind luminosity of LBV 1806-20 by itself and/or the massive star members of Cl* 1806-20. Alternatively, magnetic dissipation (e.g. via reconnection) from SGR 1806-20 can potentially account for the VHE luminosity. The origin and hadronic and/or leptonic nature of the accelerated particles responsible for HESS J1808-204 is not yet clear. If associated with SGR 1806-20, the potentially young age of the magnetar (650 yr) can be used to infer the transport limits of these particles to match the VHE source size. This discovery provides new interest in the potential for high-energy particle acceleration from magnetars, massive stars, and/or stellar clusters.

  12. Characterising the VHE diffuse emission in the central 200 parsecs of our Galaxy with H.E.S.S.

    Science.gov (United States)

    H.E.S.S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Akhperjanian, A. G.; Andersson, T.; Angüner, E. O.; Arakawa, M.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bonnefoy, S.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Büchele, M.; Bulik, T.; Capasso, M.; Carr, J.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Coffaro, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Cui, Y.; Davids, I. D.; Decock, J.; Degrange, B.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dutson, K.; Dyks, J.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holch, T. L.; Holler, M.; Horns, D.; Ivascenko, A.; Iwasaki, H.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jogler, T.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katsuragawa, M.; Katz, U.; Kerszberg, D.; Khangulyan, D.; Khélifi, B.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Nakashima, S.; de Naurois, M.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Rauth, R.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Richter, S.; Rieger, F.; Romoli, C.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Saito, S.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seglar-Arroyo, M.; Settimo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stycz, K.; Sushch, I.; Takahashi, T.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tsuji, N.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Żywucka, N.

    2018-04-01

    The diffuse very high-energy (VHE; >100 GeV) γ-ray emission observed in the central 200 pc of the Milky Way by H.E.S.S. was found to follow dense matter distribution in the central molecular zone (CMZ) up to a longitudinal distance of about 130 pc to the Galactic centre (GC), where the flux rapidly decreases. This was initially interpreted as the result of a burst-like injection of energetic particles 104 yr ago, but a recent more sensitive H.E.S.S. analysis revealed that the cosmic-ray (CR) density profile drops with the distance to the centre, making data compatible with a steady cosmic PeVatron at the GC. In this paper, we extend this analysis to obtain, for the first time, a detailed characterisation of the correlation with matter and to search for additional features and individual γ-ray sources in the inner 200 pc. Taking advantage of 250 h of H.E.S.S. data and improved analysis techniques, we perform a detailed morphology study of the diffuse VHE emission observed from the GC ridge and reconstruct its total spectrum. To test the various contributions to the total γ-ray emission, we used an iterative 2D maximum-likelihood approach that allows us to build a phenomenological model of the emission by summing a number of different spatial components. We show that the emission correlated with dense matter covers the full CMZ and that its flux is about half the total diffuse emission flux. We also detect some emission at higher latitude that is likely produced by hadronic collisions of CRs in less dense regions of the GC interstellar medium. We detect an additional emission component centred on the GC and extending over about 15 pc that is consistent with the existence of a strong CR density gradient and confirms the presence of a CR accelerator at the very centre of our Galaxy. We show that the spectrum of full ridge diffuse emission is compatible with that previously derived from the central regions, suggesting that a single population of particles fills the

  13. Detection of VHE gamma-ray emission from the vicinity of PSR B1706-44 with H.E.S.S.

    Energy Technology Data Exchange (ETDEWEB)

    Chaves, Ryan C.G.; Ona Wilhelmi, Emma de [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Terrier, Regis [APC, CNRS, Univ. Paris-7 (France); Stegmann, Christian [Universitaet Erlangen-Nuernberg, Erlangen (Germany). Physikalisches Institut; Khelifi, Bruno [LLR, Ecole Polytechnique, CNRS/IN2P3, Palaiseau (France); Jager, Okkie C. de [Unit for Space Physics, North-West Univ., Potchefstroom (South Africa)

    2010-07-01

    The gamma-ray pulsar PSR B1706-44 and the adjacent supernova remnant (SNR) candidate G343.1-2.3 were observed by H.E.S.S. during a dedicated observational campaign in 2007. A new source of very-high-energy (VHE;E>100 GeV) gamma-ray emission, HESS J1708-443, was discovered with its centroid at RA(J2000.0)=17 h 8 m 10 s and Dec (J2000.0)=-44 d 21{sup '} ({+-}3{sup '} statistical error on each axis). The VHE gamma-ray source is significantly more extended than the H.E.S.S. point-spread function and has an intrinsic Gaussian width of 0.29 {+-}0.04 . Its energy spectrum can be described by a power law with a photon index=2.0{+-}0.1 (stat){+-}0.2 (syst). The integral flux measured between 1 and 10 TeV is {proportional_to}17% of the Crab Nebula flux in the same energy range. The possible associations with the energetic PSR B1706-44, also recently detected in the GeV domain with Fermi/LAT and AGILE, and SNR G343.1-2.3 are discussed.

  14. Search for VHE γ-ray emission from the direction of the two millisecond pulsars PSR J0437-4715 and PSR J1824-2452 and the composite supernova remnant Kes 75 with H.E.S.S

    International Nuclear Information System (INIS)

    Fuessling, Matthias

    2012-01-01

    This work reports on the search for pulsed and steady very-high energy (VHE) gamma-ray emission in the energy range extending from 100 GeV up to 100 TeV from the direction of three pulsars with the High Energy Stereoscopic System (H.E.S.S.). Pulsed gamma-ray radiation from pulsars with energies beyond 100 GeV was found thus far only for the young and energetic Crab pulsar. A special class of pulsar wind nebulae (PWNe) is associated with composite supernova remnants (SNRs) where the PWN is centered in an expanding SNR shell. In the first part of this thesis, the results on the search for pulsed and steady VHE gamma-ray emission from the two millisecond pulsars, PSR J0437-4715 and PSR J1824-2452, are presented. Parts of the observations were conducted in a special trigger setup (the topological trigger with convergent pointing) to reduce the energy threshold of the instrument. No signal of pulsed or steady emission is found and upper limits on the pulsed and steady gamma-ray flux are derived. The upper limits on the pulsed gamma-ray flux are compared to existing model predictions and, in the case of PSR J1824-2452, allow the range of possible viewing geometries in some models to be constrained. In the second part of this work, results on the search for pulsed and steady VHE gamma-ray emission from the direction of the composite SNR Kes 75 are presented. The PWN in the center of Kes 75 is powered by a very young and powerful pulsar, PSR J1846-0258, that has an exceptionally high magnetic field. While no hint for pulsed emission is found, steady VHE gamma-ray emission is detected with a statistical significance of 10 sigma from a point-like source. The VHE gamma-ray emission is spatially coincident with the PWN and the SNR shell. Both are discussed as a possible origin for the observed emission. The pulsar of Kes 75 would be the youngest pulsar known to date to power a VHE PWN.

  15. Magnetic absorption of VHE photons in the magnetosphere of the Crab pulsar

    Science.gov (United States)

    Bogovalov, S. V.; Contopoulos, I.; Prosekin, A.; Tronin, I.; Aharonian, F. A.

    2018-05-01

    The detection of the pulsed ˜1 TeV gamma-ray emission from the Crab pulsar reported by MAGIC and VERITAS collaborations demands a substantial revision of existing models of particle acceleration in the pulsar magnetosphere. In this regard model independent restrictions on the possible production site of the very high energy (VHE) photons become an important issue. In this paper, we consider limitations imposed by the process of conversion of VHE gamma-rays into e± pairs in the magnetic field of the pulsar magnetosphere. Photons with energies exceeding 1 TeV are effectively absorbed even at large distances from the surface of the neutron star. Our calculations of magnetic absorption in the force-free magnetosphere show that the twisting of the magnetic field due to the pulsar rotation makes the magnetosphere more transparent compared to the dipole magnetosphere. The gamma-ray absorption appears stronger for photons emitted in the direction of rotation than in the opposite direction. There is a small angular cone inside which the magnetosphere is relatively transparent and photons with energy 1.5 TeV can escape from distances beyond 0.1 light cylinder radius (Rlc). The emission surface from where photons can be emitted in the observer's direction further restricts the sites of VHE gamma-ray production. For the observation angle 57° relative to the Crab pulsar axis of rotation and the orthogonal rotation, the emission surface in the open field line region is located as close as 0.4 Rlc from the stellar surface for a dipole magnetic field, and 0.1 Rlc for a force-free magnetic field.

  16. PKS 2005-489 at VHE: four years of monitoring with HESS and simultaneous multi-wavelength observations

    Science.gov (United States)

    H.E.S.S. Collaboration; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Barres de Almeida, U.; Bazer-Bachi, A. R.; Becherini, Y.; Behera, B.; Benbow, W.; Bernlöhr, K.; Bochow, A.; Boisson, C.; Bolmont, J.; Borrel, V.; Brucker, J.; Brun, F.; Brun, P.; Bühler, R.; Bulik, T.; Büsching, I.; Boutelier, T.; Chadwick, P. M.; Charbonnier, A.; Chaves, R. C. G.; Cheesebrough, A.; Chounet, L.-M.; Clapson, A. C.; Coignet, G.; Costamante, L.; Dalton, M.; Daniel, M. K.; Davids, I. D.; Degrange, B.; Deil, C.; Dickinson, H. J.; Djannati-Ataï, A.; Domainko, W.; O'C. Drury, L.; Dubois, F.; Dubus, G.; Dyks, J.; Dyrda, M.; Egberts, K.; Eger, P.; Espigat, P.; Fallon, L.; Farnier, C.; Fegan, S.; Feinstein, F.; Fiasson, A.; Förster, A.; Fontaine, G.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Gérard, L.; Gerbig, D.; Giebels, B.; Glicenstein, J. F.; Glück, B.; Goret, P.; Göring, D.; Hauser, M.; Heinz, S.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hoffmann, A.; Hofmann, W.; Hofverberg, P.; Holleran, M.; Hoppe, S.; Horns, D.; Jacholkowska, A.; de Jager, O. C.; Jahn, C.; Jung, I.; Katarzyński, K.; Katz, U.; Kaufmann, S.; Kerschhaggl, M.; Khangulyan, D.; Khélifi, B.; Keogh, D.; Klochkov, D.; Kluźniak, W.; Kneiske, T.; Komin, Nu.; Kosack, K.; Kossakowski, R.; Lamanna, G.; Lenain, J.-P.; Lohse, T.; Marandon, V.; Martineau-Huynh, O.; Marcowith, A.; Masbou, J.; Maurin, D.; McComb, T. J. L.; Medina, M. C.; Méhault, J.; Moderski, R.; Moulin, E.; Naumann-Godo, M.; de Naurois, M.; Nedbal, D.; Nekrassov, D.; Nicholas, B.; Niemiec, J.; Nolan, S. J.; Ohm, S.; Olive, J.-F.; de Oña Wilhelmi, E.; Orford, K. J.; Ostrowski, M.; Panter, M.; Paz Arribas, M.; Pedaletti, G.; Pelletier, G.; Petrucci, P.-O.; Pita, S.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raubenheimer, B. C.; Raue, M.; Rayner, S. M.; Renaud, M.; Rieger, F.; Ripken, J.; Rob, L.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Ruppel, J.; Sahakian, V.; Santangelo, A.; Schlickeiser, R.; Schöck, F. M.; Schwanke, U.; Schwarzburg, S.; Schwemmer, S.; Shalchi, A.; Sikora, M.; Skilton, J. L.; Sol, H.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Superina, G.; Szostek, A.; Tam, P. H.; Tavernet, J.-P.; Terrier, R.; Tibolla, O.; Tluczykont, M.; van Eldik, C.; Vasileiadis, G.; Venter, C.; Venter, L.; Vialle, J. P.; Vincent, P.; Vivier, M.; Völk, H. J.; Volpe, F.; Wagner, S. J.; Ward, M.; Zdziarski, A. A.; Zech, A.

    2010-02-01

    Aims: Our aim is to study the very high energy (VHE; E>100 GeV) γ-ray emission from BL Lac objects and the evolution in time of their broad-band spectral energy distribution (SED). Methods: VHE observations of the high-frequency peaked BL Lac object PKS 2005-489 were made with the High Energy Stereoscopic System (HESS) from 2004 through 2007. Three simultaneous multi-wavelength campaigns at lower energies were performed during the HESS data taking, consisting of several individual pointings with the XMM-Newton and RXTE satellites. Results: A strong VHE signal, ~17σ total, from PKS 2005-489 was detected during the four years of HESS observations (90.3 h live time). The integral flux above the average analysis threshold of 400 GeV is ~3% of the flux observed from the Crab Nebula and varies weakly on time scales from days to years. The average VHE spectrum measured from ~300 GeV to ~5 TeV is characterized by a power law with a photon index, Γ = 3.20± 0.16_stat± 0.10_syst. At X-ray energies the flux is observed to vary by more than an order of magnitude between 2004 and 2005. Strong changes in the X-ray spectrum (ΔΓX ≈ 0.7) are also observed, which appear to be mirrored in the VHE band. Conclusions: The SED of PKS 2005-489, constructed for the first time with contemporaneous data on both humps, shows significant evolution. The large flux variations in the X-ray band, coupled with weak or no variations in the VHE band and a similar spectral behavior, suggest the emergence of a new, separate, harder emission component in September 2005. Supported by CAPES Foundation, Ministry of Education of Brazil.Now at Harvard-Smithsonian Center for Astrophysics, Cambridge, USA.Now at W.W. Hansen Experimental Physics Laboratory & Kavli Institute for Particle Astrophysics and Cosmology, Stanford University, Stanford, USA.

  17. Detection of variable VHE γ-ray emission from the extra-galactic γ-ray binary LMC P3

    Science.gov (United States)

    HESS Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Angüner, E. O.; Arakawa, M.; Armand, C.; Arrieta, M.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Becker Tjus, J.; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bonnefoy, S.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Büchele, M.; Bulik, T.; Capasso, M.; Caroff, S.; Carosi, A.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Colafrancesco, S.; Condon, B.; Conrad, J.; Davids, I. D.; Decock, J.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Donath, A.; Drury, L. O.'C.; Dyks, J.; Edwards, T.; Egberts, K.; Emery, G.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Funk, S.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Garrigoux, T.; Gaté, F.; Giavitto, G.; Glawion, D.; Glicenstein, J. F.; Gottschall, D.; Grondin, M.-H.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holch, T. L.; Holler, M.; Horns, D.; Ivascenko, A.; Iwasaki, H.; Jacholkowska, A.; Jamrozy, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katsuragawa, M.; Katz, U.; Kerszberg, D.; Khangulyan, D.; Khélifi, B.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lefaucheur, J.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Malyshev, D.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Nakashima, S.; de Naurois, M.; Ndiyavala, H.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poireau, V.; Prokhorov, D. A.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Rauth, R.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Rieger, F.; Rinchiuso, L.; Romoli, C.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Saito, S.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seglar-Arroyo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Shiningayamwe, K.; Simoni, R.; Sol, H.; Spanier, F.; Spir-Jacob, M.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Steppa, C.; Sushch, I.; Takahashi, T.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tsirou, M.; Tsuji, N.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Zorn, J.; Żywucka, N.

    2018-03-01

    Context. Recently, the high-energy (HE, 0.1-100 GeV) γ-ray emission from the object LMC P3 in the Large Magellanic Cloud (LMC) has been discovered to be modulated with a 10.3-day period, making it the first extra-galactic γ-ray binary. Aim. This work aims at the detection of very-high-energy (VHE, >100 GeV) γ-ray emission and the search for modulation of the VHE signal with the orbital period of the binary system. Methods: LMC P3 has been observed with the High Energy Stereoscopic System (H.E.S.S.); the acceptance-corrected exposure time is 100 h. The data set has been folded with the known orbital period of the system in order to test for variability of the emission. Results: VHE γ-ray emission is detected with a statistical significance of 6.4 σ. The data clearly show variability which is phase-locked to the orbital period of the system. Periodicity cannot be deduced from the H.E.S.S. data set alone. The orbit-averaged luminosity in the 1-10 TeV energy range is (1.4 ± 0.2) × 1035 erg s-1. A luminosity of (5 ± 1) × 1035 erg s-1 is reached during 20% of the orbit. HE and VHE γ-ray emissions are anti-correlated. LMC P3 is the most luminous γ-ray binary known so far.

  18. Ground-based VHE γ ray astronomy with air Cherenkov imaging telescopes

    International Nuclear Information System (INIS)

    Mirzoyan, R.

    2000-01-01

    The history of astronomy has been one of the scientific discovery following immediately the introduction of new technology. In this report, we will review shortly the basic development of the atmospheric air Cherenkov light detection technique, particularly the imaging telescope technique, which in the last years led to the firm establishment of a new branch in experimental astronomy, namely ground-based very high-energy (VHE) γ ray astronomy. Milestones in the technology and in the analysis of imaging technique will be discussed. The design of the 17 m diameter MAGIC Telescope, being currently under construction, is based on the development of new technologies for all its major parts and sets new standards in the performance of the ground-based γ detectors. MAGIC is one of the next major steps in the development of the technique being the first instrument that will allow one to carry out measurements also in the not yet investigated energy gap i.e. between 10 and 300 GeV

  19. Seroprevalence for hepatitis E virus (HEV infection among volunteer blood donors of the Regional Blood Bank of Londrina, State of Paraná , Brazil Soroprevalência da infecção pelo virus da hepatite E (VHE em candidatos a doadores de sangue voluntários do Hemocentro Regional de Londrina, Londrina, Estado do Paraná, Brasil

    Directory of Open Access Journals (Sweden)

    André Luiz Bortoliero

    2006-04-01

    Full Text Available A cross-sectional study was carried out among 996 volunteer blood donors enrolled from May 1999 to December 1999 to determine the seroprevalence of hepatitis E virus (HEV infection among volunteer blood donors of the Regional Blood Bank of Londrina, State of Paraná, Brazil, and to evaluate whether the rate of seroprevalence of IgG anti-HEV antibodies is associated with sociodemographic variables and with seropositivity for hepatitis A virus (HAV infection. All participants answered the questionnaire regarding the sociodemographic characterisitcs. Serum samples were tested for IgG antibodies to HEV (anti-HEV by an enzyme linked immunoassay (ELISA. All serum samples positive for anti-HEV IgG and 237 serum samples negative for anti-HEV were also assayed for IgG anti-HAV antibodies by ELISA. Anti-HEV IgG was confirmed in 23/996 samples, resulting in a seroprevalence of 2.3% for HEV infection, similar to previous results obtained in developed countries. No significant association was found between the presence of anti-HEV IgG antibodies and the sociodemographic variables including gender, age, educational level, rural or urban areas, source of water, and sewer system (p > 0.05. Also, no association with seropositivity for anti-HAV IgG antibodies was observed (p > 0.05. Although this study revealed a low seroprevalence of HEV infection in the population evaluated, the results showed that this virus is circulating among the population from Londrina, South Brazil, and point out the need of further studies to define the clinical and epidemiological importance of HEV infection and to identify additional risk factors involved in the epidemiology and pathogenesis of this infection in this population.Os objetivos do estudo foram determinar a soroprevalência da infecção pelo vírus da hepatite E (VHE em candidatos a doadores de sangue voluntários do Hemocentro Regional de Londrina, Paraná, e avaliar se essa soroprevalência está associada com vari

  20. Attenuation of VHE Gamma Rays by the Milky Way Interstellar Radiation Field

    Energy Technology Data Exchange (ETDEWEB)

    Moskalenko, Igor V.; /Stanford U., HEPL; Porter, Troy A.; /Louisiana State U.; Strong, Andrew W.; /Garching, Max Planck Inst., MPE

    2006-04-19

    The attenuation of very high energy gamma rays by pair production on the Galactic interstellar radiation field has long been thought of as negligible. However, a new calculation of the interstellar radiation field consistent with multi-wavelength observations by DIRBE and FIRAS indicates that the energy density of the Galactic interstellar radiation field is higher, particularly in the Galactic center, than previously thought. We have made a calculation of the attenuation of very high energy gamma rays in the Galaxy using this new interstellar radiation field which takes into account its nonuniform spatial and angular distributions. We find that the maximum attenuation occurs around 100 TeV at the level of about 25% for sources located at the Galactic center, and is important for both Galactic and extragalactic sources.

  1. Sources

    International Nuclear Information System (INIS)

    Duffy, L.P.

    1991-01-01

    This paper discusses the sources of radiation in the narrow perspective of radioactivity and the even narrow perspective of those sources that concern environmental management and restoration activities at DOE facilities, as well as a few related sources. Sources of irritation, Sources of inflammatory jingoism, and Sources of information. First, the sources of irritation fall into three categories: No reliable scientific ombudsman to speak without bias and prejudice for the public good, Technical jargon with unclear definitions exists within the radioactive nomenclature, and Scientific community keeps a low-profile with regard to public information. The next area of personal concern are the sources of inflammation. This include such things as: Plutonium being described as the most dangerous substance known to man, The amount of plutonium required to make a bomb, Talk of transuranic waste containing plutonium and its health affects, TMI-2 and Chernobyl being described as Siamese twins, Inadequate information on low-level disposal sites and current regulatory requirements under 10 CFR 61, Enhanced engineered waste disposal not being presented to the public accurately. Numerous sources of disinformation regarding low level radiation high-level radiation, Elusive nature of the scientific community, The Federal and State Health Agencies resources to address comparative risk, and Regulatory agencies speaking out without the support of the scientific community

  2. Effect of stars in the field of view of the VHE gamma-ray atmospheric Cherenkov telescope

    International Nuclear Information System (INIS)

    Badran, H.M.

    2004-01-01

    Very high energy gamma-ray astronomy in the energy range above 100 GeV has made dramatic progress through the development of imaging atmospheric Cherenkov telescopes (lACTs). The technique has been pivotal in the establishing the existence of a number of discrete gamma-ray sources. Normally due to the presence of stars in the field of view (FOV), a number of photomultiplier tubes (pmts) in the camera has to be turned off. This may have the effect of distorting some images that happens to be in that part of the camera. This may in turn affect the gamma-ray sensitivity of the telescope. The present study aims to shade some light on this possible effect. Experimental data on the extragalactic gamma-ray source Mrk 421 measured using the 10-m Whipple IACT were used for this purpose because of its relative dark FOV compared with other sources; e.g. the Crab nebula. To simulate the presence of star(s) in the FOV, the analysis program selects randomly a number of clusters of pmts to be turned off in the software. The pmts in each cluster have to be adjacent to each other (neighbors) and the selected clusters have to be separated from each other. The significance of the detected signal and the gamma-ray rate were then determined and compared with the original results. Clusters of 2, 3 and 4 pmts were used. The number of clusters was increased up to 12 clusters at various distances from the center of the FOV

  3. Observation of a VHE Cosmic-Ray Flare-Signal with the L3+C Muon Spectrometer

    CERN Document Server

    Adriani, O; Aziz, T; Bähr, J; Banerjee, S; Becattini, F; Bellucci, L; Betev, B L; Blaising, J J; Bobbink, G J; Bottai, S; Bourilkov, D; Cartacci, A; Chemarin, M; Chen, G; Chen, G M; Chen, H S; Chiarusi, T; Coignet, G; Ding, L K; Duran, I; Eline, A; El Mamouni, H; Faber, G; Fay, J; Filthaut, F; Ganguli, S N; Gong, Z F; Grabosch, H J; Groenstege, H; Guo, Y N; Gupta, S; Gurtu, A; Haller, Ch; Hayashi, Y; He, Z X; Hebbeker, T; Herve, A; Hofer, H; Hoferjun, H; Huo, A X; Ito, N; Jing, C L; Jones, L W; Kantserov, V; Kawakami, S; Kittel, W; König, A C; Kok, E; Kuang, H H; Kuijpers, J; Ladron de Guevara, P; Le Coultre, P; Lei, Y; Leich, H; Leiste, R; Li, L; Li, Z C; Liu, Z A; Lohmann, W; Lu, Y S; Ma, W G; Ma, X H; Ma, Y Q; Mele, S; Meng, X W; Meschini, M; Metzger, W J; van Mil, A; Milcent, H; Mohanty, G B; Monteleoni, B; Nahnhauer, R; Naumov, V A; Nowak, H; Parriaud, J -F; Pauss, F; Petersen, B; Pieri, M; Pohl, M; Pojidaev, V; Qing, C R; Ramelli, R; Ranieri, R; Ravindran, K C; Rewiersma, P; Riemann, S; Rojkov, A; Romero, L; Schmitt, V; Schoeneich, B; Schotanus, D J; Shen, C Q; Spillantini, P; Sulanke, H; Tang, X W; Timmermans, C; Tonwar, S C; Trowitzsch, G; Unger, M; Verkooijen, H; Van de Walle, R T; Vogt, H; Wang, R G; Wang, Q; Wang, X L; Wang, X W; Wang, Z M; Wijk, R van; Wijnen, T A M; Wilkens, H; Xu, Y P; Xu, J S; Xu, Z Z; Yang, C G; Yang, X F; Yao, Z G; Yu, Z Q; Zhang, C; Zhang, F; Zhang, J; Zhang, S; Zhou, S J; Zhu, G Y; Zhu, Q Q; Zhuang, H L; Zwart, A N M

    2010-01-01

    The data collected by the L3+C muon spectrometer at the CERN Large Electron-Positron collider, LEP, have been used to search for short duration signals emitted by cosmic point sources. A sky survey performed from July to November 1999 and from April to November 2000 has revealed one single flux enhancement (chance probability = 2.6X10^{-3}) between the 17th and 20th of August 2000 from a direction with a galactic longitude of (265.02+-0.42)^° and latitude of (55.58+-0.24)^°. The energy of the detected muons was above 15 GeV.

  4. sources

    Directory of Open Access Journals (Sweden)

    Shu-Yin Chiang

    2002-01-01

    Full Text Available In this paper, we study the simplified models of the ATM (Asynchronous Transfer Mode multiplexer network with Bernoulli random traffic sources. Based on the model, the performance measures are analyzed by the different output service schemes.

  5. Constraints on a Proton Synchrotron Origin of VHE Gamma Rays from the Extended Jet of AP Librae

    Energy Technology Data Exchange (ETDEWEB)

    Basumallick, Partha Pratim; Gupta, Nayantara, E-mail: basuparth314@gmail.com [Raman Research Institute, C. V. Raman Avenue, Sadashivanagar, Bangalore 560080 (India)

    2017-07-20

    The multiwavelength photon spectrum from the BL Lac object AP Librae extends from radio to TeV gamma rays. The X-ray to very high-energy gamma-ray emission from the extended jet of this source has been modeled with inverse Compton (IC) scattering of relativistic electrons off the cosmic microwave background (CMB) photons. The IC/CMB model requires the kpc-scale extended jet to be highly collimated with a bulk Lorentz factor close to 10. Here we discuss the possibility of a proton synchrotron origin of X-rays and gamma rays from the extended jet with a bulk Lorentz factor of 3. This scenario requires an extreme proton energy of 3.98 × 10{sup 21} eV and a high magnetic field of 1 mG of the extended jet with jet power ∼5 × 10{sup 48} erg s{sup −1} in particles and the magnetic field (which is more than 100 times the Eddington luminosity of AP Librae) to explain the very high-energy gamma-ray emission. Moreover, we have shown that X-ray emission from the extended jets of 3C 273 and PKS 0637-752 could be possible by proton synchrotron emission with jet power comparable to the Eddington luminosities.

  6. Axion-like particle imprint in cosmological very-high-energy sources

    International Nuclear Information System (INIS)

    Domínguez, A.; Sánchez-Conde, M.A.; Prada, F.

    2011-01-01

    Discoveries of very high energy (VHE) photons from distant blazars suggest that, after correction by extragalactic background light (EBL) absorption, there is a flatness or even a turn-up in their spectra at the highest energies that cannot be easily explained by the standard framework. Here, it is shown that a possible solution to this problem is achieved by assuming the existence of axion-like particles (ALPs) with masses ∼ 1 neV. The ALP scenario is tested making use of observations of the highest redshift blazars known in the VHE energy regime, namely 3C 279, 3C 66A, PKS 1222+216 and PG 1553+113. In all cases, better fits to the observed spectra are found when including ALPs rather than considering EBL only. Interestingly, quite similar critical energies for photon/ALP conversions are also derived, independently of the source considered

  7. The Crab pulsar at VHE

    Directory of Open Access Journals (Sweden)

    Zanin Roberta

    2017-01-01

    Full Text Available The last six years have witnessed major revisions of our knowledge about the Crab Pulsar. The consensus scenario for the origin of the high-energy pulsed emission has been challenged with the discovery of a very-high-energy power law tail extending up to ~400 GeV, above the expected spectral cut off at a few GeV. Now, new measurements obtained by the MAGIC collaboration extend the energy spectrum of the Crab Pulsar even further, on the TeV regime. Above ~400 GeV the pulsed emission comes mainly from the interpulse, which becomes more prominent with energy due to a harder spectral index. These findings require γ -ray production via inverse Compton scattering close to or beyond the light cylinder radius by an underlying particle population with Lorentz factors greater than 5 × 106. We will present those new results and discuss the implications in our current knowledge concerning pulsar environments.

  8. Discovery of a point-like very-high-energy gamma-ray source in Monoceros

    International Nuclear Information System (INIS)

    Aharonian, F.A.; Benbow, W.; Berge, D.; Bernlohr, K.; Bolz, O.; Braun, I.; Buhler, R.; Carrigan, S.; Costamante, L.; Domainko, W.; Egberts, K.; Forster, A.; Funk, S.; Hauser, D.; Hermann, G.; Hinton, J.A.; Hofmann, W.; Hoppe, S.; Khelifi, B.; Kosack, K.; Masterson, C.; Panter, M.; Rowell, G.; van Eldik, C.; Volk, H.J.; Akhperjanian, A.G.; Sahakian, V.; Bazer-Bachi, A.R.; Borrel, V.; Marcowith, A.; Olive, J.P.; Beilicke, M.; Cornils, R.; Heinzelmann, G.; Raue, M.; Ripken, J.; Bernlohr, K.; Funk, Seb.; Fussling, M.; Kerschhaggl, M.; Lohse, T.; Schlenker, S.; Schwanke, U.; Boisson, C.; Martin, J.M.; Sol, H.; Brion, E.; Glicenstein, J.F.; Goret, P.; Moulin, E.; Rolland, L.

    2007-01-01

    Aims. The complex Monoceros Loop SNR/Rosette Nebula region contains several potential sources of very-high-energy (VHE) γ-ray emission and two as yet unidentified high-energy EGRET sources. Sensitive VHE observations are required to probe acceleration processes in this region. Methods. The HESS telescope array has been used to search for very high-energy gamma-ray sources in this region. CO data from the NANTEN telescope were used to map the molecular clouds in the region, which could act as target material for γ-ray production via hadronic interactions. Results. We announce the discovery of a new γ-ray source, HESS J0632+057, located close to the rim of the Monoceros SNR. This source is unresolved by HESS and has no clear counterpart at other wavelengths but is possibly associated with the weak X-ray source 1RXS J063258.3+054857, the Be-star MWC148 and/or the lower energy γ-ray source 3EGJ0634+0521. No evidence for an associated molecular cloud was found in the CO data. (authors)

  9. Study of extragalactic sources with H.E.S.S

    International Nuclear Information System (INIS)

    Giebels, Berrie

    2007-01-01

    The field of Very High Energy (VHE) γ-ray emitting extragalactic sources has considerably evolved since the new generation of atmospheric Cerenkov telescopes (ACT) of improved sensitivity, such as H.E.S.S. array and the MAGIC ACT, have started operating. This has led to a wealth of new clues about emission mechanisms at high energy through the discovery of new sources, more accurate spectra and temporal studies of sources known previously, and simultaneous multi-wavelength (MWL) campaigns since broad band variability is a key phenomenon to the underlying physical mechanisms at play. The fact that some of these new sources are located at redshifts close to z ∼ 0.2 makes them powerful probes of the Extragalactic Background Light (EBL) through the attenuation of γ-rays above 100 GeV

  10. IceCube constraints on fast-spinning pulsars as high-energy neutrino sources

    Energy Technology Data Exchange (ETDEWEB)

    Fang, Ke [Department of Astronomy, University of Maryland, College Park, MD, 20742 (United States); Kotera, Kumiko [Institut d' Astrophysique de Paris, UMR 7095 – CNRS, Université Pierre $ and $ Marie Curie, 98 bis boulevard Arago, 75014, Paris (France); Murase, Kohta [Department of Physics, Department of Astronomy and Astrophysics, Center for Particle and Gravitational Astrophysics, The Pennsylvania State University, PA 16802 (United States); Olinto, Angela V., E-mail: kefang@umd.edu, E-mail: kotera@iap.fr, E-mail: murase@psu.edu, E-mail: olinto@kicp.uchicago.edu [Department of Astronomy and Astrophysics, Kavli Institute for Cosmological Physics, University of Chicago, Chicago, IL 60637 (United States)

    2016-04-01

    Relativistic winds of fast-spinning pulsars have been proposed as a potential site for cosmic-ray acceleration from very high energies (VHE) to ultrahigh energies (UHE). We re-examine conditions for high-energy neutrino production, considering the interaction of accelerated particles with baryons of the expanding supernova ejecta and the radiation fields in the wind nebula. We make use of the current IceCube sensitivity in diffusive high-energy neutrino background, in order to constrain the parameter space of the most extreme neutron stars as sources of VHE and UHE cosmic rays. We demonstrate that the current non-observation of 10{sup 18} eV neutrinos put stringent constraints on the pulsar scenario. For a given model, birthrates, ejecta mass and acceleration efficiency of the magnetar sources can be constrained. When we assume a proton cosmic ray composition and spherical supernovae ejecta, we find that the IceCube limits almost exclude their significant contribution to the observed UHE cosmic-ray flux. Furthermore, we consider scenarios where a fraction of cosmic rays can escape from jet-like structures piercing the ejecta, without significant interactions. Such scenarios would enable the production of UHE cosmic rays and help remove the tension between their EeV neutrino production and the observational data.

  11. Search for tiny or transient sources in the Galaxy's central regions with H.E.S.S. - Application to the study of supernova W49B's remnant region

    International Nuclear Information System (INIS)

    Brun, F.

    2011-09-01

    H.E.S.S. (High Energy Stereoscopic System) is an array of four very-high energy (VHE) gamma-ray telescopes located in Namibia. These telescopes use the atmospheric Cherenkov imaging technique to detect gamma-rays between 100 GeV and a few tens of TeV. The H.E.S.S. cameras, each composed of 960 photomultiplier tubes and a fast electronics, need an accurate calibration of the shower to electronic signal conversion. A spurious capacitive coupling between the photomultiplier tubes and the data acquisition system (the common modes) was revealed and corrected during this thesis, resulting in data of better quality. H.E.S.S. is ideally located to observe the inner regions of the Galactic plane. Hence, the Galactic Plane Survey has been one of the primary goal since the beginning of the array operation in 2004 and led to unveiling the diversity of the VHE gamma-ray sources. This thesis presents the search for VHE gamma-ray sources in the inner regions of the Galactic plane using the most sensitive semi-analytical model based analysis currently available. A search for transient sources was also performed for these regions using powerful methods based on the time difference between consecutive events. These methods have been precisely characterized by simulation and didn't lead to the detection of significant variable sources. The very-high energy gamma-ray emission from the W49 region and the supernova remnant W49B in particular has been revealed during this thesis. The analysis of this region and the implications of this discovery are described in detail in this manuscript. (author)

  12. Detecting new γ-ray sources based on multi-frequency data the case of 1WHSPJ031423.9+061956

    Science.gov (United States)

    Arsioli, Bruno; Chang, Yu Ling

    2015-12-01

    We use the Fermi Science Tools in an attempt to unveil faint γ-ray blazars that may be above the threshold for detectability with Fermi-LAT and are not identified by automated methods. Our search for new sources in the 100MeV-300GeV band is mainly driven by the 1/2WHSP catalogs, which list high synchrotron peaked blazars expected to be emitters of VHE photons. Here we present the γ-ray detection of 1WHSP J031423.9+061956, modelling its high energy spectrum as a power law. We describe an example where multi-frequency selection, performed at much lower energies (from radio to X-ray), helps to pin-point a high energy source. The 1/2WHSP catalogs are built with the aim of providing a list of TeV targets for the VHE arrays of Cherenkov telescopes. Moreover, these catalogs provide useful seeds for identifying new high energy sources within the raw-data from Fermi. With the aid of multi-frequency data, we can explore the very high energy domain in greater details, improving the description of the γ-ray sky.

  13. Dicty_cDB: VHE361 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nsnnnqptnfnsstsspilsgnnnnnnnnnnnnn nninnnnnnnsnnnnnmntsnptnqqssviisddmddvqtnxnppnpqyplspnsvnrgn npsnismsgaqrsapliisp...nqptnfnsstsspilsgnnnnnnnnnnnnn nninnnnnnnsnnnnnmntsnptnqqssviisddmddvqtnxnppnpqyplspnsvnrgn npsnismsgaqrsapliisp

  14. VHE gamma-rays from radio pulsars and cataclysmic variables

    International Nuclear Information System (INIS)

    De Jager, O.C.; Brink, C.; Meintjies, P.J.; Nel, H.I.; North, A.R.; Raubenheimer, B.C.; Van der Walt, D.J.

    1990-01-01

    We present the results of observations (above 1 TeV) of radio pulsars and cataclysmic variables with the Potchefstroom air Cerenkov facility. We were able to confirm our previous detection of PSR 1509-58 and the final significance is 1.7x10 -5 . A DC enhancement at the 10 -3 significance level was seen from the L 4 Lagrange position in the PSR 1957+20 system. This result was confirmed by COS-B data. We were also able to detect the 5.4 ms pulsar PSR 1855+09 at a marginal significance level of 5%. However, the best and longest observation indicates non-uniformity at the 0.005 significance level. The TeV light curve resembles the radio light curve. The latter is also reminiscent of other millisecond pulsar observed above 1 TeV. The intermediate polar AEAQR (P = 33.08s) shows a period shift which is consistent with recent model predictions. However, the present significance of this results does not allow an unambiguous claim. (orig.)

  15. Dicty_cDB: VHE211 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available F143854.1 Sinantherina socialis 82 kD heat shock protein (hsp82) gene, partial cd...Naegleria gruberi strain ATCC 30224 heat shock protein 90 (HSP-90) gene, partial cds. 86 3e-46 7 AF143854 |A

  16. Dicty_cDB: VHE632 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KKIFXFFFXKKK--- ---YKKLFINNIYIQWVTEHSKHTTVTT*aldtitsrpttvitiitltsisktteaklx* epiavntfqlvtinkftshttytvtnqxst*...tshttytvtnqxst*ntttvkxqskvittxtylltvtvmsxxpi ttiimlxskntsykqinkxkkk Homology vs CSM-cDNA Score E Sequences p

  17. Dicty_cDB: VHE841 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available niaqfvviq*kmkekkkil*llanivinqftix aikil*itlkmsxsfinvxivlvtsx*nxvgiigvveektpkkslgkrkkk Frame C: ---*n*merklym...l*xlffkrf**kikilpnl*sfnkr*rrrrrfynylpils*issrsl rskyyr*x*k*afhl*msxly**xanktx*e*l

  18. Dicty_cDB: VHE875 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 16 3 EL476245 |EL476245.1 CHUL4181.b1_J14.ab1 CHU(LMS) puzzle sunflower Helianthus paradoxus cDNA clone CHUL...4181, mRNA sequence. 72 1e-16 3 EL513430 |EL513430.1 CHUX465.b1_A21.ab1 CHU(XYZ) puzzle

  19. Dicty_cDB: VHE489 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Value N EL477374 |EL477374.1 CHUL5577.b1_A04.ab1 CHU(LMS) puzzle sunflower Helianthus paradoxuscDNA clone ...CHUL5577, mRNA sequence. 52 0.015 1 EL474819 |EL474819.1 CHUL2764.b1_G19.ab1 CHU(LMS) puzzle

  20. Dicty_cDB: VHE642 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NA clone GR__Ea43H12 3', mRNA sequence. 58 6e-17 4 EL513430 |EL513430.1 CHUX465.b1_A21.ab1 CHU(XYZ) puzzle s...unflower Helianthus paradoxus cDNA clone CHUX465, mRNA sequence. 72 2e-16 4 EL476245 |EL476245.1 CHUL4181.b1_J14.ab1 CHU(LMS) puzzle

  1. Dicty_cDB: VHE271 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -21 (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 105 3e-21 BC171956_1( BC171956 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 BC138482_1( BC138482 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 (Q9JLC8) RecName: Full=Sacsin; 103 1e-20 AB006708_10( AB006

  2. Dicty_cDB: VHE123 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nificant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 105 4e-21 ...none) Micromonas sp. RCC299 chromosome... 103 1e-20 BC138482_1( BC138482 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 (Q9JLC8) RecName: Full=Sacsin; 103 1e-20 BC171956_1( BC17...1956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 1e-20 AB006708_10( AB006708 |pid:none) Arabidopsis

  3. Dicty_cDB: VHE487 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CNMS7844.b1_H17.ab1 CNM(LMS) spotted knapweed Centaurea maculosacDNA clone CNMS7844, mRNA sequence. 38 0.016... 2 EH740364 |EH740364.1 CNMS13648.b1_O04.ab1 CNM(LMS) spotted knapweed Centaurea maculosa cDNA clone CNMS136

  4. Dicty_cDB: VHE245 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4e-11 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 71 4e-11 AY892312_1( AY892312 |p... reading fra... 70 8e-11 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 70 8e-11 prot

  5. Dicty_cDB: VHE759 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5 CX072513 |CX072513.1 UCRCS08_28E10_g Parent Washington Navel Orange Callus cDNA Library UCRCS08-2 Citrus s...72512.1 UCRCS08_28E10_b Parent Washington Navel Orange Callus cDNA Library UCRCS08-2 Citrus sinensis cDNA cl...inensis cDNA clone UCRCS08-28E10-J20-1-4.g, mRNA sequence. 46 1.5 1 CX072512 |CX0

  6. Dicty_cDB: VHE244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vliyfvehg*rpdlticqltm*hlmnlfnw**k*rdlil*fcdlfkgkh*pnnqnkk *vl*licnsd*yhdtcylha*lvdpasshmlvskikpcms... Frame A: vgkvliyfvehg*rpdlticqltm*hlmnlfnw**k*rdlil*fcdlfkgkh*pnnqnkk *vl*licnsd*yhdtcylha*lvdpasshmlvskikpcms

  7. Observations of the unidentified gamma-ray source TeV J2032+4130 by Veritas

    Energy Technology Data Exchange (ETDEWEB)

    Aliu, E.; Errando, M. [Department of Physics and Astronomy, Barnard College, Columbia University, NY 10027 (United States); Aune, T. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Behera, B.; Chen, X.; Federici, S. [DESY, Platanenallee 6, D-15738 Zeuthen (Germany); Beilicke, M.; Buckley, J. H.; Bugaev, V. [Department of Physics, Washington University, St. Louis, MO 63130 (United States); Benbow, W.; Cerruti, M. [Fred Lawrence Whipple Observatory, Harvard-Smithsonian Center for Astrophysics, Amado, AZ 85645 (United States); Berger, K. [Department of Physics and Astronomy and the Bartol Research Institute, University of Delaware, Newark, DE 19716 (United States); Bird, R. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Cardenzana, J. V. [Department of Physics and Astronomy, Iowa State University, Ames, IA 50011 (United States); Ciupik, L. [Astronomy Department, Adler Planetarium and Astronomy Museum, Chicago, IL 60605 (United States); Connolly, M. P. [School of Physics, National University of Ireland Galway, University Road, Galway (Ireland); Cui, W. [Department of Physics, Purdue University, West Lafayette, IN 47907 (United States); Duke, C. [Department of Physics, Grinnell College, Grinnell, IA 50112-1690 (United States); Dumm, J. [School of Physics and Astronomy, University of Minnesota, Minneapolis, MN 55455 (United States); Falcone, A., E-mail: pratik.majumdar@saha.ac.in, E-mail: gareth.hughes@desy.de [Department of Astronomy and Astrophysics, 525 Davey Lab, Pennsylvania State University, University Park, PA 16802 (United States); and others

    2014-03-01

    TeV J2032+4130 was the first unidentified source discovered at very high energies (VHEs; E > 100 GeV), with no obvious counterpart in any other wavelength. It is also the first extended source to be observed in VHE gamma rays. Following its discovery, intensive observational campaigns have been carried out in all wavelengths in order to understand the nature of the object, which have met with limited success. We report here on a deep observation of TeV J2032+4130 based on 48.2 hr of data taken from 2009 to 2012 by the Very Energetic Radiation Imaging Telescope Array System experiment. The source is detected at 8.7 standard deviations (σ) and is found to be extended and asymmetric with a width of 9.'5 ± 1.'2 along the major axis and 4.'0 ± 0.'5 along the minor axis. The spectrum is well described by a differential power law with an index of 2.10 ± 0.14{sub stat} ± 0.21{sub sys} and a normalization of (9.5 ± 1.6{sub stat} ± 2.2{sub sys}) × 10{sup –13} TeV{sup –1} cm{sup –2} s{sup –1} at 1 TeV. We interpret these results in the context of multiwavelength scenarios which particularly favor the pulsar wind nebula interpretation.

  8. Shell-type SNRs as sources of cosmic rays

    Science.gov (United States)

    Sinitsyna, V. G.; Andreeva, M. S.; Balygin, K. A.; Borisov, S. S.; Ivanov, I. A.; Kirichenko, A. M.; Klimov, A. I.; Kozhukhova, I. P.; Mirzafatikhov, R. M.; Moseiko, N. I.; Ostashev, I. E.; Palamarchuk, A. I.; Sinitsyna, V. Y.; Volokh, I. G.

    2017-06-01

    Investigations of VHE gamma-ray sources by any methods, including mirror Cherenkov telescopes, touch on the problem of the cosmic ray origin and, accordingly, the role of the Galaxy in their generation. SHALON observations have yielded results on Galactic supernova remnants (SNR) of different ages. Among them are: the shell-type SNRs Tycho's SNR (1572y), Cas A (1680y), IC 443 (age ˜ (3 ÷ 30) × 103 y), Cygni SNR (age ˜ (5 ÷ 7) × 103 y), G166.0 + 4.3 (age ˜ 24 × 103 y) and the classical nova GK Per (Nova 1901). Observation results are presented for each of the SNRs with spectral energy distributions by SHALON in comparison with other experiment data and images by SHALON together with data from X-rays by Chandra and radio-data by CGPS. The collected experimental data have confirmed the prediction of the theory about the hadronic generation mechanism of very high energy 800 GeV-100 TeV gamma-rays in Tycho's SNR, Cas A and IC443. For the first time, unique data on GK Per (Nova1901) TeV gamma-ray emission were obtained with the SHALON experiment. The X-ray data shows that the nova remnant of GK Per could be a younger remnant that will resemble older SNRs like IC 443 which interact with molecular clouds. GK Per is supposed to be a candidate for TeV gamma-ray emission due to accelerated particles in the reverse shock region.

  9. Source Water Protection Contaminant Sources

    Data.gov (United States)

    Iowa State University GIS Support and Research Facility — Simplified aggregation of potential contaminant sources used for Source Water Assessment and Protection. The data is derived from IDNR, IDALS, and US EPA program...

  10. Modeling the emission of the galactic very high energy γ-ray sources G 1.9+0.3, G 330.2+1.0, HESS J1303-631 and PSR B1259-63/LS 2883 observed with H.E.S.S

    International Nuclear Information System (INIS)

    Sushch, Iurii

    2012-01-01

    Recently, imaging atmospheric Cherenkov telescopes (IACTs) have discovered numerous new sources representing various source classes in the very high energy (VHE; E>100 GeV) sky. This work presents studies of representatives of three types of Galactic VHE emitters: the Supernova remnants (SNRs) G1.9+0.3 and G330.2+1.0, the pulsar wind nebula (PWN) HESS J1303.631 and the binary system PSR B1259.63/LS 2883. The analysis of the H.E.S.S. data and the broadband emission modeling are presented. G1.9+0.3 and G330.2+1.0 are synchrotron-dominated SNRs whose non-thermal X-ray emission implies that intensive particle acceleration occurs at their shock fronts. This makes them promising candidates for the detection at VHEs. They were observed by the High Energy Stereoscopic System (H.E.S.S.) yielding no signs of significant VHE γ-ray emission from either SNR. The 99% confidence level upper limits on the TeV flux were determined. For an assumed spectral index of 2.5 the obtained upper limits are F G1.9 (>260 GeV) -13 cm -2 s -1 for G1.9+0.3 and F G330 (>380 GeV) -12 cm -2 s -1 for G330.2+1.0. Upper limits on the VHE emission provide constraints on the interior magnetic field in the context of a leptonic scenario and on the interstellar medium (ISM) density and cosmic-ray (CR) efficiency in a hadronic scenario. Lower limits on the interior magnetic fields were estimated at 15 μG for G1.9+0.3 and 14 μG for G330.2+1.0. In the case of the hadronic scenario, the H.E.S.S. upper limits are two orders of magnitude greater than the flux prediction. Obtained upper limits on the ISM densities are compatible with other estimates of the densities (from the thermal X-ray emission for G330.2+1.0 and from the expansion rate for G1.9+0.3). The CR efficiency cannot be constrained with the current H.E.S.S. upper limits. HESS J1303-631 is an initially unidentified H.E.S.S. source which was recently identified as a PWN associated with the pulsar PSR J1301-6305. The broadband emission of the source

  11. Modeling the emission of the galactic very high energy {gamma}-ray sources G 1.9+0.3, G 330.2+1.0, HESS J1303-631 and PSR B1259-63/LS 2883 observed with H.E.S.S

    Energy Technology Data Exchange (ETDEWEB)

    Sushch, Iurii

    2012-10-19

    Recently, imaging atmospheric Cherenkov telescopes (IACTs) have discovered numerous new sources representing various source classes in the very high energy (VHE; E>100 GeV) sky. This work presents studies of representatives of three types of Galactic VHE emitters: the Supernova remnants (SNRs) G1.9+0.3 and G330.2+1.0, the pulsar wind nebula (PWN) HESS J1303.631 and the binary system PSR B1259.63/LS 2883. The analysis of the H.E.S.S. data and the broadband emission modeling are presented. G1.9+0.3 and G330.2+1.0 are synchrotron-dominated SNRs whose non-thermal X-ray emission implies that intensive particle acceleration occurs at their shock fronts. This makes them promising candidates for the detection at VHEs. They were observed by the High Energy Stereoscopic System (H.E.S.S.) yielding no signs of significant VHE {gamma}-ray emission from either SNR. The 99% confidence level upper limits on the TeV flux were determined. For an assumed spectral index of 2.5 the obtained upper limits are F{sub G1.9}(>260 GeV)<4.6 x 10{sup -13} cm{sup -2}s{sup -1} for G1.9+0.3 and F{sub G330}(>380 GeV)<1.6 x 10{sup -12} cm{sup -2}s{sup -1} for G330.2+1.0. Upper limits on the VHE emission provide constraints on the interior magnetic field in the context of a leptonic scenario and on the interstellar medium (ISM) density and cosmic-ray (CR) efficiency in a hadronic scenario. Lower limits on the interior magnetic fields were estimated at 15 {mu}G for G1.9+0.3 and 14 {mu}G for G330.2+1.0. In the case of the hadronic scenario, the H.E.S.S. upper limits are two orders of magnitude greater than the flux prediction. Obtained upper limits on the ISM densities are compatible with other estimates of the densities (from the thermal X-ray emission for G330.2+1.0 and from the expansion rate for G1.9+0.3). The CR efficiency cannot be constrained with the current H.E.S.S. upper limits. HESS J1303-631 is an initially unidentified H.E.S.S. source which was recently identified as a PWN associated with

  12. Positron sources

    International Nuclear Information System (INIS)

    Chehab, R.

    1994-01-01

    A tentative survey of positron sources is given. Physical processes on which positron generation is based are indicated and analyzed. Explanation of the general features of electromagnetic interactions and nuclear β + decay makes it possible to predict the yield and emittance for a given optical matching system between the positron source and the accelerator. Some kinds of matching systems commonly used - mainly working with solenoidal field - are studied and the acceptance volume calculated. Such knowledge is helpful in comparing different matching systems. Since for large machines, a significant distance exists between the positron source and the experimental facility, positron emittance has to be preserved during beam transfer over large distances and methods used for that purpose are indicated. Comparison of existing positron sources leads to extrapolation to sources for future linear colliders. Some new ideas associated with these sources are also presented. (orig.)

  13. Sources management

    International Nuclear Information System (INIS)

    Mansoux, H.; Gourmelon; Scanff, P.; Fournet, F.; Murith, Ch.; Saint-Paul, N.; Colson, P.; Jouve, A.; Feron, F.; Haranger, D.; Mathieu, P.; Paycha, F.; Israel, S.; Auboiroux, B.; Chartier, P.

    2005-01-01

    Organized by the section of technical protection of the French society of radiation protection ( S.F.R.P.), these two days had for objective to review the evolution of the rule relative to the sources of ionising radiations 'sealed and unsealed radioactive sources, electric generators'. They addressed all the actors concerned by the implementation of the new regulatory system in the different sectors of activities ( research, medicine and industry): Authorities, manufacturers, and suppliers of sources, holders and users, bodies involved in the approval of sources, carriers. (N.C.)

  14. Sourcing Excellence

    DEFF Research Database (Denmark)

    Adeyemi, Oluseyi

    2011-01-01

    Sourcing Excellence is one of the key performance indicators (KPIs) in this world of ever changing sourcing strategies. Manufacturing companies need to access and diagnose the reliability and competencies of existing suppliers in order to coordinate and develop them. This would help in managing...

  15. Positron sources

    International Nuclear Information System (INIS)

    Chehab, R.

    1989-01-01

    A tentative survey of positron sources is given. Physical processes on which positron generation is based are indicated and analyzed. Explanation of the general features of electromagnetic interactions and nuclear β + decay makes it possible to predict the yield and emittance for a given optical matching system between the positron source and the accelerator. Some kinds of matching systems commonly used - mainly working with solenoidal fields - are studied and the acceptance volume calculated. Such knowledge is helpful in comparing different matching systems. Since for large machines, a significant distance exists between the positron source and the experimental facility, positron emittance has to be preserved during beam transfer over large distances and methods used for that purpose are indicated. Comparison of existing positron sources leads to extrapolation to sources for future linear colliders

  16. Neutron source

    International Nuclear Information System (INIS)

    Cason, J.L. Jr.; Shaw, C.B.

    1975-01-01

    A neutron source which is particularly useful for neutron radiography consists of a vessel containing a moderating media of relatively low moderating ratio, a flux trap including a moderating media of relatively high moderating ratio at the center of the vessel, a shell of depleted uranium dioxide surrounding the moderating media of relatively high moderating ratio, a plurality of guide tubes each containing a movable source of neutrons surrounding the flux trap, a neutron shield surrounding one part of each guide tube, and at least one collimator extending from the flux trap to the exterior of the neutron source. The shell of depleted uranium dioxide has a window provided with depleted uranium dioxide shutters for each collimator. Reflectors are provided above and below the flux trap and on the guide tubes away from the flux trap

  17. Crowd Sourcing.

    Science.gov (United States)

    Baum, Neil

    2016-01-01

    The Internet has contributed new words and slang to our daily vernacular. A few terms, such as tweeting, texting, sexting, blogging, and googling, have become common in most vocabularies and in many languages, and are now included in the dictionary. A new buzzword making the rounds in industry is crowd sourcing, which involves outsourcing an activity, task, or problem by sending it to people or groups outside a business or a practice. Crowd sourcing allows doctors and practices to tap the wisdom of many instead of relying only on the few members of their close-knit group. This article defines "crowd sourcing," offers examples, and explains how to get started with this approach that can increase your ability to finish a task or solve problems that you don't have the time or expertise to accomplish.

  18. Energy sources

    International Nuclear Information System (INIS)

    Vajda, Gy.

    1998-01-01

    A comprehensive review is presented of the available sources of energy in the world is presented. About 80 percent of primary energy utilization is based on fossile fuels, and their dominant role is not expected to change in the foreseeable future. Data are given on petroleum, natural gas and coal based power production. The role and economic aspects of nuclear power are analyzed. A brief summary of renewable energy sources is presented. The future prospects of the world's energy resources are discussed, and the special position of Hungary regarding fossil, nuclear and renewable energy and the country's energy potential is evaluated. (R.P.)

  19. Ion source

    International Nuclear Information System (INIS)

    1977-01-01

    The specifications of a set of point-shape electrodes of non-corrodable material that can hold a film of liquid material of equal thickness is described. Contained in a jacket, this set forms an ion source. The electrode is made of tungsten with a glassy carbon layer for insulation and an outer layer of aluminium-oxide ceramic material

  20. Orphan sources

    International Nuclear Information System (INIS)

    Pust, R.; Urbancik, L.

    2008-01-01

    The presentation describes how the stable detection systems (hereinafter referred to as S DS ) have contributed to reveal the uncontrolled sources of ionizing radiation on the territory of the State Office for Nuclear Safety (SONS) Brno Regional Centre (RC Brno). It also describes the emergencies which were solved by or in which the workers from the Brno. Regional Centre participated in. The contribution is divided into the following chapters: A. SDS systems installed on the territory of SONS RC Brno; B. Selected unusual emergencies; C. Comments to individual emergencies; D. Aspects of SDS operation in term of their users; E. Aspects of SDS operation and related activities in term of radiation protection; F. Current state of orphan sources. (authors)

  1. Tritium sources

    International Nuclear Information System (INIS)

    Glodic, S.; Boreli, F.

    1993-01-01

    Tritium is the only radioactive isotope of hydrogen. It directly follows the metabolism of water and it can be bound into genetic material, so it is very important to control levels of contamination. In order to define the state of contamination it is necessary to establish 'zero level', i.e. actual global inventory. The importance of tritium contamination monitoring increases with the development of fusion power installations. Different sources of tritium are analyzed and summarized in this paper. (author)

  2. Source rock

    Directory of Open Access Journals (Sweden)

    Abubakr F. Makky

    2014-03-01

    Full Text Available West Beni Suef Concession is located at the western part of Beni Suef Basin which is a relatively under-explored basin and lies about 150 km south of Cairo. The major goal of this study is to evaluate the source rock by using different techniques as Rock-Eval pyrolysis, Vitrinite reflectance (%Ro, and well log data of some Cretaceous sequences including Abu Roash (E, F and G members, Kharita and Betty formations. The BasinMod 1D program is used in this study to construct the burial history and calculate the levels of thermal maturity of the Fayoum-1X well based on calibration of measured %Ro and Tmax against calculated %Ro model. The calculated Total Organic Carbon (TOC content from well log data compared with the measured TOC from the Rock-Eval pyrolysis in Fayoum-1X well is shown to match against the shale source rock but gives high values against the limestone source rock. For that, a new model is derived from well log data to calculate accurately the TOC content against the limestone source rock in the study area. The organic matter existing in Abu Roash (F member is fair to excellent and capable of generating a significant amount of hydrocarbons (oil prone produced from (mixed type I/II kerogen. The generation potential of kerogen in Abu Roash (E and G members and Betty formations is ranging from poor to fair, and generating hydrocarbons of oil and gas prone (mixed type II/III kerogen. Eventually, kerogen (type III of Kharita Formation has poor to very good generation potential and mainly produces gas. Thermal maturation of the measured %Ro, calculated %Ro model, Tmax and Production index (PI indicates that Abu Roash (F member exciting in the onset of oil generation, whereas Abu Roash (E and G members, Kharita and Betty formations entered the peak of oil generation.

  3. Radioactive source

    International Nuclear Information System (INIS)

    Drabkina, L.E.; Mazurek, V.; Myascedov, D.N.; Prokhorov, P.; Kachalov, V.A.; Ziv, D.M.

    1976-01-01

    A radioactive layer in a radioactive source is sealed by the application of a sealing layer on the radioactive layer. The sealing layer can consist of a film of oxide of titanium, tin, zirconium, aluminum, or chromium. Preferably, the sealing layer is pure titanium dioxide. The radioactive layer is embedded in a finish enamel which, in turn, is on a priming enamel which surrounds a substrate

  4. Muon sources

    International Nuclear Information System (INIS)

    Parsa, Z.

    2001-01-01

    A full high energy muon collider may take considerable time to realize. However, intermediate steps in its direction are possible and could help facilitate the process. Employing an intense muon source to carry out forefront low energy research, such as the search for muon-number non-conservation, represents one interesting possibility. For example, the MECO proposal at BNL aims for 2 x 10 -17 sensitivity in their search for coherent muon-electron conversion in the field of a nucleus. To reach that goal requires the production, capture and stopping of muons at an unprecedented 10 11 μ/sec. If successful, such an effort would significantly advance the state of muon technology. More ambitious ideas for utilizing high intensity muon sources are also being explored. Building a muon storage ring for the purpose of providing intense high energy neutrino beams is particularly exciting.We present an overview of muon sources and example of a muon storage ring based Neutrino Factory at BNL with various detector location possibilities

  5. The Chandra Source Catalog : Automated Source Correlation

    Science.gov (United States)

    Hain, Roger; Evans, I. N.; Evans, J. D.; Glotfelty, K. J.; Anderson, C. S.; Bonaventura, N. R.; Chen, J. C.; Davis, J. E.; Doe, S. M.; Fabbiano, G.; Galle, E.; Gibbs, D. G.; Grier, J. D.; Hall, D. M.; Harbo, P. N.; He, X.; Houck, J. C.; Karovska, M.; Lauer, J.; McCollough, M. L.; McDowell, J. C.; Miller, J. B.; Mitschang, A. W.; Morgan, D. L.; Nichols, J. S.; Nowak, M. A.; Plummer, D. A.; Primini, F. A.; Refsdal, B. L.; Rots, A. H.; Siemiginowska, A. L.; Sundheim, B. A.; Tibbetts, M. S.; Van Stone, D. W.; Winkelman, S. L.; Zografou, P.

    2009-01-01

    Chandra Source Catalog (CSC) master source pipeline processing seeks to automatically detect sources and compute their properties. Since Chandra is a pointed mission and not a sky survey, different sky regions are observed for a different number of times at varying orientations, resolutions, and other heterogeneous conditions. While this provides an opportunity to collect data from a potentially large number of observing passes, it also creates challenges in determining the best way to combine different detection results for the most accurate characterization of the detected sources. The CSC master source pipeline correlates data from multiple observations by updating existing cataloged source information with new data from the same sky region as they become available. This process sometimes leads to relatively straightforward conclusions, such as when single sources from two observations are similar in size and position. Other observation results require more logic to combine, such as one observation finding a single, large source and another identifying multiple, smaller sources at the same position. We present examples of different overlapping source detections processed in the current version of the CSC master source pipeline. We explain how they are resolved into entries in the master source database, and examine the challenges of computing source properties for the same source detected multiple times. Future enhancements are also discussed. This work is supported by NASA contract NAS8-03060 (CXC).

  6. Sources of polarized neutrons

    International Nuclear Information System (INIS)

    Walter, L.

    1983-01-01

    Various sources of polarized neutrons are reviewed. Monoenergetic source produced with unpolarized or polarized beams, white sources of polarized neutrons, production by transmissions through polarized hydrogen targets and polarized thermal neutronsare discussed, with appropriate applications included. (U.K.)

  7. Pacemakers lower sources

    International Nuclear Information System (INIS)

    Greatbatch, W.

    1984-01-01

    Energy sources for cardiac facing are considered including radioisotope sources, in a broad conceptual and historical framework.The main guidelines for future development of energy sources are assessed

  8. Sources management; La gestion des sources

    Energy Technology Data Exchange (ETDEWEB)

    Mansoux, H.; Gourmelon; Scanff, P.; Fournet, F. [Institut de Radioprotection et de Surete Nucleaire, 92 - Fontenay-aux-Roses (France); Murith, Ch. [Office Federal de la SantePublique (Switzerland); Saint-Paul, N. [NOVAR, 75 - Paris (France); Colson, P. [Electricite de France (EDF/DPN), 93 - Saint-Denis (France); Jouve, A.; Feron, F. [Direction Generale de al Surete Nucleaire et de la Radioprotection, 75 - Paris (France); Haranger, D. [Electricite de France (EDF), 75 - Paris (France); Mathieu, P. [Institut Pasteur, 75 - Paris (France); Paycha, F. [CHU Louis Mourier, Unitede Medecine Nucleaire Assistance Publique-Hopitaux de Paris, 92 - Colombes (France); Israel, S. [CEGELEC NDT et la gestion des sources radioactives (France); Auboiroux, B. [APAVE (France); Chartier, P. [DRIRE de Basse-Normandie, Div. Surete Nucleaire et Radioprotection, 14 - Caen (France)

    2005-07-01

    Organized by the section of technical protection of the French society of radiation protection ( S.F.R.P.), these two days had for objective to review the evolution of the rule relative to the sources of ionising radiations 'sealed and unsealed radioactive sources, electric generators'. They addressed all the actors concerned by the implementation of the new regulatory system in the different sectors of activities ( research, medicine and industry): Authorities, manufacturers, and suppliers of sources, holders and users, bodies involved in the approval of sources, carriers. (N.C.)

  9. EBL Inhomogeneity and Hard-Spectrum Gamma-Ray Sources

    Energy Technology Data Exchange (ETDEWEB)

    Abdalla, Hassan; Böttcher, Markus [Centre for Space Research, North-West University, Potchefstroom 2520 (South Africa)

    2017-02-01

    The unexpectedly hard very-high-energy (VHE; E > 100 GeV) γ -ray spectra of a few distant blazars have been interpreted as evidence of a reduction of the γγ opacity of the universe due to the interaction of VHE γ -rays with the extragalactic background light (EBL) compared to the expectation from current knowledge of the density and cosmological evolution of the EBL. One of the suggested solutions to this problem involves the inhomogeneity of the EBL. In this paper, we study the effects of such inhomogeneity on the energy density of the EBL (which then also becomes anisotropic) and the resulting γγ opacity. Specifically, we investigate the effects of cosmic voids along the line of sight to a distant blazar. We find that the effect of such voids on the γγ opacity, for any realistic void size, is only of the order of ≲1% and much smaller than expected from a simple linear scaling of the γγ opacity with the line-of-sight galaxy underdensity due to a cosmic void.

  10. The Chandra Source Catalog: Source Variability

    Science.gov (United States)

    Nowak, Michael; Rots, A. H.; McCollough, M. L.; Primini, F. A.; Glotfelty, K. J.; Bonaventura, N. R.; Chen, J. C.; Davis, J. E.; Doe, S. M.; Evans, J. D.; Evans, I.; Fabbiano, G.; Galle, E. C.; Gibbs, D. G., II; Grier, J. D.; Hain, R.; Hall, D. M.; Harbo, P. N.; He, X.; Houck, J. C.; Karovska, M.; Lauer, J.; McDowell, J. C.; Miller, J. B.; Mitschang, A. W.; Morgan, D. L.; Nichols, J. S.; Plummer, D. A.; Refsdal, B. L.; Siemiginowska, A. L.; Sundheim, B. A.; Tibbetts, M. S.; van Stone, D. W.; Winkelman, S. L.; Zografou, P.

    2009-09-01

    The Chandra Source Catalog (CSC) contains fields of view that have been studied with individual, uninterrupted observations that span integration times ranging from 1 ksec to 160 ksec, and a large number of which have received (multiple) repeat observations days to years later. The CSC thus offers an unprecedented look at the variability of the X-ray sky over a broad range of time scales, and across a wide diversity of variable X-ray sources: stars in the local galactic neighborhood, galactic and extragalactic X-ray binaries, Active Galactic Nuclei, etc. Here we describe the methods used to identify and quantify source variability within a single observation, and the methods used to assess the variability of a source when detected in multiple, individual observations. Three tests are used to detect source variability within a single observation: the Kolmogorov-Smirnov test and its variant, the Kuiper test, and a Bayesian approach originally suggested by Gregory and Loredo. The latter test not only provides an indicator of variability, but is also used to create a best estimate of the variable lightcurve shape. We assess the performance of these tests via simulation of statistically stationary, variable processes with arbitrary input power spectral densities (here we concentrate on results of red noise simulations) at variety of mean count rates and fractional root mean square variabilities relevant to CSC sources. We also assess the false positive rate via simulations of constant sources whose sole source of fluctuation is Poisson noise. We compare these simulations to an assessment of the variability found in real CSC sources, and estimate the variability sensitivities of the CSC.

  11. THE CHANDRA SOURCE CATALOG

    International Nuclear Information System (INIS)

    Evans, Ian N.; Primini, Francis A.; Glotfelty, Kenny J.; Anderson, Craig S.; Bonaventura, Nina R.; Chen, Judy C.; Doe, Stephen M.; Evans, Janet D.; Fabbiano, Giuseppina; Galle, Elizabeth C.; Gibbs, Danny G.; Grier, John D.; Hain, Roger M.; Harbo, Peter N.; He Xiangqun; Karovska, Margarita; Kashyap, Vinay L.; Davis, John E.; Houck, John C.; Hall, Diane M.

    2010-01-01

    The Chandra Source Catalog (CSC) is a general purpose virtual X-ray astrophysics facility that provides access to a carefully selected set of generally useful quantities for individual X-ray sources, and is designed to satisfy the needs of a broad-based group of scientists, including those who may be less familiar with astronomical data analysis in the X-ray regime. The first release of the CSC includes information about 94,676 distinct X-ray sources detected in a subset of public Advanced CCD Imaging Spectrometer imaging observations from roughly the first eight years of the Chandra mission. This release of the catalog includes point and compact sources with observed spatial extents ∼<30''. The catalog (1) provides access to the best estimates of the X-ray source properties for detected sources, with good scientific fidelity, and directly supports scientific analysis using the individual source data; (2) facilitates analysis of a wide range of statistical properties for classes of X-ray sources; and (3) provides efficient access to calibrated observational data and ancillary data products for individual X-ray sources, so that users can perform detailed further analysis using existing tools. The catalog includes real X-ray sources detected with flux estimates that are at least 3 times their estimated 1σ uncertainties in at least one energy band, while maintaining the number of spurious sources at a level of ∼<1 false source per field for a 100 ks observation. For each detected source, the CSC provides commonly tabulated quantities, including source position, extent, multi-band fluxes, hardness ratios, and variability statistics, derived from the observations in which the source is detected. In addition to these traditional catalog elements, for each X-ray source the CSC includes an extensive set of file-based data products that can be manipulated interactively, including source images, event lists, light curves, and spectra from each observation in which a

  12. The Chandra Source Catalog

    Science.gov (United States)

    Evans, Ian N.; Primini, Francis A.; Glotfelty, Kenny J.; Anderson, Craig S.; Bonaventura, Nina R.; Chen, Judy C.; Davis, John E.; Doe, Stephen M.; Evans, Janet D.; Fabbiano, Giuseppina; Galle, Elizabeth C.; Gibbs, Danny G., II; Grier, John D.; Hain, Roger M.; Hall, Diane M.; Harbo, Peter N.; He, Xiangqun Helen; Houck, John C.; Karovska, Margarita; Kashyap, Vinay L.; Lauer, Jennifer; McCollough, Michael L.; McDowell, Jonathan C.; Miller, Joseph B.; Mitschang, Arik W.; Morgan, Douglas L.; Mossman, Amy E.; Nichols, Joy S.; Nowak, Michael A.; Plummer, David A.; Refsdal, Brian L.; Rots, Arnold H.; Siemiginowska, Aneta; Sundheim, Beth A.; Tibbetts, Michael S.; Van Stone, David W.; Winkelman, Sherry L.; Zografou, Panagoula

    2010-07-01

    The Chandra Source Catalog (CSC) is a general purpose virtual X-ray astrophysics facility that provides access to a carefully selected set of generally useful quantities for individual X-ray sources, and is designed to satisfy the needs of a broad-based group of scientists, including those who may be less familiar with astronomical data analysis in the X-ray regime. The first release of the CSC includes information about 94,676 distinct X-ray sources detected in a subset of public Advanced CCD Imaging Spectrometer imaging observations from roughly the first eight years of the Chandra mission. This release of the catalog includes point and compact sources with observed spatial extents lsim30''. The catalog (1) provides access to the best estimates of the X-ray source properties for detected sources, with good scientific fidelity, and directly supports scientific analysis using the individual source data; (2) facilitates analysis of a wide range of statistical properties for classes of X-ray sources; and (3) provides efficient access to calibrated observational data and ancillary data products for individual X-ray sources, so that users can perform detailed further analysis using existing tools. The catalog includes real X-ray sources detected with flux estimates that are at least 3 times their estimated 1σ uncertainties in at least one energy band, while maintaining the number of spurious sources at a level of lsim1 false source per field for a 100 ks observation. For each detected source, the CSC provides commonly tabulated quantities, including source position, extent, multi-band fluxes, hardness ratios, and variability statistics, derived from the observations in which the source is detected. In addition to these traditional catalog elements, for each X-ray source the CSC includes an extensive set of file-based data products that can be manipulated interactively, including source images, event lists, light curves, and spectra from each observation in which a

  13. 2011 NATA - Emissions Sources

    Data.gov (United States)

    U.S. Environmental Protection Agency — This dataset includes all emissions sources that were modeled in the 2011 National Air Toxics Assessment (NATA), inlcluding point, nonpoint, and mobile sources, and...

  14. Biogenic Emission Sources

    Science.gov (United States)

    Biogenic emissions sources come from natural sources and need to accounted for in photochemical grid models. They are computed using a model which utilizes spatial information on vegetation and land use.

  15. Spallation Neutron Source (SNS)

    Data.gov (United States)

    Federal Laboratory Consortium — The SNS at Oak Ridge National Laboratory is a next-generation spallation neutron source for neutron scattering that is currently the most powerful neutron source in...

  16. EPA's Radioactive Source Program

    International Nuclear Information System (INIS)

    Kopsick, D.

    2004-01-01

    The US EPA is the lead Federal agency for emergency responses to unknown radiological materials, not licensed, owned or operated by a Federal agency or an Agreement state (Federal Radiological Emergency Response Plan, 1996). The purpose of EPA's clean materials programme is to keep unwanted and unregulated radioactive material out of the public domain. This is achieved by finding and securing lost sources, maintaining control of existing sources and preventing future losses. The focus is on both, domestic and international fronts. The domestic program concentrates on securing lost sources, preventing future losses, alternative technologies like tagging of radioactive sources in commerce, pilot radioactive source roundup, training programs, scrap metal and metal processing facilities, the demolition industry, product stewardship and alternatives to radioactive devices (fewer radioactive source devices means fewer orphan sources). The international program consists of securing lost sources, preventing future losses, radiation monitoring of scrap metal at ports and the international scrap metal monitoring protocol

  17. Dioxin emissions and sources

    International Nuclear Information System (INIS)

    1994-01-01

    The papers presented at the seminar discussed dioxin emissions and sources, dioxin pollution of soils, waste water and sewage sludge, stocktaking of emission sources, and exposure and risk analyses for dioxin and other pollutants. (EF) [de

  18. Sealed radioactive source management

    International Nuclear Information System (INIS)

    2005-01-01

    Sealed radioactive sources have been used in a wide range of application in medicine, agriculture, geology, industry and other fields. Since its utilization many sources have become out of use and became waste but no proper management. This has lead to many accidents causing deaths and serious radiation injuries worldwide. Spent sources application is expanding but their management has seen little improvements. Sealed radioactive sources have become a security risk calling for prompt action. Source management helps to maintain sources in a good physical status and provide means of source tracking and control. It also provides a well documented process of the sources making any future management options safe, secure and cost effective. Last but not least good source management substantially reduces the risk of accidents and eliminates the risk of malicious use. The International Atomic Energy Agency assists Member States to build the infrastructure to properly manage sealed radioactive sources. The assistance includes training of national experts to handle, condition and properly store the sources. For Member States that do not have proper facilities, we provide the technical assistance to design a proper facility to properly manage the radioactive sources and provide for their proper storage. For Member States that need to condition their sources properly but don't have the required infrastructure we provide direct assistance to physically help them with source recovery and provide an international expert team to properly condition their sources and render them safe and secure. We offer software (Radioactive Waste Management Registry) to properly keep a complete record on the sources and provide for efficient tracking. This also helps with proper planning and decision making for long term management

  19. Digital intelligence sources transporter

    International Nuclear Information System (INIS)

    Zhang Zhen; Wang Renbo

    2011-01-01

    It presents from the collection of particle-ray counting, infrared data communication, real-time monitoring and alarming, GPRS and other issues start to realize the digital management of radioactive sources, complete the real-time monitoring of all aspects, include the storing of radioactive sources, transporting and using, framing intelligent radioactive sources transporter, as a result, achieving reliable security supervision of radioactive sources. (authors)

  20. Spallation neutron sources

    International Nuclear Information System (INIS)

    Fraser, J.S.; Bartholomew, G.A.

    1983-01-01

    The principles and theory of spallation neutron sources are outlined and a comparison is given with other types of neutron source. A summary of the available accelerator types for spallation neutron sources and their advantages and disadvantages is presented. Suitable target materials are discussed for specific applications, and typical target assemblies shown. (U.K.)

  1. Global Sourcing of Services

    DEFF Research Database (Denmark)

    Ørberg Jensen, Peter D.; Petersen, Bent

    2013-01-01

    The global sourcing of services offers high returns but is also associated with high risks. The extent to which firms engage in ‘transformational’ global sourcing (i.e., global sourcing implying considerable changes in the home organization) chiefly depends on management's comfort zone which...

  2. Sources of pulsed radiation

    International Nuclear Information System (INIS)

    Sauer, M.C. Jr.

    1981-01-01

    Characteristics of various sources of pulsed radiation are examined from the viewpoint of their importance to the radiation chemist, and some examples of uses of such sources are mentioned. A summary is given of the application of methods of physical dosimetry to pulsed sources, and the calibration of convenient chemical dosimeters by physical dosimetry is outlined. 7 figures, 1 table

  3. Investigating Primary Source Literacy

    Science.gov (United States)

    Archer, Joanne; Hanlon, Ann M.; Levine, Jennie A.

    2009-01-01

    Primary source research requires students to acquire specialized research skills. This paper presents results from a user study testing the effectiveness of a Web guide designed to convey the concepts behind "primary source literacy". The study also evaluated students' strengths and weaknesses when conducting primary source research. (Contains 3…

  4. Open Source Business Solutions

    Directory of Open Access Journals (Sweden)

    Ion IVAN

    2008-01-01

    Full Text Available This analyses the Open source movement. Open source development process and management is seen different from the classical point of view. This focuses on characteristics and software market tendencies for the main Open source initiatives. It also points out the labor market future evolution for the software developers.

  5. Argonne inverted sputter source

    International Nuclear Information System (INIS)

    Yntema, J.L.; Billquist, P.J.

    1983-01-01

    The emittance of the inverted sputter source with immersion lenses was measured to be about 5π mm mrad MeV/sup 1/2/ at the 75% level over a wide range of beam intensities. The use of the source in experiments with radioactive sputter targets and hydrogen loaded targets is described. Self contamination of the source is discussed

  6. A method to measure the γ-ray content in VHE cosmic ray showers

    International Nuclear Information System (INIS)

    Cresti, M.; Peruzzo, L.; Pesci, A.; Saggion, A.; Sartori, G.; Angelini, F.; Bedeschi, F.; Bellazzini, R.; Bertolucci, E.; Chiarelli, G.; Mariotti, M.; Massai, M.M.; Menzione, A.; Smith, D.A.; Stefanini, A.; Zetti, F.; Scribano, A.; Bartoli, B.; Budinich, M.; Liello, F.; Milotti, E.; Biral, A.R.P.; Chinellato, J.A.; Turtelli, A.; Luksys, M.

    1991-01-01

    An experimental technique is presented to determine the effectiveness of methods to tag photon initiated air showers and reject hadron initiated ones. The technique is based on the rate reduction in the Moon direction. With a photon energy threshold below or equal to 1 TeV, with an angular resolution of a few mrad and being insensitive to visible light, the proposed CLUE detector allows a wide and original physics program. In particular the direct measurement of the fraction of primary photons in the continuum of the cosmic ray flux is feasible with adequate statistics in a few months of data taking. (orig.)

  7. Source splitting via the point source method

    International Nuclear Information System (INIS)

    Potthast, Roland; Fazi, Filippo M; Nelson, Philip A

    2010-01-01

    We introduce a new algorithm for source identification and field splitting based on the point source method (Potthast 1998 A point-source method for inverse acoustic and electromagnetic obstacle scattering problems IMA J. Appl. Math. 61 119–40, Potthast R 1996 A fast new method to solve inverse scattering problems Inverse Problems 12 731–42). The task is to separate the sound fields u j , j = 1, ..., n of n element of N sound sources supported in different bounded domains G 1 , ..., G n in R 3 from measurements of the field on some microphone array—mathematically speaking from the knowledge of the sum of the fields u = u 1 + ... + u n on some open subset Λ of a plane. The main idea of the scheme is to calculate filter functions g 1 ,…, g n , n element of N, to construct u l for l = 1, ..., n from u| Λ in the form u l (x) = ∫ Λ g l,x (y)u(y)ds(y), l=1,... n. (1) We will provide the complete mathematical theory for the field splitting via the point source method. In particular, we describe uniqueness, solvability of the problem and convergence and stability of the algorithm. In the second part we describe the practical realization of the splitting for real data measurements carried out at the Institute for Sound and Vibration Research at Southampton, UK. A practical demonstration of the original recording and the splitting results for real data is available online

  8. Thermal neutron source study

    International Nuclear Information System (INIS)

    Holden, T.M.

    1983-05-01

    The value of intense neutron beams for condensed matter research is discussed with emphasis on the complementary nature of steady state and pulsed neutron sources. A large body of information on neutron sources, both existing and planned, is then summarized under four major headings: fission reactors, electron accelerators with heavy metal targets, pulsed spallation sources and 'steady state' spallation sources. Although the cost of a spallation source is expected to exceed that of a fission reactor of the same flux by a factor of two, there are significant advantages for a spallation device such as the proposed Electronuclear Materials Test Facility (EMTF)

  9. Spallation neutrons pulsed sources

    International Nuclear Information System (INIS)

    Carpenter, J.

    1996-01-01

    This article describes the range of scientific applications which can use these pulsed neutrons sources: Studies on super fluids, measures to verify the crawling model for the polymers diffusion; these sources are also useful to study the neutron disintegration, the ultra cold neutrons. In certain applications which were not accessible by neutrons diffusion, for example, radiations damages, radionuclides production and activation analysis, the spallation sources find their use and their improvement will bring new possibilities. Among others contributions, one must notice the place at disposal of pulsed muons sources and neutrinos sources. (N.C.). 3 figs

  10. Compact microwave ion source

    International Nuclear Information System (INIS)

    Leung, K.N.; Walther, S.; Owren, H.W.

    1985-05-01

    A small microwave ion source has been fabricated from a quartz tube with one end enclosed by a two grid accelerator. The source is also enclosed by a cavity operated at a frequency of 2.45 GHz. Microwave power as high as 500 W can be coupled to the source plasma. The source has been operated with and without multicusp fields for different gases. In the case of hydrogen, ion current density of 200 mA/cm -2 with atomic ion species concentration as high as 80% has been extracted from the source

  11. Sources for charged particles

    International Nuclear Information System (INIS)

    Arianer, J.

    1997-01-01

    This document is a basic course on charged particle sources for post-graduate students and thematic schools on large facilities and accelerator physics. A simple but precise description of the creation and the emission of charged particles is presented. This course relies on every year upgraded reference documents. Following relevant topics are considered: electronic emission processes, technological and practical considerations on electron guns, positron sources, production of neutral atoms, ionization, plasma and discharge, different types of positive and negative ion sources, polarized particle sources, materials for the construction of ion sources, low energy beam production and transport. (N.T.)

  12. Polarized source upgrading

    International Nuclear Information System (INIS)

    Clegg, T.B.; Rummel, R.L.; Carter, E.P.; Westerfeldt, C.R.; Lovette, A.W.; Edwards, S.E.

    1985-01-01

    The decision was made this past year to move the Lamb-shift polarized ion source which was first installed in the laboratory in 1970. The motivation was the need to improve the flexibility of spin-axis orientation by installing the ion source with a new Wien-filter spin precessor which is capable of rotating physically about the beam axis. The move of the polarized source was accomplished in approximately two months, with the accelerator being turned off for experiments during approximately four weeks of this time. The occasion of the move provided the opportunity to rewire completely the entire polarized ion source frame and to rebuild approximately half of the electronic chassis on the source. The result is an ion source which is now logically wired and carefully documented. Beams obtained from the source are much more stable than those previously available

  13. Polarized electron sources

    International Nuclear Information System (INIS)

    Clendenin, J.E.

    1995-05-01

    Polarized electron sources for high energy accelerators took a significant step forward with the introduction of a new laser-driven photocathode source for the SLC in 1992. With an electron beam polarization of >80% and with ∼99% uptime during continuous operation, this source is a key factor in the success of the current SLC high-energy physics program. The SLC source performance is used to illustrate both the capabilities and the limitations of solid-state sources. The beam requirements for future colliders are similar to that of the SLC with the addition in most cases of multiple-bunch operation. A design for the next generation accelerator source that can improve the operational characteristics and at least minimize some of the inherent limitations of present sources is presented. Finally, the possibilities for producing highly polarized electron beams for high-duty-factor accelerators are discussed

  14. Wavelength sweepable laser source

    DEFF Research Database (Denmark)

    2014-01-01

    Wavelength sweepable laser source is disclosed, wherein the laser source is a semiconductor laser source adapted for generating laser light at a lasing wavelength. The laser source comprises a substrate, a first reflector, and a second reflector. The first and second reflector together defines...... and having a rest position, the second reflector and suspension together defining a microelectromechanical MEMS oscillator. The MEMS oscillator has a resonance frequency and is adapted for oscillating the second reflector on either side of the rest position.; The laser source further comprises electrical...... connections adapted for applying an electric field to the MEMS oscillator. Furthermore, a laser source system and a method of use of the laser source are disclosed....

  15. Orphan sources in Slovenia

    International Nuclear Information System (INIS)

    Janzekovic, H.; Cesarek, J.

    2005-01-01

    For decades the international standards and requirements postulate severe control over all lifecycle phases of radioactive sources in order to prevent risks associated with exposure of people and the environment. Despite this fact the orphan sources became a serious problem as a consequence of enlargement of economic transactions in many countries in Europe as well as in the world. The countries as well as international organisations, aware of this emerging problem, are trying to gain control over orphan sources using different approaches. These approaches include control over sources before they could become orphan sources. In addition, countries are also developing action plans in case that an orphan source could be found. The problems related to orphan sources in Slovenia is discussed based on the case studies from the last years. While in the nineties of the last century just a few cases of orphan sources were identified their number has increased substantially since 2003. The paper discusses the general reasons for the phenomena of orphan sources as well as the experience related to regaining control over orphan sources. (author)

  16. Point Pollution Sources Dimensioning

    Directory of Open Access Journals (Sweden)

    Georgeta CUCULEANU

    2011-06-01

    Full Text Available In this paper a method for determining the main physical characteristics of the point pollution sources is presented. It can be used to find the main physical characteristics of them. The main physical characteristics of these sources are top inside source diameter and physical height. The top inside source diameter is calculated from gas flow-rate. For reckoning the physical height of the source one takes into account the relation given by the proportionality factor, defined as ratio between the plume rise and physical height of the source. The plume rise depends on the gas exit velocity and gas temperature. That relation is necessary for diminishing the environmental pollution when the production capacity of the plant varies, in comparison with the nominal one.

  17. Specification of brachytherapy sources

    Energy Technology Data Exchange (ETDEWEB)

    1984-10-01

    BCRU recommends that the following specification of gamma-ray brachytherapy sources be adopted. Unless otherwise stated, the output of a cylindrical source should be specified in air kerma rate at a point in free space at a distance of 1 m from the source on the radial plane of symmetry, i.e. the plane bisecting the active length and perpendicular to the cylindrical axis of the source. For a wire source the output should be specified for a 1 cm length. For any other construction of source, the point at which the output is specified should be stated. It is also recommended that the units in which the air kerma rate is expressed should be micrograys per hour (..mu..Gy/h).

  18. Global Sourcing Flexibility

    DEFF Research Database (Denmark)

    Ørberg Jensen, Peter D.; Petersen, Bent

    2013-01-01

    the higher costs (but decreased risk for value chain disruption) embedded in a more flexible global sourcing model that allows the firm to replicate and/or relocate activities across multiple locations. We develop a model and propositions on facilitating and constraining conditions of global sourcing...... sourcing flexibility. Here we draw on prior research in the fields of organizational flexibility, international business and global sourcing as well as case examples and secondary studies. In the second part of the paper, we discuss the implications of global sourcing flexibility for firm strategy...... and operations against the backdrop of the theory-based definition of the construct. We discuss in particular the importance of global sourcing flexibility for operational performance stability, and the trade-off between specialization benefits, emerging from location and service provider specialization, versus...

  19. Rf power sources

    International Nuclear Information System (INIS)

    Allen, M.A.

    1988-05-01

    This paper covers RF power sources for accelerator applications. The approach has been with particular customers in mind. These customers are high energy physicists who use accelerators as experimental tools in the study of the nucleus of the atom, and synchrotron light sources derived from electron or positron storage rings. This paper is confined to electron-positron linear accelerators since the RF sources have always defined what is possible to achieve with these accelerators. 11 refs., 13 figs

  20. Pulsed spallation Neutron Sources

    International Nuclear Information System (INIS)

    Carpenter, J.M.

    1994-01-01

    This paper reviews the early history of pulsed spallation neutron source development at Argonne and provides an overview of existing sources world wide. A number of proposals for machines more powerful than currently exist are under development, which are briefly described. The author reviews the status of the Intense Pulsed Neutron Source, its instrumentation, and its user program, and provides a few examples of applications in fundamental condensed matter physics, materials science and technology

  1. Pulsed spallation neutron sources

    International Nuclear Information System (INIS)

    Carpenter, J.M.

    1996-01-01

    This paper reviews the early history of pulsed spallation neutron source development ar Argonne and provides an overview of existing sources world wide. A number of proposals for machines more powerful than currently exist are under development, which are briefly described. The author reviews the status of the Intense Pulsed Neutron Source, its instrumentation, and its user program, and provide a few examples of applications in fundamental condensed matter physics, materials science and technology

  2. Reference Sources in Chemistry

    OpenAIRE

    Sthapit, Dilip Man

    1995-01-01

    Information plays an important role in the development of every field. Therefore a brief knowledge regarding information sources is necessary to function in any field. There are many information sources about scientific and technical subjects. In this context there are many reference sources in Chemistry too. Chemistry is one important part of the science which deals with the study of the composition of substances and the chemical changes that they undergo. The purpose of this report is...

  3. Open-Source Colorimeter

    OpenAIRE

    Anzalone, Gerald C.; Glover, Alexandra G.; Pearce, Joshua M.

    2013-01-01

    The high cost of what have historically been sophisticated research-related sensors and tools has limited their adoption to a relatively small group of well-funded researchers. This paper provides a methodology for applying an open-source approach to design and development of a colorimeter. A 3-D printable, open-source colorimeter utilizing only open-source hardware and software solutions and readily available discrete components is discussed and its performance compared to a commercial porta...

  4. Source and replica calculations

    International Nuclear Information System (INIS)

    Whalen, P.P.

    1994-01-01

    The starting point of the Hiroshima-Nagasaki Dose Reevaluation Program is the energy and directional distributions of the prompt neutron and gamma-ray radiation emitted from the exploding bombs. A brief introduction to the neutron source calculations is presented. The development of our current understanding of the source problem is outlined. It is recommended that adjoint calculations be used to modify source spectra to resolve the neutron discrepancy problem

  5. Properties of neutron sources

    International Nuclear Information System (INIS)

    1987-03-01

    The Conference presentations were divided into sessions devoted to the following topics: white neutron sources, primarily pulsed (6 papers); fast neutron fields (5 papers); Californium-252 prompt fission neutron spectra (14 papers); monoenergetic sources and filtered beams (11 papers); 14 MeV neutron sources (10 papers); selected special application (one paper); and a general interest session (4 papers). Individual abstracts were prepared separately for the papers

  6. Emission sources and quantities

    International Nuclear Information System (INIS)

    Heinen, B.

    1991-01-01

    The paper examines emission sources and quantities for SO 2 and NO x . Natural SO 2 is released from volcanic sources and to a much lower extent from marsh gases. In nature NO x is mainly produced in the course of the chemical and bacterial denitrification processes going on in the soil. Manmade pollutants are produced in combustion processes. The paper concentrates on manmade pollution. Aspects discussed include: mechanism of pollution development; manmade emission sources (e.g. industry, traffic, power plants and domestic sources); and emission quantities and forecasts. 11 refs., 2 figs., 5 tabs

  7. Advanced Photon Source (APS)

    Data.gov (United States)

    Federal Laboratory Consortium — The Advanced Photon Source (APS) at the U.S. Department of Energy's Argonne National Laboratoryprovides this nation's (in fact, this hemisphere's) brightest storage...

  8. Source SDK development essentials

    CERN Document Server

    Bernier, Brett

    2014-01-01

    The Source Authoring Tools are the pieces of software used to create custom content for games made with Valve's Source engine. Creating mods and maps for your games without any programming knowledge can be time consuming. These tools allow you to create your own maps and levels without the need for any coding knowledge. All the tools that you need to start creating your own levels are built-in and ready to go! This book will teach you how to use the Authoring Tools provided with Source games and will guide you in creating your first maps and mods (modifications) using Source. You will learn ho

  9. Source Reference File

    Data.gov (United States)

    Social Security Administration — This file contains a national set of names and contact information for doctors, hospitals, clinics, and other facilities (known collectively as sources) from which...

  10. High current ion sources

    International Nuclear Information System (INIS)

    Brown, I.G.

    1989-06-01

    The concept of high current ion source is both relative and evolutionary. Within the domain of one particular kind of ion source technology a current of microamperers might be 'high', while in another area a current of 10 Amperes could 'low'. Even within the domain of a single ion source type, what is considered high current performance today is routinely eclipsed by better performance and higher current output within a short period of time. Within their fields of application, there is a large number of kinds of ion sources that can justifiably be called high current. Thus, as a very limited example only, PIGs, Freemen sources, ECR sources, duoplasmatrons, field emission sources, and a great many more all have their high current variants. High current ion beams of gaseous and metallic species can be generated in a number of different ways. Ion sources of the kind developed at various laboratories around the world for the production of intense neutral beams for controlled fusion experiments are used to form large area proton deuteron beams of may tens of Amperes, and this technology can be used for other applications also. There has been significant progress in recent years in the use of microwave ion sources for high current ion beam generation, and this method is likely to find wide application in various different field application. Finally, high current beams of metal ions can be produced using metal vapor vacuum arc ion source technology. After a brief consideration of high current ion source design concepts, these three particular methods are reviewed in this paper

  11. Open source community organization

    CSIR Research Space (South Africa)

    Molefe, Onkgopotse M

    2009-05-01

    Full Text Available Open Source communities (OSCs), sometimes referred to as virtual or online communities play a significant role in terms of the contribution they continue to make in producing user-friendly Open Source Software (OSS) solutions. Many projects have...

  12. Radiation Source Replacement Workshop

    Energy Technology Data Exchange (ETDEWEB)

    Griffin, Jeffrey W.; Moran, Traci L.; Bond, Leonard J.

    2010-12-01

    This report summarizes a Radiation Source Replacement Workshop in Houston Texas on October 27-28, 2010, which provided a forum for industry and researchers to exchange information and to discuss the issues relating to replacement of AmBe, and potentially other isotope sources used in well logging.

  13. Sources of Financial Sociability

    DEFF Research Database (Denmark)

    Thompson, Grahame

    2011-01-01

    This article investigates the sources of sociability in modern financial systems as a prelude to assessing the prospects for financial regulation. Three sources are identified: sociality dependent upon contract, upon relational interdependency, and upon the operation of will and passion. Each of ...

  14. Nontraditional renewable energy sources

    International Nuclear Information System (INIS)

    Shpil'rajn, Eh.Eh.

    1997-01-01

    The paper considers the application possibilities of nontraditional renewable energy sources to generate electricity, estimates the potential of nontraditional sources using energy of Sun, wind, biomass, as well as, geothermal energy and presents the results of economical analysis of cost of electricity generated by solar electrical power plants, geothermal and electrical plants and facilities for power reprocessing of biomass. 1 tab

  15. Sources of atmospheric acidity

    International Nuclear Information System (INIS)

    Clarke, A.G.

    1992-01-01

    The emissions of acid gases from anthropogenic sources and their impact on the environment are the main concern of this book. However, that impact can only be assessed if all the naturally occurring sources of these gases are also known and can be quantified. Given the widely dispersed nature of the natural sources and the problems of measurement of trace species at low concentrations, often in remote regions, the quantification is a very difficult task. Nevertheless, considerable progress has been made over the last decade. In this chapter both man-made and natural sources of atmospheric acidity will be reviewed, but the emphasis will be placed not so much on the global balances as on the scale of the natural sources in relation to the man-made sources. This requires that the very uneven geographical distribution of emissions and the lifetime of individual chemical species be taken into account. The emissions considered are sulphur compounds, nitrogen compounds, chlorine compounds and organic acids. The anthropogenic sources discussed are the combustion of fossil fuels and certain industrial processes. Emissions data for anthropogenic sources are given for the United Kingdom, Europe, USA and globally. A list of 95 references is given. (Author)

  16. Radioisotopic heat source

    Science.gov (United States)

    Jones, G.J.; Selle, J.E.; Teaney, P.E.

    1975-09-30

    Disclosed is a radioisotopic heat source and method for a long life electrical generator. The source includes plutonium dioxide shards and yttrium or hafnium in a container of tantalum-tungsten-hafnium alloy, all being in a nickel alloy outer container, and subjected to heat treatment of from about 1570$sup 0$F to about 1720$sup 0$F for about one h. (auth)

  17. Ion sources for accelerators

    International Nuclear Information System (INIS)

    Alton, G.D.

    1974-01-01

    A limited review of low charge sate positive and negative ion sources suitable for accelerator use is given. A brief discussion is also given of the concepts underlying the formation and extraction of ion beams. Particular emphasis is placed on the technology of ion sources which use solid elemental or molecular compounds to produce vapor for the ionization process

  18. Using Primary Source Documents.

    Science.gov (United States)

    Mintz, Steven

    2003-01-01

    Explores the use of primary sources when teaching about U.S. slavery. Includes primary sources from the Gilder Lehrman Documents Collection (New York Historical Society) to teach about the role of slaves in the Revolutionary War, such as a proclamation from Lord Dunmore offering freedom to slaves who joined his army. (CMK)

  19. PORTABLE SOURCE OF RADIOACTIVITY

    Science.gov (United States)

    Goertz, R.C.; Ferguson, K.R.; Rylander, E.W.; Safranski, L.M.

    1959-06-16

    A portable source for radiogiaphy or radiotherapy is described. It consists of a Tl/sup 170/ or Co/sup 60/ source mounted in a rotatable tungsten alloy plug. The plug rotates within a brass body to positions of safety or exposure. Provision is made for reloading and carrying the device safely. (T.R.H.)

  20. Radioactive Sources Service

    CERN Document Server

    2007-01-01

    Please note that the radioactive sources service will be open by appointment only every Monday, Wednesday and Friday during CERN working hours (instead of alternate weeks). In addition, please note that our 2007 schedule is available on our web site: http://cern.ch/service-rp-sources

  1. H- source developments

    International Nuclear Information System (INIS)

    Allison, P.W.

    1978-01-01

    The design and operation of a Penning discharge, cold cathode, surface plasma H - ion source are described. A high current density, about 2 A/cm 2 , is extracted from the source by putting about 20 keV across the 2 to 2 1 / 2 mm gap

  2. Variability in GPS sources

    NARCIS (Netherlands)

    Jauncey, DL; King, EA; Bignall, HE; Lovell, JEJ; Kedziora-Chudczer, L; Tzioumis, AK; Tingay, SJ; Macquart, JP; McCulloch, PM

    2003-01-01

    Flux density monitoring data at 2.3 and 8.4 GHz is presented for a sample of 33 southern hemisphere GPS sources, drawn from the 2.7 GHz Parkes survey. This monitoring data, together with VLBI monitoring data, shows that a small fraction of these sources, similar to10%, vary. Their variability falls

  3. Creating Open Source Conversation

    Science.gov (United States)

    Sheehan, Kate

    2009-01-01

    Darien Library, where the author serves as head of knowledge and learning services, launched a new website on September 1, 2008. The website is built with Drupal, an open source content management system (CMS). In this article, the author describes how she and her colleagues overhauled the library's website to provide an open source content…

  4. Sealed radioactive sources toolkit

    International Nuclear Information System (INIS)

    Mac Kenzie, C.

    2005-09-01

    The IAEA has developed a Sealed Radioactive Sources Toolkit to provide information to key groups about the safety and security of sealed radioactive sources. The key groups addressed are officials in government agencies, medical users, industrial users and the scrap metal industry. The general public may also benefit from an understanding of the fundamentals of radiation safety

  5. Calorimeter for thermal sources

    International Nuclear Information System (INIS)

    Shai, I.; Shaham, Ch.; Barnea, I.

    1978-12-01

    A calorimeter was built, enabling the thermal power of radioactive sources to be measured in the range of 50 to 120 mW. The system was calibrated with an electrical heater. The calibration curves serve to determine the power of radioactive sources with a reasonable accuracy

  6. Gravitation and source theory

    International Nuclear Information System (INIS)

    Yilmaz, H.

    1975-01-01

    Schwinger's source theory is applied to the problem of gravitation and its quantization. It is shown that within the framework of a flat-space the source theory implementation leads to a violation of probability. To avoid the difficulty one must introduce a curved space-time hence the source concept may be said to necessitate the transition to a curved-space theory of gravitation. It is further shown that the curved-space theory of gravitation implied by the source theory is not equivalent to the conventional Einstein theory. The source concept leads to a different theory where the gravitational field has a stress-energy tensor t/sup nu//sub mu/ which contributes to geometric curvatures

  7. Photonic crystal light source

    Science.gov (United States)

    Fleming, James G [Albuquerque, NM; Lin, Shawn-Yu [Albuquerque, NM; Bur, James A [Corrales, NM

    2004-07-27

    A light source is provided by a photonic crystal having an enhanced photonic density-of-states over a band of frequencies and wherein at least one of the dielectric materials of the photonic crystal has a complex dielectric constant, thereby producing enhanced light emission at the band of frequencies when the photonic crystal is heated. The dielectric material can be a metal, such as tungsten. The spectral properties of the light source can be easily tuned by modification of the photonic crystal structure and materials. The photonic crystal light source can be heated electrically or other heating means. The light source can further include additional photonic crystals that exhibit enhanced light emission at a different band of frequencies to provide for color mixing. The photonic crystal light source may have applications in optical telecommunications, information displays, energy conversion, sensors, and other optical applications.

  8. Belgrade waterworks groundwater source

    International Nuclear Information System (INIS)

    Sotic, A.; Dasic, M.; Vukcevic, G.; Vasiljevic, Lj.; Nikolic, S.

    2002-01-01

    Paper deals with Belgrade Waterworks groundwater source, its characteristics, conception of protection programme, contaminations on source and with parameters of groundwater quality degradation. Groundwaters present natural heritage with their strategic and slow renewable natural resources attributes, and as such they require priority in protection. It is of greatest need that existing source is to be protected and used optimally for producing quality drinkable water. The concept of source protection programme should be based on regular water quality monitoring, identification of contaminators, defining areas of their influences on the source and their permanent control. However, in the last 10 years, but drastically in the last 3, because of the overall situation in the country, it is very characteristic downfall in volume of business, organisation and the level of supply of the technical equipment

  9. Neutron sources and applications

    Energy Technology Data Exchange (ETDEWEB)

    Price, D.L. [ed.] [Argonne National Lab., IL (United States); Rush, J.J. [ed.] [National Inst. of Standards and Technology, Gaithersburg, MD (United States)

    1994-01-01

    Review of Neutron Sources and Applications was held at Oak Brook, Illinois, during September 8--10, 1992. This review involved some 70 national and international experts in different areas of neutron research, sources, and applications. Separate working groups were asked to (1) review the current status of advanced research reactors and spallation sources; and (2) provide an update on scientific, technological, and medical applications, including neutron scattering research in a number of disciplines, isotope production, materials irradiation, and other important uses of neutron sources such as materials analysis and fundamental neutron physics. This report summarizes the findings and conclusions of the different working groups involved in the review, and contains some of the best current expertise on neutron sources and applications.

  10. Categorization of radiation sources

    International Nuclear Information System (INIS)

    2000-12-01

    The objective of this report is to develop a categorization scheme for radiation sources that could be relevant to decisions both in a retrospective application to bring sources under control and in a prospective sense to guide the application of the regulatory infrastructure. The Action Plan envisages that the preparation of guidance on national strategies and programmes for the detection and location of orphan sources and their subsequent management should commence after the categorization of sources has been carried out. In the prospective application of the system of notification, registration, and licensing, the categorization is relevant to prioritize a regulatory authority's resources and training activities; to guide the degree of detail necessary for a safety assessment; and to serve as a measure of the intensity of effort which a regulatory authority should apply to the safety and security of a particular type of source

  11. Neutron sources and applications

    International Nuclear Information System (INIS)

    Price, D.L.; Rush, J.J.

    1994-01-01

    Review of Neutron Sources and Applications was held at Oak Brook, Illinois, during September 8--10, 1992. This review involved some 70 national and international experts in different areas of neutron research, sources, and applications. Separate working groups were asked to (1) review the current status of advanced research reactors and spallation sources; and (2) provide an update on scientific, technological, and medical applications, including neutron scattering research in a number of disciplines, isotope production, materials irradiation, and other important uses of neutron sources such as materials analysis and fundamental neutron physics. This report summarizes the findings and conclusions of the different working groups involved in the review, and contains some of the best current expertise on neutron sources and applications

  12. Cesium glass irradiation sources

    International Nuclear Information System (INIS)

    Plodinec, M.J.

    1982-01-01

    The precipitation process for the decontamination of soluble SRP wastes produces a material whose radioactivity is dominated by 137 Cs. Potentially, this material could be vitrified to produce irradiation sources similar to the Hanford CsCl sources. In this report, process steps necessary for the production of cesium glass irradiation sources (CGS), and the nature of the sources produced, are examined. Three options are considered in detail: direct vitrification of precipitation process waste; direct vitrification of this waste after organic destruction; and vitrification of cesium separated from the precipitation process waste. Direct vitrification is compatible with DWPF equipment, but process rates may be limited by high levels of combustible materials in the off-gas. Organic destruction would allow more rapid processing. In both cases, the source produced has a dose rate of 2 x 10 4 rads/hr at the surface. Cesium separation produces a source with a dose rate of 4 x 10 5 at the surface, which is nearer that of the Hanford sources (2 x 10 6 rads/hr). Additional processing steps would be required, as well as R and D to demonstrate that DWPF equipment is compatible with this intensely radioactive material

  13. Negative ion sources

    International Nuclear Information System (INIS)

    Ishikawa, Junzo; Takagi, Toshinori

    1983-01-01

    Negative ion sources have been originally developed at the request of tandem electrostatic accelerators, and hundreds of nA to several μA negative ion current has been obtained so far for various elements. Recently, the development of large current hydrogen negative ion sources has been demanded from the standpoint of the heating by neutral particle beam injection in nuclear fusion reactors. On the other hand, the physical properties of negative ions are interesting in the thin film formation using ions. Anyway, it is the present status that the mechanism of negative ion action has not been so fully investigated as positive ions because the history of negative ion sources is short. In this report, the many mechanisms about the generation of negative ions proposed so far are described about negative ion generating mechanism, negative ion source plasma, and negative ion generation on metal surfaces. As a result, negative ion sources are roughly divided into two schemes, plasma extraction and secondary ion extraction, and the former is further classified into the PIG ion source and its variation and Duoplasmatron and its variation; while the latter into reflecting and sputtering types. In the second half of the report, the practical negative ion sources of each scheme are described. If the mechanism of negative ion generation will be investigated more in detail and the development will be continued under the unified know-how as negative ion sources in future, the development of negative ion sources with which large current can be obtained for any element is expected. (Wakatsuki, Y.)

  14. Vacuum Arc Ion Sources

    CERN Document Server

    Brown, I.

    2013-12-16

    The vacuum arc ion source has evolved into a more or less standard laboratory tool for the production of high-current beams of metal ions, and is now used in a number of different embodiments at many laboratories around the world. Applications include primarily ion implantation for material surface modification research, and good performance has been obtained for the injection of high-current beams of heavy-metal ions, in particular uranium, into particle accelerators. As the use of the source has grown, so also have the operational characteristics been improved in a variety of different ways. Here we review the principles, design, and performance of vacuum arc ion sources.

  15. Polarized electron sources

    International Nuclear Information System (INIS)

    Prepost, R.

    1994-01-01

    The fundamentals of polarized electron sources are described with particular application to the Stanford Linear Accelerator Center. The SLAC polarized electron source is based on the principle of polarized photoemission from Gallium Arsenide. Recent developments using epitaxially grown, strained Gallium Arsenide cathodes have made it possible to obtain electron polarization significantly in excess of the conventional 50% polarization limit. The basic principles for Gallium and Arsenide polarized photoemitters are reviewed, and the extension of the basic technique to strained cathode structures is described. Results from laboratory measurements of strained photocathodes as well as operational results from the SLAC polarized source are presented

  16. BERKELEY: Light Source anniversary

    International Nuclear Information System (INIS)

    Anon.

    1994-01-01

    The staff of the Advanced Light Source (ALS) at the Lawrence Berkeley Laboratory has been too busy to celebrate the first anniversary of the facility's transition from a US Department of Energy construction project to operating third-generation synchrotron radiation source. Based on a 1.5-GeV, low-emittance electron storage ring that accommodates up to ten insertion-device radiation sources optimized primarily for the soft X-ray and vacuum ultra-violet regions of the spectrum, the ALS has completed

  17. Renewable sources of energy

    International Nuclear Information System (INIS)

    Wojas, K.

    1996-01-01

    The author takes a look at causes of the present interest in the renewable, natural sources of energy. These are: the fuel deposits becoming exhausted, hazard to environment (especially carbon dioxide) and accessibility of these sources for under-developed countries. An interrelation is shown between these sources and the energy circulations connected with atmosphere and ocean systems. The chief ones from among them that are being used now are discussed, i.e. solar radiation, wind, water waves energy, tides, geothermal heat, and the like. Problems of conversion of the forms of these kinds of energy are also given a mention. (author)

  18. BERKELEY: Light Source anniversary

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1994-10-15

    The staff of the Advanced Light Source (ALS) at the Lawrence Berkeley Laboratory has been too busy to celebrate the first anniversary of the facility's transition from a US Department of Energy construction project to operating third-generation synchrotron radiation source. Based on a 1.5-GeV, low-emittance electron storage ring that accommodates up to ten insertion-device radiation sources optimized primarily for the soft X-ray and vacuum ultra-violet regions of the spectrum, the ALS has completed.

  19. Polarized electron sources

    Energy Technology Data Exchange (ETDEWEB)

    Prepost, R. [Univ. of Wisconsin, Madison, WI (United States)

    1994-12-01

    The fundamentals of polarized electron sources are described with particular application to the Stanford Linear Accelerator Center. The SLAC polarized electron source is based on the principle of polarized photoemission from Gallium Arsenide. Recent developments using epitaxially grown, strained Gallium Arsenide cathodes have made it possible to obtain electron polarization significantly in excess of the conventional 50% polarization limit. The basic principles for Gallium and Arsenide polarized photoemitters are reviewed, and the extension of the basic technique to strained cathode structures is described. Results from laboratory measurements of strained photocathodes as well as operational results from the SLAC polarized source are presented.

  20. Open source development

    DEFF Research Database (Denmark)

    Ulhøi, John Parm

    2004-01-01

    This paper addresses innovations based on open source or non-proprietary knowledge. Viewed through the lens of private property theory, such agency appears to be a true anomaly. However, by a further turn of the theoretical kaleidoscope, we will show that there may be perfectly justifiable reasons...... for not regarding open source innovations as anomalies. The paper is based on three sectorial and generic cases of open source innovation, which is an offspring of contemporary theory made possible by combining elements of the model of private agency with those of the model of collective agency. In closing...

  1. AGS polarized H- source

    International Nuclear Information System (INIS)

    Kponou, A.; Alessi, J.G.; Sluyters, T.

    1985-01-01

    The AGS polarized H - source is now operational. During a month-long experimental physics run in July 1984, pulses equivalent to 15 μA x 300 μs (approx. 3 x 10 10 protons) were injected into the RFQ preaccelerator. Beam polarization, measured at 200 MeV, was approx. 75%. After the run, a program to increase the H - yield of the source was begun and significant progress has been made. The H - current is now frequently 20 to 30 μA. A description of the source and some details of our operating experience are given. We also briefly describe the improvement program

  2. Categorization of radiation sources

    International Nuclear Information System (INIS)

    Antonova, M.

    2000-01-01

    Through one-parameter (factor) analysis it is proved a hypothesis that the value of a radiation source (RS) activity of an application correlates with the category (the rank) given to it by the IAEA categorization although it is based on other parameters of the RS applications (practices like devices with radiation sources in industry, science, medicine and agriculture). The principles of the new IAEA categorization, taking into account the potential harm the sources may cause and the necessary regulatory control, are described. (author)

  3. Advanced Light Source (ALS)

    Data.gov (United States)

    Federal Laboratory Consortium — The Advanced Light Source (ALS), a world leader in soft x-ray science, generates light in the wavelengths needed for examining the atomic and electronic structure of...

  4. National Synchrotron Light Source

    International Nuclear Information System (INIS)

    Hulbert, S.L.; Lazarz, N.M.

    1991-04-01

    This report discussion research being conducted at the National Synchrotron light source. In particular, this report contains operations summaries; symposia, workshops, and projects; NSLS highlights; and abstracts of science at the NSLS

  5. Sources of pollution

    Indian Academy of Sciences (India)

    First page Back Continue Last page Overview Graphics. Sources of pollution. Domestic wastewater (Sewage). Organic matter; Nitrogen & phosphorus; Pathogens, viruses, …. Agricultural runoff. Nitrogen & phosphorus; Pesticides; Industrial effluents; Organics (oil &grease, pigments, phenols, organic matter ….) Heavy ...

  6. New renewable energy sources

    International Nuclear Information System (INIS)

    2001-06-01

    This publication presents a review of the technological, economical and market status in the field of new renewable energy sources. It also deals briefly with the present use of energy, external conditions for new renewable energy sources and prospects for these energy sources in a future energy system. The renewable energy sources treated here are ''new'' in the sense that hydroelectric energy technology is excluded, being fully developed commercially. This publication updates a previous version, which was published in 1996. The main sections are: (1) Introduction, (2) Solar energy, (3) Bio energy, (4) Wind power, (5) Energy from the sea, (6) Hydrogen, (7) Other new renewable energy technologies and (8) New renewable s in the energy system of the future

  7. EPA Sole Source Aquifers

    Data.gov (United States)

    U.S. Environmental Protection Agency — Information on sole source aquifers (SSAs) is widely used in assessments under the National Environmental Policy Act and at the state and local level. A national...

  8. Miniature radioactive light source

    International Nuclear Information System (INIS)

    Caffarella, T.E.; Radda, G.J.; Dooley, H.H.

    1980-01-01

    A miniature radioactive light source for illuminating digital watches is described consisting of a glass tube with improved laser sealing and strength containing tritium gas and a transducer responsive to the gas. (U.K.)

  9. Ion sources in AMS

    International Nuclear Information System (INIS)

    Iyer, Indira S.

    1997-01-01

    Accelerator Mass Spectrometry (AMS) entails the sputtering of various samples in an ion source followed by high precision mass analysis of the sputtered ion species in a Tandem Electrostatic Accelerator. A brief account is given

  10. Treatment planning source assessment

    International Nuclear Information System (INIS)

    Calzetta Larrieu, O.; Blaumann, H.; Longhino, J.

    2000-01-01

    The reactor RA-6 NCT system was improved during the last year mainly in two aspects: the facility itself getting lower contamination factors and using better measurements techniques to obtain lower uncertainties in its characterization. In this job we show the different steps to get the source to be used in the treatment planning code representing the NCT facility. The first one was to compare the dosimetry in a water phantom between the calculation using the entire facility including core, filter and shields and a surface source at the end of the beam. The second one was to transform this particle by particle source in a distribution one regarding the minimum spatial, energy and angular resolution to get similar results. Finally we compare calculation and experimental values with and without the water phantom to adjust the distribution source. The results are discussed. (author)

  11. Environmental Data Sources

    Data.gov (United States)

    Kansas Data Access and Support Center — This database includes gauging stations, climatic data centers, and storet sites. The accuracy of the locations is dependent on the source data for each of the...

  12. Calcium source (image)

    Science.gov (United States)

    Getting enough calcium to keep bones from thinning throughout a person's life may be made more difficult if that person has ... as a tendency toward kidney stones, for avoiding calcium-rich food sources. Calcium deficiency also effects the ...

  13. Electron Beam Ion Sources

    CERN Document Server

    Zschornacka, G.; Thorn, A.

    2013-12-16

    Electron beam ion sources (EBISs) are ion sources that work based on the principle of electron impact ionization, allowing the production of very highly charged ions. The ions produced can be extracted as a DC ion beam as well as ion pulses of different time structures. In comparison to most of the other known ion sources, EBISs feature ion beams with very good beam emittances and a low energy spread. Furthermore, EBISs are excellent sources of photons (X-rays, ultraviolet, extreme ultraviolet, visible light) from highly charged ions. This chapter gives an overview of EBIS physics, the principle of operation, and the known technical solutions. Using examples, the performance of EBISs as well as their applications in various fields of basic research, technology and medicine are discussed.

  14. Open Source Telecommunication Companies

    OpenAIRE

    Peter Liu

    2007-01-01

    Little is known about companies whose core business is selling telecommunications products that lever open source projects. Open source telecommunications (OST) companies operate in markets that are very different from typical software product markets. The telecommunications market is regulated, vertically integrated, and proprietary designs and special chips are widely used. For a telecommunications product to be useful, it must interact with both access network products and core network pro...

  15. Photoacoustic Point Source

    International Nuclear Information System (INIS)

    Calasso, Irio G.; Craig, Walter; Diebold, Gerald J.

    2001-01-01

    We investigate the photoacoustic effect generated by heat deposition at a point in space in an inviscid fluid. Delta-function and long Gaussian optical pulses are used as sources in the wave equation for the displacement potential to determine the fluid motion. The linear sound-generation mechanism gives bipolar photoacoustic waves, whereas the nonlinear mechanism produces asymmetric tripolar waves. The salient features of the photoacoustic point source are that rapid heat deposition and nonlinear thermal expansion dominate the production of ultrasound

  16. Laser ion sources

    Energy Technology Data Exchange (ETDEWEB)

    Bykovskij, Yu

    1979-02-01

    The characteristics a laser source of multiply-ionized ions are described with regard to the interaction of laser radiation and matter, ion energy spectrum, angular ion distribution. The amount of multiple-ionization ions is evaluated. Out of laser source applications a laser injector of multiple-ionization ions and nuclei, laser mass spectrometry, laser X-ray microradiography, and a laser neutron generators are described.

  17. X-ray sources

    International Nuclear Information System (INIS)

    Masswig, I.

    1986-01-01

    The tkb market survey comparatively evaluates the X-ray sources and replacement tubes for stationary equipment currently available on the German market. It lists the equipment parameters of 235 commercially available X-ray sources and their replacement tubes and gives the criteria for purchase decisions. The survey has been completed with December 1985, and offers good information concerning medical and technical aspects as well as those of safety and maintenance. (orig.) [de

  18. Diversification of energy sources

    Science.gov (United States)

    1975-01-01

    The concept of energy source diversification was introduced as a substitution conservation action. The current status and philosophy behind a diversification program is presented in the context of a national energy policy. Advantages, disadvantages (constraints), and methods of implementation for diversification are discussed. The energy source systems for diversification are listed and an example impact assessment is outlined which deals with the water requirements of the specific energy systems.

  19. Cardiomagnetic source imaging

    OpenAIRE

    Pesola, Katja

    2000-01-01

    Magnetocardiographic (MCG) source imaging has received increasing interest in recent years. With a high enough localization accuracy of the current sources in the heart, valuable information can be provided, e.g., for the pre-ablative evaluation of arrhythmia patients. Furthermore, preliminary studies indicate that ischemic areas, i.e. areas which are suffering from lack of oxygen, and infarcted regions could be localized from multichannel MCG recordings. In this thesis, the accuracy of cardi...

  20. Reactor Neutron Sources

    International Nuclear Information System (INIS)

    Aksenov, V.L.

    1994-01-01

    The present status and the prospects for development of reactor neutron sources for neutron scattering research in the world are considered. The fields of application of neutron scattering relative to synchrotron radiation, the creation stages of reactors (steady state and pulsed) and their position in comparison with spallation neutron sources at present and in the foreseen future are discussed. (author). 15 refs.; 8 figs.; 3 tabs

  1. Hubble Source Catalog

    Science.gov (United States)

    Lubow, S.; Budavári, T.

    2013-10-01

    We have created an initial catalog of objects observed by the WFPC2 and ACS instruments on the Hubble Space Telescope (HST). The catalog is based on observations taken on more than 6000 visits (telescope pointings) of ACS/WFC and more than 25000 visits of WFPC2. The catalog is obtained by cross matching by position in the sky all Hubble Legacy Archive (HLA) Source Extractor source lists for these instruments. The source lists describe properties of source detections within a visit. The calculations are performed on a SQL Server database system. First we collect overlapping images into groups, e.g., Eta Car, and determine nearby (approximately matching) pairs of sources from different images within each group. We then apply a novel algorithm for improving the cross matching of pairs of sources by adjusting the astrometry of the images. Next, we combine pairwise matches into maximal sets of possible multi-source matches. We apply a greedy Bayesian method to split the maximal matches into more reliable matches. We test the accuracy of the matches by comparing the fluxes of the matched sources. The result is a set of information that ties together multiple observations of the same object. A byproduct of the catalog is greatly improved relative astrometry for many of the HST images. We also provide information on nondetections that can be used to determine dropouts. With the catalog, for the first time, one can carry out time domain, multi-wavelength studies across a large set of HST data. The catalog is publicly available. Much more can be done to expand the catalog capabilities.

  2. [Outbreaks of viral hepatitis E in the Czech Republic?].

    Science.gov (United States)

    Trmal, Josef; Pavlík, Ivo; Vasícková, Petra; Matejícková, Ladislava; Simůnková, Lenka; Luks, Stanislav; Pazderková, Jana

    2012-05-01

    Until recently, viral hepatitis E (VHE) has typically been an imported infection, related to travel to developing countries. A number of travel-unrelated VHE cases currently diagnosed in the Czech Republic. Outcomes of the epidemiological investigations of two VHE outbreaks associated with the consumption of pork and pork products at pig-slaughtering feasts are presented. Thirteen cases have been reported in the first outbreak and eight cases in the second outbreak. The epidemiological investigations are described and the experience gained in analysing suspected biological specimens is presented. The source of infection has not been identified in the first outbreak while in the other one, a link between human cases and infection in farm pigs was revealed for the first time. Although the epidemiological investigation may not always lead to the detection of the VHE source, it must be conducted in any outbreak and can only be successful when done in cooperation of the public health authorities with the veterinary health agency.

  3. Heavy ion fusion sources

    International Nuclear Information System (INIS)

    Grote, D.P.; Kwan, J.; Westenskow, G.

    2003-01-01

    In Heavy-Fusion and in other applications, there is a need for high brightness sources with both high current and low emittance. The traditional design with a single monolithic source, while very successful, has significant constraints on it when going to higher currents. With the Child-Langmuir current-density limit, geometric aberration limits, and voltage breakdown limits, the area of the source becomes a high power of the current, A ∼ I 8/3 . We are examining a multi-beamlet source, avoiding the constraints by having many beamlets each with low current and small area. The beamlets are created and initially accelerated separately and then merged to form a single beam. This design offers a number of potential advantages over a monolithic source, such as a smaller transverse footprint, more control over the shaping and aiming of the beam, and more flexibility in the choice of ion sources. A potential drawback, however, is the emittance that results from the merging of the beamlets. We have designed injectors using simulation that have acceptably low emittance and are beginning to examine them experimentally

  4. Dosimetry of industrial sources

    International Nuclear Information System (INIS)

    Vega C, H.R.; Rodriguez J, R.; Manzanares A, E.; Hernandez V, R.; Ramirez G, J.; Rivera M, T.

    2007-01-01

    The gamma rays are produced during the disintegration of the atomic nuclei, its high energy allows them to cross thick materials. The capacity to attenuate a photons beam allows to determine the density, in line, of industrial interest materials as the mining. By means of two active dosemeters and a TLDs group (passive dosimetry) the dose rates of two sources of Cs-137 used for determining in line the density of mining materials were determined. With the dosemeters the dose levels in diverse points inside the grave that it harbors the sources and by means of calculations the isodoses curves were determined. In the phase of calculations was supposed that both sources were punctual and the isodose curves were calculated for two situations: naked sources and in their Pb packings. The dosimetry was carried out around two sources of 137 Cs. The measured values allowed to develop a calculation procedure to obtain the isodoses curves in the grave where the sources are installed. (Author)

  5. Characteristics and locations of sources

    International Nuclear Information System (INIS)

    Lahtinen, J.; Poellaenen, R.; Toivonen, H.

    1997-01-01

    Ten artificial radiation sources were placed in the terrain in order to test the capability of airborne measuring teams to detect them. One of the sources was a line source, others were point sources (three of them collimated). The radionuclides used in the sources were 60 Co, 137 Cs, 99m Tc and 192 Ir. The source activities ranged from about 26 MBq (one of the cobalt sources) to 0.56 TBq (iridium). (au)

  6. Characteristics and locations of sources

    Energy Technology Data Exchange (ETDEWEB)

    Lahtinen, J.; Poellaenen, R.; Toivonen, H. [Finnish Centre for Radiation and Nuclear Safety, Helsinki (Finland)

    1997-12-31

    Ten artificial radiation sources were placed in the terrain in order to test the capability of airborne measuring teams to detect them. One of the sources was a line source, others were point sources (three of them collimated). The radionuclides used in the sources were {sup 60}Co, {sup 137}Cs, {sup 99m}Tc and {sup 192}Ir. The source activities ranged from about 26 MBq (one of the cobalt sources) to 0.56 TBq (iridium). (au).

  7. Characteristics and locations of sources

    Energy Technology Data Exchange (ETDEWEB)

    Lahtinen, J; Poellaenen, R; Toivonen, H [Finnish Centre for Radiation and Nuclear Safety, Helsinki (Finland)

    1998-12-31

    Ten artificial radiation sources were placed in the terrain in order to test the capability of airborne measuring teams to detect them. One of the sources was a line source, others were point sources (three of them collimated). The radionuclides used in the sources were {sup 60}Co, {sup 137}Cs, {sup 99m}Tc and {sup 192}Ir. The source activities ranged from about 26 MBq (one of the cobalt sources) to 0.56 TBq (iridium). (au).

  8. Open Source Telecommunication Companies

    Directory of Open Access Journals (Sweden)

    Peter Liu

    2007-08-01

    Full Text Available Little is known about companies whose core business is selling telecommunications products that lever open source projects. Open source telecommunications (OST companies operate in markets that are very different from typical software product markets. The telecommunications market is regulated, vertically integrated, and proprietary designs and special chips are widely used. For a telecommunications product to be useful, it must interact with both access network products and core network products. Due to specifications in Service Agreements Levels, penalties for failures of telecommunications products are very high. This article shares information that is not widely known, including a list of OST companies and the open source projects on which they depend, the size and diversity of venture capital investment in OST companies, the nature of the commercial product-open source software and company-project relationships, ways in which OST companies make money, benefits and risks of OST companies, and competition between OST companies. Analysis of this information provides insights into the ways in which companies can build business models around open source software. These findings will be of interest to entrepreneurs, top management teams of incumbent companies that sell telecommunications products, and those who care about Ontario's ability to compete globally.

  9. Rf power sources

    International Nuclear Information System (INIS)

    Allen, M.A.

    1988-01-01

    In this paper, the author reports on RF power sources for accelerator applications. The approach will be with particular customers in mind. These customers are high energy physicists who use accelerators as experimental tools in the study of the nucleus of the atom, and synchrotron light sources derived from electron or positron storage rings. The author pays close attention to electron- positron linear accelerators since the RF sources have always defined what is possible to achieve with these accelerators. Circular machines, cyclotrons, synchrotrons, etc. have usually not been limited by the RF power available and the machine builders have usually had their RF power source requirements met off the shelf. The main challenge for the RF scientist has been then in the areas of controls. An interesting example of this is in the Conceptual Design Report of the Superconducting Super Collider (SSC) where the RF system is described in six pages of text in a 700-page report. Also, the cost of that RF system is about one-third of a percent of the project's total cost. The RF system is well within the state of the art and no new power sources need to be developed. All the intellectual effort of the system designer would be devoted to the feedback systems necessary to stabilize beams during storage and acceleration, with the main engineering challenges (and costs) being in the superconducting magnet lattice

  10. Lunar neutron source function

    International Nuclear Information System (INIS)

    Kornblum, J.J.

    1974-01-01

    The search for a quantitative neutron source function for the lunar surface region is justified because it contributes to our understanding of the history of the lunar surface and of nuclear process occurring on the moon since its formation. A knowledge of the neutron source function and neutron flux distribution is important for the interpretation of many experimental measurements. This dissertation uses the available pertinent experimental measurements together with theoretical calculations to obtain an estimate of the lunar neutron source function below 15 MeV. Based upon reasonable assumptions a lunar neutron source function having adjustable parameters is assumed for neutrons below 15 MeV. The lunar neutron source function is composed of several components resulting from the action of cosmic rays with lunar material. A comparison with previous neutron calculations is made and significant differences are discussed. Application of the results to the problem of lunar soil histories is examined using the statistical model for soil development proposed by Fireman. The conclusion is drawn that the moon is losing mass

  11. Management of 'orphan' sources

    International Nuclear Information System (INIS)

    Telleria, D.; Spano, F.; Rudelli, M.D.

    1998-01-01

    The experience has shown that most of the accidents with severe radiological consequences take place when radioactive sources were beyond the control system. In Argentina, the primary framework in radiological safety was established in the late fifties, with a non-prescriptive regulatory approach. For any application involving radioactive material, users must be authorised by the Authority, unless the application has demonstrated to be exempted. The licensees are responsible for ensuring protection against the risk associated with exposure to radiation, and for safety of radioactive sources. To obtain an authorisation, the applicant has to prove to the Authority knowledge and capability to carry on an application. Not only normal operation circumstances are considered, but every conceivable accidental situation. It has been shown the existence of radioactive sources not attributed to an authorised user or installation, and therefore outside of the primary control structure described above. These sources, from here on called 'orphans' recognise several origins. The regulatory authority should necessary foresee mechanisms to afford early detection and management of these sources, before an undesired consequence arises. Up to some extent, the deployment of multiple and varied organisations or procedures, could be understood as a 'defence in depth' concept, applied to the control. (author)

  12. Open source posturography.

    Science.gov (United States)

    Rey-Martinez, Jorge; Pérez-Fernández, Nicolás

    2016-12-01

    The proposed validation goal of 0.9 in intra-class correlation coefficient was reached with the results of this study. With the obtained results we consider that the developed software (RombergLab) is a validated balance assessment software. The reliability of this software is dependent of the used force platform technical specifications. Develop and validate a posturography software and share its source code in open source terms. Prospective non-randomized validation study: 20 consecutive adults underwent two balance assessment tests, six condition posturography was performed using a clinical approved software and force platform and the same conditions were measured using the new developed open source software using a low cost force platform. Intra-class correlation index of the sway area obtained from the center of pressure variations in both devices for the six conditions was the main variable used for validation. Excellent concordance between RombergLab and clinical approved force platform was obtained (intra-class correlation coefficient =0.94). A Bland and Altman graphic concordance plot was also obtained. The source code used to develop RombergLab was published in open source terms.

  13. Optically pumped terahertz sources

    Institute of Scientific and Technical Information of China (English)

    ZHONG Kai; SHI Wei; XU DeGang; LIU PengXiang; WANG YuYe; MEI JiaLin; YAN Chao; FU ShiJie; YAO JianQuan

    2017-01-01

    High-power terahertz (THz) generation in the frequency range of0.1-10 THz has been a fast-developing research area ever since the beginning of the THz boom two decades ago,enabling new technological breakthroughs in spectroscopy,communication,imaging,etc.By using optical (laser) pumping methods with near-or mid-infrared (IR) lasers,flexible and practical THz sources covering the whole THz range can be realized to overcome the shortage of electronic THz sources and now they are playing important roles in THz science and technology.This paper overviews various optically pumped THz sources,including femtosecond laser based ultrafast broadband THz generation,monochromatic widely tunable THz generation,single-mode on-chip THz source from photomixing,and the traditional powerful THz gas lasers.Full descriptions from basic principles to the latest progress are presented and their advantages and disadvantages are discussed as well.It is expected that this review gives a comprehensive reference to researchers in this area and additionally helps newcomers to quickly gain understanding of optically pumped THz sources.

  14. Arctic Aerosols and Sources

    DEFF Research Database (Denmark)

    Nielsen, Ingeborg Elbæk

    2017-01-01

    Since the Industrial Revolution, the anthropogenic emission of greenhouse gases has been increasing, leading to a rise in the global temperature. Particularly in the Arctic, climate change is having serious impact where the average temperature has increased almost twice as much as the global during......, ammonium, black carbon, and trace metals. This PhD dissertation studies Arctic aerosols and their sources, with special focus on black carbon, attempting to increase the knowledge about aerosols’ effect on the climate in an Arctic content. The first part of the dissertation examines the diversity...... of aerosol emissions from an important anthropogenic aerosol source: residential wood combustion. The second part, characterizes the chemical and physical composition of aerosols while investigating sources of aerosols in the Arctic. The main instrument used in this research has been the state...

  15. Dual source CT imaging

    International Nuclear Information System (INIS)

    Seidensticker, Peter R.; Hofmann, Lars K.

    2008-01-01

    The introduction of Dual Source Computed Tomography (DSCT) in 2005 was an evolutionary leap in the field of CT imaging. Two x-ray sources operated simultaneously enable heart-rate independent temporal resolution and routine spiral dual energy imaging. The precise delivery of contrast media is a critical part of the contrast-enhanced CT procedure. This book provides an introduction to DSCT technology and to the basics of contrast media administration followed by 25 in-depth clinical scan and contrast media injection protocols. All were developed in consensus by selected physicians on the Dual Source CT Expert Panel. Each protocol is complemented by individual considerations, tricks and pitfalls, and by clinical examples from several of the world's best radiologists and cardiologists. This extensive CME-accredited manual is intended to help readers to achieve consistently high image quality, optimal patient care, and a solid starting point for the development of their own unique protocols. (orig.)

  16. Dual source heat pump

    Science.gov (United States)

    Ecker, Amir L.; Pietsch, Joseph A.

    1982-01-01

    What is disclosed is a heat pump apparatus for conditioning a fluid characterized by a fluid handler and path for circulating the fluid in heat exchange relationship with a refrigerant fluid; at least two refrigerant heat exchangers, one for effecting heat exchange with the fluid and a second for effecting heat exchange between refrigerant and a heat exchange fluid and the ambient air; a compressor for efficiently compressing the refrigerant; at least one throttling valve for throttling liquid refrigerant; a refrigerant circuit; refrigerant; a source of heat exchange fluid; heat exchange fluid circulating device and heat exchange fluid circuit for circulating the heat exchange fluid in heat exchange relationship with the refrigerant; and valves or switches for selecting the heat exchangers and direction of flow of the refrigerant therethrough for selecting a particular mode of operation. The heat exchange fluid provides energy for defrosting the second heat exchanger when operating in the air source mode and also provides a alternate source of heat.

  17. PS proton source

    CERN Multimedia

    1959-01-01

    The first proton source used at CERN's Proton Synchrotron (PS) which started operation in 1959. This is CERN's oldest accelerator still functioning today (2018). It is part of the accelerator chain that supplies proton beams to the Large Hadron Collider. The source is a Thonemann type. In order to extract and accelerate the protons at high energy, a high frequency electrical field is used (140Mhz). The field is transmitted by a coil around a discharge tube in order to maintain the gas hydrogen in an ionised state. An electrical field pulse, in the order of 15kV, is then applied via an impulse transformer between anode and cathode of the discharge tube. The electrons and protons of the plasma formed in the ionised gas in the tube, are then separated. Currents in the order of 200mA during 100 microseconds have benn obtained with this type of source.

  18. INEEL Source Water Assessment

    Energy Technology Data Exchange (ETDEWEB)

    Sehlke, Gerald

    2003-03-01

    The Idaho National Engineering and Environmental Laboratory (INEEL) covers approximately 890 mi2 and includes 12 public water systems that must be evaluated for Source water protection purposes under the Safe Drinking Water Act. Because of its size and location, six watersheds and five aquifers could potentially affect the INEEL’s drinking water sources. Based on a preliminary evaluation of the available information, it was determined that the Big Lost River, Birch Creek, and Little Lost River Watersheds and the eastern Snake River Plain Aquifer needed to be assessed. These watersheds were delineated using the United States Geologic Survey’s Hydrological Unit scheme. Well capture zones were originally estimated using the RESSQC module of the Environmental Protection Agency’s Well Head Protection Area model, and the initial modeling assumptions and results were checked by running several scenarios using Modflow modeling. After a technical review, the resulting capture zones were expanded to account for the uncertainties associated with changing groundwater flow directions, a thick vadose zone, and other data uncertainties. Finally, all well capture zones at a given facility were merged to a single wellhead protection area at each facility. A contaminant source inventory was conducted, and the results were integrated with the well capture zones, watershed and aquifer information, and facility information using geographic information system technology to complete the INEEL’s Source Water Assessment. Of the INEEL’s 12 public water systems, three systems rated as low susceptibility (EBR-I, Main Gate, and Gun Range), and the remainder rated as moderate susceptibility. No INEEL public water system rated as high susceptibility. We are using this information to develop a source water management plan from which we will subsequently implement an INEEL-wide source water management program. The results are a very robust set of wellhead protection areas that will

  19. Intense fusion neutron sources

    International Nuclear Information System (INIS)

    Kuteev, B. V.; Goncharov, P. R.; Sergeev, V. Yu.; Khripunov, V. I.

    2010-01-01

    The review describes physical principles underlying efficient production of free neutrons, up-to-date possibilities and prospects of creating fission and fusion neutron sources with intensities of 10 15 -10 21 neutrons/s, and schemes of production and application of neutrons in fusion-fission hybrid systems. The physical processes and parameters of high-temperature plasmas are considered at which optimal conditions for producing the largest number of fusion neutrons in systems with magnetic and inertial plasma confinement are achieved. The proposed plasma methods for neutron production are compared with other methods based on fusion reactions in nonplasma media, fission reactions, spallation, and muon catalysis. At present, intense neutron fluxes are mainly used in nanotechnology, biotechnology, material science, and military and fundamental research. In the near future (10-20 years), it will be possible to apply high-power neutron sources in fusion-fission hybrid systems for producing hydrogen, electric power, and technological heat, as well as for manufacturing synthetic nuclear fuel and closing the nuclear fuel cycle. Neutron sources with intensities approaching 10 20 neutrons/s may radically change the structure of power industry and considerably influence the fundamental and applied science and innovation technologies. Along with utilizing the energy produced in fusion reactions, the achievement of such high neutron intensities may stimulate wide application of subcritical fast nuclear reactors controlled by neutron sources. Superpower neutron sources will allow one to solve many problems of neutron diagnostics, monitor nano-and biological objects, and carry out radiation testing and modification of volumetric properties of materials at the industrial level. Such sources will considerably (up to 100 times) improve the accuracy of neutron physics experiments and will provide a better understanding of the structure of matter, including that of the neutron itself.

  20. Intense fusion neutron sources

    Science.gov (United States)

    Kuteev, B. V.; Goncharov, P. R.; Sergeev, V. Yu.; Khripunov, V. I.

    2010-04-01

    The review describes physical principles underlying efficient production of free neutrons, up-to-date possibilities and prospects of creating fission and fusion neutron sources with intensities of 1015-1021 neutrons/s, and schemes of production and application of neutrons in fusion-fission hybrid systems. The physical processes and parameters of high-temperature plasmas are considered at which optimal conditions for producing the largest number of fusion neutrons in systems with magnetic and inertial plasma confinement are achieved. The proposed plasma methods for neutron production are compared with other methods based on fusion reactions in nonplasma media, fission reactions, spallation, and muon catalysis. At present, intense neutron fluxes are mainly used in nanotechnology, biotechnology, material science, and military and fundamental research. In the near future (10-20 years), it will be possible to apply high-power neutron sources in fusion-fission hybrid systems for producing hydrogen, electric power, and technological heat, as well as for manufacturing synthetic nuclear fuel and closing the nuclear fuel cycle. Neutron sources with intensities approaching 1020 neutrons/s may radically change the structure of power industry and considerably influence the fundamental and applied science and innovation technologies. Along with utilizing the energy produced in fusion reactions, the achievement of such high neutron intensities may stimulate wide application of subcritical fast nuclear reactors controlled by neutron sources. Superpower neutron sources will allow one to solve many problems of neutron diagnostics, monitor nano-and biological objects, and carry out radiation testing and modification of volumetric properties of materials at the industrial level. Such sources will considerably (up to 100 times) improve the accuracy of neutron physics experiments and will provide a better understanding of the structure of matter, including that of the neutron itself.

  1. Renewable energy sources (promotion)

    International Nuclear Information System (INIS)

    Cook, F.

    1986-01-01

    Permission to present a Bill to establish an independent commission directly responsible for the research, development and demonstration of clean, renewable, alternative sources of energy (to nuclear energy) is requested. The paragraphs of the preamble to the Bill are summarized by the Member seeking permission. The main reason for promoting renewable energy sources is opposition to the nuclear industry. One objection was raised. However, permission was granted to present the Bill and it was read for the first time with a second reading ordered for 7 March 1986. The Bill itself is not reprinted but the permission and question are reported verbatim. (U.K.)

  2. Production of sealed sources

    International Nuclear Information System (INIS)

    Bandi, L.N.

    2016-01-01

    Radioisotope production has been an ongoing activity in India since the sixties. Radioisotopes find wide-ranging applications in various fields, including industry, research, agriculture and medicine. Board of Radiation and Isotope Technology, an industrial unit of Department of Atomic Energy is involved in fabrication and supply of wide variety of sealed sources. The main radioisotopes fabricated and supplied by BRIT are Cobalt-60, Iridium-192. These isotopes are employed in industrial and laboratory irradiators, teletherapy machines, radiography exposure devices, nucleonic gauges. The source fabrication facilities of BRIT are located at Rajasthan Atomic Power Project Cobalt-60 Facility (RAPPCOF), Kota, Radiological Laboratories Group (RLG) and High Intensity Radiation Utilization Project (HIRUP) at Trombay

  3. Power source facility

    Energy Technology Data Exchange (ETDEWEB)

    Yoshikawa, Kazuhiro; Kinoshita, Shoichiro

    1998-09-29

    The present invention concerns a power plant, in which power is supplied from an ordinary system battery to an ordinary DC bus system when all of the AC power sources should be lost and a generator is driven by a steam turbine. A generator is connected with an ordinary system battery charger by way of a channel. If all of power sources should be lost, the ordinary system battery charger is driven by using emergency steam turbine generator facilities, and reactor steams are supplied thereby enabling to supply power to the ordinary system DC bus system for a long period of time. (N.H.)

  4. Y-source inverter

    DEFF Research Database (Denmark)

    Siwakoti, Yam P.; Town, Graham; Loh, Poh Chiang

    2014-01-01

    This paper introduces a new 3-phase Y-source inverter whose gain is presently not matched by classical impedance-network-based inverters operating at the same duty ratio. The proposed network uses a tightly coupled transformer with three windings. By squeezing the shoot-through range while keeping...... higher boost, the inverter can operate at a higher modulation index, thereby minimizing switching device stress and providing better output power quality. In addition, the inverter has more degrees of freedom for setting the voltage gain and modulation index than other classical impedance-source networks...

  5. Open source molecular modeling.

    Science.gov (United States)

    Pirhadi, Somayeh; Sunseri, Jocelyn; Koes, David Ryan

    2016-09-01

    The success of molecular modeling and computational chemistry efforts are, by definition, dependent on quality software applications. Open source software development provides many advantages to users of modeling applications, not the least of which is that the software is free and completely extendable. In this review we categorize, enumerate, and describe available open source software packages for molecular modeling and computational chemistry. An updated online version of this catalog can be found at https://opensourcemolecularmodeling.github.io. Copyright © 2016 The Author(s). Published by Elsevier Inc. All rights reserved.

  6. National Synchrotron Light Source

    International Nuclear Information System (INIS)

    van Steenbergen, A.

    1979-01-01

    The National Synchrotron Light Source comprises two high intensity electron storage rings for the generation of intense fluxes of synchrotron radiation in the vuv wavelength domain (700 MeV e - ring) and in the x-ray wavelength domain (2.5 GeV e - ring). A description is presented of the basic facility and the characteristics of the synchrotron radiation sources. The present plans for specific beam lines will be enumerated and the planned use of beam wigglers and undulators will be discussed

  7. Investigating scintillometer source areas

    Science.gov (United States)

    Perelet, A. O.; Ward, H. C.; Pardyjak, E.

    2017-12-01

    Scintillometry is an indirect ground-based method for measuring line-averaged surface heat and moisture fluxes on length scales of 0.5 - 10 km. These length scales are relevant to urban and other complex areas where setting up traditional instrumentation like eddy covariance is logistically difficult. In order to take full advantage of scintillometry, a better understanding of the flux source area is needed. The source area for a scintillometer is typically calculated as a convolution of point sources along the path. A weighting function is then applied along the path to compensate for a total signal contribution that is biased towards the center of the beam path, and decreasing near the beam ends. While this method of calculating the source area provides an estimate of the contribution of the total flux along the beam, there are still questions regarding the physical meaning of the weighted source area. These questions are addressed using data from an idealized experiment near the Salt Lake City International Airport in northern Utah, U.S.A. The site is a flat agricultural area consisting of two different land uses. This simple heterogeneity in the land use facilitates hypothesis testing related to source areas. Measurements were made with a two wavelength scintillometer system spanning 740 m along with three standard open-path infrared gas analyzer-based eddy-covariance stations along the beam path. This configuration allows for direct observations of fluxes along the beam and comparisons to the scintillometer average. The scintillometer system employed measures the refractive index structure parameter of air for two wavelengths of electromagnetic radiation, 880 μm and 1.86 cm to simultaneously estimate path-averaged heat and moisture fluxes, respectively. Meteorological structure parameters (CT2, Cq2, and CTq) as well as surface fluxes are compared for various amounts of source area overlap between eddy covariance and scintillometry. Additionally, surface

  8. Double chamber ion source

    International Nuclear Information System (INIS)

    Uman, M.F.; Winnard, J.R.; Winters, H.F.

    1978-01-01

    The ion source is comprised of two discharge chambers one of which is provided with a filament and an aperture leading into the other chamber which in turn has an extraction orifice. A low voltage arc discharge is operated in an inert gas atmosphere in the filament chamber while an arc of higher voltage is operated in the second ionization chamber which contains a vapor which will give the desired dopant ion species. The entire source is immersed in an axial magnetic field parallel to a line connecting the filament, the aperture between the two chambers and the extraction orifice. (author)

  9. Fuel fired heat sources

    Energy Technology Data Exchange (ETDEWEB)

    Ortlinghaus, U

    1977-09-08

    Fuel fired heat sources with a valve-controlled ignition and main burner, whose flame is monitored and whose control valve is closed or opened by a controller according to the control deviation between actual and reference heat source temperature, previously suffered the disadvantage of high consumption of ignition gas. According to the invention this disadvantage is avoided by closing the ignition valve from the controller via a delay unit and having the delay time of the delay unit controlled either by the temperature measured by the sensor or increasing it with increasing deviation of the actual value of pre-temperature from the reference value of the pre-temperature.

  10. Advanced neutron source project

    International Nuclear Information System (INIS)

    Gorynina, L.V.; Proskuryakov, S.F.; Tishchenko, V.A.; Uzhanova, V.V.

    1991-01-01

    The project of the ANS improved neutron source intended for fundamental researches in nuclear physics and materials testing is considered. New superhigh-flux heavy-water 350 MW reactor is used for the source creation. The standard fuel is uranium silicide (U 3 Si 2 ). Reactor core volume equals 67.4 l and average power density is 4.9 MW/l. Neutron flux density is 10 16 neutron/(cm 2 xs). The facility construction begin is planned for 1996. The first experiments should be accomplished in 2000

  11. Valorization of ECR sources

    CERN Document Server

    2003-01-01

    One way to limit the size of particle accelerators is to use intense multicharged ion beams. Thus, compact, low cost and reliable sources have been developed. These sources are based on the electron cyclotron resonance (ECR) principle and need no cathode nor filament. A prototype named Nanogan has been developed for the Spiral project of the Ganil accelerator (Caen, France). Then, this technology has been transferred toward other research domains and industrial applications, like the ion implantation in micro-electronics components. (J.S.)

  12. Compact radio sources

    International Nuclear Information System (INIS)

    Altschuler, D.R.

    1975-01-01

    Eighty-seven compact radio sources were monitored between 1971 and 1974 with the National Radio Astronomy Observatory interferometer. Both flux density and polarization were measured at intervals of about one month at wavelengths of 3.7 and 11.1 cms. Forty-four sources showed definite variability in their total and/or polarized flux density. The variations in polarization were of a shorter time scale than the corresponding flux density variations. Some of the qualitative features of an expanding source model were observed. The data suggest that some form of injection of relativistic electrons is taking place. The absence of significant depolarization in the variable sources indicates that only a small fraction of the mass of the radio outburst is in the form of non-relativistic plasma. Some of the objects observed belong to the BL-Lacertal class. It is shown that this class is very inhomogeneous in its radio properties. For the violently variable BL-Lacertal type objects the spectrum, flux variations and polarization data strongly suggest that these are very young objects

  13. Alternate energy sources

    International Nuclear Information System (INIS)

    Stevens-Guille, P.D.

    1975-01-01

    The author highlights the interesting points made by the speeches during the conference on Energy and its Future in Southern Africa. He also draws attention to potential alternate energy sources such as power from tides, ocean waves, ocean temperature differences and geothermal power

  14. International Entrepreneurship and Sourcing

    DEFF Research Database (Denmark)

    Servais, Per; Zucchella, Antonella; Palamera, Giada

    2006-01-01

    This contribution focuses on international sourcing as an entrepreneurial act and aims at demonstrating that it is actually at the core of internationalization processes of small firms, both established and international new ventures. Another issue of this research is to understand how these firm...

  15. Requirements for Ion Sources

    International Nuclear Information System (INIS)

    Scrivens, R

    2013-01-01

    Ion sources produce beams for a large variety of different physical experiments, industrial processes and medical applications. In order to characterize the beam delivered by them, a list of requirements is necessary. In this chapter the list of principal requirements is specified and definitions for them are given. (author)

  16. Accessing vs Sourcing Knowledge

    DEFF Research Database (Denmark)

    Awate, Snehal; Larsen, Marcus M.; Mudambi, Ram

    2015-01-01

    to get on par with industry leaders. An in-depth comparison of knowledge flows reveals that within AMNEs, headquarters often serves the primary source of knowledge for R&D subsidiaries. In contrast, within EMNEs, headquarters accesses knowledge from R&D subsidiaries in advanced economies for innovation...

  17. Risks of energy sources

    International Nuclear Information System (INIS)

    Pop-Jordanov, J.; Pop-Jordanova, N.

    1989-09-01

    The paper is devoted to comparative health and environmental risks of different energy sources and their influence to public perception, social acceptability and decision-making. The technical heights of the risks, expressed in the number of fatalities of labor and public per unit energy output, from fossil, nuclear and renewable sources are analysed and compared. The complete energy cycle from mining to waste disposal, as well as the future trends, are taken into account. A comparison of the risks of different energy systems with the anticipated global and national energy shares by source is also presented. Furthermore, detailed studies of the non-technical dimensions of the energy risks are performed. Using a modified attitude-behaviour model, the cognitive structure underlying the positions towards different energy options is investigated. Estimating the diverse acting of the risk components, the consequent changes in the rank ordering of the energy sources are deduced. Finally, adding the psychological components nuclear reaches the highest place. In this respect, a unified multidimensional space for the representation of various technological risks is introduced. It affords a comparison of the risks not only by their technical height, but also by other characteristics (involuntary, fearfulness etc.). Finally, it was pointed out that in considering the risk characteristics and constraints, as well as the external fields, a system approach has to be used, taking into account the risks simultaneously with the benefits. 12 refs, 4 figs, 2 tabs

  18. Tandem Terminal Ion Source

    International Nuclear Information System (INIS)

    Harper, G.C.; Lindner, C.E.; Myers, A.W.; Wechel, T.D. van

    2000-01-01

    OAK-B135 Tandem Terminal Ion Source. The terminal ion source (TIS) was used in several experiments during this reporting period, all for the 7 Be(γ) 8 B experiment. Most of the runs used 1 H + at terminal voltages from 0.3 MV to 1.5 MV. One of the runs used 2 H + at terminal voltage of 1.4 MV. The other run used 4 He + at a terminal voltage of 1.37 MV. The list of experiments run with the TIS to date is given in table 1 below. The tank was opened four times for unscheduled source repairs. On one occasion the tank was opened to replace the einzel lens power supply which had failed. The 10 kV unit was replaced with a 15 kV unit. The second time the tank was opened to repair the extractor supply which was damaged by a tank spark. On the next occasion the tank was opened to replace a source canal which had sputtered away. Finally, the tank was opened to replace the discharge bottle which had been coated with aluminum sputtered from the exit canal

  19. Electrochemical Power Sources

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 7. Electrochemical Power Sources - Rechargeable Batteries. A K Shukla S K Martha. General Article Volume 6 Issue 7 July 2001 pp 52-63. Fulltext. Click here to view fulltext PDF. Permanent link:

  20. Particle beam source development

    International Nuclear Information System (INIS)

    Anon.

    1978-01-01

    Electron beam research directed toward providing improved in-diode pinched beam sources and establishing the efficiency and feasibility for superposition of many beams progressed in three major areas. Focusing stability has been improved from large effective aspect ratio (radius/gap of emitting surface) diodes. Substantial progress toward establishing the feasibility of combining beams guided along ionized current-carrying channels has been made. Two beams have been transported and overlayed on a target. Theoretical and experimental measurements on channel formation have resulted in specifications for the capacitor bank channel initiation system for a 12-beam combination experiment on Proto II. An additional area of beam research has been the development of a small pulsed X-ray source to yield high quality flash X-radiography of pellets. A source yielding approximately 100-μm resolution of objects has been demonstrated and work continues to improve the convenience and reliability of this source. The effort to extend the capability of higher power conventional pulse power generators to accelerate ions (rather than electrons), and assess the feasibility of this technology variation for target experiments and reactors has progressed. Progress toward development of a multistage accelerator for ions with pulse power technology centered on development of a new laboratory facility and design and procurement of hardware for a five-stage test apparatus for the Pulslac concept

  1. OMNIDIRECTIONAL SOUND SOURCE

    DEFF Research Database (Denmark)

    1996-01-01

    A sound source comprising a loudspeaker (6) and a hollow coupler (4) with an open inlet which communicates with and is closed by the loudspeaker (6) and an open outlet, said coupler (4) comprising rigid walls which cannot respond to the sound pressures produced by the loudspeaker (6). According...

  2. Gamma-ray sources

    International Nuclear Information System (INIS)

    Hermsen, W.

    1980-01-01

    Results are presented from an analysis of the celestial gamma-ray fine-scale structure based on over half of the data which may ultimately be available from the COS-B satellite. A catalogue consisting of 25 gamma-ray sources measured at energies above 100 MeV is presented. (Auth.)

  3. Dosimetry of linear sources

    International Nuclear Information System (INIS)

    Mafra Neto, F.

    1992-01-01

    The dose of gamma radiation from a linear source of cesium 137 is obtained, presenting two difficulties: oblique filtration of radiation when cross the platinum wall, in different directions, and dose connection due to the scattering by the material mean of propagation. (C.G.C.)

  4. Open-source colorimeter.

    Science.gov (United States)

    Anzalone, Gerald C; Glover, Alexandra G; Pearce, Joshua M

    2013-04-19

    The high cost of what have historically been sophisticated research-related sensors and tools has limited their adoption to a relatively small group of well-funded researchers. This paper provides a methodology for applying an open-source approach to design and development of a colorimeter. A 3-D printable, open-source colorimeter utilizing only open-source hardware and software solutions and readily available discrete components is discussed and its performance compared to a commercial portable colorimeter. Performance is evaluated with commercial vials prepared for the closed reflux chemical oxygen demand (COD) method. This approach reduced the cost of reliable closed reflux COD by two orders of magnitude making it an economic alternative for the vast majority of potential users. The open-source colorimeter demonstrated good reproducibility and serves as a platform for further development and derivation of the design for other, similar purposes such as nephelometry. This approach promises unprecedented access to sophisticated instrumentation based on low-cost sensors by those most in need of it, under-developed and developing world laboratories.

  5. Alternative Energy Sources

    CERN Document Server

    Michaelides, Efstathios E (Stathis)

    2012-01-01

    Alternative Energy Sources is designed to give the reader, a clear view of the role each form of alternative energy may play in supplying the energy needs of the human society in the near and intermediate future (20-50 years).   The two first chapters on energy demand and supply and environmental effects, set the tone as to why the widespread use of alternative energy is essential for the future of human society. The third chapter exposes the reader to the laws of energy conversion processes, as well as the limitations of converting one energy form to another. The sections on exergy give a succinct, quantitative background on the capability/potential of each energy source to produce power on a global scale. The fourth, fifth and sixth chapters are expositions of fission and fusion nuclear energy. The following five chapters (seventh to eleventh) include detailed descriptions of the most common renewable energy sources – wind, solar, geothermal, biomass, hydroelectric – and some of the less common sources...

  6. New sources of radiation

    International Nuclear Information System (INIS)

    Schimmerling, W.

    1979-09-01

    An attempt is made to select examples of radiation sources whose application may make new or unconventional demands on radiation protection and dosimetry. A substantial body of knowledge about high energy facilities exists and, partly for this reason, the great high energy accelerators are mentioned only briefly

  7. NSLS source development laboratory

    International Nuclear Information System (INIS)

    Ben-Zvi, I.; Blum, E.; Johnson, E.D.

    1995-01-01

    The National Synchrotron Light Source (NSLS) has initiated an ambitious project to develop fourth generation radiation sources. To achieve this goal, the Source Development Laboratory (SDL) builds on the experience gained at the NSLS, and at the highly successful BNL Accelerator Test Facility. The SDL accelerator system will consist of a high brightness short pulse linac, a station for coherent synchrotron and transition radiation experiments, a short bunch storage ring, and an ultra-violet free electron laser utilizing the NISUS wiggler. The electrons will be provided by a laser photocathode gun feeding a 210 MeV S-band electron linac, with magnetic bunch compression at 80 MeV. Electron bunches as short as 100 μm with 1 nC charge will be used for pump-probe experiments utilizing coherent transition radiation. Beam will also be injected into a compact storage ring which will be a source of millimeter wave coherent synchrotron radiation. The linac will also serve as the driver for an FEL designed to allow the study of various aspects of single pass amplifiers. The first FEL configuration will be as a self-amplified spontaneous emission (SASE) FEL at 900 nm. Seeded beam and sub-harmonic seeded beam operations will push the output wavelength below 200 nm. Chirped pulse amplification (CPA) operation will also be possible, and a planned energy upgrade (by powering a fifth linac section) to 310 MeV will extend the wavelength range of the FEL to below 100 nm

  8. Sourcing made easy.

    Science.gov (United States)

    2005-09-01

    MDT Sourcing is a free online service for buyers seeking the range of services used in the design, manufacture and marketing of finished medical devices. Take up of the service has been good since its launch earlier this year. Some of the latest requests for quotations are outlined here.

  9. PF slow positron source

    International Nuclear Information System (INIS)

    Shirakawa, A.; Enomoto, A.; Kurihara, T.

    1993-01-01

    A new slow-positron source is under construction at the Photon Factory. Positrons are produced by bombarding a tantalum rod with high-energy electrons; they are moderated in multiple tungsten vanes. We report here the present status of this project. (author)

  10. Open-Source Colorimeter

    Science.gov (United States)

    Anzalone, Gerald C.; Glover, Alexandra G.; Pearce, Joshua M.

    2013-01-01

    The high cost of what have historically been sophisticated research-related sensors and tools has limited their adoption to a relatively small group of well-funded researchers. This paper provides a methodology for applying an open-source approach to design and development of a colorimeter. A 3-D printable, open-source colorimeter utilizing only open-source hardware and software solutions and readily available discrete components is discussed and its performance compared to a commercial portable colorimeter. Performance is evaluated with commercial vials prepared for the closed reflux chemical oxygen demand (COD) method. This approach reduced the cost of reliable closed reflux COD by two orders of magnitude making it an economic alternative for the vast majority of potential users. The open-source colorimeter demonstrated good reproducibility and serves as a platform for further development and derivation of the design for other, similar purposes such as nephelometry. This approach promises unprecedented access to sophisticated instrumentation based on low-cost sensors by those most in need of it, under-developed and developing world laboratories. PMID:23604032

  11. Tandem Terminal Ion Source

    International Nuclear Information System (INIS)

    None

    2000-01-01

    OAK-B135 Tandem Terminal Ion Source. The terminal ion source (TIS) was used in several experiments during this reporting period, all for the(sup 7)Be((gamma))(sup 8)B experiment. Most of the runs used(sup 1)H(sup+) at terminal voltages from 0.3 MV to 1.5 MV. One of the runs used(sup 2)H(sup+) at terminal voltage of 1.4 MV. The other run used(sup 4)He(sup+) at a terminal voltage of 1.37 MV. The list of experiments run with the TIS to date is given in table 1 below. The tank was opened four times for unscheduled source repairs. On one occasion the tank was opened to replace the einzel lens power supply which had failed. The 10 kV unit was replaced with a 15 kV unit. The second time the tank was opened to repair the extractor supply which was damaged by a tank spark. On the next occasion the tank was opened to replace a source canal which had sputtered away. Finally, the tank was opened to replace the discharge bottle which had been coated with aluminum sputtered from the exit canal

  12. Open Source Software Acquisition

    DEFF Research Database (Denmark)

    Holck, Jesper; Kühn Pedersen, Mogens; Holm Larsen, Michael

    2005-01-01

    Lately we have seen a growing interest from both public and private organisations to adopt OpenSource Software (OSS), not only for a few, specific applications but also on a more general levelthroughout the organisation. As a consequence, the organisations' decisions on adoption of OSS arebecoming...

  13. Adaptive distributed source coding.

    Science.gov (United States)

    Varodayan, David; Lin, Yao-Chung; Girod, Bernd

    2012-05-01

    We consider distributed source coding in the presence of hidden variables that parameterize the statistical dependence among sources. We derive the Slepian-Wolf bound and devise coding algorithms for a block-candidate model of this problem. The encoder sends, in addition to syndrome bits, a portion of the source to the decoder uncoded as doping bits. The decoder uses the sum-product algorithm to simultaneously recover the source symbols and the hidden statistical dependence variables. We also develop novel techniques based on density evolution (DE) to analyze the coding algorithms. We experimentally confirm that our DE analysis closely approximates practical performance. This result allows us to efficiently optimize parameters of the algorithms. In particular, we show that the system performs close to the Slepian-Wolf bound when an appropriate doping rate is selected. We then apply our coding and analysis techniques to a reduced-reference video quality monitoring system and show a bit rate saving of about 75% compared with fixed-length coding.

  14. Organizing for Global Sourcing

    DEFF Research Database (Denmark)

    Bals, Lydia; Turkulainen, Virpi

    Research on Purchasing Organization is dominated by studies on centralization versus decentralization. While global sourcing relates to the integrated activities of purchasing and other functions in line with the company’s strategic objectives and while it has been put forward that hybrid...

  15. Californium source transfer

    International Nuclear Information System (INIS)

    Wallace, C.R.

    1995-01-01

    In early 1995, the receipt of four sealed californium-252 sources from Oak Ridge National Lab was successfully accomplished by a team comprised of Radiological Engineering, Radiological Operations and Health Physics Instrumentation personnel. A procedure was developed and walked-down by the participants during a Dry Run Evolution. Several special tools were developed during the pre-planning phases of the project which reduced individual and job dose to minimal levels. These included a mobile lifting device for attachment of a transfer ball valve assembly to the undercarriage of the Cannonball Carrier, a transfer tube elbow to ensure proper angle of the source transfer tube, and several tools used during emergency response for remote retrieval and handling of an unshielded source. Lessons were learned in the areas of contamination control, emergency preparedness, and benefits of thorough pre-planning, effectiveness of locally creating and designing special tools to reduce worker dose, and methods of successfully accomplishing source receipt evolutions during extreme or inclement weather

  16. Cobalt source calibration

    International Nuclear Information System (INIS)

    Rizvi, H.M.

    1999-01-01

    The data obtained from these tests determine the dose rate of the two cobalt sources in SRTC. Building 774-A houses one of these sources while the other resides in room C-067 of Building 773-A. The data from this experiment shows the following: (1) The dose rate of the No.2 cobalt source in Building 774-A measured 1.073 x 10 5 rad/h (June 17, 1999). The dose rate of the Shepherd Model 109 Gamma cobalt source in Building 773-A measured 9.27 x 10 5 rad/h (June 25, 1999). These rates come from placing the graduated cylinder containing the dosimeter solution in the center of the irradiation chamber. (2) Two calibration tests in the 774-A source placed the graduated cylinder with the dosimeter solution approximately 1.5 inches off center in the axial direction. This movement of the sample reduced the measured dose rate 0.92% from 1.083 x 10 5 rad/h to 1.073 x 10 5 rad/h. and (3) A similar test in the cobalt source in 773-A placed the graduated cylinder approximately 2.0 inches off center in the axial direction. This change in position reduced the measured dose rate by 10.34% from 1.036 x 10 6 to 9.27 x 10 5 . This testing used chemical dosimetry to measure the dose rate of a radioactive source. In this method, one determines the dose by the chemical change that takes place in the dosimeter. For this calibration experiment, the author used a Fricke (ferrous ammonium sulfate) dosimeter. This solution works well for dose rates to 10 7 rad/h. During irradiation of the Fricke dosimeter solution the Fe 2+ ions ionize to Fe 3+ . When this occurs, the solution acquires a slightly darker tint (not visible to the human eye). To determine the magnitude of the change in Fe ions, one places the solution in an UV-VIS Spectrophotometer. The UV-VIS Spectrophotometer measures the absorbency of the solution. Dividing the absorbency by the total time (in minutes) of exposure yields the dose rate

  17. Safe handling of radiation sources

    International Nuclear Information System (INIS)

    Abd Nasir Ibrahim; Azali Muhammad; Ab Razak Hamzah; Abd Aziz Mohamed; Mohammad Pauzi Ismail

    2004-01-01

    This chapter discussed the subjects related to the safe handling of radiation sources: type of radiation sources, method of use: transport within premises, transport outside premises; Disposal of Gamma Sources

  18. Synchrotron radiation sources

    Energy Technology Data Exchange (ETDEWEB)

    van Steenbergen, A.

    1979-01-01

    As a result of the exponential growth of the utilization of synchrotron radiation for research in the domain of the material sciences, atomic and molecular physics, biology and technology, a major construction activity has been generated towards new dedicated electron storage rings, designed optimally for synchrotron radiation applications, also, expansion programs are underway at the existing facilities, such as DORIS, SPEAR, and VEPP. In this report the basic properties of synchrotron radiation will be discussed, a short overview will be given of the existing and new facilities, some aspects of the optimization of a structure for a synchrotron radiation source will be discussed and the addition of wigglers and undulators for spectrum enhancement will be described. Finally, some parameters of an optimized synchrotron radiation source will be given.

  19. Radioactive sources service

    CERN Multimedia

    2006-01-01

    Please note that, as of 1st May, the Radioactive Sources Service will be open full-time, i.e. from 8.00 a.m. to 5.00 p.m., on alternate weeks (rather than part-time, from 8.00 a.m. to 11.00 a.m., every day, as at present). The weeks in which the Service will be open during the coming month are listed below: week No. 18: from 01/05 to 05/05 week No. 20: from 15/05 to 19/05 week No. 22: from 29/05 to 02/06 http://cern.ch/service-rp-sources

  20. Sources of groundwater contamination

    International Nuclear Information System (INIS)

    Assaf, H.; Al-Masri, M. S.

    2007-09-01

    In spite of the importance of water for life, either for drinking, irrigation, industry or other wide uses in many fields, human beings seem to contaminate it and make it unsuitable for human uses. This is due to disposal of wastes in the environment without treatment. In addition to population increase and building expanding higher living costs, industrial and economical in growth that causes an increase in water consumption. All of these factors have made an increase pressure on our water environment quantitatively and qualitatively. In addition, there is an increase of potential risks to the water environmental due to disposal of domestic and industrial wastewater in areas near the water sources. Moreover, the use of unacceptable irrigation systems may increase soil salinity and evaporation rates. The present report discusses the some groundwater sources and problem, hot and mineral waters that become very important in our life and to our health due to its chemical and radioactivity characteristics.(authors)

  1. The Advanced Light Source

    International Nuclear Information System (INIS)

    Jackson, A.

    1991-05-01

    The Advanced Light Source (ALS), a national user facility currently under construction at the Lawrence Berkeley Laboratory (LBL), is a third-generation synchrotron light source designed to produce extremely bright beams of synchrotron radiation in the energy range from a few eV to 10 keV. The design is based on a 1--1.9-GeV electron storage ring (optimized at 1.5 GeV), and utilizes special magnets, known as undulators and wigglers (collectively referred to as insertion devices), to generate the radiation. The facility is scheduled to begin operating in April 1993. In this paper we describe the progress in the design, construction, and commissioning of the accelerator systems, insertion devices, and beamlines. Companion presentations at this conference give more detail of specific components in the ALS, and describe the activities towards establishing an exciting user program. 3 figs., 2 tabs

  2. Cold source economic study

    International Nuclear Information System (INIS)

    Fuster, Serge.

    1975-01-01

    This computer code is intended for the statement of the general economic balance resulting from using a given cold source. The balance includes the investments needed for constructing the various materials, and also production balances resulting from their utilization. The case of either using an open circuit condenser on sea or river, or using air cooling systems with closed circuits or as auxiliaries can be dealt with. The program can be used to optimize the characteristics of the various parts of the cold source. The performance of the various materials can be evaluated for a given situation from using very full, precise economic balances, these materials can also be classified according to their possible uses, the outer constraints being taken into account (limits for heat disposal into rivers or seas, water temperature, air temperature). Technical choices whose economic consequences are important have been such clarified [fr

  3. Advanced Light Source

    International Nuclear Information System (INIS)

    Sah, R.C.

    1983-03-01

    The Advanced Light Source (ALS) is a new synchrotron radiation source which has been proposed by Lawrence Berkeley Laboratory. The ALS will be a key component in a major new research facility, the National Center for Advanced Materials. The ALS will consist of an electron linear accelerator, a booster synchrotron, a 1.3-GeV electron storage ring, and a number of photon beam lines. Most or all photon beam lines will originate from wiggler and undulator magnets placed in the 12 long straight sections of the ALS. A very low electron beam emittance will provide photon beams of unsurpassed spectral brilliance from specially-designed undulators, and a high radiofrequency will produce very short pulse lengths

  4. The advanced photon source

    International Nuclear Information System (INIS)

    Galayda, J.N.

    1995-01-01

    The Advanced Photon Source (APS) is a 7-GeV third-generation synchrotron radiation storage ring and full-energy positron injector. Construction project funding began in 1989, and ground breaking took place on 5 May 1990. Construction of all accelerator facilities was completed in January 1995 and storage ring commissioning is underway. First observation of x-rays from a bending magnet source took place on 26 March 1995. Nearly all performance specifications of the injector have been reached, and first observations indicate that the reliability, dynamic aperture, emittance, and orbit stability in the storage ring are satisfactory. Observation of radiation from the first of 20 insertion device beamlines is scheduled for October 1995. Start of regular operations is expected to take place well before the APS Project target date of December 1996

  5. BNL volume H- source

    International Nuclear Information System (INIS)

    Prelec, K.; Alessi, J.G.

    1991-01-01

    The volume H minus ion source under development at Brookhaven is unique in that it has a toroidal plasma region, which feeds ions into the central extraction region through a conically shaped filter field. In pulsed operation, it produced 25 mA of H minus in a 1 cm 2 aperture, with an electron-to-H minus ratio of ∼ 3. At 19 mA, a normalized, 90% emittance of 0.44 π mm-mrad has been measured. Up to 50 mA has been extracted through a 1.87 cm 2 aperture. Although not designed for steady state operation, up to 6 mA has been extracted d.c. The addition of xenon to the discharge was found to improve the source output by 20--70%. The circular magnetic cusp field geometry was found to be more favorable than radial cusp fields. 4 refs., 5 figs

  6. Filtered cathodic arc source

    International Nuclear Information System (INIS)

    Falabella, S.; Sanders, D.M.

    1994-01-01

    A continuous, cathodic arc ion source coupled to a macro-particle filter capable of separation or elimination of macro-particles from the ion flux produced by cathodic arc discharge is described. The ion source employs an axial magnetic field on a cathode (target) having tapered sides to confine the arc, thereby providing high target material utilization. A bent magnetic field is used to guide the metal ions from the target to the part to be coated. The macro-particle filter consists of two straight solenoids, end to end, but placed at 45 degree to one another, which prevents line-of-sight from the arc spot on the target to the parts to be coated, yet provides a path for ions and electrons to flow, and includes a series of baffles for trapping the macro-particles. 3 figures

  7. Single-photon sources

    International Nuclear Information System (INIS)

    Lounis, Brahim; Orrit, Michel

    2005-01-01

    The concept of the photon, central to Einstein's explanation of the photoelectric effect, is exactly 100 years old. Yet, while photons have been detected individually for more than 50 years, devices producing individual photons on demand have only appeared in the last few years. New concepts for single-photon sources, or 'photon guns', have originated from recent progress in the optical detection, characterization and manipulation of single quantum objects. Single emitters usually deliver photons one at a time. This so-called antibunching of emitted photons can arise from various mechanisms, but ensures that the probability of obtaining two or more photons at the same time remains negligible. We briefly recall basic concepts in quantum optics and discuss potential applications of single-photon states to optical processing of quantum information: cryptography, computing and communication. A photon gun's properties are significantly improved by coupling it to a resonant cavity mode, either in the Purcell or strong-coupling regimes. We briefly recall early production of single photons with atomic beams, and the operation principles of macroscopic parametric sources, which are used in an overwhelming majority of quantum-optical experiments. We then review the photophysical and spectroscopic properties and compare the advantages and weaknesses of various single nanometre-scale objects used as single-photon sources: atoms or ions in the gas phase and, in condensed matter, organic molecules, defect centres, semiconductor nanocrystals and heterostructures. As new generations of sources are developed, coupling to cavities and nano-fabrication techniques lead to improved characteristics, delivery rates and spectral ranges. Judging from the brisk pace of recent progress, we expect single photons to soon proceed from demonstrations to applications and to bring with them the first practical uses of quantum information

  8. Feed sources for livestock

    OpenAIRE

    Zanten, van, H.H.E.

    2016-01-01

    Production of food has re-emerged at the top of the global political agenda, driven by two contemporary challenges: the challenge to produce enough nutritious food to feed a growing and more prosperous human population, and the challenge to produce this food in an environmentally sustainable way. Current levels of production of especially animal-source food (ASF), pose severe pressure on the environment via their emissions to air, water, and soil; and their use of scarce resources, such as la...

  9. The Advanced Neutron Source

    International Nuclear Information System (INIS)

    Hayter, J.B.

    1989-01-01

    The Advanced Neutron Source (ANS) is a new user experimental facility planned to be operational at Oak Ridge in the late 1990's. The centerpiece of the ANS will be a steady-state research reactor of unprecedented thermal neutron flux (φ th ∼ 9·10 19 m -2 ·s -1 ) accompanied by extensive and comprehensive equipment and facilities for neutron-based research. 5 refs., 5 figs

  10. Source of seismic signals

    Energy Technology Data Exchange (ETDEWEB)

    Frankovskii, B.A.; Khor' yakov, K.A.

    1980-08-30

    Patented is a source of seismic signals consisting of a shock generator with a basic low-voltage and auxillary high-voltage stator coils, a capacitive transformer and control switches. To increase the amplitude of signal excitation a condensor battery and auxillary commutator are introduced into the device, which are connected in parallel and serially into the circuit of the main low-voltage stator coil.

  11. Radioisotope Power Sources

    International Nuclear Information System (INIS)

    Culwell, J. P.

    1963-01-01

    The radioisotope power programme of the US Atomic Energy Commission has brought forth a whole new technology of the use of radioisotopes as energy sources in electric power generators. Radioisotope power systems are particularly suited for remote applications where long-lived, compact, reliable power is needed. Able to perform satisfactorily under extreme environmental conditions of temperature, sunlight and electromagnetic radiations, these ''atomic batteries'' are attractive power sources for remote data collecting devices, monitoring systems, satellites and other space missions. Radioisotopes used as fuels generally are either alpha or beta emitters. Alpha emitters are the preferable fuels but are more expensive and less available than beta fuels and are generally reserved for space applications. Beta fuels separated from reactor fission wastes are being used exclusively in land and sea applications at the present. It can be expected, however, that beta emitters such as stiontium-90 eventually will be used in space. Development work is being carried out on generators which will use mixed fission products as fuel. This fuel will be less expensive than the pure radioisotopes since the costs of isotope separation and purification are eliminated. Prototype thermoelectric generators, fuelled with strontium-90 and caesium-137, are now in operation or being developed for use in weather stations, marine navigation aids and deep sea monitoring devices. A plutonium-238 thermoelectric generator is in orbit operating as electric power source in a US Navy TRANSIT satellite. Generators are under development for use on US National Aeronautics and Space Administration missions. The large quantities of radioactivity involved in radioisotope power sources require that special attention be given to safety aspects of the units. Rigid safety requirements have been established and extensive tests have been conducted to insure that these systems can be employed without creating undue

  12. Sources and diagenet..

    African Journals Online (AJOL)

    The inter-site differences in 13C and 151V could be related to the sources of OM. In the Msasani Bay the material is derived from seagrasses while in the Dar es salaam harbour and Msimbazi micro-bay, large proportion is derived from the continent. Other parameters ofOC, nitrogen and C/N ratios for these three sites show ...

  13. Open Source Software Development

    Science.gov (United States)

    2011-01-01

    appropriate to refer to FOSS or FLOSS (L for Libre , where the alternative term “ libre software ” has popularity in some parts of the world) in order...Applying Social Network Analysis to Community-Drive Libre Software Projects, Intern. J. Info. Tech. and Web Engineering, 2006, 1(3), 27-28. 17...Open Source Software Development* Walt Scacchi Institute for Software Researcher University of California, Irvine Irvine, CA 92697-3455 USA Abstract

  14. Tritium sources; Izvori tricijuma

    Energy Technology Data Exchange (ETDEWEB)

    Glodic, S [Institute of Nuclear Sciences VINCA, Belgrade (Yugoslavia); Boreli, F [Elektrotehnicki fakultet, Belgrade (Yugoslavia)

    1993-07-01

    Tritium is the only radioactive isotope of hydrogen. It directly follows the metabolism of water and it can be bound into genetic material, so it is very important to control levels of contamination. In order to define the state of contamination it is necessary to establish 'zero level', i.e. actual global inventory. The importance of tritium contamination monitoring increases with the development of fusion power installations. Different sources of tritium are analyzed and summarized in this paper. (author)

  15. Stutter seismic source

    Energy Technology Data Exchange (ETDEWEB)

    Gumma, W. H.; Hughes, D. R.; Zimmerman, N. S.

    1980-08-12

    An improved seismic prospecting system comprising the use of a closely spaced sequence of source initiations at essentially the same location to provide shorter objective-level wavelets than are obtainable with a single pulse. In a preferred form, three dynamite charges are detonated in the same or three closely spaced shot holes to generate a downward traveling wavelet having increased high frequency content and reduced content at a peak frequency determined by initial testing.

  16. Radioactive sources in brachytherapy:

    OpenAIRE

    Burger, Janez

    2003-01-01

    Background. In modern brachytherapy, a greast step forward was made in the 1960s in France with the introduction of new radioactive isotopes and new techniques. These innovations spread rapidly across Europe, though no single dosimetry standard had been set by then. In the new millennium, the advances in brachytherapy are further stimulated by the introduction of 3-D imaging techniques and the latest after loading irradiation equipment that use point sources. The international organiyation IC...

  17. The advanced neutron source

    International Nuclear Information System (INIS)

    Raman, S.; Hayter, J.B.

    1990-01-01

    The Advanced Neutron Source (ANS) is a new user experimental facility planned to be operational at Oak Ridge in the late 1990's. The centerpiece of the ANS will be a steady-state research reactor of unprecedented thermal neutron flux (φ th ∼ 8 x 10 19 m -2 ·s -1 ) accompanied by extensive and comprehensive equipment and facilities for neutron-based research

  18. Mixed phase evaporation source

    International Nuclear Information System (INIS)

    1975-01-01

    Apparatus for reducing convection current heat loss in electron beam evaporator is described. A material to be evaporated (evaporant) is placed in the crucible of an electron beam evaporation source along with a porous mass formed of a powdered or finely divided solid to act as an impedance to convection currents. A feed system is employed to replenish the supply of evaporant as it is vaporized

  19. Protected isotope heat source

    International Nuclear Information System (INIS)

    Burns, R.K.; Shure, L.I.; Katzen, E.D.

    1975-01-01

    A radioactive isotope capsule is disposed in a container (heat shield) which will have a single stable trim attitude when reentering the earth's atmosphere and while falling to earth. The center of gravity of the heat source is located forward of the midpoint between the front face and the rear face of the container. The capsule is insulated from the front face of the container but not from the rear surface of the container. (auth)

  20. Background sources at PEP

    International Nuclear Information System (INIS)

    Lynch, H.; Schwitters, R.F.; Toner, W.T.

    1988-01-01

    Important sources of background for PEP experiments are studied. Background particles originate from high-energy electrons and positrons which have been lost from stable orbits, γ-rays emitted by the primary beams through bremsstrahlung in the residual gas, and synchrotron radiation x-rays. The effect of these processes on the beam lifetime are calculated and estimates of background rates at the interaction region are given. Recommendations for the PEP design, aimed at minimizing background are presented. 7 figs., 4 tabs

  1. BEPC II positron source

    International Nuclear Information System (INIS)

    Pei Guoxi; Sun Yaolin; Liu Jintong; Chi Yunlong; Liu Yucheng; Liu Nianzong

    2006-01-01

    BEPC II-an upgrade project of the Beijing Electron Positron Collider (BEPC) is a factory type of e + e - collider. The fundamental requirements for its injector linac are the beam energy of 1.89 GeV for on-energy injection and a 40 mA positron beam current at the linac end with a low beam emittance of 1.6 μm and a low energy spread of ±0.5% so as to guarantee a higher injection rate (≥50 mA/min) to the storage ring. Since the positron flux is proportional to the primary electron beam power on the target, the authors will increase the electron gun current from 4A to 10A by using a new electron gun system and increase the primary electron energy from 120 MeV to 240 MeV. The positron source itself is an extremely important system for producing more positrons, including a positron converter target chamber, a 12kA flux modulator, the 7m focusing module with DC power supplies and the support. The new positron production linac from the electron gun to the positron source has been installed into the tunnel. In what follows, the authors will emphasize the positron source design, manufacture and tests. (authors)

  2. Carbon source for fermentation

    Energy Technology Data Exchange (ETDEWEB)

    1977-11-25

    Molasses is hydrolyzed and treated with Ca/sup 2 +/ to produce fructose and a good C-source for glutamic acid and lysine fermentation. Thus, sugarcane molasses was diluted with H/sub 2/O, adjusted to pH 1.5, and kept at 60/sup 0/ for 4 hr. Three liters of this solution was cooled to 0/sup 0/ and 262 g Ca(OH)/sub 2/ in a 30% solution was added, along with seed crystals of Ca-fructose additional product. Crystal addition product was recovered and dissolved; the solution contained 6.4g glucose and 168 g fructose, a 50% yield of fructose. The mother liquor was neutralized with H/sub 2/SO/sub 4/ to precipitate the Ca. The supernatant contained 284 g glucose and 159 g fructose and was used as the C source in a fermentation medium in which Coryne-bacterium lilum produced glutamic acid. Yield was 49.0 g/L compared to 48.3 g/L when molasses was used as the C source.

  3. Nonambipolar electron source

    International Nuclear Information System (INIS)

    Longmier, B.; Baalrud, S.; Hershkowitz, N.

    2006-01-01

    A radio frequency (rf) plasma-based electron source that does not rely on electron emission at a cathode surface has been constructed. All of the random electron flux incident on an exit aperture is extracted through an electron sheath resulting in total nonambipolar flow within the device when the ratio of the ion loss area to the electron loss area is approximately equal to the square root of the ratio of the ion mass to the electron mass, and the ion sheath potential drop at the chamber walls is much larger than T e /e. The nonambipolar electron source (NES) has an axisymmetric magnetic field of 100 G at the extraction aperture that results in a uniform plasma potential across the aperture, allowing the extraction of all the incident electron flux without the use of grids. A prototype NES has produced 15 A of continuous electron current, using 15 SCCM (SCCM denotes cubic centimeter per minute at STP) Ar, 1200 W rf power at 13.56 MHz, and 6 times gas utilization. Alternatively 8 A of electron current can be produced, using 3 SCCM Ar at 1200 W rf and 20 times gas utilization. NES could replace hollow cathode electron sources in a wide variety of applications

  4. Future Synchrotron Radiation Sources

    CERN Document Server

    Winick, Herman

    2003-01-01

    Sources of synchrotron radiation (also called synchrotron light) and their associated research facilities have experienced a spectacular growth in number, performance, and breadth of application in the past two to three decades. In 1978 there were eleven electron storage rings used as light sources. Three of these were small rings, all below 500 mega-electron volts (MeV), dedicated to this purpose; the others, with energy up to 5 giga-electron volts (GeV), were used parasitically during the operation of the ring for high energy physics research. In addition, at that time synchrotron radiation from nine cyclic electron synchrotrons, with energy up to 5 GeV, was also used parasitically. At present no cyclic synchrotrons are used, while about 50 electron storage rings are in operation around the world as fully dedicated light sources for basic and applied research in a wide variety of fields. Among these fields are structural molecular biology, molecular environmental science, materials, analytic chemistry, micr...

  5. Inverted magnetron ion source

    International Nuclear Information System (INIS)

    Singh, B.; Boyarsky, D.

    1985-01-01

    The present invention provides, in a preferred embodiment, a cylindrical stainless steel cathode with end pieces thereon to form a cathode chamber within. In addition, in a preferred embodiment, there is a stainless steel rod which passes axially through the cathode chamber and which is electrically insulated therefrom at the end pieces. The stainless steel cathode has first and second apertures formed therein with the first to be connected to a source of ionizable gas and the second to act as the opening through which there passes a stream of ions to an ion beam target. A magnetic flux source is coupled to the cathode chamber to pass magnetic flux therethrough and a voltage source is connected between the anode and the cathode to provide an electrostatic field therebetween whereby when ionizable gas is fed into the cathode chamber, it is ionized and a stream of ions emanates from the second aperture. In a preferred embodiment there is further provided an electrostatic ion focusing means to focus the ion stream emanating from the second aperture

  6. Introscopy using gamma sources

    International Nuclear Information System (INIS)

    Gromov, Yu.V.; Leonov, B.I.; Najorov, A.N.; Smirnov, N.N.; Firstov, V.G.

    1978-01-01

    A method is described of working with standard 170 Tm, 75 Se, 192 Ir, 137 Cs and 60 Co sources at the activity of 1-4000 Ci, during television gamma introscopy of steel products. Experiments involving the RI-10T introscope are carried out to determine prospects of using various radiation sources. The results of using X-ray instruments for control of steel products are also shown for comparison. In introscopy of X-rayed steel products over 25 mm thick, spreading of the edge of the detected groove image is shown to be comparable when using X radiation and gamma radiation of standard sources. Sensitivity of control by fluorographic introscope in X-raying and gamma irradiation of products over 25 mm thick will presumably be the same owing to the detector storage capacity. The use of commercial gamma flaw detecting instruments together with a television introscope permits to reliably reveal defects of 0.5-2.0 mm in size, eliminating possible instability of operation of X-ray instruments, particularly in field conditions

  7. Natural sources of ionizing radiations

    International Nuclear Information System (INIS)

    Marej, A.N.

    1984-01-01

    Natural sources of ionizing radiations are described in detail. The sources are subdivided into sources of extraterrestrial origin (cosmic radiation) and sources of terrestrial origin. Data on the concentration of different nuclides in rocks, various soils, ground waters, atmospheric air, tissues of plants and animals, various food stuffs are presented. The content of natural radionuclides in environmental objects, related to human activities, is discussed

  8. Source Monitoring in Alzheimer's Disease

    Science.gov (United States)

    El Haj, Mohamad; Fasotti, Luciano; Allain, Philippe

    2012-01-01

    Source monitoring is the process of making judgments about the origin of memories. There are three categories of source monitoring: reality monitoring (discrimination between self- versus other-generated sources), external monitoring (discrimination between several external sources), and internal monitoring (discrimination between two types of…

  9. Online Sources of Competitive Intelligence.

    Science.gov (United States)

    Wagers, Robert

    1986-01-01

    Presents an approach to using online sources of information for competitor intelligence (i.e., monitoring industry and tracking activities of competitors); identifies principal sources; and suggests some ways of making use of online databases. Types and sources of information and sources and database charts are appended. Eight references are…

  10. Chandra Source Catalog: User Interface

    Science.gov (United States)

    Bonaventura, Nina; Evans, Ian N.; Rots, Arnold H.; Tibbetts, Michael S.; van Stone, David W.; Zografou, Panagoula; Primini, Francis A.; Glotfelty, Kenny J.; Anderson, Craig S.; Chen, Judy C.; Davis, John E.; Doe, Stephen M.; Evans, Janet D.; Fabbiano, Giuseppina; Galle, Elizabeth C.; Gibbs, Danny G., II; Grier, John D.; Hain, Roger; Hall, Diane M.; Harbo, Peter N.; He, Helen; Houck, John C.; Karovska, Margarita; Kashyap, Vinay L.; Lauer, Jennifer; McCollough, Michael L.; McDowell, Jonathan C.; Miller, Joseph B.; Mitschang, Arik W.; Morgan, Douglas L.; Mossman, Amy E.; Nichols, Joy S.; Nowak, Michael A.; Plummer, David A.; Refsdal, Brian L.; Siemiginowska, Aneta L.; Sundheim, Beth A.; Winkelman, Sherry L.

    2009-09-01

    The Chandra Source Catalog (CSC) is intended to be the definitive catalog of all X-ray sources detected by Chandra. For each source, the CSC provides positions and multi-band fluxes, as well as derived spatial, spectral, and temporal source properties. Full-field and source region data products are also available, including images, photon event lists, light curves, and spectra. The Chandra X-ray Center CSC website (http://cxc.harvard.edu/csc/) is the place to visit for high-level descriptions of each source property and data product included in the catalog, along with other useful information, such as step-by-step catalog tutorials, answers to FAQs, and a thorough summary of the catalog statistical characterization. Eight categories of detailed catalog documents may be accessed from the navigation bar on most of the 50+ CSC pages; these categories are: About the Catalog, Creating the Catalog, Using the Catalog, Catalog Columns, Column Descriptions, Documents, Conferences, and Useful Links. There are also prominent links to CSCview, the CSC data access GUI, and related help documentation, as well as a tutorial for using the new CSC/Google Earth interface. Catalog source properties are presented in seven scientific categories, within two table views: the Master Source and Source Observations tables. Each X-ray source has one ``master source'' entry and one or more ``source observation'' entries, the details of which are documented on the CSC ``Catalog Columns'' pages. The master source properties represent the best estimates of the properties of a source; these are extensively described on the following pages of the website: Position and Position Errors, Source Flags, Source Extent and Errors, Source Fluxes, Source Significance, Spectral Properties, and Source Variability. The eight tutorials (``threads'') available on the website serve as a collective guide for accessing, understanding, and manipulating the source properties and data products provided by the catalog.

  11. Selective structural source identification

    Science.gov (United States)

    Totaro, Nicolas

    2018-04-01

    In the field of acoustic source reconstruction, the inverse Patch Transfer Function (iPTF) has been recently proposed and has shown satisfactory results whatever the shape of the vibrating surface and whatever the acoustic environment. These two interesting features are due to the virtual acoustic volume concept underlying the iPTF methods. The aim of the present article is to show how this concept of virtual subsystem can be used in structures to reconstruct the applied force distribution. Some virtual boundary conditions can be applied on a part of the structure, called virtual testing structure, to identify the force distribution applied in that zone regardless of the presence of other sources outside the zone under consideration. In the present article, the applicability of the method is only demonstrated on planar structures. However, the final example show how the method can be applied to a complex shape planar structure with point welded stiffeners even in the tested zone. In that case, if the virtual testing structure includes the stiffeners the identified force distribution only exhibits the positions of external applied forces. If the virtual testing structure does not include the stiffeners, the identified force distribution permits to localize the forces due to the coupling between the structure and the stiffeners through the welded points as well as the ones due to the external forces. This is why this approach is considered here as a selective structural source identification method. It is demonstrated that this approach clearly falls in the same framework as the Force Analysis Technique, the Virtual Fields Method or the 2D spatial Fourier transform. Even if this approach has a lot in common with these latters, it has some interesting particularities like its low sensitivity to measurement noise.

  12. Synchroton Radiation Sources

    International Nuclear Information System (INIS)

    Hulbert, S.L.; Williams, G.P.

    1998-01-01

    Synchrotron radiation is a very bright, broadband, polarized, pulsed source of light extending from the infrared to the x-ray region. It is an extremely important source of Vacuum Ultraviolet radiation. Brightness is defined as flux per unit area per unit solid angle and is normally a more important quantity than flux alone particularly in throughput limited applications which include those in which monochromators are used. It is well known from classical theory of electricity and magnetism that accelerating charges emit electromagnetic radiation. In the case of synchrotron radiation, relativistic electrons are accelerated in a circular orbit and emit electromagnetic radiation in a broad spectral range. The visible portion of this spectrum was first observed on April 24, 1947 at General Electric's Schenectady facility by Floyd Haber, a machinist working with the synchrotron team, although the first theoretical predictions were by Lienard in the latter part of the 1800's. An excellent early history with references was presented by Blewett and a history covering the development of the utilization of synchrotron radiation was presented by Hartman. Synchrotron radiation covers the entire electromagnetic spectrum from the infrared region through the visible, ultraviolet, and into the x-ray region up to energies of many 10's of kilovolts. If the charged particles are of low mass, such as electrons, and if they are traveling relativistically, the emitted radiation is very intense and highly collimated, with opening angles of the order of 1 milliradian. In electron storage rings there are three possible sources of synchrotron radiation; dipole (bending) magnets; wigglers, which act like a sequence of bending magnets with alternating polarities; and undulators, which are also multi-period alternating magnet systems but in which the beam deflections are small resulting in coherent interference of the emitted light

  13. Chernobyl source term estimation

    International Nuclear Information System (INIS)

    Gudiksen, P.H.; Harvey, T.F.; Lange, R.

    1990-09-01

    The Chernobyl source term available for long-range transport was estimated by integration of radiological measurements with atmospheric dispersion modeling and by reactor core radionuclide inventory estimation in conjunction with WASH-1400 release fractions associated with specific chemical groups. The model simulations revealed that the radioactive cloud became segmented during the first day, with the lower section heading toward Scandinavia and the upper part heading in a southeasterly direction with subsequent transport across Asia to Japan, the North Pacific, and the west coast of North America. By optimizing the agreement between the observed cloud arrival times and duration of peak concentrations measured over Europe, Japan, Kuwait, and the US with the model predicted concentrations, it was possible to derive source term estimates for those radionuclides measured in airborne radioactivity. This was extended to radionuclides that were largely unmeasured in the environment by performing a reactor core radionuclide inventory analysis to obtain release fractions for the various chemical transport groups. These analyses indicated that essentially all of the noble gases, 60% of the radioiodines, 40% of the radiocesium, 10% of the tellurium and about 1% or less of the more refractory elements were released. These estimates are in excellent agreement with those obtained on the basis of worldwide deposition measurements. The Chernobyl source term was several orders of magnitude greater than those associated with the Windscale and TMI reactor accidents. However, the 137 Cs from the Chernobyl event is about 6% of that released by the US and USSR atmospheric nuclear weapon tests, while the 131 I and 90 Sr released by the Chernobyl accident was only about 0.1% of that released by the weapon tests. 13 refs., 2 figs., 7 tabs

  14. Internal sources dosimetry

    International Nuclear Information System (INIS)

    Savio, Eduardo

    1994-01-01

    The absorbed dose, need of estimation in risk evaluation in the application of radiopharmaceuticals in Nuclear Medicine practice,internal dosimetry,internal and external sources. Calculation methodology,Marinelli model,MIRD system for absorbed dose calculation based on biological parameters of radiopharmaceutical in human body or individual,energy of emitted radiations by administered radionuclide, fraction of emitted energy that is absorbed by target body.Limitation of the MIRD calculation model. A explanation of Marinelli method of dosimetry calculation,β dosimetry. Y dosimetry, effective dose, calculation in organs and tissues, examples. Bibliography .

  15. Pulsed Plasma Electron Sources

    Science.gov (United States)

    Krasik, Yakov

    2008-11-01

    Pulsed (˜10-7 s) electron beams with high current density (>10^2 A/cm^2) are generated in diodes with electric field of E > 10^6 V/cm. The source of electrons in these diodes is explosive emission plasma, which limits pulse duration; in the case E Saveliev, J. Appl. Phys. 98, 093308 (2005). Ya. E. Krasik, A. Dunaevsky, and J. Felsteiner, Phys. Plasmas 8, 2466 (2001). D. Yarmolich, V. Vekselman, V. Tz. Gurovich, and Ya. E. Krasik, Phys. Rev. Lett. 100, 075004 (2008). J. Z. Gleizer, Y. Hadas and Ya. E. Krasik, Europhysics Lett. 82, 55001 (2008).

  16. Compact ion accelerator source

    Science.gov (United States)

    Schenkel, Thomas; Persaud, Arun; Kapadia, Rehan; Javey, Ali

    2014-04-29

    An ion source includes a conductive substrate, the substrate including a plurality of conductive nanostructures with free-standing tips formed on the substrate. A conductive catalytic coating is formed on the nanostructures and substrate for dissociation of a molecular species into an atomic species, the molecular species being brought in contact with the catalytic coating. A target electrode placed apart from the substrate, the target electrode being biased relative to the substrate with a first bias voltage to ionize the atomic species in proximity to the free-standing tips and attract the ionized atomic species from the substrate in the direction of the target electrode.

  17. Compact synchrotron radiation source

    International Nuclear Information System (INIS)

    Liu, N.; Wang, T.; Tian, J.; Lin, Y.; Chen, S.; He, W.; Hu, Y.; Li, Q.

    1985-01-01

    A compact 800 MeV synchrotron radiation source is discussed. The storage ring has a circumference of 30.3 m, two 90 degree and four 45 degree bending magnet sections, two long straight sections and four short straight sections. The radius of the bending magnet is 2.224m. The critical wave length is 24A. The injector is a 15 Mev Microtron Electrons are accelerated from 15 Mev to 800 Mev by ramping the field of the ring. The expected stored current will be around 100 ma

  18. PLANTS, SOURCE FOR BIOFUELS

    Directory of Open Access Journals (Sweden)

    Irina Ramona PECINGINĂ

    2016-12-01

    Full Text Available The most affordable alternative energy sources to fossil plants with hydropower are some oils that accumulate in different organs other accumulating carbohydrates with high energy value. They are known worldwide and cultivated a number of plant species entering the oilseeds, which provides significant production of edible oil (soybean, sunflower, etc. Vegetable oils or their product derived biodiesel fuels are potential diesel engines, representing an alternative to fuels. The most promising suitable for the production of oil crops "with short circuit "or biodiesel are fruits and seeds, both herbaceous and tree.

  19. Central radio sources

    International Nuclear Information System (INIS)

    Phinney, E.S.

    1985-01-01

    The compact radio sources in the nuclei of most active galaxies lie closer to their centers of activity than any other region accessible to observation, excepting only the broad emission line region. They provide uniquely strong evidence for bulk motion of matter at relativistic velocities, encouraging the belief that the activity originates in a gravitational potential well whose escape velocity is of the order of the speed of light. The observational facts are reviewed as well as several theoretical pictures of them. Those places where systematic observations could help to distinguish the true theoretical picture from the many competing forgeries are emphasized. 76 references

  20. Contact ionization ion source

    International Nuclear Information System (INIS)

    Hashmi, N.; Van Der Houven Van Oordt, A.J.

    1975-01-01

    An ion source in which an apertured or foraminous electrode having a multiplicity of openings is spaced from one or more active surfaces of an ionisation electrode, the active surfaces comprising a material capable of ionising by contact ionization a substance to be ionized supplied during operation to the active surface or surfaces comprises means for producing during operation a magnetic field which enables a stable plasma to be formed in the space between the active surface or surfaces and the apertured electrode, the field strength of the magnetic field being preferably in the range between 2 and 8 kilogauss. (U.S.)

  1. Alternative energy sources

    International Nuclear Information System (INIS)

    Chapman, P.

    1978-01-01

    It is suggested that the development of alternative energy sources has made them more attractive than nuclear power, due to their characteristics, such as small scale and short lead times, moderate costs and minimal environmental impact. The objectives of energy policy are discussed in relation to forecasts of energy demand. Tables show (a) projected useful energy demands UK; (b) patterns of end-use of energy; (c) costs of heating fuels; (d) net present value of gas purchases; (e) useful-energy by end-use analysis; and (f) primary fuel summary 2025. The contributions of hydro, nuclear, waves, solar, oil, gas and coal are estimated to 2025. (U.K.)

  2. Data source handbook

    CERN Document Server

    Warden, Pete

    2011-01-01

    If you''re a developer looking to supplement your own data tools and services, this concise ebook covers the most useful sources of public data available today. You''ll find useful information on APIs that offer broad coverage, tie their data to the outside world, and are either accessible online or feature downloadable bulk data. You''ll also find code and helpful links. This guide organizes APIs by the subjects they cover-such as websites, people, or places-so you can quickly locate the best resources for augmenting the data you handle in your own service. Categories include: Website tools

  3. GPC Single Source Letter

    Science.gov (United States)

    This document may be of assistance in applying the New Source Review (NSR) air permitting regulations including the Prevention of Significant Deterioration (PSD) requirements. This document is part of the NSR Policy and Guidance Database. Some documents in the database are a scanned or retyped version of a paper photocopy of the original. Although we have taken considerable effort to quality assure the documents, some may contain typographical errors. Contact the office that issued the document if you need a copy of the original.

  4. Sources of tritium

    International Nuclear Information System (INIS)

    Phillips, J.E.; Easterly, C.E.

    1980-12-01

    A review of tritium sources is presented. The tritium production and release rates are discussed for light water reactors (LWRs), heavy water reactors (HWRs), high temperature gas cooled reactors (HTGRs), liquid metal fast breeder reactors (LMFBRs), and molten salt breeder reactors (MSBRs). In addition, release rates are discussed for tritium production facilities, fuel reprocessing plants, weapons detonations, and fusion reactors. A discussion of the chemical form of the release is included. The energy producing facilities are ranked in order of increasing tritium production and release. The ranking is: HTGRs, LWRs, LMFBRs, MSBRs, and HWRs. The majority of tritium has been released in the form of tritiated water

  5. Heidelberg polarized alkali source

    International Nuclear Information System (INIS)

    Kraemer, D.; Steffens, E.; Jaensch, H.; Philipps Universitaet, Marburg, Germany)

    1984-01-01

    A new atomic beam type polarized alkali ion source has been installed at Heidelberg. In order to improve the beam polarization considerably optical pumping is applied in combination with an adiabatic medium field transition which results in beams in single hyperfine sublevels. The m state population is determined by laser-induced fluorescence spectroscopy. Highly polarized beams (P/sub s/ > 0.9, s = z, zz) with intensities of 30 to 130 μA can be extracted for Li + and Na + , respectively

  6. Neutron source multiplication method

    International Nuclear Information System (INIS)

    Clayton, E.D.

    1985-01-01

    Extensive use has been made of neutron source multiplication in thousands of measurements of critical masses and configurations and in subcritical neutron-multiplication measurements in situ that provide data for criticality prevention and control in nuclear materials operations. There is continuing interest in developing reliable methods for monitoring the reactivity, or k/sub eff/, of plant operations, but the required measurements are difficult to carry out and interpret on the far subcritical configurations usually encountered. The relationship between neutron multiplication and reactivity is briefly discussed and data presented to illustrate problems associated with the absolute measurement of neutron multiplication and reactivity in subcritical systems. A number of curves of inverse multiplication have been selected from a variety of experiments showing variations observed in multiplication during the course of critical and subcritical experiments where different methods of reactivity addition were used, with different neutron source detector position locations. Concern is raised regarding the meaning and interpretation of k/sub eff/ as might be measured in a far subcritical system because of the modal effects and spectrum differences that exist between the subcritical and critical systems. Because of this, the calculation of k/sub eff/ identical with unity for the critical assembly, although necessary, may not be sufficient to assure safety margins in calculations pertaining to far subcritical systems. Further study is needed on the interpretation and meaning of k/sub eff/ in the far subcritical system

  7. Open source clustering software.

    Science.gov (United States)

    de Hoon, M J L; Imoto, S; Nolan, J; Miyano, S

    2004-06-12

    We have implemented k-means clustering, hierarchical clustering and self-organizing maps in a single multipurpose open-source library of C routines, callable from other C and C++ programs. Using this library, we have created an improved version of Michael Eisen's well-known Cluster program for Windows, Mac OS X and Linux/Unix. In addition, we generated a Python and a Perl interface to the C Clustering Library, thereby combining the flexibility of a scripting language with the speed of C. The C Clustering Library and the corresponding Python C extension module Pycluster were released under the Python License, while the Perl module Algorithm::Cluster was released under the Artistic License. The GUI code Cluster 3.0 for Windows, Macintosh and Linux/Unix, as well as the corresponding command-line program, were released under the same license as the original Cluster code. The complete source code is available at http://bonsai.ims.u-tokyo.ac.jp/mdehoon/software/cluster. Alternatively, Algorithm::Cluster can be downloaded from CPAN, while Pycluster is also available as part of the Biopython distribution.

  8. Duopigatron ion source studies

    International Nuclear Information System (INIS)

    Bacon, F.M.; Bickes, R.W. Jr.; O'Hagan, J.B.

    1978-07-01

    Ion source performance characteristics consisting of total ion current, ion energy distribution, mass distribution, and ion current density distribution were measured for several models of a duopigatron. Variations on the duopigatron design involved plasma expansion cup material and dimensions, secondary cathode material, and interelectrode spacings. Of the designs tested, the one with a copper and molybdenum secondary cathode and a mild steel plasma expansion cup proved to give the best results. The ion current density distribution was peaked at the center of the plasma expansion cup and fell off to 80 percent of the peak value at the cup wall for a cup 15.2 mm deep. A total ion current of 180 mA consisting of 60 to 70 percent atomic ions was produced with an arc current of 20 A and source pressure of 9.3 Pa. More shallow cups produced a larger beam current and a more sharply peaked ion current density distribution. Typical ion energy distributions were bell-shaped curves with a peak 10 to 20 V below anode potential and with ion energies extending 30 to 40 V on either side of the peak

  9. Moving Sources Detection System

    International Nuclear Information System (INIS)

    Coulon, Romain; Kondrasovs, Vladimir; Boudergui, Karim; Normand, Stephane

    2013-06-01

    To monitor radioactivity passing through a pipe or in a given container such as a train or a truck, radiation detection systems are commonly employed. These detectors could be used in a network set along the source track to increase the overall detection efficiency. However detection methods are based on counting statistics analysis. The method usually implemented consists in trigging an alarm when an individual signal rises over a threshold initially estimated in regards to the natural background signal. The detection efficiency is then proportional to the number of detectors in use, due to the fact that each sensor is taken as a standalone sensor. A new approach is presented in this paper taking into account the temporal periodicity of the signals taken by all distributed sensors as a whole. This detection method is not based only on counting statistics but also on the temporal series analysis aspect. Therefore, a specific algorithm is then developed in our lab for this kind of applications and shows a significant improvement, especially in terms of detection efficiency and false alarms reduction. We also plan on extracting information from the source vector. This paper presents the theoretical approach and some preliminary results obtain in our laboratory. (authors)

  10. Alternative energy sources

    Energy Technology Data Exchange (ETDEWEB)

    Ruiter, J P [N. V. Kema te Arnhem, NL

    1975-01-01

    A review of alternative energy sources is presented. Solar energy may be used by collecting the heat for direct use or by converting it to electricity. Flat-plate and concentrating collectors are described. Wind energy is an indirect form of solar energy, and has been used for many years in the Netherlands. Calculations of the efficiency of windmills, and of the useful available wind energy along the Netherlands' coastline, are provided. The conversion of organic waste to useable energy is described, including techniques of pyrolysis, combustion, and biological conversion. Tidal energy and ocean-thermal-gradient power plants are briefly described. Geothermal energy is a particularly attractive resource. The average temperature gradient is about 30/sup 0/C/km, ranging from 10/sup 0/C/km in South Africa to 150/sup 0/C/km in Italy. In the Netherlands it ranges from 20-50/sup 0/C/km. The various types of geothermal systems (steam, water, geopressured) are reviewed, and presently operating geothermal power plants are described. A comparison is made of the costs of various energy sources, and 27 references are provided.

  11. The advanced neutron source

    International Nuclear Information System (INIS)

    Hayter, J.B.

    1994-01-01

    The Advanced Neutron Source (ANS), slated for construction start in 1994, will be a multipurpose neutron research laboratory serving academic and industrial users in chemistry, biology, condensed matter physics, nuclear and fundamental physics, materials science and engineering, and many other fields. It will be centered on the world's highest flux neutron beam reactor, operating at 330 MW, with careful design integration between the neutron source and the experiment systems. Many instruments will be situated in low backgrounds at distances up to 80 m from the reactor, using neutron guides with tailored neutron optical coatings for beam transport. Apart from the many stations for neutron scattering research, specialized stations will also be provided for isotope separation on-line, experiments with liquid hydrogen targets, neutron optical techniques such as interferometry, activation analysis, depth profiling, and positron production. Careful consideration has been given to providing a good research environment for visiting scientists, including easy access to the experimental areas, while maintaining a highly secure nuclear facility. This paper will describe the reactor and experimental facilities and give some examples of the types of research for which ANS has been designed

  12. Plasma source ion implantation

    International Nuclear Information System (INIS)

    Conrad, J.R.; Forest, C.

    1986-01-01

    The authors' technique allows the ion implantation to be performed directly within the ion source at higher currents without ion beam extraction and transport. The potential benefits include greatly increased production rates (factors of 10-1000) and the ability to implant non-planar targets without rastering or shadowing. The technique eliminates the ion extractor grid set, beam raster equipment, drift space and target manipulator equipment. The target to be implanted is placed directly within the plasma source and is biased to a large negative potential so that plasma ions gain energy as they accelerate through the potential drop across the sheath that forms at the plasma boundary. Because the sheath surrounds the target on all sides, all surfaces of the target are implanted without the necessity to raster the beam or to rotate the target. The authors have succeeded in implanting nitrogen ions in a silicon target to the depths and concentrations required for surface treatment of materials like stainless steel and titanium alloys. They have performed ESCA measurements of the penetration depth profile of a silicon target that was biased to 30 kV in a nitrogen discharge plasma. Nitrogen ions were implanted to a depth of 700A at a peak concentration of 30% atomic. The measured profile is quite similar to a previously obtained profile in titanium targets with conventional techniques

  13. New source review for stationary sources of air pollution

    National Research Council Canada - National Science Library

    Committee on Changes in New Source Review Programs for Stationary Sources of Air Pollution, National Research Council

    2006-01-01

    The Clean Air Act established a pair of programsâ€"known as New Source Review (NSR)â€"that regulate large stationary sources of air pollution, such as factories and electricity-generating facilities...

  14. GANIL Workshop on Ion Sources

    International Nuclear Information System (INIS)

    Leroy, Renan

    1999-01-01

    The proceedings of the GANIL Workshop on Ion Sources held at GANIL - Caen on 18-19 March 1999 contains 13 papers aiming at improving the old source operation and developing new types of sources for nuclear research and studies of ion physics. A number of reports are devoted to applications like surface treatment, ion implantation or fusion injection. The 1+→n+ transformation, charged particle transport in ECR sources, addition of cesium and xenon in negative ion sources and other basic issues in ion sources are also addressed

  15. Solar Power Sources

    DEFF Research Database (Denmark)

    Kim, Katherine A.; Mentesidi, Konstantina; Yang, Yongheng

    2017-01-01

    a significant change. Beyond this energy transition, the still declining cost of the solar technology has become an important driving force for more solar-powered systems. However, high penetration of solar-powered systems also brings technical challenges to the entire energy systems. In order to fully address......Solar power is highly abundant, relatively reliable, and not limited to a geographic region, making it one of the most important renewable energy sources. Catering for a clean and green energy system, solar energy will be an active player in the future mixed power grid that is also undergoing...... those issues, the technological properties of solar power should be investigated. Thus, the basics of solar power technology will be introduced and discussed in this chapter....

  16. Thulium-170 heat source

    Science.gov (United States)

    Walter, Carl E.; Van Konynenburg, Richard; VanSant, James H.

    1992-01-01

    An isotopic heat source is formed using stacks of thin individual layers of a refractory isotopic fuel, preferably thulium oxide, alternating with layers of a low atomic weight diluent, preferably graphite. The graphite serves several functions: to act as a moderator during neutron irradiation, to minimize bremsstrahlung radiation, and to facilitate heat transfer. The fuel stacks are inserted into a heat block, which is encased in a sealed, insulated and shielded structural container. Heat pipes are inserted in the heat block and contain a working fluid. The heat pipe working fluid transfers heat from the heat block to a heat exchanger for power conversion. Single phase gas pressure controls the flow of the working fluid for maximum heat exchange and to provide passive cooling.

  17. Arsenic pollution sources.

    Science.gov (United States)

    Garelick, Hemda; Jones, Huw; Dybowska, Agnieszka; Valsami-Jones, Eugenia

    2008-01-01

    Arsenic is a widely dispersed element in the Earth's crust and exists at an average concentration of approximately 5 mg/kg. There are many possible routes of human exposure to arsenic from both natural and anthropogenic sources. Arsenic occurs as a constituent in more than 200 minerals, although it primarily exists as arsenopyrite and as a constituent in several other sulfide minerals. The introduction of arsenic into drinking water can occur as a result of its natural geological presence in local bedrock. Arsenic-containing bedrock formations of this sort are known in Bangladesh, West Bengal (India), and regions of China, and many cases of endemic contamination by arsenic with serious consequences to human health are known from these areas. Significant natural contamination of surface waters and soil can arise when arsenic-rich geothermal fluids come into contact with surface waters. When humans are implicated in causing or exacerbating arsenic pollution, the cause can almost always be traced to mining or mining-related activities. Arsenic exists in many oxidation states, with arsenic (III) and (V) being the most common forms. Similar to many metalloids, the prevalence of particular species of arsenic depends greatly on the pH and redox conditions of the matrix in which it exists. Speciation is also important in determining the toxicity of arsenic. Arsenic minerals exist in the environment principally as sulfides, oxides, and phosphates. In igneous rocks, only those of volcanic origin are implicated in high aqueous arsenic concentrations. Sedimentary rocks tend not to bear high arsenic loads, and common matrices such as sands and sandstones contain lower concentrations owing to the dominance of quartz and feldspars. Groundwater contamination by arsenic arises from sources of arsenopyrite, base metal sulfides, realgar and orpiment, arsenic-rich pyrite, and iron oxyhydroxide. Mechanisms by which arsenic is released from minerals are varied and are accounted for by

  18. PRAMU. Contamination sources

    International Nuclear Information System (INIS)

    Asenjo, Armando R.

    2000-01-01

    Mining and milling activities have been carried out in Argentina during the last 40 years, and nowadays National Atomic Energy Commission (CNEA) of Argentina is undertaking the Uranium Mining Environmental Restoration Project (PRAMU). The aim of this project is to achieve that in all the places where uranium mining activities were developed, to restore the environment as much as it is possible, according to the legislation in force. The sites which are studied are: Malargue (Mendoza province), Cordoba (Cordoba province), Los Gigantes (Cordoba province), Huemul (Mendoza province), Pichinan (Chubut province), Tonco (Salta province), La Estela (San Luis province), Los Colorados (La Rioja province). In order to develop the restoration project in each site, one of the first task to be performed is to know quantities and the chemical, physicals and radiological characteristics of the contamination sources. In the present paper the activities of PRAMU in this field, are informed. (author)

  19. Swiss Light Source SLS

    International Nuclear Information System (INIS)

    1999-09-01

    The Paul Scherrer Institute has begun work on the implementation of the Swiss Synchrotron Light Source (SLS). The construction of this facility, which will have international scope, is intended to provide a national focus for co-operation between various disciplines and for research in material sciences. Although basic research in physics and chemistry, biology, medicine and environmental sciences would seem to be in the foreground, industrial users also have an interest in the SLS. At present, this mainly centres on investigations into the structure of biological and chemical molecules, the use of high-performance methods of analysis, and the manufacture and investigation of microstructures. SLS is planned to be taken into service with an initial experimental installation by the middle of 2001. In this brochure an overview is presented on the main characteristics of the SLS facility and on its significance as a tool for interdisciplinary research

  20. Infrared source test

    Energy Technology Data Exchange (ETDEWEB)

    Ott, L.

    1994-11-15

    The purpose of the Infrared Source Test (IRST) is to demonstrate the ability to track a ground target with an infrared sensor from an airplane. The system is being developed within the Advance Technology Program`s Theater Missile Defense/Unmanned Aerial Vehicle (UAV) section. The IRST payload consists of an Amber Radiance 1 infrared camera system, a computer, a gimbaled mirror, and a hard disk. The processor is a custom R3000 CPU board made by Risq Modular Systems, Inc. for LLNL. The board has ethernet, SCSI, parallel I/O, and serial ports, a DMA channel, a video (frame buffer) interface, and eight MBytes of main memory. The real-time operating system VxWorks has been ported to the processor. The application code is written in C on a host SUN 4 UNIX workstation. The IRST is the result of a combined effort by physicists, electrical and mechanical engineers, and computer scientists.

  1. Swiss Light Source SLS

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-09-01

    The Paul Scherrer Institute has begun work on the implementation of the Swiss Synchrotron Light Source (SLS). The construction of this facility, which will have international scope, is intended to provide a national focus for co-operation between various disciplines and for research in material sciences. Although basic research in physics and chemistry, biology, medicine and environmental sciences would seem to be in the foreground, industrial users also have an interest in the SLS. At present, this mainly centres on investigations into the structure of biological and chemical molecules, the use of high-performance methods of analysis, and the manufacture and investigation of microstructures. SLS is planned to be taken into service with an initial experimental installation by the middle of 2001. In this brochure an overview is presented on the main characteristics of the SLS facility and on its significance as a tool for interdisciplinary research.

  2. Sources et bibliographie

    OpenAIRE

    2017-01-01

    Sources manuscrites Archives nationales JJ 97, JJ 111 (registres du Trésor des Chartes) P 490 ; P 492 ; P 493 ; P 13782 ; P 14022 ; P 14023 (Chambre des comptes, Forez, anciens aveux, 1214-1514 et titres du Forez, 1173-1519). Archives départementales de la Loire Série B B 1171 ; B 1189 ; B 1190 ; B 1353 ; B 1571 ; B 1717 ; B 1724 ; B 1839 ; B 1842 ; B 1844 ; B 1850 ; B 1851 ; B 1852 ; B 1853 ; B 1854 ; B 1856 ; B 1858 ; B 1860 ; B 1861 ; B 1862 ; B 1864 ; B 1865 ; B 1866 ; B 1867 ; B 1869 ; B...

  3. SOURCES OF ENTERPRISE VALUE

    Directory of Open Access Journals (Sweden)

    Viorica Mădălina Ion

    2016-05-01

    Full Text Available The value of the enterprise has an increased importance in business valuation, so maximizing it becomes a priority for the interested parties, such as its shareholders or investors. The purpose of this article is the analysis of the sources of enterprise value and its factors, in order to understand the causes of the decrease or the possibilities for maximizing the enterprise value, passing over the main concepts in the literature. The analysis refers to the listed companies on the Bucharest Stock Exchange (BVB from the energy sector, including the largest Romanian company as per its capitalization, OMV Petrom. The research took into account the fact that the analysis of a large company with a long history is facilitated by the existence of multi-annual information, unlike the firms in the early life cycle operating in an emerging market.

  4. Total quality at source

    International Nuclear Information System (INIS)

    Chiandone, A.C.

    1990-01-01

    The Total Quality at Source philosophy is based on optimizing the effectiveness of people in achieving ZERO-DEFECT results. In this paper a philosophy of what, I have come to perceive, it takes to get people to perform to the very best of their abilities and thereby achieve the best results they can, is presented. In the examples I shall describe I have played an instrumental role since it has become my belief that any job can always be done better provided that the people doing it can themselves become convinced that they can do better. Clearly there are many ideas on how to do this. The philosophy that I am presenting in this paper is based on my own experience, where I have both participated and observed it being applied; its effectiveness may be judged by the results. (author)

  5. Nonlinear Source Emulator

    DEFF Research Database (Denmark)

    Nguyen-Duy, Khiem

    of a proposed NSE system with high dynamic performance. The goal of the work is to achieve a state-of-the art transient time of 10 µs. In order to produce the arbitrary nonlinear curve, the exponential function of a typical diode is used, but the diode can be replaced by other nonlinear curve reference...... of conductive common-mode current produced by the high rate of change of voltage over time (high dv/dt) at the NSE output. v/xvii The contributions of the thesis are based on the development of both units: the low Cio isolated power supply and the high dynamic performance NSE. Both units are investigated......-of-the-art dynamic performance among devices of the same kind. It also offers a complete solution for simulation of nonlinear source systems of different sizes, both in terrestrial and non-terrestrial applications. Key words: Current transformers, dc-dc power converters, hysteresis, parasitic capacitance, system...

  6. Interferometry using undulator sources

    International Nuclear Information System (INIS)

    Beguiristain, R.; Goldberg, K.A.; Tejnil, E.; Bokor, J.; Medecki, H.; Attwood, D.T.; Jackson, K.

    1996-01-01

    Optical systems for extreme ultraviolet (EUV) lithography need to use optical components with subnanometer surface figure error tolerances to achieve diffraction-limited performance [M.D. Himel, in Soft X-Ray Projection Lithography, A.M. Hawryluk and R.H. Stulen, eds. (OSA, Washington, D.C., 1993), 18, 1089, and D. Attwood et al., Appl. Opt. 32, 7022 (1993)]. Also, multilayer-coated optics require at-wavelength wavefront measurement to characterize phase effects that cannot be measured by conventional optical interferometry. Furthermore, EUV optical systems will additionally require final testing and alignment at the operational wavelength for adjustment and reduction of the cumulative optical surface errors. Therefore, at-wavelength interferometric measurement of EUV optics will be the necessary metrology tool for the successful development of optics for EUV lithography. An EUV point diffraction interferometer (PDI) has been developed at the Center for X-Ray Optics (CXRO) and has been already in operation for a year [K. Goldberg et al., in Extreme Ultra Lithography, D.T. Attwood and F. Zernike, eds. (OSA, Washington, D.C., 1994), K. Goldberg et al., Proc. SPIE 2437, to be published, and K. Goldberg et al., J. Vac. Sci. Technol. B 13, 2923 (1995)] using an undulator radiation source and coherent optics beamline at the Advanced Light Source (ALS) at Lawrence Berkeley National Laboratory. An overview of the PDI interferometer and some EUV wavefront measurements obtained with this instrument will be presented. In addition, future developments planned for EUV interferometry at CXRO towards the measurement of actual EUV lithography optics will be shown. copyright 1996 American Institute of Physics

  7. Radiation sources and process

    International Nuclear Information System (INIS)

    Honious, H.B.; Janzow, E.F.; Malson, H.A.; Moyer, S.E.

    1980-01-01

    The invention relates to radiation sources comprising a substrate having an electrically-conductive non-radioactive metal surface, a layer of a metal radioactive isotope of the scandium group, which in addition to scandium, yttrium, lanthanum and actinium, includes all the lanthanide and actinide series of elements, with the actinide series usually being preferred because of the nature of the radioactive isotopes therein, particularly americium-241, curium-244, plutonium-238, californium-252 and promethium-147, and a non-radioactive bonding metal codeposited on the surface by electroplating the isotope and bonding metal from an electrolytic solution, the isotope being present in the layer in minor amount as compared to the bonding metal, and with or without a non-radioactive protective metal coating covering the isotoype and bonding metal on the surface, the coating being sufficiently thin to permit radiation to pass through the coating. The invention also relates to a process for providing radiation sources comprising codepositing a layer of the metal radioactive isotope with a non-radioactive bonding metal from an electrolytic solution in which the isotope is present in minor molar amount as compared to the bonding metal such that the codeposited layer contains a minor molar amount of the isotope compared to the bonding metal by electroplating on an electrically-conductive non-radioactive metal surface of a cathode substrate, and with or without depositing a nonradioactive protective metal coating over the isotope and bonding metal on the surface, the coating being sufficiently thin to permit radiation to pass through the coating

  8. Artificial UV sources in perspective

    International Nuclear Information System (INIS)

    Coppell, R.

    1993-01-01

    With rare exceptions, the sun is by far the most important source of exposure to ultraviolet radiation. This is the conclusion of a brief examination into use of artificial sources in New Zealand. (author). 1 tab

  9. Photon sources for absorptiometric measurements

    International Nuclear Information System (INIS)

    Witt, R.M.; Sandrik, J.M.; Cameron, J.R.

    1976-01-01

    Photon absorptiometry is defined and the requirements of photon sources for these measurements are described. Both x-ray tubes and radionuclide sources are discussed, including the advantages of each in absorptiometric systems

  10. SOFTWARE OPEN SOURCE, SOFTWARE GRATIS?

    Directory of Open Access Journals (Sweden)

    Nur Aini Rakhmawati

    2006-01-01

    Full Text Available Normal 0 false false false IN X-NONE X-NONE MicrosoftInternetExplorer4 Berlakunya Undang – undang Hak Atas Kekayaan Intelektual (HAKI, memunculkan suatu alternatif baru untuk menggunakan software open source. Penggunaan software open source menyebar seiring dengan isu global pada Information Communication Technology (ICT saat ini. Beberapa organisasi dan perusahaan mulai menjadikan software open source sebagai pertimbangan. Banyak konsep mengenai software open source ini. Mulai dari software yang gratis sampai software tidak berlisensi. Tidak sepenuhnya isu software open source benar, untuk itu perlu dikenalkan konsep software open source mulai dari sejarah, lisensi dan bagaimana cara memilih lisensi, serta pertimbangan dalam memilih software open source yang ada. Kata kunci :Lisensi, Open Source, HAKI

  11. Mobile Source Observation Database (MSOD)

    Science.gov (United States)

    The Mobile Source Observation Database (MSOD) is a relational database developed by the Assessment and Standards Division (ASD) of the U.S. EPA Office of Transportation and Air Quality (formerly the Office of Mobile Sources).

  12. Testing earthquake source inversion methodologies

    KAUST Repository

    Page, Morgan T.; Mai, Paul Martin; Schorlemmer, Danijel

    2011-01-01

    Source Inversion Validation Workshop; Palm Springs, California, 11-12 September 2010; Nowadays earthquake source inversions are routinely performed after large earthquakes and represent a key connection between recorded seismic and geodetic data

  13. EV-GHG Mobile Source

    Data.gov (United States)

    U.S. Environmental Protection Agency — The EV-GHG Mobile Source Data asset contains measured mobile source GHG emissions summary compliance information on light-duty vehicles, by model, for certification...

  14. Sources for charged particles; Les sources de particules chargees

    Energy Technology Data Exchange (ETDEWEB)

    Arianer, J.

    1997-09-01

    This document is a basic course on charged particle sources for post-graduate students and thematic schools on large facilities and accelerator physics. A simple but precise description of the creation and the emission of charged particles is presented. This course relies on every year upgraded reference documents. Following relevant topics are considered: electronic emission processes, technological and practical considerations on electron guns, positron sources, production of neutral atoms, ionization, plasma and discharge, different types of positive and negative ion sources, polarized particle sources, materials for the construction of ion sources, low energy beam production and transport. (N.T.).

  15. Quasi-Y-source inverter

    DEFF Research Database (Denmark)

    Siwakoti, Yam Prasad; Blaabjerg, Frede; Loh, Poh Chiang

    2015-01-01

    This paper introduces a new inverter topology called a “quasi-Y-source inverter”. The proposed inverter inherits all the advantages of the original Y-source inverter. In addition, the new topology draws continuous current from the source which is required for many renewable sources. It also has dc......-current-blocking capacitors, which avoids saturation in the transformer core. Simulations and experimental results have proved the validity of the proposed inverter....

  16. Global Sourcing and Firm Selection

    DEFF Research Database (Denmark)

    Kohler, Wilhelm; Smolka, Marcel

    2014-01-01

    We analyze the sourcing strategies of firms active in the Spanish manufacturing sector. We show that firms that select strategies of vertical integration and of foreign sourcing ex post tend to have been more productive, ex ante, than other firms.......We analyze the sourcing strategies of firms active in the Spanish manufacturing sector. We show that firms that select strategies of vertical integration and of foreign sourcing ex post tend to have been more productive, ex ante, than other firms....

  17. Ion sources for cyclotron applications

    International Nuclear Information System (INIS)

    Leung, K.N.; Bachman, D.A.; McDonald, D.S.; Young, A.T.

    1992-07-01

    The use of a multicusp plasma generator as an ion source has many advantages. The development of both positive and negative ion beams based on the multicusp source geometry is presented. It is shown that these sources can be operated at steady state or cw mode. As a result they are very suitable for cyclotron operations

  18. Experience with synchrotron radiation sources

    International Nuclear Information System (INIS)

    Krinsky, S.

    1987-01-01

    The development of synchrotron radiation sources is discussed, emphasizing characteristics important for x-ray microscopy. Bending magnets, wigglers and undulators are considered as sources of radiation. Operating experience at the national Synchrotron Light Source on the VUV and XRAY storage rings is reviewed, with particular consideration given to achieved current and lifetime, transverse bunch dimensions, and orbit stability. 6 refs., 3 figs

  19. The SLC polarized electron source

    International Nuclear Information System (INIS)

    Clendenin, J.E.

    1990-10-01

    A polarized electron source consisting of a 3-electrode photocathode gun and a flashlamp-pumped dye laser has been designed and built for the SLC and is currently undergoing commissioning. The source is described, and the operating configuration is discussed. The present status of the source and future plans are briefly indicated. 7 refs., 4 figs

  20. Source-space ICA for MEG source imaging.

    Science.gov (United States)

    Jonmohamadi, Yaqub; Jones, Richard D

    2016-02-01

    One of the most widely used approaches in electroencephalography/magnetoencephalography (MEG) source imaging is application of an inverse technique (such as dipole modelling or sLORETA) on the component extracted by independent component analysis (ICA) (sensor-space ICA + inverse technique). The advantage of this approach over an inverse technique alone is that it can identify and localize multiple concurrent sources. Among inverse techniques, the minimum-variance beamformers offer a high spatial resolution. However, in order to have both high spatial resolution of beamformer and be able to take on multiple concurrent sources, sensor-space ICA + beamformer is not an ideal combination. We propose source-space ICA for MEG as a powerful alternative approach which can provide the high spatial resolution of the beamformer and handle multiple concurrent sources. The concept of source-space ICA for MEG is to apply the beamformer first and then singular value decomposition + ICA. In this paper we have compared source-space ICA with sensor-space ICA both in simulation and real MEG. The simulations included two challenging scenarios of correlated/concurrent cluster sources. Source-space ICA provided superior performance in spatial reconstruction of source maps, even though both techniques performed equally from a temporal perspective. Real MEG from two healthy subjects with visual stimuli were also used to compare performance of sensor-space ICA and source-space ICA. We have also proposed a new variant of minimum-variance beamformer called weight-normalized linearly-constrained minimum-variance with orthonormal lead-field. As sensor-space ICA-based source reconstruction is popular in EEG and MEG imaging, and given that source-space ICA has superior spatial performance, it is expected that source-space ICA will supersede its predecessor in many applications.

  1. Chandra Source Catalog: User Interfaces

    Science.gov (United States)

    Bonaventura, Nina; Evans, I. N.; Harbo, P. N.; Rots, A. H.; Tibbetts, M. S.; Van Stone, D. W.; Zografou, P.; Anderson, C. S.; Chen, J. C.; Davis, J. E.; Doe, S. M.; Evans, J. D.; Fabbiano, G.; Galle, E.; Gibbs, D. G.; Glotfelty, K. J.; Grier, J. D.; Hain, R.; Hall, D. M.; He, X.; Houck, J. C.; Karovska, M.; Lauer, J.; McCollough, M. L.; McDowell, J. C.; Miller, J. B.; Mitschang, A. W.; Morgan, D. L.; Nichols, J. S.; Nowak, M. A.; Plummer, D. A.; Primini, F. A.; Refsdal, B. L.; Siemiginowska, A. L.; Sundheim, B. A.; Winkelman, S. L.

    2010-03-01

    The CSCview data mining interface is available for browsing the Chandra Source Catalog (CSC) and downloading tables of quality-assured source properties and data products. Once the desired source properties and search criteria are entered into the CSCview query form, the resulting source matches are returned in a table along with the values of the requested source properties for each source. (The catalog can be searched on any source property, not just position.) At this point, the table of search results may be saved to a text file, and the available data products for each source may be downloaded. CSCview save files are output in RDB-like and VOTable format. The available CSC data products include event files, spectra, lightcurves, and images, all of which are processed with the CIAO software. CSC data may also be accessed non-interactively with Unix command-line tools such as cURL and Wget, using ADQL 2.0 query syntax. In fact, CSCview features a separate ADQL query form for those who wish to specify this type of query within the GUI. Several interfaces are available for learning if a source is included in the catalog (in addition to CSCview): 1) the CSC interface to Sky in Google Earth shows the footprint of each Chandra observation on the sky, along with the CSC footprint for comparison (CSC source properties are also accessible when a source within a Chandra field-of-view is clicked); 2) the CSC Limiting Sensitivity online tool indicates if a source at an input celestial location was too faint for detection; 3) an IVOA Simple Cone Search interface locates all CSC sources within a specified radius of an R.A. and Dec.; and 4) the CSC-SDSS cross-match service returns the list of sources common to the CSC and SDSS, either all such sources or a subset based on search criteria.

  2. Pi a source book

    CERN Document Server

    Berggren, Lennart; Borwein, Peter

    2004-01-01

    This book documents the history of pi from the dawn of mathematical time to the present. One of the beauties of the literature on pi is that it allows for the inclusion of very modern, yet accessible, mathematics. The articles on pi collected herein include selections from the mathematical and computational literature over four millennia, a variety of historical studies on the cultural significance of the number, and an assortment of anecdotal, fanciful, and simply amusing pieces. For this new edition, the authors have updated the original material while adding new material of historical and cultural interest. There is a substantial exposition of the recent history of the computation of digits of pi, a discussion of the normality of the distribution of the digits, new translations of works by Viete and Huygen, as well as Kaplansky's never-before-published "Song of Pi." From the reviews of earlier editions: "Few mathematics books serve a wider potential readership than does a source book and this particular on...

  3. Industrial ion source technology

    Science.gov (United States)

    Kaufman, H. R.; Robinson, R. S.

    1978-01-01

    An analytical model was developed to describe the development of a coned surface texture with ion bombardment and simultaneous deposition of an impurity. A mathematical model of sputter deposition rate from a beveled target was developed in conjuction with the texturing models to provide an important input to that model. The establishment of a general procedure that will allow the treatment of manay different sputtering configurations is outlined. Calculation of cross sections for energetic binary collisions was extened to Ar, Kr.. and Xe with total cross sections for viscosity and diffusion calculated for the interaction energy range from leV to 1000eV. Physical sputtering and reactive ion etching experiments provided experimental data on the operating limits of a broad beam ion source using CF4 as a working gas to produce reactive species in a sputtering beam. Magnetic clustering effects are observed when Al is seeded with Fe and sputtered with Ar(?) ions. Silicon was textured at a micron scale by using a substrate temperature of 600 C.

  4. Hydrocarbons: source of energy

    International Nuclear Information System (INIS)

    Imarisio, G.; Frias, M.; Bemtgen, J.M.

    1989-01-01

    Hydrocarbons are at present the single most important source of energy, since they are the most versatile and widely used. It is expected that their importance will extend well into the next century and therefore it is essential to provide for all those improvements which will extend their availability and usefulness. The sub-programme ''Optimization of the production and utilization of hydrocarbons'' (within the Non-Nuclear Energy R and D Programme of the European Communities) is pursuing a number of R and D topics aimed at the above-mentioned results. It is implemented by means of shared-cost R and D contracts. At this first Seminar held in Lyon (France) from 21-23 September, 1988, all contractors of the sub-programme presented the state of progress of their R and D projects. These proceedings comprise all the papers presented at the Seminar. The section on oilfield exploration includes a report of work on the interpretation of nuclear logs by means of mathematical models. (author)

  5. The Advanced Neutron Source

    International Nuclear Information System (INIS)

    Peretz, F.J.

    1990-01-01

    The Advanced Neutron Source (ANS) is to be a multipurpose neutron research center, constructed around a high-flux reactor now being designed at the Oak Ridge National Laboratory (ORNL). Its primary purpose is to place the United States in the forefront of neutron scattering in the twenty-first century. Other research programs include nuclear and fundamental physics, isotope production, materials irradiation, and analytical chemistry. The ANS will be a unique and invaluable research tool because of the unprecedented neutron flux available from the high-intensity research reactor. But this reactor would be ineffective without world-class research facilities that allow the fullest utilization of the available neutrons. And, in turn, those research facilities will not produce new and exciting science without a broad population of users from all parts of the nation and the world, placed in a stimulating environment in which experiments can be effectively conducted and in which scientific exchange is encouraged. This paper discusses the measures being taken to ensure that the design of the ANS focuses not only on the reactor, but on providing the experiment and user support facilities needed to allow its effective use

  6. Impurity sources in TEXTOR

    Energy Technology Data Exchange (ETDEWEB)

    Pospieszczyk, A; Bay, H L; Bogen, P; Hartwig, H; Hintz, E; Koenen, L; Ross, G G; Rusbueldt, D; Samm, U; Schweer, B

    1987-02-01

    The deuterium, oxygen and carbon fluxes from the main limiter and the deuterium fluxes from the wall are measured in TEXTOR for an 'all carbon' surrounding as a function of central density n/sub e/, of applied ICRH-power and of different wall conditions (carbonization). For this purpose, emission spectroscopy both with filter systems and spectrometers has been used. It is found that a major release mechanism for light impurities is via the formation of molecules. Oxygen seems to enter the discharge from the liner via O-D containing molecules, whereas the limiter acts as the main carbon source by the release of hydro-carbons as indicated by the observed CD-band spectra. Both oxygen and carbon fluxes are reduced by about a factor of two after a fresh carbonization. Above a certain critical density the plasma detaches from the limiter and forms a stable discharge with a radiation cooled boundary layer and with a major fraction of particles now reaching the wall instead of the limiter. The critical density rises with decreasing impurity fluxes or with increasing heating powers.

  7. Impurity sources in TEXTOR

    International Nuclear Information System (INIS)

    Pospieszczyk, A.; Bay, H.L.; Bogen, P.; Hartwig, H.; Hintz, E.; Koenen, L.; Ross, G.G.; Rusbueldt, D.; Samm, U.; Schweer, B.

    1987-01-01

    The deuterium, oxygen and carbon fluxes from the main limiter and the deuterium fluxes from the wall are measured in TEXTOR for an 'all carbon' surrounding as a function of central density n e , of applied ICRH-power and of different wall conditions (carbonization). For this purpose, emission spectroscopy both with filter systems and spectrometers has been used. It is found that a major release mechanism for light impurities is via the formation of molecules. Oxygen seems to enter the discharge from the liner via O-D containing molecules, whereas the limiter acts as the main carbon source by the release of hydro-carbons as indicated by the observed CD-band spectra. Both oxygen and carbon fluxes are reduced by about a factor of two after a fresh carbonization. Above a certain critical density the plasma detaches from the limiter and forms a stable discharge with a radiation cooled boundary layer and with a major fraction of particles now reaching the wall instead of the limiter. The critical density rises with decreasing impurity fluxes or with increasing heating powers. (orig.)

  8. Defining Open Source

    Directory of Open Access Journals (Sweden)

    Russ Nelson

    2007-09-01

    Full Text Available The Open Source Initiative and the Free Software Foundation share a common goal: that everyone should be free to modify and redistribute the software they commonly use. 'Should' is of course a normative word. For the FSF, 'should' is a moral imperative. Anything else is an immoral restriction on people's activities, just as are restrictions on speech, press, movement, and religion. For the OSI, freedom is a necessary precondition for a world where "software doesn't suck", in the words of a founder of the OSI. The FSF started from its founder's GNU Manifesto widely published in 1985. Given the manifesto's hostility to copyright, and given the failure of the Free Software Foundation to gain any traction amongst commercial users of software even with a 13-year head start, a group of people gathered together in 1998 to talk about a new strategy to get the corporate world to listen to hackers. They were impressed by Eric Raymond's Cathedral and the Bazaar's take-up among business leaders.

  9. High speed atom source

    International Nuclear Information System (INIS)

    Hoshino, Hitoshi.

    1990-01-01

    In a high speed atom source, since the speed is not identical between ions and electrons, no sufficient neutralizing effect for ionic rays due to the mixing of the ionic rays and the electron rays can be obtained failing to obtain high speed atomic rays at high density. In view of the above, a speed control means is disposed for equalizing the speed of ions forming ionic rays and the speed of electrons forming electron rays. Further, incident angle of the electron rays and/or ionic rays to a magnet or an electrode is made variable. As a result, the relative speed between the ions and the electrons to the processing direction is reduced to zero, in which the probability of association between the ions and the electrons due to the coulomb force is increased to improve the neutralizing efficiency to easily obtain fine and high density high speed electron rays. Further, by varying the incident angle, a track capable of obtaining an ideal mixing depending on the energy of the neutralized ionic rays is formed. Since the high speed electron rays has such high density, they can be irradiated easily to the minute region of the specimen. (N.H.)

  10. Economic explanations for concurrent sourcing

    DEFF Research Database (Denmark)

    Mols, Niels Peter

    2010-01-01

    Concurrent sourcing is a phenomenon where firms simultaneously make and buy the same good, i.e. they simultaneously use the governance modes of market and hierarchy. Though concurrent sourcing seems to be widespread, few studies of sourcing have focused on this phenomenon. This paper reviews...... different economic explanations for why firms use concurrent sourcing. The distinctive features of the explanations are compared, and it is discussed how they may serve as a springboard for research on concurrent sourcing. Managerial implications are also offered....

  11. Investigation on Ion Source Parameters

    CERN Document Server

    M. Cheikh Mhamed, S. Essabaa, C. Lau

    The EURISOL multi-mega-watt target station requires dedicated radioactive ion sources. Notably, they must be capable of operating under extremely hard radiations and with a larger fission target producing over 1014 fissions/s. The realisation of next-generation ion sources suitable for such operating conditions needs exhaustive studies and developments. In order to take up such a challenge, a review on radioactive ion sources was achieved and the investigation on ion source parameters was in particular focused on a plasma ion source through a R&D program.

  12. Tuned sources of submillimetre radiation

    International Nuclear Information System (INIS)

    Berezhnyj, V.L.

    1981-01-01

    The main present directions of development of sources of frequency coherent tuned radiation of electromagnetic waves in the submillimeter range: nonlinear mixing of different frequencies; semiconductor lasers; molecular lasers with optical pumping; relativistic electron beams in a magnetic field as submillimeter radiation sources; submillimeter radiation sources on the basis of SHF classical electrovacuum devices - are considered. The designs of generator systems and their specifications are presented. The main parameters of electromagnetic radiation of different sources, such as: power, stability, frequency, tuning range - are presented. The methods of improving sources and electromagnetic radiation parameters are proposed. The examples of possible applications of submillimeter radiation in different spheres of science and technology are given [ru

  13. Os Retratos de Dorian G(ray – corpo, imagem e subjetividade em um site de relacionamentos

    Directory of Open Access Journals (Sweden)

    Luiz Felipe Zago

    2014-12-01

    como utiliza entrevistas realizadas com usuários do site. Foca nas relações entre corpo, imagem e produção de subjetividade no tempo presente, empregando aportes teóricos do pós-estruturalismo. Considera a ligação entre imagem e corpo como legitimação da “verdade” dos corpos, coagidos pelo espectro da velhice e pela exortação à visibilidade.

  14. Molecular characterization of non-thymic lymphomas in mice exposed to continuous low-dose-rate g-ray irradiation

    International Nuclear Information System (INIS)

    Takabatake, T.; Fujikawa, K.; Nakamura, S.; Tanaka, S.; Tanaka, I.; Tanaka-Braga III, I.; Sunaga, Y.; Ichinoche, K.; Sato, F.; Tanaka, K.; Matsumoto, T.

    2004-01-01

    To investigate the effects of continuous low-dose-rate irradiation on life span and neoplasm incidence, SPE B6C3 F1 mice were irradiated with 137Cs-ray at dose-rates of 20, 1 and 0.05 mGy/day with accumulated doses equivalent to 8000, 40 and 20 mGy, respectively. Examination of a total of 3,000 irradiated and 1,000 non-irradiated control mice showed that the life spans of the both sexes irradiated at 20 mGy/day, respectively. Examination of a total of 3,000 irradiated and 1,000 non-irradiated control mice showed that the life spans of the both sexes irradiated at 20 mGy/day were significantly shorter than that of the non-irradiated group. No significant difference in the cause of death and mortality rates was found between the groups. However, non-thymic lymphomas, the most common lethal neoplasm, showed a tendency to develop at an earlier age in mice irradiated with 20 mGy/day, regardless of sex. to obtain clues on the molecular mechanisms underlying the earlier development of non-thymic lymphomas in 20 mGy/day irradiated group, detailed molecular characterizations of non-thymic lymphomas with respect to B-cell or T-cell origin was done by detecting rearrangements in immunoglobulin heavy gene and in T-cell receptor b-and g chain genes by Southem hybridization method. to determine whether the early development of non-thymic lymphomas in 20 mGy/day irradiated group is associated wi the any recurrent chromosomal imbalance such as deletions and amplifications, the genome-wide scanning is also currently in progress by both LOH and array CGH methods. Present data obtained by LOH method show that deletions in parts of chromosomes 11 and 12 were more frequent than in chromosomes 2, 4 and 14 in both the non-irradiated control and 20 mGy/day irradiated groups. this work is supported by grants from Aomori Prefecture, Japan. (Author)

  15. Large source test stand for H-(D-) ion source

    International Nuclear Information System (INIS)

    Larson, R.; McKenzie-Wilson, R.

    1981-01-01

    The Brookhaven National Laboratory Neutral Beam Group has constructed a large source test stand for testing of the various source modules under development. The first objective of the BNL program is to develop a source module capable of delivering 10A of H - (D - ) at 25 kV operating in the steady state mode with satisfactory gas and power efficiency. The large source test stand contains gas supply and vacuum pumping systems, source cooling systems, magnet power supplies and magnet cooling systems, two arc power supplies rated at 25 kW and 50 kW, a large battery driven power supply and an extractor electrode power supply. Figure 1 is a front view of the vacuum vessel showing the control racks with the 36'' vacuum valves and refrigerated baffles mounted behind. Figure 2 shows the rear view of the vessel with a BNL Mk V magnetron source mounted in the source aperture and also shows the cooled magnet coils. Currently two types of sources are under test: a large magnetron source and a hollow cathode discharge source

  16. Radioactive source recovery program responses to neutron source emergencies

    International Nuclear Information System (INIS)

    Dinehart, S.M.; Hatler, V.A.; Gray, D.W.; Guillen, A.D.

    1997-01-01

    Recovery of neutron sources containing Pu 239 and Be is currently taking place at Los Alamos National Laboratory. The program was initiated in 1979 by the Department of Energy (DOE) to dismantle and recover sources owned primarily by universities and the Department of Defense. Since the inception of this program, Los Alamos has dismantled and recovered more than 1000 sources. The dismantlement and recovery process involves the removal of source cladding and the chemical separation of the source materials to eliminate neutron emissions. While this program continues for the disposal of 239 Pu/Be sources, there is currently no avenue for the disposition of any sources other than those containing Pu 239 . Increasingly, there have been demands from agencies both inside and outside the Federal Government and from the public to dispose of unwanted sources containing 238 Pu/Be and 241 Am/Be. DOE is attempting to establish a formal program to recover these sources and is working closely with the Nuclear Regulatory Commission (NRC) on a proposed Memorandum of Understanding to formalize an Acceptance Program. In the absence of a formal program to handle 238 Pu/Be and 241 Am/Be neutron sources, Los Alamos has responded to several emergency requests to receive and recover sources that have been determined to be a threat to public health and safety. This presentation will: (1) review the established 239 Pu neutron source recovery program at Los Alamos, (2) detail plans for a more extensive neutron source disposal program, and (3) focus on recent emergency responses

  17. Plume rise from multiple sources

    International Nuclear Information System (INIS)

    Briggs, G.A.

    1975-01-01

    A simple enhancement factor for plume rise from multiple sources is proposed and tested against plume-rise observations. For bent-over buoyant plumes, this results in the recommendation that multiple-source rise be calculated as [(N + S)/(1 + S)]/sup 1/3/ times the single-source rise, Δh 1 , where N is the number of sources and S = 6 (total width of source configuration/N/sup 1/3/ Δh 1 )/sup 3/2/. For calm conditions a crude but simple method is suggested for predicting the height of plume merger and subsequent behavior which is based on the geometry and velocity variations of a single buoyant plume. Finally, it is suggested that large clusters of buoyant sources might occasionally give rise to concentrated vortices either within the source configuration or just downwind of it

  18. Global inventory of NOx sources

    International Nuclear Information System (INIS)

    Delmas, R.; Serca, D.; Jambert, C.

    1997-01-01

    Nitrogen oxides are key compounds for the oxidation capacity of the troposphere. Their concentration depends on the proximity of sources because of their short atmospheric lifetime. An accurate knowledge of the distribution of their sources and sinks is therefore crucial. At the global scale, the dominant sources of nitrogen oxides - combustion of fossil fuel (about 50%) and biomass burning (about 20%) - are basically anthropogenic. Natural sources, including lightning and microbial activity in soils, represent therefore less than 30% of total emissions. Fertilizer use in agriculture constitutes an anthropogenic perturbation to the microbial source. The methods to estimate the magnitude and distribution of these dominant sources of nitrogen oxides are discussed. Some minor sources which may play a specific role in tropospheric chemistry such as NO x emission from aircraft in the upper troposphere or input from production in the stratosphere from N 2 O photodissociation are also considered

  19. Radiation sources working group summary

    International Nuclear Information System (INIS)

    Fazio, M.V.

    1998-01-01

    The Radiation Sources Working Group addressed advanced concepts for the generation of RF energy to power advanced accelerators. The focus of the working group included advanced sources and technologies above 17 GHz. The topics discussed included RF sources above 17 GHz, pulse compression techniques to achieve extreme peak power levels, components technology, technology limitations and physical limits, and other advanced concepts. RF sources included gyroklystrons, magnicons, free-electron masers, two beam accelerators, and gyroharmonic and traveling wave devices. Technology components discussed included advanced cathodes and electron guns, high temperature superconductors for producing magnetic fields, RF breakdown physics and mitigation, and phenomena that impact source design such as fatigue in resonant structures due to RF heating. New approaches for RF source diagnostics located internal to the source were discussed for detecting plasma and beam phenomena existing in high energy density electrodynamic systems in order to help elucidate the reasons for performance limitations

  20. OASYS (OrAnge SYnchrotron Suite): an open-source graphical environment for x-ray virtual experiments

    Science.gov (United States)

    Rebuffi, Luca; Sanchez del Rio, Manuel

    2017-08-01

    The evolution of the hardware platforms, the modernization of the software tools, the access to the codes of a large number of young people and the popularization of the open source software for scientific applications drove us to design OASYS (ORange SYnchrotron Suite), a completely new graphical environment for modelling X-ray experiments. The implemented software architecture allows to obtain not only an intuitive and very-easy-to-use graphical interface, but also provides high flexibility and rapidity for interactive simulations, making configuration changes to quickly compare multiple beamline configurations. Its purpose is to integrate in a synergetic way the most powerful calculation engines available. OASYS integrates different simulation strategies via the implementation of adequate simulation tools for X-ray Optics (e.g. ray tracing and wave optics packages). It provides a language to make them to communicate by sending and receiving encapsulated data. Python has been chosen as main programming language, because of its universality and popularity in scientific computing. The software Orange, developed at the University of Ljubljana (SLO), is the high level workflow engine that provides the interaction with the user and communication mechanisms.

  1. Coaxial slow source

    International Nuclear Information System (INIS)

    Brooks, R.D.; Jarboe, T.R.

    1990-01-01

    Field reversed configurations (FRCs) are a class of compact toroid with not toroidal field. The field reversed theta pinch technique has been successfully used for formation of FRCs since their inception in 1958. In this method an initial bias field is produced. After ionization of the fill gas, the current in the coil is rapidly reversed producing the radial implosion of a current sheath. At the ends of the coil the reversed field lines rapidly tear and reconnect with the bias field lines until no more bias flux remains. At this point, vacuum reversed field accumulates around the configuration which contracts axially until an equilibrium is reached. When extrapolating the use of such a technique to reactor size plasmas two main shortcomings are found. First, the initial bias field, and hence flux in a given device, which can be reconnected to form the configuration is limited from above by destructive axial dynamics. Second, the voltages required to produce rapid current reversal in the coil are very large. Clearly, a low voltage formation technique without limitations on flux addition is desirable. The Coaxial Slow Source (CSS) device was designed to meet this need. It has two coaxial theta pinch coils. Coaxial coil geometry allows for the addition of as much magnetic flux to the annular plasma between them as can be generated inside the inner coil. Furthermore the device can be operated at charging voltages less than 10 kV and on resistive diffusion, rather than implosive time scales. The inner coil is a novel, concentric, helical design so as to allow it to be cantilevered on one end to permit translation of the plasma. Following translation off the inner coil the Annular Field Reversed Configuration would be re-formed as a true FRC. In this paper we investigate the formation process in the new parallel configuration., CSSP, in which the inner and outer coils are connected in parallel to the main capacitor bank

  2. A Hybrid, Current-Source/Voltage-Source Power Inverter Circuit

    DEFF Research Database (Denmark)

    Trzynadlowski, Andrzej M.; Patriciu, Niculina; Blaabjerg, Frede

    2001-01-01

    A combination of a large current-source inverter and a small voltage-source inverter circuits is analyzed. The resultant hybrid inverter inherits certain operating advantages from both the constituent converters. In comparison with the popular voltage-source inverter, these advantages include...... reduced switching losses, improved quality of output current waveforms, and faster dynamic response to current control commands. Description of operating principles and characteristics of the hybrid inverter is illustrated with results of experimental investigation of a laboratory model....

  3. The Chandra Source Catalog 2.0: Estimating Source Fluxes

    Science.gov (United States)

    Primini, Francis Anthony; Allen, Christopher E.; Miller, Joseph; Anderson, Craig S.; Budynkiewicz, Jamie A.; Burke, Douglas; Chen, Judy C.; Civano, Francesca Maria; D'Abrusco, Raffaele; Doe, Stephen M.; Evans, Ian N.; Evans, Janet D.; Fabbiano, Giuseppina; Gibbs, Danny G., II; Glotfelty, Kenny J.; Graessle, Dale E.; Grier, John D.; Hain, Roger; Hall, Diane M.; Harbo, Peter N.; Houck, John C.; Lauer, Jennifer L.; Laurino, Omar; Lee, Nicholas P.; Martínez-Galarza, Juan Rafael; McCollough, Michael L.; McDowell, Jonathan C.; McLaughlin, Warren; Morgan, Douglas L.; Mossman, Amy E.; Nguyen, Dan T.; Nichols, Joy S.; Nowak, Michael A.; Paxson, Charles; Plummer, David A.; Rots, Arnold H.; Siemiginowska, Aneta; Sundheim, Beth A.; Tibbetts, Michael; Van Stone, David W.; Zografou, Panagoula

    2018-01-01

    The Second Chandra Source Catalog (CSC2.0) will provide information on approximately 316,000 point or compact extended x-ray sources, derived from over 10,000 ACIS and HRC-I imaging observations available in the public archive at the end of 2014. As in the previous catalog release (CSC1.1), fluxes for these sources will be determined separately from source detection, using a Bayesian formalism that accounts for background, spatial resolution effects, and contamination from nearby sources. However, the CSC2.0 procedure differs from that used in CSC1.1 in three important aspects. First, for sources in crowded regions in which photometric apertures overlap, fluxes are determined jointly, using an extension of the CSC1.1 algorithm, as discussed in Primini & Kashyap (2014ApJ...796…24P). Second, an MCMC procedure is used to estimate marginalized posterior probability distributions for source fluxes. Finally, for sources observed in multiple observations, a Bayesian Blocks algorithm (Scargle, et al. 2013ApJ...764..167S) is used to group observations into blocks of constant source flux.In this poster we present details of the CSC2.0 photometry algorithms and illustrate their performance in actual CSC2.0 datasets.This work has been supported by NASA under contract NAS 8-03060 to the Smithsonian Astrophysical Observatory for operation of the Chandra X-ray Center.

  4. Industrial ion sources broadbeam gridless ion source technology

    CERN Document Server

    Zhurin, Viacheslav V

    2012-01-01

    Due to the large number of uses of ion sources in academia and industry, those who utilize these sources need up to date and coherent information to keep themselves abreast of developments and options, and to chose ideal solutions for quality and cost-effectiveness. This book, written by an author with a strong industrial background and excellent standing, is the comprehensive guide users and developers of ion sources have been waiting for. Providing a thorough refresher on the physics involved, this resource systematically covers the source types, components, and the operational parameters.

  5. Leakage of caesium braquitherapy sources

    International Nuclear Information System (INIS)

    Lozada, J.A.

    1998-01-01

    In several Venezuelan public hospitals where cervix uteri tumours are treated by intracavitary radiotherapy, that use manual after loading Fletcher method, with Caesium 137 sources, the use of improper source holders, locally manufactured from pieces of drainage plastic tubing, which deteriorated and created a corrosive environment all around the sources, omission of manufacturer's recommendations regarding corrosion information, source storage, inspection and testing, violation of International Atomic Energy Agency Radiation Protection Procedures, and lack of proper regulatory control, resulted integrity damage to about sixty special form sources (ISO2919 C 63322), leakage of Cs-137 from a supposed insoluble refractory active content (caesium silicoaluminate), and contamination of applicators, floors and bedding. When the situation was detected by means removal contamination tests, after routine inspections, the sources were removed from the hospitals, decontaminated by means of immersion in 3% EDTA solution in ultrasonic bath, subjected to leaking assessment tests, and the ones that passed were placed in low cost stainless steel source holders, designed and built by the instituto Venezolano de Investigaciones Cientificas (IVIC) returned to the hospitals. The leaking sources were removed from use and considered radioactive waste. In order to avoid the occurrence of similar situations, all the importers of such sources are now required to send them to IVIC for testing and placement in proper source holders, before they are shipped to the hospitals. (author)

  6. Disintegrins from Hematophagous Sources

    Directory of Open Access Journals (Sweden)

    Ivo M. B. Francischetti

    2012-04-01

    Full Text Available Bloodsucking arthropods are a rich source of salivary molecules (sialogenins which inhibit platelet aggregation, neutrophil function and angiogenesis. Here we review the literature on salivary disintegrins and their targets. Disintegrins were first discovered in snake venoms, and were instrumental in our understanding of integrin function and also for the development of anti-thrombotic drugs. In hematophagous animals, most disintegrins described so far have been discovered in the salivary gland of ticks and leeches. A limited number have also been found in hookworms and horseflies, and none identified in mosquitoes or sand flies. The vast majority of salivary disintegrins reported display a RGD motif and were described as platelet aggregation inhibitors, and few others as negative modulator of neutrophil or endothelial cell functions. This notably low number of reported disintegrins is certainly an underestimation of the actual complexity of this family of proteins in hematophagous secretions. Therefore an algorithm was created in order to identify the tripeptide motifs RGD, KGD, VGD, MLD, KTS, RTS, WGD, or RED (flanked by cysteines in sialogenins deposited in GenBank database. The search included sequences from various blood-sucking animals such as ticks (e.g., Ixodes sp., Argas sp., Rhipicephalus sp., Amblyomma sp., tabanids (e.g., Tabanus sp., bugs (e.g., Triatoma sp., Rhodnius prolixus, mosquitoes (e.g., Anopheles sp., Aedes sp., Culex sp., sand flies (e.g., Lutzomyia sp., Phlebotomus sp., leeches (e.g., Macrobdella sp., Placobdella sp. and worms (e.g., Ancylostoma sp.. This approach allowed the identification of a remarkably high number of novel putative sialogenins with tripeptide motifs typical of disintegrins (>450 sequences whose biological activity remains to be verified. This database is accessible

  7. Editorial: Open Source in Government

    Directory of Open Access Journals (Sweden)

    Dru Lavigne

    2009-04-01

    Full Text Available Last summer, the Center for Strategic and International Studies published the sixth update to their Open Source Policy survey. The survey "tracks governmental policies on the use of open source software as reported in the press or other media." The report lists 275 open source policy initiatives. It also breaks down by country and by government level whether the policy on the use of open source is considered to be advisory, preferential, or mandatory. The editorial theme for the May issue of the OSBR is "open source in government" and we are pleased that the authors have drawn upon their experiences to provide insight into public policy regarding open source for many parts of the world.

  8. DESIGN OF ALTERNATIVE ENERGY SOURCES

    Directory of Open Access Journals (Sweden)

    Popa Stefania

    2013-11-01

    Full Text Available By energy sources we understand technologies and materials used to obtain various forms of energy necessary for the development of society. These sources must be in adequate quantities and be conveniently exploited in terms of technical, economic and sustainable perspective. Alternative energy uses the inherent power of natural sources like wind, tides, the sun. Alternative energy is a term used for some energy sources and energy storage technologies. Generally it indicates energies that are nontraditional and have low impact to the environment. The alternative energy term is used in contrast with the term fossil fuel according to some sources, while other sources use it with the meaning of renewable energy purposes.

  9. Ion sources for electrostatic accelerators

    International Nuclear Information System (INIS)

    Hellborg, R.

    1998-01-01

    Maybe the most important part of an electrostatic accelerator system, and also often the most tricky part is the ion source. There has been a rapid growth in activity in ion-source research and development during the last two to three decades. Some of these developments have also been of benefit to electrostatic accelerator users. In this report some of the different types of ion sources used in electrostatic accelerators are described. The list is not complete but more an overview of some of the more commonly used sources. The description is divided into two groups; positive ion sources for single stage electrostatic accelerators and negative ion sources for two stages (i.e. tandem) accelerators

  10. Recent negative ion source developments

    International Nuclear Information System (INIS)

    Alton, G.D.

    1978-01-01

    This report describes recent results obtained from studies associated with the development of negative ion sources which utilize sputtering in a diffuse cesium plasma as a means of ion beam generation. Data are presented which relate negative ion yield and important operational parameters such as cesium oven temperature and sputter probe voltage from each of the following sources: (1) A source based in principle according to the University of Aarhus design and (2) an axial geometry source. The important design aspects of the sources are given--along with a list of the negative ion intensities observed to date. Also a qualitative description and interpretation of the negative ion generation mechanism in sources which utilize sputtering in the presence of cesium is given

  11. Radiation sources and technical services

    International Nuclear Information System (INIS)

    Stonek, K.; Satorie, Z.; Vyskocil, I.

    1981-01-01

    Work is briefly described of the department for sealed sources production of the Institute, including leak testing and surface contamination of sealed sources. The department also provides technical services including the inspections of sealed sources used in medicine and geology and repair of damaged sources. It carries out research of the mechanical and thermal strength of sealed sources and of the possibility of reprocessing used 226 Ra sources. The despatch department is responsible for supplying the entire country with home and imported radionuclides. The department of technical services is responsible for testing imported radionuclides, assembling materials testing, industrial and medical irradiation devices, and for the collection and storage of low-level wastes on a national scale. (M.D.)

  12. Convolutive Blind Source Separation Methods

    DEFF Research Database (Denmark)

    Pedersen, Michael Syskind; Larsen, Jan; Kjems, Ulrik

    2008-01-01

    During the past decades, much attention has been given to the separation of mixed sources, in particular for the blind case where both the sources and the mixing process are unknown and only recordings of the mixtures are available. In several situations it is desirable to recover all sources from...... the recorded mixtures, or at least to segregate a particular source. Furthermore, it may be useful to identify the mixing process itself to reveal information about the physical mixing system. In some simple mixing models each recording consists of a sum of differently weighted source signals. However, in many...... real-world applications, such as in acoustics, the mixing process is more complex. In such systems, the mixtures are weighted and delayed, and each source contributes to the sum with multiple delays corresponding to the multiple paths by which an acoustic signal propagates to a microphone...

  13. Source-circuit design overview

    Science.gov (United States)

    Ross, R. G., Jr.

    1983-01-01

    The source circuit is the fundamental electrical building block of a large central-station array; it consists of a series-parallel network of solar cells that develops full system voltage. The array field is generally made up of a large number of parallel source circuits. Source-circuit electrical configuration is driven by a number of design considerations, which must be considered simultaneously. Array fault tolerance and hot spot heating endurance are examined in detail.

  14. Open source software and libraries

    OpenAIRE

    Randhawa, Sukhwinder

    2008-01-01

    Open source software is, software that users have the ability to run, copy, distribute, study, change, share and improve for any purpose. Open source library software’s does not need the initial cost of commercial software and enables libraries to have greater control over their working environment. Library professionals should be aware of the advantages of open source software and should involve in their development. They should have basic knowledge about the selection, installation and main...

  15. Ion sources for medical accelerators

    Science.gov (United States)

    Barletta, W. A.; Chu, W. T.; Leung, K. N.

    1998-02-01

    Advanced injector systems for proton synchrotrons and accelerator-based boron neutron capture therapy systems are being developed at the Lawrence Berkeley National Laboratory. Multicusp ion sources, particularly those driven by radio frequency, have been tested for these applications. The use of a radio frequency induction discharge provides clean, reliable, and long-life source operation. It has been demonstrated that the multicusp ion source can provide good-quality positive hydrogen ion beams with a monatomic ion fraction higher than 90%. The extractable ion current densities from this type of source can meet the injector requirements for both proton synchrotron and accelerator-based boron neutron capture therapy projects.

  16. Enhancement of SPES source performances

    International Nuclear Information System (INIS)

    Fagotti, E.; Palmieri, A.; Ren, X.

    2008-01-01

    Installation of SPES source at LNL was finished in July 2006 and the first beam was extracted in September 2006. Commissioning results confirmed very good performance of the extracted current density. Conversely, source reliability was very poor due to glow-discharge phenomena, which were caused by the ion source axial magnetic field protruding in the high-voltage column. This problem was fixed by changing the stainless steel plasma electrode support with a ferromagnetic one. This new configuration required us to recalculate ion source solenoids positions and fields in order to recover the correct resonance pattern. Details on magnetic simulations and experimental results of high voltage column shielding are presented

  17. Fission-product source terms

    International Nuclear Information System (INIS)

    Lorenz, R.A.

    1981-01-01

    This presentation consists of a review of fission-product source terms for light water reactor (LWR) fuel. A source term is the quantity of fission products released under specified conditions that can be used to calculate the consequences of the release. The source term usually defines release from breached fuel-rod cladding but could also describe release from the primary coolant system, the reactor containment shell, or the site boundary. The source term would be different for each locality, and the chemical and physical forms of the fission products could also differ

  18. Advanced LIGO: sources and astrophysics

    International Nuclear Information System (INIS)

    Creighton, Teviet

    2003-01-01

    Second-generation detectors in LIGO will take us from the discovery phase of gravitational-wave observations to the phase of true gravitational-wave astrophysics, with hundreds or thousands of potential sources. This paper surveys the most likely and interesting potential sources for Advanced LIGO, and the astrophysical processes that each one will probe. I conclude that binary inspiral signals are expected, while continuous signals from pulsars are plausible but not guaranteed. Other sources, such as core-collapse bursts, cosmic strings and primordial stochastic backgrounds, are speculative sources for Advanced LIGO, but also potentially the most interesting, since they push the limits of our theoretical knowledge

  19. The Chandra Source Catalog: Algorithms

    Science.gov (United States)

    McDowell, Jonathan; Evans, I. N.; Primini, F. A.; Glotfelty, K. J.; McCollough, M. L.; Houck, J. C.; Nowak, M. A.; Karovska, M.; Davis, J. E.; Rots, A. H.; Siemiginowska, A. L.; Hain, R.; Evans, J. D.; Anderson, C. S.; Bonaventura, N. R.; Chen, J. C.; Doe, S. M.; Fabbiano, G.; Galle, E. C.; Gibbs, D. G., II; Grier, J. D.; Hall, D. M.; Harbo, P. N.; He, X.; Lauer, J.; Miller, J. B.; Mitschang, A. W.; Morgan, D. L.; Nichols, J. S.; Plummer, D. A.; Refsdal, B. L.; Sundheim, B. A.; Tibbetts, M. S.; van Stone, D. W.; Winkelman, S. L.; Zografou, P.

    2009-09-01

    Creation of the Chandra Source Catalog (CSC) required adjustment of existing pipeline processing, adaptation of existing interactive analysis software for automated use, and development of entirely new algorithms. Data calibration was based on the existing pipeline, but more rigorous data cleaning was applied and the latest calibration data products were used. For source detection, a local background map was created including the effects of ACIS source readout streaks. The existing wavelet source detection algorithm was modified and a set of post-processing scripts used to correct the results. To analyse the source properties we ran the SAO Traceray trace code for each source to generate a model point spread function, allowing us to find encircled energy correction factors and estimate source extent. Further algorithms were developed to characterize the spectral, spatial and temporal properties of the sources and to estimate the confidence intervals on count rates and fluxes. Finally, sources detected in multiple observations were matched, and best estimates of their merged properties derived. In this paper we present an overview of the algorithms used, with more detailed treatment of some of the newly developed algorithms presented in companion papers.

  20. The H.E.S.S. Galactic plane survey

    Science.gov (United States)

    H. E. S. S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Benkhali, F. Ait; Angüner, E. O.; Arakawa, M.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Tjus, J. Becker; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bonnefoy, S.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Büchele, M.; Bulik, T.; Capasso, M.; Carrigan, S.; Caroff, S.; Carosi, A.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Colafrancesco, S.; Condon, B.; Conrad, J.; Davids, I. D.; Decock, J.; Deil, C.; Devin, J.; deWilt, P.; Dirson, L.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dutson, K.; Dyks, J.; Edwards, T.; Egberts, K.; Eger, P.; Emery, G.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Garrigoux, T.; Gast, H.; Gaté, F.; Giavitto, G.; Giebels, B.; Glawion, D.; Glicenstein, J. F.; Gottschall, D.; Grondin, M.-H.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holch, T. L.; Holler, M.; Horns, D.; Ivascenko, A.; Iwasaki, H.; Jacholkowska, A.; Jamrozy, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katsuragawa, M.; Katz, U.; Kerszberg, D.; Khangulyan, D.; Khélifi, B.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Marandon, V.; Malyshev, D.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Nakashima, S.; de Naurois, M.; Ndiyavala, H.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Paz Arribas, M.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poireau, V.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Rauth, R.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Rieger, F.; Rinchiuso, L.; Romoli, C.; Rowell, G.; Rudak, B.; Rulten, C. B.; Safi-Harb, S.; Sahakian, V.; Saito, S.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schandri, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seglar-Arroyo, M.; Settimo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Shiningayamwe, K.; Simoni, R.; Sol, H.; Spanier, F.; Spir-Jacob, M.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Steppa, C.; Sushch, I.; Takahashi, T.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tsirou, M.; Tsuji, N.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Zorn, J.; Żywucka, N.

    2018-04-01

    We present the results of the most comprehensive survey of the Galactic plane in very high-energy (VHE) γ-rays, including a public release of Galactic sky maps, a catalog of VHE sources, and the discovery of 16 new sources of VHE γ-rays. The High Energy Spectroscopic System (H.E.S.S.) Galactic plane survey (HGPS) was a decade-long observation program carried out by the H.E.S.S. I array of Cherenkov telescopes in Namibia from 2004 to 2013. The observations amount to nearly 2700 h of quality-selected data, covering the Galactic plane at longitudes from ℓ = 250° to 65° and latitudes |b|≤ 3°. In addition to the unprecedented spatial coverage, the HGPS also features a relatively high angular resolution (0.08° ≈ 5 arcmin mean point spread function 68% containment radius), sensitivity (≲1.5% Crab flux for point-like sources), and energy range (0.2-100 TeV). We constructed a catalog of VHE γ-ray sources from the HGPS data set with a systematic procedure for both source detection and characterization of morphology and spectrum. We present this likelihood-based method in detail, including the introduction of a model component to account for unresolved, large-scale emission along the Galactic plane. In total, the resulting HGPS catalog contains 78 VHE sources, of which 14 are not reanalyzed here, for example, due to their complex morphology, namely shell-like sources and the Galactic center region. Where possible, we provide a firm identification of the VHE source or plausible associations with sources in other astronomical catalogs. We also studied the characteristics of the VHE sources with source parameter distributions. 16 new sources were previously unknown or unpublished, and we individually discuss their identifications or possible associations. We firmly identified 31 sources as pulsar wind nebulae (PWNe), supernova remnants (SNRs), composite SNRs, or gamma-ray binaries. Among the 47 sources not yet identified, most of them (36) have possible

  1. C-188 cobalt-60 sealed source integrity: source monitoring

    International Nuclear Information System (INIS)

    Defalco, G.M.; Shah, V.

    1995-01-01

    The integrity of C-188 cobalt-60 sealed sources used for radiation processing will be a key factor in the continued industrial acceptance and growth of gamma irradiation technology. Given the public's relatively poor understanding of most nuclear topics and the news media's tendency to sensationalize events, it is appropriate for suppliers and users of gamma technology to be vigilant and conservative regarding the application of cobalt-60 sources to industrial purposes. Nordion's recent decision to extend the optional warranty on its C-188 cobalt-60 sealed source from 15 years to 20 years is based on over 30 years of data generated from its on-going SOURCE SURVEILLANCE PROGRAM. This paper presents an overview of the C-188 SOURCE SURVEILLANCE PROGRAM. (author)

  2. Radiation Safety and Orphan Sources

    International Nuclear Information System (INIS)

    Janzekovic, H.; Krizman, M.

    2006-01-01

    The wide spread use of radioactive and particularly of nuclear materials which started in the last century very quickly also demonstrated negative sides. The external exposure and radiotoxicity of these materials could be easily used in a malevolent act. Due to the fact that these materials could not be detected without special equipment designed for that purpose, severe control over their use in all phases of a life cycle is required. An orphan source is a radioactive source which is not under regulatory control, either because it has never been under regulatory or because it has been abandoned, lost, misplaced, stolen or transferred without proper authorization. In the last ten years a few international conferences were dedicated to the improvement of the safety and security of radioactive sources. Three main tasks are focused, the maintenance of data bases related to events with orphan sources and the publications of such events, the preparation of recommendations and guidelines to national regulatory bodies in order to prevent and detect the events related to orphan sources as well as to develop the response strategies to radiological or nuclear emergency, appraisals of the national strategies of radioactive sources control. Concerning Slovenia, strengthening control over orphan sources in Slovenia started after the adoption of new legislation in 2002. It was carried out through several tasks with the aim to prevent orphan sources, as well as to identify the sources which could be potentially orphan sources. The comprehensive methodology was developed by the Slovenian nuclear safety administration (S.N.S.A.) based on international guidelines as well as on the study of national lesson learned cases. The methodology was developed and used in close cooperation with all parties involved, namely other regulatory authorities, police, customs, agency for radioactive waste management (A.R.A.O.), technical support organisations (T.S.O.), users of source, authorised

  3. Radiation Safety and Orphan Sources

    Energy Technology Data Exchange (ETDEWEB)

    Janzekovic, H.; Krizman, M. [Slovenian Nuclear Safety Administration, Ljubljana (Slovenia)

    2006-07-01

    The wide spread use of radioactive and particularly of nuclear materials which started in the last century very quickly also demonstrated negative sides. The external exposure and radiotoxicity of these materials could be easily used in a malevolent act. Due to the fact that these materials could not be detected without special equipment designed for that purpose, severe control over their use in all phases of a life cycle is required. An orphan source is a radioactive source which is not under regulatory control, either because it has never been under regulatory or because it has been abandoned, lost, misplaced, stolen or transferred without proper authorization. In the last ten years a few international conferences were dedicated to the improvement of the safety and security of radioactive sources. Three main tasks are focused, the maintenance of data bases related to events with orphan sources and the publications of such events, the preparation of recommendations and guidelines to national regulatory bodies in order to prevent and detect the events related to orphan sources as well as to develop the response strategies to radiological or nuclear emergency, appraisals of the national strategies of radioactive sources control. Concerning Slovenia, strengthening control over orphan sources in Slovenia started after the adoption of new legislation in 2002. It was carried out through several tasks with the aim to prevent orphan sources, as well as to identify the sources which could be potentially orphan sources. The comprehensive methodology was developed by the Slovenian nuclear safety administration (S.N.S.A.) based on international guidelines as well as on the study of national lesson learned cases. The methodology was developed and used in close cooperation with all parties involved, namely other regulatory authorities, police, customs, agency for radioactive waste management (A.R.A.O.), technical support organisations (T.S.O.), users of source, authorised

  4. Status of spallation neutron source

    Energy Technology Data Exchange (ETDEWEB)

    Oyama, Yukio [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1997-03-01

    Existing and planned facilities using proton accelerator driven spallation neutron source are reviewed. These include new project of neutron science proposed from Japan Atomic Energy Research Institute. The present status of facility requirement and accelerator technology leads us to new era of neutron science such as neutron scattering research and nuclear transmutation study using very intense neutron source. (author)

  5. Analyzing and Interpreting Historical Sources

    DEFF Research Database (Denmark)

    Kipping, Matthias; Wadhwani, Dan; Bucheli, Marcelo

    2014-01-01

    This chapter outlines a methodology for the interpretation of historical sources, helping to realize their full potential for the study of organization, while overcoming their challenges in terms of distortions created by time, changes in context, and selective production or preservation. Drawing....... The chapter contributes to the creation of a language for describing the use of historical sources in management research....

  6. School Principals' Sources of Knowledge

    Science.gov (United States)

    Perkins, Arland Early

    2014-01-01

    The purpose of this study was to determine what sources of professional knowledge are available to principals in 1 rural East Tennessee school district. Qualitative research methods were applied to gain an understanding of what sources of knowledge are used by school principals in 1 rural East Tennessee school district and the barriers they face…

  7. Vacuum Technology for Ion Sources

    International Nuclear Information System (INIS)

    Chiggiato, P

    2013-01-01

    The basic notions of vacuum technology for ion sources are presented, with emphasis on pressure profile calculation and choice of pumping technique. A Monte Carlo code (Molflow+) for the evaluation of conductances and the vacuum-electrical analogy for the calculation of time-dependent pressure variations are introduced. The specific case of the Linac4 H - source is reviewed. (author)

  8. Embedded EZ-Source Inverters

    DEFF Research Database (Denmark)

    Blaabjerg, Frede; Loh, Poh Chiang; Gao, F.

    2008-01-01

    -voltage oscillations to the system. Therefore, Z-source inverters are in effect safer and less complex, and can be implemented using only passive elements with no additional active semiconductor needed. Believing in the prospects of Z-source inverters, this paper contributes by introducing a new family of embedded EZ...

  9. Embedded EZ-Source Inverters

    DEFF Research Database (Denmark)

    Chiang Loh, Poh; Gao, Feng; Blaabjerg, Frede

    2010-01-01

    overvoltage oscillations to the system. Therefore, Z-source inverters are, in effect, safer and less complex and can be implemented using only passive elements with no additional active semiconductor needed. Believing in the prospects of Z-source inverters, this paper contributes by introducing a new family...

  10. Acoustic Holography With Incoherent Sources

    NARCIS (Netherlands)

    Druyvesteyn, W.F.; Raangs, R.

    2005-01-01

    In near field acoustic holography the sound field is scanned near the surface of the vibrating object; from these measurements the vibration of the structure can be calculated. In the case of correlated sources one reference signal is sufficient. When incoherent sources are present the separation of

  11. A-Source Impedance Network

    DEFF Research Database (Denmark)

    Siwakoti, Yam Prasad; Blaabjerg, Frede; Galigekere, Veda Prakash

    2016-01-01

    A novel A-source impedance network is proposed in this letter. The A-source impedance network uses an autotransformer for realizing converters for any application that demand a very high dc voltage gain. The network utilizes a minimal turns ratio compared to other Magnetically Coupled Impedance S...

  12. The cohesiveness of sourcing teams

    DEFF Research Database (Denmark)

    Lidegaard, Nina

    2015-01-01

    Sourcing teams are introduced as an approach to achieving the interdepartmental integration necessary for companies to address the complexity of strategic sourcing. Companies aim at facilitating teams capable of balancing the goals and tasks of the team with departmental expectations; however...

  13. Accelerator based continuous neutron source.

    CERN Document Server

    Shapiro, S M; Ruggiero, A G

    2003-01-01

    Until the last decade, most neutron experiments have been performed at steady-state, reactor-based sources. Recently, however, pulsed spallation sources have been shown to be very useful in a wide range of neutron studies. A major review of neutron sources in the US was conducted by a committee chaired by Nobel laureate Prof. W. Kohn: ''Neutron Sources for America's Future-BESAC Panel on Neutron Sources 1/93''. This distinguished panel concluded that steady state and pulsed sources are complementary and that the nation has need for both to maintain a balanced neutron research program. The report recommended that both a new reactor and a spallation source be built. This complementarity is recognized worldwide. The conclusion of this report is that a new continuous neutron source is needed for the second decade of the 20 year plan to replace aging US research reactors and close the US neutron gap. it is based on spallation production of neutrons using a high power continuous superconducting linac to generate pr...

  14. The SLAC polarized electron source

    International Nuclear Information System (INIS)

    Clendenin, J.E.; Alley, R.; Frisch, J.; Kotseroglou, T.; Mulhollan, G.; Schultz, D.; Tang, H.; Turner, J.; Yeremian, A.D.

    1997-08-01

    Since 1992, the SLAC 3-km linac has operated exclusively with polarized electrons. The polarized electron source is highly reliable, remotely operated and monitored, and able to produce a variety of electron bunch profiles for high-energy physics experiments. The source and its operating characteristics are described. Some implications drawn from the operating experience are discussed

  15. A cold atom electron source

    NARCIS (Netherlands)

    Taban, G.

    2009-01-01

    Pulsed bright electron sources offer the possibility to study the structure of matter in great spatial and temporal detail. An example of an indirect method is to generate hard X-ray °ashes with high brilliance, a new Free Electron Laser facility is under construction. It requires an electron source

  16. High current density ion source

    International Nuclear Information System (INIS)

    King, H.J.

    1977-01-01

    A high-current-density ion source with high total current is achieved by individually directing the beamlets from an electron bombardment ion source through screen and accelerator electrodes. The openings in these screen and accelerator electrodes are oriented and positioned to direct the individual beamlets substantially toward a focus point. 3 figures, 1 table

  17. Urban Sources of Air Pollution

    DEFF Research Database (Denmark)

    Sorenson, Spencer C.

    1998-01-01

    A discusion of the relative importance of different mobile sources, effects of driving on emissions, history of emissions standards, and technological methods to reduce emissions.......A discusion of the relative importance of different mobile sources, effects of driving on emissions, history of emissions standards, and technological methods to reduce emissions....

  18. High average power supercontinuum sources

    Indian Academy of Sciences (India)

    The physical mechanisms and basic experimental techniques for the creation of high average spectral power supercontinuum sources is briefly reviewed. We focus on the use of high-power ytterbium-doped fibre lasers as pump sources, and the use of highly nonlinear photonic crystal fibres as the nonlinear medium.

  19. Online Sources for Competitor Information.

    Science.gov (United States)

    Weiss, Arthur

    Competitor information gathering is a key aspect of business planning. Information can be collected from either published or unpublished sources. Unpublished information will often be verified based on material from published sources. Published information is more likely to be factual and includes financial, stockmarket, press, market and…

  20. Ion source requirements for pulsed spallation neutron sources

    International Nuclear Information System (INIS)

    Alonso, J.R.

    1996-01-01

    The neutron scattering community has endorsed the need for a high-power (1 to 5 MW) accelerator-driven source of neutrons for materials research. Properly configured, the accelerator could produce very short (sub-microsecond) bursts of cold neutrons, said time structure offering advantages over the continuous flux from a reactor for a large class of experiments. The recent cancellation of the ANS reactor project has increased the urgency to develop a comprehensive strategy based on the best technological scenarios. Studies to date have built on the experience from ISIS (the 160 kW source in the UK), and call for a high-current (approx. 100 mA peak) H - source-linac combination injecting into one or more accumulator rings in which beam may be further accelerated. The 1 to 5 GeV proton beam is extracted in a single turn and brought to the target-moderator stations. The high current, high duty-factor, high brightness and high reliability required of the ion source present a very large challenge to the ion source community. A workshop held in Berkeley in October 1994, analyzed in detail the source requirements for proposed accelerator scenarios, the present performance capabilities of different H - source technologies, and identified necessary R ampersand D efforts to bridge the gap. copyright 1996 American Institute of Physics

  1. Ion source requirements for pulsed spallation neutron sources

    International Nuclear Information System (INIS)

    Alonso, J.R.

    1995-10-01

    The neutron scattering community has endorsed the need for a high- power (1 to 5 MW) accelerator-driven source of neutrons for materials research. Properly configured, the accelerator could produce very short (sub-microsecond) bursts of cold neutrons, said time structure offering advantages over the continuous flux from a reactor for a large class of experiments. The recent cancellation of the ANS reactor project has increased the urgency to develop a comprehensive strategy based on the best technological scenarios. Studies to date have built on the experience from ISIS (the 160 KW source in the UK), and call for a high-current (approx. 100 mA peak) H - source-linac combination injecting into one or more accumulator rings in which beam may be further accelerated. The 1 to 5 GeV proton beam is extracted in a single turn and brought to the target-moderator stations. The high current, high duty-factor, high brightness and high reliability required of the ion source present a very large challenge to the ion source community. A workshop held in Berkeley in October 1994, analyzed in detail the source requirements for proposed accelerator scenarios, the present performance capabilities of different H - source technologies, and identified necessary R ampersand D efforts to bridge the gap

  2. The Chandra Source Catalog: Background Determination and Source Detection

    Science.gov (United States)

    McCollough, Michael; Rots, Arnold; Primini, Francis A.; Evans, Ian N.; Glotfelty, Kenny J.; Hain, Roger; Anderson, Craig S.; Bonaventura, Nina R.; Chen, Judy C.; Davis, John E.; Doe, Stephen M.; Evans, Janet D.; Fabbiano, Giuseppina; Galle, Elizabeth C.; Danny G. Gibbs, II; Grier, John D.; Hall, Diane M.; Harbo, Peter N.; He, Xiang Qun (Helen); Houck, John C.; Karovska, Margarita; Kashyap, Vinay L.; Lauer, Jennifer; McCollough, Michael L.; McDowell, Jonathan C.; Miller, Joseph B.; Mitschang, Arik W.; Morgan, Douglas L.; Mossman, Amy E.; Nichols, Joy S.; Nowak, Michael A.; Plummer, David A.; Refsdal, Brian L.; Siemiginowska, Aneta L.; Sundheim, Beth A.; Tibbetts, Michael S.; van Stone, David W.; Winkelman, Sherry L.; Zografou, Panagoula

    2009-09-01

    The Chandra Source Catalog (CSC) is a major project in which all of the pointed imaging observations taken by the Chandra X-Ray Observatory are used to generate one of the most extensive X-ray source catalog produced to date. Early in the development of the CSC it was recognized that the ability to estimate local background levels in an automated fashion would be critical for essential CSC tasks such as source detection, photometry, sensitivity estimates, and source characterization. We present a discussion of how such background maps are created directly from the Chandra data and how they are used in source detection. The general background for Chandra observations is rather smoothly varying, containing only low spatial frequency components. However, in the case of ACIS data, a high spatial frequency component is added that is due to the readout streaks of the CCD chips. We discuss how these components can be estimated reliably using the Chandra data and what limitations and caveats should be considered in their use. We will discuss the source detection algorithm used for the CSC and the effects of the background images on the detection results. We will also touch on some the Catalog Inclusion and Quality Assurance criteria applied to the source detection results. This work is supported by NASA contract NAS8-03060 (CXC).

  3. Chandra Source Catalog: Background Determination and Source Detection

    Science.gov (United States)

    McCollough, Michael L.; Rots, A. H.; Primini, F. A.; Evans, I. N.; Glotfelty, K. J.; Hain, R.; Anderson, C. S.; Bonaventura, N. R.; Chen, J. C.; Davis, J. E.; Doe, S. M.; Evans, J. D.; Fabbiano, G.; Galle, E.; Gibbs, D. G.; Grier, J. D.; Hall, D. M.; Harbo, P. N.; He, X.; Houck, J. C.; Karovska, M.; Lauer, J.; McDowell, J. C.; Miller, J. B.; Mitschang, A. W.; Morgan, D. L.; Nichols, J. S.; Nowak, M. A.; Plummer, D. A.; Refsdal, B. L.; Siemiginowska, A. L.; Sundheim, B. A.; Tibbetts, M. S.; Van Stone, D. W.; Winkelman, S. L.; Zografou, P.

    2009-01-01

    The Chandra Source Catalog (CSC) is a major project in which all of the pointed imaging observations taken by the Chandra X-Ray Observatory will used to generate the most extensive X-ray source catalog produced to date. Early in the development of the CSC it was recognized that the ability to estimate local background levels in an automated fashion would be critical for essential CSC tasks such as source detection, photometry, sensitivity estimates, and source characterization. We present a discussion of how such background maps are created directly from the Chandra data and how they are used in source detection. The general background for Chandra observations is rather smoothly varying, containing only low spatial frequency components. However, in the case of ACIS data, a high spatial frequency component is added that is due to the readout streaks of the CCD chips. We discuss how these components can be estimated reliably using the Chandra data and what limitations and caveats should be considered in their use. We will discuss the source detection algorithm used for the CSC and the effects of the background images on the detection results. We will also touch on some the Catalog Inclusion and Quality Assurance criteria applied to the source detection results. This work is supported by NASA contract NAS8-03060 (CXC).

  4. Mean energy polarized neutron source

    International Nuclear Information System (INIS)

    Aleshin, V.A.; Zaika, N.I.; Kolotyj, V.V.; Prokopenko, V.S.; Semenov, V.S.

    1988-01-01

    Physical bases and realization scheme of a pulsed source of polarized neutrons with the energy of up to 75 MeV are described. The source comprises polarized deuteron source, transport line, low-energy ion and axial injector to the accelerator, U-240 isochronous cyclotron, targets for polarized neutron production, accelerated deuteron transport line and flight bases. The pulsed source of fast neutrons with the energy of up to 75 MeV can provide for highly polarized neutron beams with the intensity by 2-3 orders higher than in the most perfect source of this range which allows one to perform various experiments with high efficiency and energy resolution. 9 refs.; 1 fig

  5. Superconducting ECR ion source system

    International Nuclear Information System (INIS)

    Sharma, S.C.; Gore, J.A.; Gupta, A.K.; Saxena, A.

    2017-01-01

    In order to cover the entire mass range of the elements across the periodic table, an ECR based heavy ion accelerator programme, consisting of a superconducting ECR (Electron Cyclotron Resonance) source and a room temperature RFQ (Radio Frequency Quadrupole) followed by low and high beta superconducting resonator cavities has been proposed. The 18 GHz superconducting ECR ion source system has already been commissioned and being operated periodically at FOTIA beam hall. This source is capable of delivering ion beams right from proton to uranium with high currents and high charge states over a wide mass range (1/7 ≤ q/m ≤ 1/2) across the periodic table, including U"3"4"+ (q/m∼1/7) with 100 pna yield. The normalized transverse beam emittance from ECR source is expected to be <1.0 pi mm mrad. ECR ion sources are quite robust, making them suitable for operating for weeks continuously without any interruption

  6. Housing for a radioactive source

    International Nuclear Information System (INIS)

    Domnanovich, J. R.; Erwin, W. D.

    1985-01-01

    The radioactive structure comprises a radioactive source surrounded by a housing. The housing contains a first and second shielding body and a connecting device. The first shielding body has a protrusion which contains a first recess for receiving the radioactive source. The second shielding body has a second recess in one face end which accommodates the protrusion and a conical aperture communicating with the second recess in another face end. The connecting device connects the first shielding body to the second shielding body. When the radioactive source is inserted into the first recess and when the protrusion is located in the second recess, the radioactive source emits radiation primarily through the conical aperture into the environment. The source preferably contains americium which emits gamma radiation. The structure may be used as a motion correction sensor or as a marker in a nuclear diagnostic imaging

  7. Testing earthquake source inversion methodologies

    KAUST Repository

    Page, Morgan T.

    2011-01-01

    Source Inversion Validation Workshop; Palm Springs, California, 11-12 September 2010; Nowadays earthquake source inversions are routinely performed after large earthquakes and represent a key connection between recorded seismic and geodetic data and the complex rupture process at depth. The resulting earthquake source models quantify the spatiotemporal evolution of ruptures. They are also used to provide a rapid assessment of the severity of an earthquake and to estimate losses. However, because of uncertainties in the data, assumed fault geometry and velocity structure, and chosen rupture parameterization, it is not clear which features of these source models are robust. Improved understanding of the uncertainty and reliability of earthquake source inversions will allow the scientific community to use the robust features of kinematic inversions to more thoroughly investigate the complexity of the rupture process and to better constrain other earthquakerelated computations, such as ground motion simulations and static stress change calculations.

  8. Impedance Source Power Electronic Converters

    DEFF Research Database (Denmark)

    Liu, Yushan; Abu-Rub, Haitham; Ge, Baoming

    Impedance Source Power Electronic Converters brings together state of the art knowledge and cutting edge techniques in various stages of research related to the ever more popular impedance source converters/inverters. Significant research efforts are underway to develop commercially viable...... and technically feasible, efficient and reliable power converters for renewable energy, electric transportation and for various industrial applications. This book provides a detailed understanding of the concepts, designs, controls, and application demonstrations of the impedance source converters/inverters. Key...... features: Comprehensive analysis of the impedance source converter/inverter topologies, including typical topologies and derived topologies. Fully explains the design and control techniques of impedance source converters/inverters, including hardware design and control parameter design for corresponding...

  9. Impedance source power electronic converters

    CERN Document Server

    Liu, Yushan; Ge, Baoming; Blaabjerg, Frede; Ellabban, Omar; Loh, Poh Chiang

    2016-01-01

    Impedance Source Power Electronic Converters brings together state of the art knowledge and cutting edge techniques in various stages of research related to the ever more popular impedance source converters/inverters. Significant research efforts are underway to develop commercially viable and technically feasible, efficient and reliable power converters for renewable energy, electric transportation and for various industrial applications. This book provides a detailed understanding of the concepts, designs, controls, and application demonstrations of the impedance source converters/inverters. Key features: Comprehensive analysis of the impedance source converter/inverter topologies, including typical topologies and derived topologies. Fully explains the design and control techniques of impedance source converters/inverters, including hardware design and control parameter design for corresponding control methods. Presents the latest power conversion solutions that aim to advance the role of pow...

  10. Incidents with hazardous radiation sources

    International Nuclear Information System (INIS)

    Schoenhacker, Stefan

    2016-01-01

    Incidents with hazardous radiation sources can occur in any country, even those without nuclear facilities. Preparedness for such incidents is supposed to fulfill globally agreed minimum standards. Incidents are categorized in incidents with licensed handling of radiation sources as for material testing, transport accidents of hazardous radiation sources, incidents with radionuclide batteries, incidents with satellites containing radioactive inventory, incidents wit not licensed handling of illegally acquired hazardous radiation sources. The emergency planning in Austria includes a differentiation according to the consequences: incidents with release of radioactive materials resulting in restricted contamination, incidents with release of radioactive materials resulting in local contamination, and incidents with the hazard of e@nhanced exposure due to the radiation source.

  11. Sealed source peer review plan

    International Nuclear Information System (INIS)

    Feldman, Alexander; Leonard, Lee; Burns, Ron

    2009-01-01

    Sealed sources are known quantities of radioactive materials that have been encapsulated in quantities that produce known radiation fields. Sealed sources have multiple uses ranging from instrument calibration sources to sources that produce radiation fields for experimental applications. The Off-Site Source Recovery (OSR) Project at Los Alamos National Laboratory (LANL), created in 1999, under the direction of the Waste Management Division of the U.S. Department of Energy (DOE) Albuquerque has been assigned the responsibility to recover and manage excess and unwanted radioactive sealed sources from the public and private sector. LANL intends to ship drums containing qualified sealed sources to the Waste Isolation Pilot Plant (WIPP) for disposal. Prior to shipping, these drums must be characterized with respect to radiological content and other parameters. The U. S. Environmental Protection Agency (EPA) requires that ten radionulcides be quantified and reported for every container of waste to be disposed in the WIPP. The methods traditionally approved by the EPA include non-destructive assay (NDA) in accordance with Appendix A of the Contact-Handled Transuranic Waste Acceptance Criteria for the Waste Isolation Pilot Plant (DOE, 2002) (CH WAC). However, because of the nature and pedigree of historical records for sealed sources and the technical infeasibility of performing NDA on these sources, LANL proposes to characterize the content of these waste drums using qualified existing radiological data in lieu of direct measurement. This plan describes the process and documentation requirements for the use of the peer review process to qualify existing data for sealed radiological sources in lieu of perfonning radioassay. The peer review process will be performed in accordance with criteria provided in 40 CFR (section) 194.22 which specifies the use of the NUREG 1297 guidelines. The plan defines the management approach, resources, schedule, and technical requirements

  12. Radiation exposure by using unsealed radiation sources

    International Nuclear Information System (INIS)

    Preitfellner, J.

    1999-05-01

    Investigations on patients using radioactive substances are performed on a routinely basis in nuclear medicine facilities at many hospitals in our days. These investigations are performed by administering a radiopharmacon to the patient which, depending on several parameters, remains in the body of the patient for various periods of time. All these investigations have in common a g-ray exposure of the environment by the radioactive substance in the body of the patient. Among others, doctors, technical personnel, cleaning personnel, and accompanying persons of patients are exposed to g-rays. Based on these facts, the degree of danger for persons who get into contact with these patients is repeatedly questioned. An additional problem is the health risk of persons employed at a nuclear medicine facility. To answer the first question, the local dose rate in the environment of 102 patients was evaluated immediately after application of the radioactive substance, in intervals from 30 minutes up to several hours, over a period of up to 2 weeks. Depending on the nature of the investigation, the patients were subdivided into 6 groups of 16-20 persons. From the data measured, the effective and the biological half life as well as the local dose were computed. With the aid of concrete case examples, the possible radiation exposure for contact persons was estimated. Postulating unfavorable local and temporal factors in our estimations, the actual radiation exposure is to be estimated about 10-30 % lower. As a reference value for the danger of persons, the maximum permissible boundary values from the Austrian Regulations for Protection against Radiation were used. Referring to these boundary values, for none of the six nuclear medicine investigation methods a danger for contact persons could be derived, indicating that available security measures offer a sufficient protection for affected contact persons. To answer the question about the risk for persons employed at a nuclear

  13. CADDIS Volume 2. Sources, Stressors and Responses: Urbanization - Energy Sources

    Science.gov (United States)

    Introduction to changes in basal energy sources with urbanization, overview of terrestrial leaf litter dynamics in urban streams, overview of how urbanization can affect primary production, respiration, and dissolved organic carbon quantity and quality.

  14. Spectrometers for compact neutron sources

    Science.gov (United States)

    Voigt, J.; Böhm, S.; Dabruck, J. P.; Rücker, U.; Gutberlet, T.; Brückel, T.

    2018-03-01

    We discuss the potential for neutron spectrometers at novel accelerator driven compact neutron sources. Such a High Brilliance Source (HBS) relies on low energy nuclear reactions, which enable cryogenic moderators in very close proximity to the target and neutron optics at comparably short distances from the moderator compared to existing sources. While the first effect aims at increasing the phase space density of a moderator, the second allows the extraction of a large phase space volume, which is typically requested for spectrometer applications. We find that competitive spectrometers can be realized if (a) the neutron production rate can be synchronized with the experiment repetition rate and (b) the emission characteristics of the moderator can be matched to the phase space requirements of the experiment. MCNP simulations for protons or deuterons on a Beryllium target with a suitable target/moderator design yield a source brightness, from which we calculate the sample fluxes by phase space considerations for different types of spectrometers. These match closely the figures of todays spectrometers at medium flux sources. Hence we conclude that compact neutron sources might be a viable option for next generation neutron sources.

  15. Diversity employment and recruitment sources

    Energy Technology Data Exchange (ETDEWEB)

    1994-08-01

    Effective human resources management has been identified as one of four critical success factors in the Department of Energy Strategic Plan. The Plan states relative to this factor: ``The Department seeks greater alignment of resources with agency priorities and increased diversification of the workforce, including gender, ethnicity, age, and skills. This diversification will bring new thinking and perspectives that heretofore have not had a voice in departmental decision-making.`` This Guide has been developed as a key tool to assist Department of Energy management and administrative staff in achieving Goal 2 of this critical success factor, which is to ``Ensure a diverse and talented workforce.`` There are numerous sources from which to recruit minorities, women and persons with disabilities. Applying creativity and proactive effort, using traditional and non-traditional approaches, and reaching out to various professional, academic and social communities will increase the reservoir of qualified candidates from which to make selections. In addition, outreach initiatives will undoubtedly yield further benefits such as a richer cultural understanding and diversity awareness. The resource listings presented in this Guide are offered to encourage active participation in the diversity recruitment process. This Guide contains resource listings by state for organizations in the following categories: (1) African American Recruitment Sources; (2) Asian American/Pacific Islander Recruitment Sources; (3) Hispanic Recruitment Sources; (4) Native American/Alaskan Native Recruitment Sources; (5) Persons with Disabilities Recruitment Sources; and (6) Women Recruitment Sources.

  16. Spallation source neutron target systems

    International Nuclear Information System (INIS)

    Russell, G.; Brown, R.; Collier, M.; Donahue, J.

    1996-01-01

    This is the final report for a two-year, Laboratory-Directed Research and Development (LDRD) project at the Los Alamos National Laboratory (LANL). The project sought to design a next-generation spallation source neutron target system for the Manuel Lujan, Jr., Neutron Scattering Center (LANSCE) at Los Alamos. It has been recognized for some time that new advanced neutron sources are needed in the US if the country is to maintain a competitive position in several important scientific and technological areas. A recent DOE panel concluded that the proposed Advanced Neutron Source (a nuclear reactor at Oak Ridge National Laboratory) and a high-power pulsed spallation source are both needed in the near future. One of the most technically challenging designs for a spallation source is the target station itself and, more specifically, the target-moderator-reflector arrangement. Los Alamos has demonstrated capabilities in designing, building, and operating high-power spallation-neutron-source target stations. Most of the new design ideas proposed worldwide for target system design for the next generation pulsed spallation source have either been conceived and implemented at LANSCE or proposed by LANSCE target system designers. These concepts include split targets, flux-trap moderators, back scattering and composite moderators, and composite reflectors

  17. Designing of RF ion source and the power sources system

    International Nuclear Information System (INIS)

    Rusdiyanto.

    1978-01-01

    An RF ion source prototype is being developed for the particle accelerator at the Gama Research Centre. Supply of the gas is fed into the plasma chamber by means of neadle valve system. Magnetic field strength of about 500 gauss is applied to the system to improve the ionization efficiency. Components and spare parts of the RF ion source are made based on locally available materials and are discussed in this report. (author)

  18. Source Segregation and Collection of Source-Segregated Waste

    DEFF Research Database (Denmark)

    Christensen, Thomas Højlund; Matsufuji, Y.

    2011-01-01

    of optimal handling of the waste. But in a few cases, the waste must also be separated at source, for example removing the protective plastic cover from a commercial advertisement received by mail, prior to putting the advertisement into the waste collection bin for recyclable paper. These issues are often...... in wastes segregation addressing: - Purpose of source segregation. - Segregation criteria and guidance. - Segregation potentials and efficiencies. - Systems for collecting segregated fraction....

  19. Renewable energy sources. Erneuerbare Energien

    Energy Technology Data Exchange (ETDEWEB)

    1988-01-01

    To judge future trends in work on the exploitation of renewable energy sources for overall energy supply, it is necessary to know the following: the rules that nature abides by, the principles of technical exploitation of these energies, and the basic data for the current state of development. The above information is compiled in this publication for those renewable energy sources on which topical discussion centres: solar radiation and wind. For the remaining renowable energy sources (e.g. biomass, tidal power, geothermal energy), some examples of use are mentioned and advanced literature is indicated. (orig./HSCH).

  20. Superradiance in the source theory

    International Nuclear Information System (INIS)

    Kim, Y.D.

    1979-01-01

    The radiative transition rate is formulated in a new approach within the framework of the source theory which makes use of a vacuum persistence amplitude. It is also shown that the source theory can be applied effectively to detemine the likelihood of superradiance of coherence in spontaneous emission. Since the source theory is applicable not only to electromagnetic interactions but also to many other interaction, it would be most interesting to inquire if superradiance can occur in processes other than the elctromagnetic radiative process, such as nuclear or gravitational process. (Author)

  1. Visualization of Broadband Sound Sources

    Directory of Open Access Journals (Sweden)

    Sukhanov Dmitry

    2016-01-01

    Full Text Available In this paper the method of imaging of wideband audio sources based on the 2D microphone array measurements of the sound field at the same time in all the microphones is proposed. Designed microphone array consists of 160 microphones allowing to digitize signals with a frequency of 7200 Hz. Measured signals are processed using the special algorithm that makes it possible to obtain a flat image of wideband sound sources. It is shown experimentally that the visualization is not dependent on the waveform, but determined by the bandwidth. Developed system allows to visualize sources with a resolution of up to 10 cm.

  2. The sources of radiation exposure

    International Nuclear Information System (INIS)

    Bennett, B.G.

    1992-01-01

    Radiation protection of workers and of members of the public requires an assessment of the various sources of exposure, their variations in time or under specific conditions or circumstances, and the possibilities for control or limitation. The United Nations Scientific Committee on the Effects of Atomic Radiation (UNSCEAR) has evaluated the various components of natural and man-made sources in some detail. Natural exposures form the largest component of radiation exposure of man. Variability in exposures depends on elevation, the concentrations of radionuclides in soil, food and water, the composition of building materials and the susceptibility of indoor spaces to radon build-up. Man-made sources have included exposures to fallout from atmospheric nuclear testing and discharged from nuclear fuel cycle installations in routine operations or in accidents. The other main source of radiation exposures of individuals is in medical diagnostic examinations and therapeutic treatments. (author)

  3. Sources of Research on Ranganathan.

    Science.gov (United States)

    Satija, Mohinder Partap

    1987-01-01

    Identifies and describes major sources of information on the life and work of Ranganathan, the leader of the Indian library movement and a major contributor to the fields of library and information science. (CLB)

  4. Hot Hydrogen Heat Source Development

    Data.gov (United States)

    National Aeronautics and Space Administration — The purpose of this project is to develop a  hot hydrogen heat source that would produce  a high temperature hydrogen flow which would be comparable to that produced...

  5. Pulsed neutron sources at Dubna

    International Nuclear Information System (INIS)

    Shabalin, E.P.

    1991-01-01

    In 1960 the first world repetitively pulsed reactor IBR was put into operation. It was the beginning of the story how fission based pulsed neutron sources at Dubna have survived. The engineers involved have experienced many successes and failures in the course of new sources upgrading to finally come to possess the world's brightest neutron source - IBR-2. The details are being reviewed through the paper. The fission based pulsed neutron sources did not reach their final state as yet- the conceptual views of IBR prospects are being discussed with the goal to double the thermal neutron peak flux (up to 2x10 16 ) and to enhance the cold neutron flux by 10 times (with the present one being as high that of the ISIS cold moderator). (author)

  6. Synchrotron light source data book

    International Nuclear Information System (INIS)

    Murphy, J.

    1989-01-01

    The ''Synchrotron Light Source Data Book'' is as its name implies a collection of data on existing and planned synchrotron light sources. The intention was to provide a compendium of tools for the design of electron storage rings as synchrotron radiation sources. The slant is toward the accelerator physicist as other booklets such as the X-ray Data Booklet, edited by D. Vaughan (LBL PUB-490), address the 'use' of synchrotron radiation. It is hoped that the booklet serves as a pocket sized reference to facilitate back of the envelope type calculations. It contains some useful formulae in 'practical units' and a brief description of many of the existing and planned light source lattices

  7. Data Sources for the Analyses

    Data.gov (United States)

    U.S. Environmental Protection Agency — Links are provided for the National Wetlands Inventory, National Hydrography Dataset, and the WorldClim-Global Climate Data source data websites. This dataset is...

  8. Polluted Runoff: Nonpoint Source Pollution

    Science.gov (United States)

    Nonpoint Source (NPS) pollution is caused by rainfall or snowmelt moving over and through the ground, it picks up and carries natural and human-made pollutants, depositing them into lakes, rivers, wetlands, coastal waters and ground waters.

  9. Doses from Medical Radiation Sources

    Science.gov (United States)

    ... Medical Radiation Sources Michael G. Stabin, PhD, CHP Introduction Radiation exposures from diagnostic medical examinations are generally ... of exposure annually to natural background radiation. Plain Film X Rays Single Radiographs Effective Dose, mSv Skull ( ...

  10. Polar source analysis : technical memorandum

    Science.gov (United States)

    2017-09-29

    The following technical memorandum describes the development, testing and analysis of various polar source data sets. The memorandum also includes recommendation for potential inclusion in future releases of AEDT. This memorandum is the final deliver...

  11. Electromagnetic field sources in radiofrequency

    International Nuclear Information System (INIS)

    Oliveira, C.; Sebastiao, D.; Ladeira, D.; Antunes, M.; Correia, L.M.

    2010-01-01

    In the scope of the monIT Project, several measurements were made of electromagnetic fields in Portugal. This paper presents an analysis of the sources operating in the radiofrequency range, resulting from 2429 measurements in 466 locations.

  12. Mobile Source Observation Database (MSOD)

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Mobile Source Observation Database (MSOD) is a relational database being developed by the Assessment and Standards Division (ASD) of the US Environmental...

  13. Perspectives on Open Source Software

    National Research Council Canada - National Science Library

    Hissam, Scott

    2001-01-01

    Open source software (OSS) is emerging as the software community's next "silver bullet" and appears to be playing a significant role in the acquisition and development plans of the Department of Defense (DoD) and industry...

  14. Calibration and check light source

    Energy Technology Data Exchange (ETDEWEB)

    Nejedla, B; Krotil, J

    1979-02-15

    The light source is designed for calibrating photomultipliers and checking the function of the thermoluminescent dosemeters evaluation equipment. The check light source consists of a polymer material-based (polyvinyl toluene) plastic scintillator and a 2-phenyl-5-(4-bisphenyl)-1,3,4-oxadiazol and/or paraterphenyl activator, and of emission spectrum shifters for response in the green and the blue light regions. The plastic scintillator is sealed in a case to whose bottom a radiation source is fixed, such as a /sup 90/Sr-/sup 90/Y source of an activity of 1.85x10/sup 3/s/sup -1/ to 0.74x10/sup 9/s/sup -1/.

  15. H- radio frequency source development at the Spallation Neutron Source.

    Science.gov (United States)

    Welton, R F; Dudnikov, V G; Gawne, K R; Han, B X; Murray, S N; Pennisi, T R; Roseberry, R T; Santana, M; Stockli, M P; Turvey, M W

    2012-02-01

    The Spallation Neutron Source (SNS) now routinely operates nearly 1 MW of beam power on target with a highly persistent ∼38 mA peak current in the linac and an availability of ∼90%. H(-) beam pulses (∼1 ms, 60 Hz) are produced by a Cs-enhanced, multicusp ion source closely coupled with an electrostatic low energy beam transport (LEBT), which focuses the 65 kV beam into a radio frequency quadrupole accelerator. The source plasma is generated by RF excitation (2 MHz, ∼60 kW) of a copper antenna that has been encased with a thickness of ∼0.7 mm of porcelain enamel and immersed into the plasma chamber. The ion source and LEBT normally have a combined availability of ∼99%. Recent increases in duty-factor and RF power have made antenna failures a leading cause of downtime. This report first identifies the physical mechanism of antenna failure from a statistical inspection of ∼75 antennas which ran at the SNS, scanning electron microscopy studies of antenna surface, and cross sectional cuts and analysis of calorimetric heating measurements. Failure mitigation efforts are then described which include modifying the antenna geometry and our acceptance∕installation criteria. Progress and status of the development of the SNS external antenna source, a long-term solution to the internal antenna problem, are then discussed. Currently, this source is capable of delivering comparable beam currents to the baseline source to the SNS and, an earlier version, has briefly demonstrated unanalyzed currents up to ∼100 mA (1 ms, 60 Hz) on the test stand. In particular, this paper discusses plasma ignition (dc and RF plasma guns), antenna reliability, magnet overheating, and insufficient beam persistence.

  16. Ring insertions as light sources

    International Nuclear Information System (INIS)

    Green, G.K.

    1975-01-01

    Bending magnets can be inserted in the long straight sections of electron storage rings to produce synchrotron radiation. If the design is carefully proportioned, the bending magnets create only a small perturbation of the properties of the ring. The resulting spectra have favorable optical properties as sources for spectroscopy and diffraction studies. The characteristics of the source are discussed, and the geometrical requirements of the magnets are presented

  17. Irradiation device using radiation sources

    International Nuclear Information System (INIS)

    Perraudin, Claude; Amarge, Edmond; Guiho, J.-P.; Horiot, J.-C.; Taniel, Gerard; Viel, Georges; Brethon, J.-P.

    1981-01-01

    The invention refers to an irradiation appliance making use of radioactive sources such as cobalt 60. This invention concerns an irradiation appliance delivering an easily adjustable irradiation beam in accurate dimensions and enabling the radioactive sources to be changed without making use of intricate manipulations at the very place where the appliance has to be used. This kind of appliance is employed in radiotherapy [fr

  18. Open Source Vulnerability Database Project

    Directory of Open Access Journals (Sweden)

    Jake Kouns

    2008-06-01

    Full Text Available This article introduces the Open Source Vulnerability Database (OSVDB project which manages a global collection of computer security vulnerabilities, available for free use by the information security community. This collection contains information on known security weaknesses in operating systems, software products, protocols, hardware devices, and other infrastructure elements of information technology. The OSVDB project is intended to be the centralized global open source vulnerability collection on the Internet.

  19. Information in vague data sources

    Czech Academy of Sciences Publication Activity Database

    Mareš, Milan; Mesiar, Radko

    2013-01-01

    Roč. 49, č. 3 (2013), s. 433-445 ISSN 0023-5954 R&D Projects: GA ČR GAP402/11/0378 Keywords : alphabet * triangular norm * information * entropy * fuzziness * data source Subject RIV: BA - General Mathematics Impact factor: 0.563, year: 2013 http://library.utia.cas.cz/separaty/2013/E/mesiar-information in vague data sources.pdf

  20. Ion sources for industrial use

    International Nuclear Information System (INIS)

    Sakudo, Noriyuki

    1994-01-01

    Industrial applications of ion beams began in the 1970's with their application in fabrication of semiconductor devices. Since then, various improvements have been carried out for source lifetimes, current levels and diversification of ion species. Nowadays, ion beams are expected to be used for surface modification of materials as well as semiconductor fabrication. In this report, some of the typical ion sources are reviewed from the viewpoint of future industrial use. (author)

  1. Minor sources of miner exposure

    International Nuclear Information System (INIS)

    Strong, J.C.; Green, N.; Brown, K.; O'Riordan, M.C.

    1983-01-01

    The sources of radiation exposure to miners in non-coal mines in addition to radon daughters are thoron daughters in mine air, long-lived radionuclides in mine dust and gamma radiation from the local rocks. A crude estimate of the total annual effective dose equivalent from these minor sources is 2 - 5 mSv which is of secondary importance compared to the dose from radon daughters. (UK)

  2. Dosimetry of β extensive sources

    International Nuclear Information System (INIS)

    Rojas C, E.L.; Lallena R, A.M.

    2002-01-01

    In this work, we have been studied, making use of the Penelope Monte Carlo simulation code, the dosimetry of β extensive sources in situations of spherical geometry including interfaces. These configurations are of interest in the treatment of the called cranealfaringyomes of some synovia leisure of knee and other problems of interest in medical physics. Therefore, its application can be extended toward problems of another areas with similar geometric situation and beta sources. (Author)

  3. Visualization of Broadband Sound Sources

    OpenAIRE

    Sukhanov Dmitry; Erzakova Nadezhda

    2016-01-01

    In this paper the method of imaging of wideband audio sources based on the 2D microphone array measurements of the sound field at the same time in all the microphones is proposed. Designed microphone array consists of 160 microphones allowing to digitize signals with a frequency of 7200 Hz. Measured signals are processed using the special algorithm that makes it possible to obtain a flat image of wideband sound sources. It is shown experimentally that the visualization is not dependent on the...

  4. Cornell electron beam ion source

    International Nuclear Information System (INIS)

    Kostroun, V.O.; Ghanbari, E.; Beebe, E.N.; Janson, S.W.

    1981-01-01

    An electron beam ion source (EBIS) for the production of low energy, multiply charged ion beams to be used in atomic physics experiments has been designed and constructed. An external high perveance electron gun is used to launch the electron beam into a conventional solenoid. Novel features of the design include a distributed sputter ion pump to create the ultrahigh vacuum environment in the ionization region of the source and microprocessor control of the axial trap voltage supplies

  5. Ion source with plasma cathode

    International Nuclear Information System (INIS)

    Yabe, E.

    1987-01-01

    A long lifetime ion source with plasma cathode has been developed for use in ion implantation. In this ion source, a plasma of a nonreactive working gas serves as a cathode in place of a thermionic tungsten filament used in the Freeman ion source. In an applied magnetic field, the plasma is convergent, i.e., filamentlike; in zero magnetic field, it turns divergent and spraylike. In the latter case, the plasma exhibits a remarkable ability when the working gas has an ionization potential larger than the feed gas. By any combination of a working gas of either argon or neon and a feed gas of AsF 5 or PF 5 , the lifetime of this ion source was found to be more than 90 h with an extraction voltage of 40 kV and the corresponding ion current density 20 mA/cm 2 . Mass spectrometry results show that this ion source has an ability of generating a considerable amount of As + and P + ions from AsF 5 and PF 5 , and hence will be useful for realizing a fully cryopumped ion implanter system. This ion source is also eminently suitable for use in oxygen ion production

  6. Refurbishing tritium contaminated ion sources

    International Nuclear Information System (INIS)

    Wright, K.E.; Carnevale, R.H.; McCormack, B.E.; Stevenson, T.; Halle, A. von

    1995-01-01

    Extended tritium experimentation on TFTR has necessitated refurbishing Neutral Beam Long Pulse Ion Sources (LPIS) which developed operational difficulties, both in the TFTR Test Cell and later, in the NB Source Refurbishment Shop. Shipping contaminated sources off-site for repair was not permissible from a transport and safety perspective. Therefore, the NB source repair facility was upgraded by relocating fixtures, tooling, test apparatus, and three-axis coordinate measuring equipment; purchasing and fabricating fume hoods; installing exhaust vents; and providing a controlled negative pressure environment in the source degreaser/decon area. Appropriate air flow monitors, pressure indicators, tritium detectors and safety alarms were also included. The effectiveness of various decontamination methods was explored while the activation was monitored. Procedures and methods were developed to permit complete disassembly and rebuild of an ion source while continuously exhausting the internal volume to the TFTR Stack to avoid concentrations of tritium from outgassing and minimize personnel exposure. This paper presents upgrades made to the LPIS repair facility, various repair tasks performed, and discusses the effectiveness of the decontamination processes utilized

  7. Cold source vessel development for the advanced neutron source

    Energy Technology Data Exchange (ETDEWEB)

    Williams, P.T.; Lucas, A.T. [Oak Ridge National Lab., TN (United States)

    1995-09-01

    The Advanced Neutron Source (ANS), in its conceptual design phase at Oak Ridge National Laboratory (ORNL), will be a user-oriented neutron research facility that will produce the most intense flux of neutrons in the world. Among its many scientific applications, the productions of cold neutrons is a significant research mission for the ANS. The cold neutrons come from two independent cold sources positioned near the reactor core. Contained by an aluminum alloy vessel, each cold source is a 410 mm diameter sphere of liquid deuterium that functions both as a neutron moderator and a cryogenic coolant. With nuclear heating of the containment vessel and internal baffling, steady-state operation requires close control of the liquid deuterium flow near the vessel`s inner surface. Preliminary thermal-hydraulic analyses supporting the cold source design are being performed with multi-dimensional computational fluid dynamics simulations of the liquid deuterium flow and heat transfer. This paper presents the starting phase of a challenging program and describes the cold source conceptual design, the thermal-hydraulic feasibility studies of the containment vessel, and the future computational and experimental studies that will be used to verify the final design.

  8. The Chandra Source Catalog: Source Properties and Data Products

    Science.gov (United States)

    Rots, Arnold; Evans, Ian N.; Glotfelty, Kenny J.; Primini, Francis A.; Zografou, Panagoula; Anderson, Craig S.; Bonaventura, Nina R.; Chen, Judy C.; Davis, John E.; Doe, Stephen M.; Evans, Janet D.; Fabbiano, Giuseppina; Galle, Elizabeth C.; Gibbs, Danny G., II; Grier, John D.; Hain, Roger; Hall, Diane M.; Harbo, Peter N.; He, Xiang Qun (Helen); Houck, John C.; Karovska, Margarita; Kashyap, Vinay L.; Lauer, Jennifer; McCollough, Michael L.; McDowell, Jonathan C.; Miller, Joseph B.; Mitschang, Arik W.; Morgan, Douglas L.; Mossman, Amy E.; Nichols, Joy S.; Nowak, Michael A.; Plummer, David A.; Refsdal, Brian L.; Siemiginowska, Aneta L.; Sundheim, Beth A.; Tibbetts, Michael S.; van Stone, David W.; Winkelman, Sherry L.

    2009-09-01

    The Chandra Source Catalog (CSC) is breaking new ground in several areas. There are two aspects that are of particular interest to the users: its evolution and its contents. The CSC will be a living catalog that becomes richer, bigger, and better in time while still remembering its state at each point in time. This means that users will be able to take full advantage of new additions to the catalog, while retaining the ability to back-track and return to what was extracted in the past. The CSC sheds the limitations of flat-table catalogs. Its sources will be characterized by a large number of properties, as usual, but each source will also be associated with its own specific data products, allowing users to perform mini custom analysis on the sources. Source properties fall in the spatial (position, extent), photometric (fluxes, count rates), spectral (hardness ratios, standard spectral fits), and temporal (variability probabilities) domains, and are all accompanied by error estimates. Data products cover the same coordinate space and include event lists, images, spectra, and light curves. In addition, the catalog contains data products covering complete observations: event lists, background images, exposure maps, etc. This work is supported by NASA contract NAS8-03060 (CXC).

  9. Sources

    OpenAIRE

    2017-01-01

    1 - Archives départementales de l’Isère (AD38) Série B, Chambre des comptes du Dauphiné B 2611 (1331)B 2635 (1213-1282)B 3006, fos 743v°-744r°B 3120, fos 220-221v° (1339)B 3138 (1398)B 3139 1251)B 3158 (1231)B 3159 (1214-1284)B 3551B 3637-B 3698B 3735 (1257)B 3791 (1262)B 3850 (1298-1379)B 3978 (1270-1331)B 4000 (1290)B 4077B 4079 (1242-1247-1428)B 4083 (1263)B 4086 (1235-1306)B 4454 (1364-1433) Série B, visites du maître des œuvres delphinales Libri visitationis receptionis castrorum et domo...

  10. Design parameters and source terms: Volume 3, Source terms

    International Nuclear Information System (INIS)

    1987-10-01

    The Design Parameters and Source Terms Document was prepared in accordance with DOE request and to provide data for the environmental impact study to be performed in the future for the Deaf Smith County, Texas site for a nuclear waste repository in salt. This document updates a previous unpublished report by Stearns Catalytic Corporation (SCC), entitled ''Design Parameters and Source Terms for a Two-Phase Repository in Salt,'' 1985, to the level of the Site Characterization Plan - Conceptual Design Report. The previous unpublished SCC Study identifies the data needs for the Environmental Assessment effort for seven possible Salt Repository sites. 11 refs., 9 tabs

  11. The status of DESY H- - sources

    International Nuclear Information System (INIS)

    Peters, J.

    1996-01-01

    Two different types of H - sources are operated at DESY, a magnetron source and an rf- driven volume source. H - sources for HERA have to run for long uninterrupted periods with a low duty factor and a high reliability. Several necessary improvements are under construction for our rf - driven volume source. The status of both our magnetron and our volume source will be discussed and the first LINAC III experiment with the rf-driven volume source will be presented. (author)

  12. Miniature field deployable terahertz source

    Science.gov (United States)

    Mayes, Mark G.

    2006-05-01

    Developments in terahertz sources include compacted electron beam systems, optical mixing techniques, and multiplication of microwave frequencies. Although significant advances in THz science have been achieved, efforts continue to obtain source technologies that are more mobile and suitable for field deployment. Strategies in source development have approached generation from either end of the THz spectrum, from up-conversion of high-frequency microwave to down-conversion of optical frequencies. In this paper, we present the design of a THz source which employs an up-conversion method in an assembly that integrates power supply, electronics, and radiative component into a man-portable unit for situations in which a lab system is not feasible. This unit will ultimately evolve into a ruggedized package suitable for use in extreme conditions, e.g. temporary security check points or emergency response teams, in conditions where THz diagnostics are needed with minimal planning or logistical support. In order to meet design goals of reduced size and complexity, the inner workings of the unit ideally would be condensed into a monolithic active element, with ancillary systems, e.g. user interface and power, coupled to the element. To attain these goals, the fundamental component of our design is a THz source and lens array that may be fabricated with either printed circuit board or wafer substrate. To reduce the volume occupied by the source array, the design employs a metamaterial composed of a periodic lattice of resonant elements. Each resonant element is an LC oscillator, or tank circuit, with inductance, capacitance, and center frequency determined by dimensioning and material parameters. The source array and supporting electronics are designed so that the radiative elements are driven in-phase to yield THz radiation with a high degree of partial coherence. Simulation indicates that the spectral width of operation may be controlled by detuning of critical dimensions

  13. Modelling Choice of Information Sources

    Directory of Open Access Journals (Sweden)

    Agha Faisal Habib Pathan

    2013-04-01

    Full Text Available This paper addresses the significance of traveller information sources including mono-modal and multimodal websites for travel decisions. The research follows a decision paradigm developed earlier, involving an information acquisition process for travel choices, and identifies the abstract characteristics of new information sources that deserve further investigation (e.g. by incorporating these in models and studying their significance in model estimation. A Stated Preference experiment is developed and the utility functions are formulated by expanding the travellers' choice set to include different combinations of sources of information. In order to study the underlying choice mechanisms, the resulting variables are examined in models based on different behavioural strategies, including utility maximisation and minimising the regret associated with the foregone alternatives. This research confirmed that RRM (Random Regret Minimisation Theory can fruitfully be used and can provide important insights for behavioural studies. The study also analyses the properties of travel planning websites and establishes a link between travel choices and the content, provenance, design, presence of advertisements, and presentation of information. The results indicate that travellers give particular credence to governmentowned sources and put more importance on their own previous experiences than on any other single source of information. Information from multimodal websites is more influential than that on train-only websites. This in turn is more influential than information from friends, while information from coachonly websites is the least influential. A website with less search time, specific information on users' own criteria, and real time information is regarded as most attractive

  14. Radio outbursts in extragalactic sources

    International Nuclear Information System (INIS)

    Kinzel, W.M.

    1989-01-01

    Three aspects of the flux density variability of extragalactic radio sources were examined: millimeter wavelength short timescale variability, the spectral evolution of outbursts, and whether the outbursts are periodically spaced. Observations of extragalactic radio sources were conducted using the Five College Radio Astronomy Observatory between January and June 1985 at 88.2 GHz and during June and July 1985 at 40.0 GHz. Many of the sources exhibited significant flux density variations during the observing span. In addition, the most rapid variations observed were comparable with those reported in previous works. Two sources, 0355+50 and OJ287, both exhibited outbursts whose rise and fall timescales were less than a month. An anomalous flux density dropout was observed in 3C446 and was interpreted as an occultation event. Data at five frequencies between 2.7 and 89.6 GHz from the Dent-Balonek monitoring program were used to investigate the spectral evolution of eight outbursts. Outburst profile fitting was used to deconvolve the individual outbursts from one another at each frequency. The fit profiles were used to generate multiple epoch spectra to investigate the evolution of the outbursts. A phase residual minimization method was used to examine four sources for periodic behavior

  15. Searching for Orphan radiation sources

    International Nuclear Information System (INIS)

    Bystrov, Evgenij; Antonau, Uladzimir; Gurinovich, Uladzimir; Kazhamiakin, Valery; Petrov, Vitaly; Shulhovich, Heorhi; Tischenko, Siarhei

    2008-01-01

    Full text: The problem of orphan sources cannot be left unaddressed due high probability of accidental exposure and use of sources for terrorism. Search of objects of this kind is complex particularly when search territory is large. This requires devices capable of detecting sources, identifying their radionuclide composition, and correlating scan results to geographical coordinates and displaying results on a map. Spectral radiation scanner AT6101C can fulfill the objective of search for gamma and neutron radiation sources, radionuclide composition identification, correlation results to geographical coordinates and displaying results on a map. The scanner consists of gamma radiation scintillation detection unit based on NaI(Tl) crystal, neutron detection unit based on two He 3 counters, GPS receiver and portable ruggedized computer. Built-in and application software automates entire scan process, saving all results to memory for further analysis with visual representation of results as spectral information diagrams, count rate profile and gamma radiation dose rates on a geographical map. The scanner informs operator with voice messages on detection of radiation sources, identification result and other events. Scanner detection units and accessories are packed in a backpack. Weighing 7 kg, the scanner is human portable and can be used for scan inside cars. The scanner can also be used for radiation mapping and inspections. (author)

  16. Instrumentation at pulsed neutron sources

    International Nuclear Information System (INIS)

    Carpenter, J.M.; Lander, G.H.; Windsor, C.G.

    1984-01-01

    Scientific investigations involving the use of neutron beams have been centered at reactor sources for the last 35 years. Recently, there has been considerable interest in using the neutrons produced by accelerator driven (pulsed) sources. Such installations are in operation in England, Japan, and the United States. In this article a brief survey is given of how the neutron beams are produced and how they can be optimized for neutron scattering experiments. A detailed description is then given of the various types of instruments that have been, or are planned, at pulsed sources. Numerous examples of the scientific results that are emerging are given. An attempt is made throughout the article to compare the scientific opportunities at pulsed sources with the proven performance of reactor installations, and some familiarity with the latter and the general field of neutron scattering is assumed. New areas are being opened up by pulsed sources, particularly with the intense epithermal neutron beams, which promise to be several orders of magnitude more intense than can be obtained from a thermal reactor

  17. Event-sequence time series analysis in ground-based gamma-ray astronomy

    International Nuclear Information System (INIS)

    Barres de Almeida, U.; Chadwick, P.; Daniel, M.; Nolan, S.; McComb, L.

    2008-01-01

    The recent, extreme episodes of variability detected from Blazars by the leading atmospheric Cerenkov experiments motivate the development and application of specialized statistical techniques that enable the study of this rich data set to its furthest extent. The identification of the shortest variability timescales supported by the data and the actual variability structure observed in the light curves of these sources are some of the fundamental aspects being studied, that answers can bring new developments on the understanding of the physics of these objects and on the mechanisms of production of VHE gamma-rays in the Universe. Some of our efforts in studying the time variability of VHE sources involve the application of dynamic programming algorithms to the problem of detecting change-points in a Poisson sequence. In this particular paper we concentrate on the more primary issue of the applicability of counting statistics to the analysis of time-series on VHE gamma-ray astronomy.

  18. Compact portable electric power sources

    Energy Technology Data Exchange (ETDEWEB)

    Fry, D.N.; Holcomb, D.E.; Munro, J.K.; Oakes, L.C.; Matson, M.J.

    1997-02-01

    This report provides an overview of recent advances in portable electric power source (PEPS) technology and an assessment of emerging PEPS technologies that may meet US Special Operations Command`s (SOCOM) needs in the next 1--2- and 3--5-year time frames. The assessment was performed through a literature search and interviews with experts in various laboratories and companies. Nineteen PEPS technologies were reviewed and characterized as (1) PEPSs that meet SOCOM requirements; (2) PEPSs that could fulfill requirements for special field conditions and locations; (3) potentially high-payoff sources that require additional R and D; and (4) sources unlikely to meet present SOCOM requirements. 6 figs., 10 tabs.

  19. Materials for spallation neutron sources

    International Nuclear Information System (INIS)

    Sommer, W.F.; Daemen, L.L.

    1996-03-01

    The Workshop on Materials for Spallation Neutron Sources at the Los Alamos Neutron Science Center, February 6 to 10, 1995, gathered scientists from Department of Energy national laboratories, other federal institutions, universities, and industry to discuss areas in which work is needed, successful designs and use of materials, and opportunities for further studies. During the first day of the workshop, speakers presented overviews of current spallation neutron sources. During the next 3 days, seven panels allowed speakers to present information on a variety of topics ranging from experimental and theoretical considerations on radiation damage to materials safety issues. An attempt was made to identify specific problems that require attention within the context of spallation neutron sources. This proceedings is a collection of summaries from the overview sessions and the panel presentations

  20. Solid sources of krypton-85

    International Nuclear Information System (INIS)

    Puig, J.R.; Sandier, J.

    1962-01-01

    Krypton-85, a β-emitter with a long half-life and low biological hazard, has considerable industrial potentialities. It is difficult, however, to manufacture sources since the element occurs in gaseous form and cannot be chemically fixed. The authors describe a method of krypton-fixation in a macromolecular matrix formed by mass polymerization of a liquid monomer containing krypton; they also give an account of the preparation of two types of source produced in this way-one enclosed in polystyrene, the other in polyvinyl acetate. Such sources lose krypton; the activity of the first decreases by 8 % daily, that of the second by 3 % daily. These apparent decays enable the diffusion coefficients of krypton in these polymers to be calculated. Diffusion appears to be prevented by the cross-linkages which exist in the polymers. (author) [fr

  1. Graphite moderated 252Cf source

    International Nuclear Information System (INIS)

    Sajo B, L.; Barros, H.; Greaves, E. D.; Vega C, H. R.

    2014-08-01

    The thorium molten salt reactor is an attractive and affordable nuclear power option for developing countries with insufficient infrastructure and limited technological capability. In the aim of personnel training and experience gathering at the Universidad Simon Bolivar there is in progress a project of developing a subcritical thorium liquid fuel reactor. The neutron source to run this subcritical reactor is a 252 Cf source and the reactor will use high-purity graphite as moderator. Using the MCNP5 code the neutron spectra of the 252 Cf in the center of the graphite moderator has been estimated along the channel where the liquid thorium salt will be inserted; also the ambient dose equivalent due to the source has been determined around the moderator. (Author)

  2. Entrepreneurship as re-sourcing

    DEFF Research Database (Denmark)

    Korsgaard, Steffen; Anderson, Alistair; Gaddefors, Johan

    Objectives The purpose of this paper is to re-examine the concept of entrepreneurship in light of the current financial and environmental crisis and its socio-spatial impact. Building on Hudson’s analysis of production in late-capitalist societies, we identify problems inherent in the dominant...... of grounding in material reality, lacking emphasis on environmental externalities and an impoverished conceptualization of spatial relations. Comparing this analysis with the dominant opportunistic image of the entrepreneur, leads us to formulate a critique of this image. In formulating an alternative we build...... The paper presents a “new image” of entrepreneurship as re-sourcing. The concept of re-sourcing emphasizes the dual meaning of the word resource as both a stock of supply and strategy or action adopted in adverse circumstances. Re-sourcing thus signifies a shift in focus from opportunities to resources...

  3. Miniature x-ray source

    Science.gov (United States)

    Trebes, James E.; Bell, Perry M.; Robinson, Ronald B.

    2000-01-01

    A miniature x-ray source utilizing a hot filament cathode. The source has a millimeter scale size and is capable of producing broad spectrum x-ray emission over a wide range of x-ray energies. The miniature source consists of a compact vacuum tube assembly containing the hot filament cathode, an anode, a high voltage feedthru for delivering high voltage to the cathode, a getter for maintaining high vacuum, a connector for initial vacuum pump down and crimp-off, and a high voltage connection for attaching a compact high voltage cable to the high voltage feedthru. At least a portion of the vacuum tube wall is fabricated from highly x-ray transparent materials, such as sapphire, diamond, or boron nitride.

  4. Infrared observations of extragalactic sources

    International Nuclear Information System (INIS)

    Kleinmann, D.E.

    1977-01-01

    The available balloon-borne and airborne infrared data on extragalactic sources, in particular M 82, NGC 1068 and NGC 253, is reviewed and discussed in the context of the extensive groundbased work. The data is examined for the clues they provide on the nature of the ultimate source of the energy radiated and on the mechanism(s) by which it is radiated. Since the discovery of unexpectedly powerful infrared radiation from extragalactic objects - a discovery now about 10 years old - the outstanding problems in this field have been to determine (1) the mechanism by which prodigious amounts of energy are released in the infrared, and (2) the nature of the underlying energy source. (Auth.)

  5. Source and LINAC3 studies

    CERN Document Server

    Bellodi, G

    2017-01-01

    In the framework of the LHC Ion Injector Upgrade pro-gramme (LIU), several activities have been carried out in2016 to improve the ion source and Linac3 performance,with the goal to increase the beam current routinely deliv-ered to LEIR. The extraction region of the GTS-LHC ionsource was upgraded with enlarged vacuum chamber aper-tures and the addition of an einzel lens, yielding highertransmission through the rest of the machine. Also, a seriesof experiments have been performed to study the effects ofdouble frequency mixing on the afterglow performance ofthe source after installation of a Travelling Wave Tube Am-plifier (TWTA) as secondary microwave source at variablefrequency. Measurements have been carried out at a dedi-cated oven test stand for better understanding of the ionsource performance. Finally, several MD sessions werededicated to the study and characterization of the strippingfoils, after evidence of degradation in time was discoveredin the 2015 run.

  6. Spark-safe power source

    Energy Technology Data Exchange (ETDEWEB)

    Mester, I M; Konushkin, N A; Nevozinskiy, A K; Rubinshteyn, B Sh; Serov, V I; Vasnev, M A

    1981-01-01

    A shortcoming of the known power sources is their low reliability. The purpose of the invention is to improve the reliability of the device. This is achieved because the spark-safe power source is equipped with a by-passing transistor and potentiometer, and also a generator of control interruptions in the circuit, an I-element, first separating transformer, control block, second separating transformer whose secondary winding has a relay winding whose contacts are connected to the load circuit are connected in series. The generator of control separations of the circuit is connected to the base of the by-passing transistor and to the power source outlet, the potentiometer is connected in series to the main thyristor. The middle point of the potentiometer is connected to the second inlet of the I-element.

  7. Solar cell power source system

    Energy Technology Data Exchange (ETDEWEB)

    Shimizu, Yoichi; Toma, Kunio; Fukuwa, Shinji

    1988-05-14

    This invention aims to supply a power source system with stable power output by reducing the power loss due to switching in the voltage stabilization even when the power source is a solar cell with frequent voltage variation. For this purpose, in a solar cell power source system consisting of a solar cell, a storage battery, a switching regulator placed between the storage cell and the load, and a load, arrangement was made that, by judging the input voltage from the storage battery, switch-acting the transistor of the switching regulator, if the input voltage is higher than the specified voltage; is the input voltage is lower than the specified voltage, the transistor is put in a full-on state. By this, the supply voltage can be stabilized even when the voltage fluctuates, and system gets more efficient as the switching loss decreases in the voltage stabilizing means. (1 fig)

  8. Light sources and light pollution

    International Nuclear Information System (INIS)

    Pichler, G.

    2005-01-01

    From the dawn of mankind fire and light sources in general played an essential role in everyday life and protection over night. The development of new light sources went through many stages and is now an immense technological achievement, but also a threat for the wildlife at night, mainly because of the so-called light pollution. This paper discusses several very successful light sources connected with low pressure mercury and sodium vapour electric discharges. The luminous efficacy, colour rendering index and other lighting features cannot be always satisfactory, but at least some of the features can be much better than those met by the standard tungsten filament bulbs. High-pressure metal-vapour discharge lamps definitely have a good colour rendering index and a relatively high luminosity. Different light sources with burners at high pressure are discussed, paying special attention to their spectrum. The paper investigates new trends in development through a number of examples with non-toxic elements and pulsed electric discharge, which may be good news in terms of clean environment and energy savings. Light emitting diodes have recently appeared as worthy competitors to conventional light sources. White LEDs have approached 100 lumen/Watt efficacy in laboratories. This suggests that in some not very distant future they could completely replace high-pressure lamps, at least in indoor lighting. The article speculates on new developments which combine trends in nano technology and material science. The paper concludes with light pollution in view of several recent observations of plant and animal life at night in the vicinity of strong light sources. Photo-induced changes at the cell level may completely alter the normal life of plants and animals.(author)

  9. Gas and metal ion sources

    International Nuclear Information System (INIS)

    Oaks, E.; Yushkov, G.

    1996-01-01

    The positive ion sources are now of interest owing to both their conventional use, e.g., as injectors in charged-particle accelerators and the promising capabilities of intense ion beams in the processes related to the action of ions on various solid surfaces. For industrial use, the sources of intense ion beams and their power supplies should meet the specific requirements as follows: They should be simple, technologically effective, reliable, and relatively low-cost. Since the scanning of an intense ion beam is a complicated problem, broad ion beams hold the greatest promise. For the best use of such beams it is desirable that the ion current density be uniformly distributed over the beam cross section. The ion beam current density should be high enough for the treatment process be accomplished for an acceptable time. Thus, the ion sources used for high-current, high-dose metallurgical implantation should provide for gaining an exposure dose of ∼ 10 17 cm -2 in some tens of minutes. So the average ion current density at the surface under treatment should be over 10 -5 A/cm 2 . The upper limit of the current density depends on the admissible heating of the surface under treatment. The accelerating voltage of an ion source is dictated by its specific use; it seems to lie in the range from ∼1 kV (for the ion source used for surface sputtering) to ∼100 kV and over (for the ion sources used for high-current, high-dose metallurgical implantation)

  10. Open source systems security certification

    CERN Document Server

    Damiani, Ernesto; El Ioini, Nabil

    2009-01-01

    Open Source Advances in Computer Applications book series provides timely technological and business information for: Enabling Open Source Systems (OSS) to become an integral part of systems and devices produced by technology companies; Inserting OSS in the critical path of complex network development and embedded products, including methodologies and tools for domain-specific OSS testing (lab code available), plus certification of security, dependability and safety properties for complex systems; Ensuring integrated systems, including OSS, meet performance and security requirements as well as achieving the necessary certifications, according to the overall strategy of OSS usage on the part of the adopter

  11. External dosimetry sources and shielding

    International Nuclear Information System (INIS)

    Calisto, Washington

    1994-01-01

    A definition of external dosimetry r external sources dosimetry,physical and mathematical treatment of the interaction of gamma radiation with a minimal area in that direction. Concept of attenuation coefficient, cumulated effect by polyenergetic sources, exposition rate, units, cumulated dose,shielding, foton shielding, depth calculation, materials used for shielding.Beta shielding, consideration of range and maximum β energy , low stopping radiation by use of low Z shielding. Tables for β energy of β emitters, I (tau) factor, energy-range curves for β emitters in aqueous media, gamma attenuation factors for U, W and Pb. Y factor for bone tissue,muscle and air, build-up factors

  12. Ion source and injector development

    International Nuclear Information System (INIS)

    Curtis, C.D.

    1976-01-01

    This is a survey of low energy accelerators which inject into proton linacs. Laboratories covered include Argonne, Brookhaven, CERN, Chalk River, Fermi, ITEP, KEK, Rutherford, and Saclay. This paper emphasizes complete injector systems, comparing significant hardware features and beam performance data, including recent additions. There is increased activity now in the acceleration of polarized protons, H + and H - , and of unpolarized H - . New source development and programs for these ion beams is outlined at the end of the report. Heavy-ion sources are not included

  13. Escaping "localisms" in IT sourcing

    DEFF Research Database (Denmark)

    Mola, L.; Carugati, Andrea

    2012-01-01

    Organizations are limited in their choices by the institutional environment in which they operate. This is particularly true for IT sourcing decisions that go beyond cost considerations and are constrained by traditions, geographical location, and social networks. This article investigates how......, organizations can strike a balance between the different institutional logics guiding IT sourcing decisions and eventually shift from the dominant logic of localism to a logic of market efficiency. This change does not depend from a choice but rather builds on a process through which IT management competences...

  14. Penetration Tester's Open Source Toolkit

    CERN Document Server

    Faircloth, Jeremy

    2011-01-01

    Great commercial penetration testing tools can be very expensive and sometimes hard to use or of questionable accuracy. This book helps solve both of these problems. The open source, no-cost penetration testing tools presented do a great job and can be modified by the user for each situation. Many tools, even ones that cost thousands of dollars, do not come with any type of instruction on how and in which situations the penetration tester can best use them. Penetration Tester's Open Source Toolkit, Third Edition, expands upon existing instructions so that a professional can get the most accura

  15. X-ray source array

    International Nuclear Information System (INIS)

    Cooperstein, G.; Lanza, R.C.; Sohval, A.R.

    1983-01-01

    A circular array of cold cathode diode X-ray sources, for radiation imaging applications, such as computed tomography includes electrically conductive cathode plates each of which cooperates with at least two anodes to form at least two diode sources. In one arrangement, two annular cathodes are separated by radially extending, rod-like anodes. Field enhancement blades may be provided on the cathodes. In an alternative arrangement, the cathode plates extend radially and each pair is separated by an anode plate also extending radially. (author)

  16. Tikal obsidian: sources and typology

    Energy Technology Data Exchange (ETDEWEB)

    Moholy-Nagy, H.; Asaro, F.; Stross, F.H.

    1984-01-01

    The obsidian industry of Classic period Tikal, Guatemala, is discussed with regard to geological source determinations and behavioral typology. The potential of these two approaches for cultural reconstruction is greatly extended when they can supplement each other. Recent source determinations of obsidian artifacts from Tikal indicate (1) a behavioral link between locally-produced prismatic blades of Highland Guatemalan stone and ceremonial incised obsidians and eccentrics, and (2) a Central Mexican origin for a seemingly large portion of Tikal's obsidian projectile points and knives. 25 references, 3 figures, 5 tables.

  17. Wood fuels sources and markets

    International Nuclear Information System (INIS)

    Koopmans, Auke

    2003-01-01

    Biomass energy is an important source of energy in most Asian countries. Households and industries use substantial amounts of fuel wood, charcoal and other biomass energy, such as agricultural residues, dung, leaves and sawmill residues. The main household applications are cooking and heating whereas industrial applications range widely. This paper provides an overview of estimates on the production and trade of biomass fuels in the South-east Asia region. The flows and channels used in the supply of wood fuels in different countries were analysed. This paper may help in identifying policy gaps with regards to the supply and consumption of wood fuels from both forest and non-forest sources. (Author)

  18. Identification of petroleum pollution sources

    International Nuclear Information System (INIS)

    Begak, O.Yu.; Syroezhko, A.M.

    2001-01-01

    A possibility of preliminary identification of petroleum pollution sources was investigated on specimens of the Khanty-Mansi autonomous district six deposits and specimens of soil and water polluted by these petroleums. Investigations were conducted using IR Fourier spectroscopy and gamma spectrometry, as well as methods of chromato-mass spectrometry and capillary gas liquid chromatography. Every of studied samples of petroleum from different deposits have an individual radiation impression. Insignificant total content of radionuclides in samples is specific to the Khanty-Mansi petroleum region. Gamma spectrometry admits to identify potential source of petroleum pollution using radionuclides of uranium and thorium series [ru

  19. Sourcing teams and interdepartmental integration

    DEFF Research Database (Denmark)

    Lidegaard, Nina; Ellegaard, Chris; Møller, Morten Munkgaard

    2015-01-01

    Internal integration is often mentioned as a prerequisite for conducting strategic sourcing, as multiple functional departments must collaborate on creating value-creating activities amongst them. Though it is one of many possibilities, the use of cross-functional teams is often the most commonly...... proposed solution to ensure internal integration. This paper presents an exploratory case study evaluating the use of internal integration mechanisms in a cross-functional sourcing process. Two commodity categories are examined. One is organised in a cross-functional team, while the other is not. Findings...... indicate that informal integration mechanisms not promoted by management or the organizational structure may contribute to the overall level of integration....

  20. Consumer Trust in Information Sources

    Directory of Open Access Journals (Sweden)

    Brad Love

    2013-06-01

    Full Text Available Trust is essential to understanding public reaction to innovative issues. This research focuses on trust in information sources by explicating the construct of trust and testing a comprehensive model on several information sources about genetically modified foods. Results from a survey of 369 participants reveal the significance of projecting competence and the role of the environment in which a target public receives information. Perceptions of regulatory, social, business, and technical environments affect how likely individuals are to follow advice from institutions like the Food and Drug Administration and the news media. Future research should incorporate knowledge levels and personal relevance as variables likely to influence trusting relationships.

  1. Modulation of Current Source Inverter

    Directory of Open Access Journals (Sweden)

    Golam Reza Arab Markadeh

    2011-04-01

    Full Text Available Direct torque control with Current Source Inverter (CSI instead of voltage source inverter is so appropriate because of determining the torque of induction motor with machine current and air gap flux. In addition, Space-Vector Modulation (SVM is a more proper method for CSI because of low order harmonics reduction, lower switching frequency and easier implementation. This paper introduces the SVM method for CSI and uses the proposed inverter for vector control of an induction motor. The simulation results illustrate fast dynamic response and desirable torque and speed output. Fast and accurate response to changes of speed and load torque reference completely proves the prominence of this method.

  2. Magnetogasdynamics of double radio sources

    International Nuclear Information System (INIS)

    Nepveu, M.

    1979-01-01

    The magnetogasdynamical behaviour of plasmoids moving through an ambient gas is investigated numerically with a two-dimensional code, based on the SHASTA scheme. The astrophysical importance of this study lies in the observed extended extragalactic radio sources. It is assumed that plasma clouds with cylinder symmetry are ejected from the nucleus of a galaxy. Their large-scale evolution in the intergalactic medium (IGM) is followed. The gas dynamics of an ejected cloud, the magnetogasdynamics of ejected clouds, the Christiansen-Pacholczyk-Scott picture for radio galaxies and the shear layers in double radio sources are studied. (Auth.)

  3. The SLAC polarized electron source

    International Nuclear Information System (INIS)

    Tang, H.; Alley, R.; Frisch, J.

    1995-06-01

    The SLAC polarized electron source employs a photocathode DC high voltage gun with a loadlock and a YAG pumped Ti:sapphire laser system for colliding beam experiments or a flash lamp pumped Ti:sapphire laser for fixed target experiments. It uses a thin, strained GaAs(100) photocathode, and is capable of producing a pulsed beam with a polarization of ≥80% and a peak current exceeding 10 A. Its operating efficiency has reached 99%. The physics and technology of producing high polarization electron beams from a GaAs photocathode will be reviewed. The prospects of realizing a polarized electron source for future linear colliders will also be discussed

  4. A review of polarized ion sources

    International Nuclear Information System (INIS)

    Schmor, P.W.

    1995-06-01

    The two main types of polarized ion sources in use on accelerators today are the Atomic Beam Polarized Ion Source (ABIS) source and the Optically Pumped Polarized Ion Source (OPPIS). Both types can provide beams of nuclearly polarized light ions which are either positively or negatively charged. Heavy ion polarized ion sources for accelerators are being developed. (author). 35 refs., 1 tab

  5. Unidentified point sources in the IRAS minisurvey

    Science.gov (United States)

    Houck, J. R.; Soifer, B. T.; Neugebauer, G.; Beichman, C. A.; Aumann, H. H.; Clegg, P. E.; Gillett, F. C.; Habing, H. J.; Hauser, M. G.; Low, F. J.

    1984-01-01

    Nine bright, point-like 60 micron sources have been selected from the sample of 8709 sources in the IRAS minisurvey. These sources have no counterparts in a variety of catalogs of nonstellar objects. Four objects have no visible counterparts, while five have faint stellar objects visible in the error ellipse. These sources do not resemble objects previously known to be bright infrared sources.

  6. Open source in Experimental Psychology

    OpenAIRE

    Dalmaijer, Edwin

    2015-01-01

    Talk on using open-source software in experimental psychology. Presented on 3 March 2015, at the Attention, Brain and Cognitive Development group (http://www.psy.ox.ac.uk/research/attention-brain-and-cognitive-development-group) at the University of Oxford's Department of Experimental Psychology.

  7. High efficiency atomic hydrogen source

    International Nuclear Information System (INIS)

    Lagomarsino, V.; Bassi, D.; Bertok, E.; De Paz, M.; Tommasini, F.

    1974-01-01

    This work presents preliminary results of research intended to produce a M.W. discharge atomic hydrogen source with good dissociation at pressures larger than 10 torr. Analysis of the recombination process at these pressures shows that the volume recombination by three body collisions may be more important than wall recombination or loss of atoms by diffusion and flow outside the discharge region

  8. Open Source Wifi Hotspot Implementation

    Directory of Open Access Journals (Sweden)

    Tyler Sondag

    2007-06-01

    Full Text Available The goal of this paper is to describe a design—including the hardware, software, and configuration––for an open source wireless network. The network designed will require authentication. While care will be taken to keep the authentication exchange secure, the network will otherwise transmit data without encryption.

  9. On Hubbell's rectangular source integral

    International Nuclear Information System (INIS)

    Stalker, John

    2001-01-01

    The integral H(a,b)=∫ 0 b ∫ 0 a dx dy/(1+x 2 +y 2 ) arises naturally in the study of radiation from a rectangular source and has been studied by many authors. This paper introduces a new series expansion which is rapidly convergent for large a and b

  10. Refurbishment and open source software

    CSIR Research Space (South Africa)

    Mabuza, S

    2006-11-01

    Full Text Available  & Open Source Software Electronic Waste Management Conference 2006 Sibongile Mabuza 2 Presentation Outline  About Meraka Institute Open Source Centre  Background to OSS  Extending life span using OSS  Different choices for different situations  Examples of... = common grazing ground (Sesotho)  Shared space for creative productivity  Emphasise African nature of scope and needs 4 Meraka Open Source Centre  Open Source Centre is part of the Meraka  Institute.  Currently, there are two offices:  CSIR headquarters  Soweto  Set up to amplify the beneficial impact of...

  11. Holophonic synthesis of musical sources

    OpenAIRE

    Menzies, Dylan

    2007-01-01

    The composition of a soundfield containing complex nearfield sources has interesting musical applications. A method is presented here using freefield expansions about exterior points of a harmonic multipole field. A derivation and verification are included. Binaural rendering is the natural method for displaying such soundfields. Some possible musical applications are discussed.

  12. Energy sources and power plants

    International Nuclear Information System (INIS)

    Schulz, Detlef; Schulz, Karen

    2013-01-01

    Energy is obtained from various energy sources (coal, petroleum, natural gas, nuclear fuels, wind energy, solar energy, hydro power, biomass, geothermal energy). These differ in each case with respect to their availability, methods of their production and the required power plant technologies. As technologies of the future fuel cells and nuclear fusion are traded. [de

  13. Occasioning change through HR sourcing

    NARCIS (Netherlands)

    van Balen, Mitchell; Bondarouk, Tatiana; Strohmeier, Stefan; Diederichsen, Anke

    2010-01-01

    This article describes how structuration theory can be used to analyze changes as invoked by two HR Sourcing arrangements: HR Shared Service Centers and HR Outsourcing. This approach allows us to under-stand changing responsibilities, altered HR processes, and the adaptation of web-based tools for

  14. History Sources on the Internet.

    Science.gov (United States)

    Fink, Kenneth D.

    This paper provides descriptions of key online history resources useful to teachers, librarians, and other education professionals. Highlights include: primary sources on the Internet; archives; Online Public Access Catalogs (OPACs); the American Historical Association (AHA) Web site; state and federal government resources; business history…

  15. CH2 molecular beam source

    International Nuclear Information System (INIS)

    Porter, R.A.R.; Grosser, A.E.

    1980-01-01

    A molecular beam source of CH 2 is described. Coaxial beams of methylene halide and alkali metal react and the mixture is formed into a molecular beam. Passage through a mechanical velocity selector rotating at a suitably high speed purifies the beam, separating light, fast CH 2 from heavier, slower contaminating species

  16. Contamination sources, prevention, and research

    Science.gov (United States)

    Contamination is defined as anything other than cotton in cotton lint. Worldwide, contamination is on the rise and plastic contamination has increased at a faster rate than contamination overall. In the U.S., there are many sources of plastic contaminants, such as plastic trash that collects in cott...

  17. Organizing for External Knowledge Sourcing

    DEFF Research Database (Denmark)

    Rabbiosi, Larissa; Reichstein, Toke

    2011-01-01

    The aim of this article is to provide an introduction to the special issue. We briefly consider the external knowledge sourcing and organizing for innovation literatures, which offer a background for the special issue, and we highlight their mutual dialogue. We then illustrate the main findings o...

  18. Renewable Energy Sources Brno '93

    International Nuclear Information System (INIS)

    1993-01-01

    The proceedings contain 27 contributions dealing with unconventional energy sources. The numbers of contributions in the individual classes of topics indicate that interest has mostly concentrated on the direct utilization of solar energy, whereas wind energy, hydroelectric energy and geothermal energy receive less attention and the use of biomass is at the margin of interest. (J.B.)

  19. New sources of animal proteins

    NARCIS (Netherlands)

    Huis, Van A.

    2017-01-01

    As the land currently available for livestock is not enough to satisfy the growing demand for meat, insects are proposed as an alternative protein source. Examples of insect consumption are given from the Lao People's Democratic Republic and Nigeria. It is argued that edible insects may qualify as a

  20. Organizational Dysfunctions: Sources and Areas

    Directory of Open Access Journals (Sweden)

    Jacek Pasieczny

    2016-12-01

    Full Text Available Objective:The purpose of this article is to identify and describe various types and sources of organizational dysfunctions. Research Design & Methods: The findings are based on literature review and an ongoing empirical research project conducted in private sector organisations. The empirical study can be situated within interpretative approach. In this qualitative project open interviews and observations were used to collect data. Findings: The study indicates that various types and sources of organizational dysfunctions can be identified in organizations operating in Poland. The sources of dysfunctions may be found both within the organization and its environment. Regardless of its specific features, most of the dysfunctions may be interpreted as an undesirable goal displacement. Very often areas of these dysfunctions are strongly interconnected and create a system that hinders organizational performance. Yet, it is difficult to study these phenomena as respondents are unwilling, for various reasons, to disclose the problems faced by their organizations. Implications & Recommendations: The results imply that the issue of organisational dysfunctions requires open, long-lasting and comparative studies. Recommendations for further studies are formulated in the last section of the paper. Contribution & Value Added: The paper provides insight into "the dark side of organising" by identifying sources and areas of dysfunctions. It also reveals difficulties connected with conducting research on dysfunctions in the Polish context.

  1. Image Makers: Reporters or Sources.

    Science.gov (United States)

    Petruzzello, Marion C.

    To explore how news sources are used by media to create a social image of women during key suffrage events of 1858, 1920, and 1970, the front page stories of the "New York Times" were reviewed for 1 week prior to and 1 week following each of these events: May 14, 1858, the Eighth National Women's Rights Convention in New York City;…

  2. Primary Sources and Inquiry Learning

    Science.gov (United States)

    Pappas, Marjorie L.

    2006-01-01

    In this article, the author discusses inquiry learning and primary sources. Inquiry learning puts students in the active role of investigators. Questioning, authentic and active learning, and interactivity are a few of the characteristics of inquiry learning that put the teacher and library media specialist in the role of coaches while students…

  3. Alternative sources of natural rubber

    NARCIS (Netherlands)

    Mooibroek, H.; Cornish, K.

    2000-01-01

    Rubber (cis-1,4-polyisoprene) is one of the most important polymers naturally produced by plants because it is a strategic raw material used in more than 40,000 products, including more than 400 medical devices. The sole commercial source, at present, is natural rubber harvested from the Brazilian

  4. Stellar X-ray sources

    International Nuclear Information System (INIS)

    Katz, J.I.; Washington Univ., St. Louis, MO

    1988-01-01

    I Review some of the salient accomplishments of X-rap studies of compact objects. Progress in this field has closely followed the improvement of observational methods, particularly in angular resolution and duration of exposure. Luminous compact X-ray sources are accreting neutron stars or black holes. Accreting neutron stars may have characteristic temporal signatures, but the only way to establish that an X-ray source is a black hole is to measure its mass. A rough phenomenological theory is succesful, but the transport of angular momentum in accretion flows is not onderstood. A number of interesting complications have been observed, including precessing accretion discs, X-ray bursts, and the acceleration of jets in SS433. Many puzzles remain unsolved, including the excitation of disc precession, the nature of the enigmatic A- and gamma-ray source Cyg X-3, the mechanism by which slowly spinning accreting neutron stars lose angular momentum, and the superabundance of X-ray sources in globular clusters. 41 refs.; 5 figs

  5. Source preparation in alpha spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Lally, A E [UKAEA Atomic Energy Research Establishment, Harwell. Environmental and Medical Sciences Div.; Glover, K M [UKAEA Atomic Energy Research Establishment, Harwell. Chemistry Div.

    1984-06-15

    Techniques, for the preparation of sources suitable for alpha spectrometric measurements are presented. These include vacuum sublimation, electrodeposition, self-deposition, direct evaporation, direct precipitation and the use of solvents and spreading agents. The relative merits of each technique and the applicability to both high and low levels of activity are considered.

  6. Synchrotron-driven spallation sources

    CERN Document Server

    Bryant, P J

    1996-01-01

    The use of synchrotrons for pulsed neutron spallation sources is an example of scientific and technological spin-off from the accelerator development for particle physics. Accelerator-driven sources provide an alternative to the continuous-flux, nuclear reactors that currently furnish the majority of neutrons for research and development. Although the present demand for neutrons can be adequately met by the existing reactors, this situation is unlikely to continue due to the increasing severity of safety regulations and the declared policies of many countries to close down their reactors within the next decade or so. Since the demand for neutrons as a research tool is, in any case,expected to grow, there has been a corresponding interest in sources that are synchrotron-driven or linac-driven with a pulse compression ring and currently several design studies are being made. These accelerator-driven sources also have the advantage of a time structure with a high peak neutron flux. The basic requirement is for a...

  7. Linac4 H− ion sources

    International Nuclear Information System (INIS)

    Lettry, J.; Aguglia, D.; Andersson, P.; Bertolo, S.; Butterworth, A.; Coutron, Y.; Dallocchio, A.; David, N.; Chaudet, E.; Fink, D. A.; Garlasche, M.; Grudiev, A.; Guida, R.; Hansen, J.; Haase, M.; Jones, A.; Koszar, I.; Lallement, J.-B.; Lombardi, A. M.; Machado, C.

    2016-01-01

    CERN’s 160 MeV H − linear accelerator (Linac4) is a key constituent of the injector chain upgrade of the Large Hadron Collider that is being installed and commissioned. A cesiated surface ion source prototype is being tested and has delivered a beam intensity of 45 mA within an emittance of 0.3 π ⋅ mm ⋅ mrad. The optimum ratio of the co-extracted electron- to ion-current is below 1 and the best production efficiency, defined as the ratio of the beam current to the 2 MHz RF-power transmitted to the plasma, reached 1.1 mA/kW. The H − source prototype and the first tests of the new ion source optics, electron-dump, and front end developed to minimize the beam emittance are presented. A temperature regulated magnetron H − source developed by the Brookhaven National Laboratory was built at CERN. The first tests of the magnetron operated at 0.8 Hz repetition rate are described

  8. Synthetic aperture controlled source electromagnetics

    NARCIS (Netherlands)

    Fan, Y.; Snieder, R.; Slob, E.; Hunziker, J.W.; Singer, J.; Sheiman, J.; Rosenquist, M.

    2010-01-01

    Controlled?source electromagnetics (CSEM) has been used as a de?risking tool in the hydrocarbon exploration industry. Although there have been successful applications of CSEM, this technique is still not widely used in the industry because the limited types of hydrocarbon reservoirs CSEM can detect.

  9. Ionizing radiations: effects and sources

    International Nuclear Information System (INIS)

    Vignes, S.; Nenot, J.C.

    1978-01-01

    Having first mentioned the effects of ionizing radiations in cancerogenisis, pre-natal, and genetic fields, the authors present the different sources of radiations and estimate their respective contributions to the total irradiation dose. Their paper makes reference to the main elements of a report issued by the United Nations Scientific Committee in 1977 [fr

  10. Steady-state emission of blazars at very high energies

    International Nuclear Information System (INIS)

    Hoehne-Moench, Daniel

    2010-01-01

    One key scientific program of the MAGIC telescope project is the discovery and detection of blazars. They constitute the most prominent extragalactic source class in the very high energy (VHE) γ-ray regime with 29 out of 34 known objects. Therefore a major part of the available observation time was spent in the last years on high-frequency peaked blazars. The selection criteria were chosen to increase the detection probability. As the X-ray flux is believed to be correlated to the VHE γ-ray flux, only X-ray selected sources with a flux F X >2 μJy at 1 keV were considered. To avoid strong attenuation of the -rays in the extragalactic infrared background, the redshift was restricted to values between z X-γ between the X-ray range at 1 keV and the VHE γ-ray regime at 200 GeV were calculated. The majority of objects show a spectral behaviour as expected from the source class of HBLs: The energy output in the VHE regime is in general lower than in X-rays. For the stacked blazar sample the broad-band spectral index was calculated to α X-γ =1.09, confirming the result found for the individual objects. Another evidence for the revelation of the baseline emission is the broad-band spectral energy distribution (SED) comprising archival as well as contemporaneous multi-wavelength data from the radio to the VHE band. The SEDs of known VHE γ-ray sources in low flux states matches well the SED of the stacked blazar sample. (orig.)

  11. OSGeo - Open Source Geospatial Foundation

    Directory of Open Access Journals (Sweden)

    Margherita Di Leo

    2012-09-01

    Full Text Available L'esigenza nata verso la fine del 2005 di selezionare ed organizzare più di 200 progetti FOSS4G porta alla nascita nel Febbraio2006 di OSGeo (the Open Source Geospatial Foundation, organizzazione internazionale la cui mission è promuovere lo sviluppo collaborativo di software libero focalizzato sull'informazione geografica (FOSS4G.Open   Source   Geospatial   Foundation (OSGeoThe Open Source Geospatial Foundation (OSGeo  is  a  not-for-profit  organization, created  in  early  2006  to  the  aim  at  sup-porting   the   collaborative   development of  geospatial  open  source  software,  and promote its widespread use. The founda-tion provides financial, organizational and legal support to the broader open source geospatial community. It also serves as an independent  legal  entity  to  which  com-munity  members  can  contribute  code, funding  and  other  resources,  secure  in the knowledge that their contributions will be maintained for public benefit. OSGeo also  serves  as  an  outreach  and  advocacy organization for the open source geospa-tial  community,  and  provides  a  common forum  and  shared  infrastructure  for  im-proving  cross-project  collaboration.  The foundation's projects are all freely available and  useable  under  an  OSI-certified  open source license. The Italian OSGeo local chapter is named GFOSS.it     (Associazione     Italiana     per l'informazione Geografica Libera.

  12. Radioactive sources in chemical laboratories

    International Nuclear Information System (INIS)

    Janzekovic, H.; Krizman, M.

    2007-01-01

    Radioactive sources including all radioactive materials exceeding exemption levels have to be registered in national databases according to international standards based on the recommendations ICRP 60 and a proper licensing should take place as described for example in the 96/29/EURATOM. In spite of that, unregistered sources could be found, usually due to the fact that the owner is not aware of radiation characteristics of sources. The material inventories of chemical laboratories are typical and most frequent example where radioactive sources could be found. Five different types of sources could be identified. The most frequent type are chemicals, namely thorium and uranium compounds. They are used not due to their radioactivity but due to their chemical properties. As for all other sources a stringent control is necessary in order to assure their safe use. Around hundred of stored radioactive chemical items were found during inspections of such laboratories performed by the Slovenian Nuclear Safety Administration or qualified experts in a period December 2006 - July 2007. Users of such chemicals are usually not aware that thorium and uranium chemicals are radioactive and, as unsealed sources, they could be easily spilled out and produce contamination of persons, surfaces, equipment etc. The external exposure as well as the internal exposure including exposure due to inhalation could be present. No knowledge about special precautions is usually present in laboratories and leads to underestimating of a potential risk and unintentional exposure of the laboratory personnel, students etc. Due to the long decay times in decay series of Th -232, U-238 and U- 235 the materials are also radioactive today. Even more, in case of thorium chemicals the radioactivity increased substantially from the time of their production. The implementation of safety measures has been under way and includes a survey of the qualified experts, establishment of organizational structure in a

  13. Discovery of TeV gamma-ray emission from the pulsar wind nebula 3C 58 by MAGIC

    Directory of Open Access Journals (Sweden)

    López-Coto Rubén

    2016-01-01

    Full Text Available The pulsar wind nebula (PWN 3C 58 is one of the historical very-high-energy (VHE; E>100 GeV gamma-ray source candidates. It has been compared to the Crab Nebula due to their morphological similarities. This object was detected by Fermi-LAT with a spectrum extending beyond 100 GeV. We analyzed 81 hours of 3C 58 data taken with the MAGIC telescopes and we detected VHE gamma-ray emission for the first time at TeV energies with a significance of 5.7 sigma and an integral flux of 0.65% C.U. above 1 TeV. According to our results 3C 58 is the least luminous PWN ever detected at VHE and the one with the lowest flux at VHE to date. We compare our results with the expectations of time-dependent models in which electrons up-scatter photon fields. The best representation favors a distance to the PWN of 2 kpc and Far Infrared (FIR comparable to CMB photon fields. Hadronic contribution from the hosting supernova remnant (SNR requires unrealistic energy budget given the density of the medium, disfavoring cosmic ray acceleration in the SNR as origin of the VHE gamma-ray emission.

  14. Global Particulate Matter Source Apportionment

    Science.gov (United States)

    Lamancusa, C.; Wagstrom, K.

    2017-12-01

    As our global society develops and grows it is necessary to better understand the impacts and nuances of atmospheric chemistry, in particular those associated with atmospheric particulate matter. We have developed a source apportionment scheme for the GEOS-Chem global atmospheric chemical transport model. While these approaches have existed for several years in regional chemical transport models, the Global Particulate Matter Source Apportionment Technology (GPSAT) represents the first incorporation into a global chemical transport model. GPSAT runs in parallel to a standard GEOS-Chem run. GPSAT uses the fact that all molecules of a given species have the same probability of undergoing any given process as a core principle. This allows GPSAT to track many different species using only the flux information provided by GEOS-Chem's many processes. GPSAT accounts for the change in source specific concentrations as a result of aqueous and gas-phase chemistry, horizontal and vertical transport, condensation and evaporation on particulate matter, emissions, and wet and dry deposition. By using fluxes, GPSAT minimizes computational cost by circumventing the computationally costly chemistry and transport solvers. GPSAT will allow researchers to address many pertinent research questions about global particulate matter including the global impact of emissions from different source regions and the climate impacts from different source types and regions. For this first application of GPSAT, we investigate the contribution of the twenty largest urban areas worldwide to global particulate matter concentrations. The species investigated include: ammonium, nitrates, sulfates, and the secondary organic aerosols formed by the oxidation of benzene, isoprene, and terpenes. While GPSAT is not yet publically available, we will incorporate it into a future standard release of GEOS-Chem so that all GEOS-Chem users will have access to this new tool.

  15. Point-source inversion techniques

    Science.gov (United States)

    Langston, Charles A.; Barker, Jeffrey S.; Pavlin, Gregory B.

    1982-11-01

    A variety of approaches for obtaining source parameters from waveform data using moment-tensor or dislocation point source models have been investigated and applied to long-period body and surface waves from several earthquakes. Generalized inversion techniques have been applied to data for long-period teleseismic body waves to obtain the orientation, time function and depth of the 1978 Thessaloniki, Greece, event, of the 1971 San Fernando event, and of several events associated with the 1963 induced seismicity sequence at Kariba, Africa. The generalized inversion technique and a systematic grid testing technique have also been used to place meaningful constraints on mechanisms determined from very sparse data sets; a single station with high-quality three-component waveform data is often sufficient to discriminate faulting type (e.g., strike-slip, etc.). Sparse data sets for several recent California earthquakes, for a small regional event associated with the Koyna, India, reservoir, and for several events at the Kariba reservoir have been investigated in this way. Although linearized inversion techniques using the moment-tensor model are often robust, even for sparse data sets, there are instances where the simplifying assumption of a single point source is inadequate to model the data successfully. Numerical experiments utilizing synthetic data and actual data for the 1971 San Fernando earthquake graphically demonstrate that severe problems may be encountered if source finiteness effects are ignored. These techniques are generally applicable to on-line processing of high-quality digital data, but source complexity and inadequacy of the assumed Green's functions are major problems which are yet to be fully addressed.

  16. EPA Region 1 Sole Source Aquifers

    Data.gov (United States)

    U.S. Environmental Protection Agency — This coverage contains boundaries of EPA-approved sole source aquifers. Sole source aquifers are defined as an aquifer designated as the sole or principal source of...

  17. Land Streamer Surveying Using Multiple Sources

    KAUST Repository

    Mahmoud, Sherif

    2014-12-11

    Various examples are provided for land streamer seismic surveying using multiple sources. In one example, among others, a method includes disposing a land streamer in-line with first and second shot sources. The first shot source is at a first source location adjacent to a proximal end of the land streamer and the second shot source is at a second source location separated by a fixed length corresponding to a length of the land streamer. Shot gathers can be obtained when the shot sources are fired. In another example, a system includes a land streamer including a plurality of receivers, a first shot source located adjacent to the proximal end of the land streamer, and a second shot source located in-line with the land streamer and the first shot source. The second shot source is separated from the first shot source by a fixed overall length corresponding to the land streamer.

  18. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... The field of Very High Energy (VHE) gamma ray astronomy using the Atmospheric Cerenkov Technique has entered an interesting phase with detection of various galactic and extragalactic sources. Among galactic sources, only the Crab nebula has been established as a standard candle.

  19. From Open Source Software to Open Source Hardware

    OpenAIRE

    Viseur , Robert

    2012-01-01

    Part 2: Lightning Talks; International audience; The open source software principles progressively give rise to new initiatives for culture (free culture), data (open data) or hardware (open hardware). The open hardware is experiencing a significant growth but the business models and legal aspects are not well known. This paper is dedicated to the economics of open hardware. We define the open hardware concept and determine intellectual property tools we can apply to open hardware, with a str...

  20. Control of sealed radioactive sources in Peru

    International Nuclear Information System (INIS)

    Ramirez Quijada, R.

    2001-01-01

    The paper describes the inventory of radioactive sources in Peru and assesses the control. Three groups of source conditions are established: controlled sources, known sources, and lost and orphan sources. The potential risk, described as not significant, for producing accidents is established and the needed measures are discussed. The paper concludes that, while the control on sealed sources is good, there is still room for improvement. (author)

  1. The Advanced Neutron Source liquid deuterium cold source

    International Nuclear Information System (INIS)

    Lucas, A.T.

    1995-08-01

    The Advanced Neutron Source will employ two cold sources to moderate neutrons to low energy (<10 meV). The cold neutrons produced are then passed through beam guides to various experiment stations. Each cold source moderator is a sphere of 410-mm internal diameter. The moderator material is liquid deuterium flowing at a rate of 1 kg/s and maintained at subcooled temperatures at all points of the circuit, to prevent boiling. Nuclear beat deposited within the liquid deuterium and its containment structure totals more than 30 kW. All of this heat is removed by the liquid deuterium, which raises its temperature by 5 K. The liquid prime mover is a cryogenic circulator that is situated in the return leg of the flow loop. This arrangement minimizes the heat added to the liquid between the heat exchanger and the moderator vessel, allowing the moderator to be operated at the minimum practical temperature. This report describes the latest thinking at the time of project termination. It also includes the status of various systems at that time and outlines anticipated directions in which the design would have progressed. In this regard, some detail differences between this report and official design documents reflect ideas that were not approved at the time of closure but are considered noteworthy

  2. Handling of radioactive sources in Ecuador

    International Nuclear Information System (INIS)

    Benitez, Manuel

    2000-01-01

    This document describes the following aspects: sealed and unsealed radioactive sources, radiation detectors, personnel and area monitoring, surface pollution, radioactive wastes control and radioactive sources transferring. (The author)

  3. Review of available power sources

    International Nuclear Information System (INIS)

    Beard, Carl

    2006-01-01

    Klystrons and triodes have been the accepted choice for particle accelerators because they produce high power RF and offer high gain (60 dB) with efficiencies of ∼50%. Although fairly new to the market, inductive output tubes (IOTs) have become available at L-band frequencies and have maintained their high efficiency. The development of superconducting RF at the L-band frequency allows IOTs to become the choice for future accelerator programs. Due to the operational nature of SRF technology in energy recovery mode, there is no longer the requirement for large amounts of RF power from single sources. This report reviews some of the developments in RF power sources suitable for energy recovery linacs (ERLs)

  4. Distributed source coding of video

    DEFF Research Database (Denmark)

    Forchhammer, Søren; Van Luong, Huynh

    2015-01-01

    A foundation for distributed source coding was established in the classic papers of Slepian-Wolf (SW) [1] and Wyner-Ziv (WZ) [2]. This has provided a starting point for work on Distributed Video Coding (DVC), which exploits the source statistics at the decoder side offering shifting processing...... steps, conventionally performed at the video encoder side, to the decoder side. Emerging applications such as wireless visual sensor networks and wireless video surveillance all require lightweight video encoding with high coding efficiency and error-resilience. The video data of DVC schemes differ from...... the assumptions of SW and WZ distributed coding, e.g. by being correlated in time and nonstationary. Improving the efficiency of DVC coding is challenging. This paper presents some selected techniques to address the DVC challenges. Focus is put on pin-pointing how the decoder steps are modified to provide...

  5. Neutron diffraction on pulsed sources

    International Nuclear Information System (INIS)

    Aksenov, V.L.; Balagurov, A.M.

    2016-01-01

    The possibilities currently offered and major scientific problems solved by time-of-flight neutron diffraction are reviewed. The reasons for the rapid development of the method over the last two decades has been mainly the emergence of third generation pulsed sources with a MW time-averaged power and advances in neutron-optical devices and detector systems. The paper discusses some historical aspects of time-of-flight neutron diffraction and examines the contribution to this method by F.L.Shapiro whose 100th birth anniversary was celebrated in 2015. The state of the art with respect to neutron sources for studies on output beams is reviewed in a special section. [ru

  6. The synchrotron light source ROSY

    International Nuclear Information System (INIS)

    Einfeld, D.; Buettig, H.; Dienel, S.; Glaeser, W.; Goetz, T.; Guratzsch, H.; Hartmann, B.; Janssen, D.; Krug, H.; Linnemann, J.; Matz, W.; Murphy, J.B.; Neumann, W.; Oehme, W.; Picard, M.; Plesko, M.; Proehl, D.; Schlenk, R.; Tomassini, D.; Tyrroff, H.

    1994-01-01

    ROSY, a 3rd generation synchrotron light source, has been proposed to be built at the Research Center Rossendorf/Dresden in Germany. With its low emittance and optimized space for installing insertion devices ROSY will be the first synchrotron radiation source in the 3 GeV range in Europe, dedicated to materials research and industrial application. The critical wavelength of the synchrotron radiation spectra was designed to be 0.15 nm corresponding to a critical photon energy of 8.4 keV. It is proposed to use a ''modified multiple bend achromat'' (MBA) lattice in order to get a compact machine as well as a low emittance. For 3 GeV an emittance smaller than 30π nm rad can be obtained. With a fourfold symmetry and two larger straight sections within the achromatic arcs the circumference is 148 m. 23% of the circumference can be used for installing insertion devices. (orig.)

  7. Overview of terahertz radiation sources

    International Nuclear Information System (INIS)

    Gallerano, G.P.; Biedron, S.G.

    2004-01-01

    Although terahertz (THz) radiation was first observed about hundred years ago, the corresponding portion of the electromagnetic spectrum has been for long time considered a rather poorly explored region at the boundary between the microwaves and the infrared. This situation has changed during the past ten years with the rapid development of coherent THz sources, such as solid state oscillators, quantum cascade lasers, optically pumped solid state devices and novel free electron devices, which have in turn stimulated a wide variety of applications from material science to telecommunications, from biology to biomedicine. For a comprehensive review of THz technology the reader is addressed to a recent paper by P. Siegel. In this paper we focus on the development and perspectives of THz radiation sources.

  8. Inverse source problems in elastodynamics

    Science.gov (United States)

    Bao, Gang; Hu, Guanghui; Kian, Yavar; Yin, Tao

    2018-04-01

    We are concerned with time-dependent inverse source problems in elastodynamics. The source term is supposed to be the product of a spatial function and a temporal function with compact support. We present frequency-domain and time-domain approaches to show uniqueness in determining the spatial function from wave fields on a large sphere over a finite time interval. The stability estimate of the temporal function from the data of one receiver and the uniqueness result using partial boundary data are proved. Our arguments rely heavily on the use of the Fourier transform, which motivates inversion schemes that can be easily implemented. A Landweber iterative algorithm for recovering the spatial function and a non-iterative inversion scheme based on the uniqueness proof for recovering the temporal function are proposed. Numerical examples are demonstrated in both two and three dimensions.

  9. Use of tritium and sources

    International Nuclear Information System (INIS)

    Noguchi, Hiroshi

    1997-01-01

    There are many kinds of tritium, sources in the environment. The maximum inventory of them is the nuclear tests, although the atmospheric nuclear test has not been carried out since 1981. So that the inventory originated from them will decrease. By the latest data in 1989, the total amount of released tritium was about 24 PBq/yr by the use of atomic energy in the world. The maximum source was the heavy water moderated reactors, for example, CANDU reactor. In the future, large amount of tritium inventory may be the fusion reactor. The test of JET (Joint European Torus) released about 600 GBq of tritium until March in 1992. 80-90% of them were tritium water (HTO). The amount of tritium released from industries and medicine are limited. Although ITER has a large amount of tritium inventory, the amount of release is seemed not to be larger than other nuclear power facility. (S.Y.)

  10. Ion source of discharge type

    Energy Technology Data Exchange (ETDEWEB)

    Enchevich, I.B. [TRIUMF, Cyclotron Div., Vancouver, British Columbia (Canada); Korenev, S.A. [JINR, Hihg Energy Physics Lab., Dubna, Moscow (Russian Federation)

    1992-07-01

    A new scheme of ion source based on a dielectric surface sliding discharge is described. The conditions to form this type of discharge are analyzed and experimental results are shown. The main parameters of this ion source are: accelerating voltage U = 1/20kV; continuous extracted ion beam; current density j = 0.01/0.5 A/cm{sup 2}; ions of Cl, F, C, H; residual gas pressure P = 10{sup -6} Torr. A magnetic system is used to separate the different types of ions. The dielectric material in the discharge circuit (anode plasma emitter) defines the type of ions. The emission characteristics of plasma emitter and the discharge parameters are presented. The ion current yield satisfies the Child-Langmuir law. (author)

  11. Ion source of discharge type

    International Nuclear Information System (INIS)

    Enchevich, I.B.; Korenev, S.A.

    1992-07-01

    A new scheme of ion source based on a dielectric surface sliding discharge is described. The conditions to form this type of discharge are analyzed and experimental results are shown. The main parameters of this ion source are: accelerating voltage U = 1/20kV; continuous extracted ion beam; current density j = 0.01/0.5 A/cm 2 ; ions of Cl, F, C, H; residual gas pressure P = 10 -6 Torr. A magnetic system is used to separate the different types of ions. The dielectric material in the discharge circuit (anode plasma emitter) defines the type of ions. The emission characteristics of plasma emitter and the discharge parameters are presented. The ion current yield satisfies the Child-Langmuir law. (author)

  12. Russian Virtual Observatory: Data Sources

    Directory of Open Access Journals (Sweden)

    Malkov O.

    2016-03-01

    Full Text Available The purpose of this review is to analyze main directions of creation and functioning of major data sources developed by Russian astronomers or with their participation and to compare them with the worldwide trends in these fields. We discuss astronomical space missions of the past, present, and future (Astron, INTEGRAL, WSO-UV, Spectrum Roentgen Gamma, Lyra-B, high-quality photometric atlases and catalogues, and spectroscopic data sources, primarily VALD and the global VAMDC framework for the maintenance and distribution of atomic and molecular data. We describe collection, analysis, and dissemination of astronomical data on minor bodies of the Solar System and on variable stars. Also described is the project joining data for all observational types of binary and multiple stars, Binary star DataBase (BDB.

  13. Open-Source Telephony Infrastructure

    CERN Document Server

    CERN. Geneva

    2018-01-01

    TONE (Telephony Open-source Network Evolution) is CERN’s future-proof telephony network. Over the past few years, TONE has evolved from its initial design to a solid reality that accommodates some of CERN’s most critical communication services.   TONE’s architecture was designed to: -          Use VoIP (Voice over IP) standard protocols. -          Avoid vendor lock-in by using open-source components. -          Reduce operational costs. -          Be built on top on the IT department’s Agile Infrastructure, combining Virtual Machines and redundant physical servers.   In this presentation we will review the project’s past and future milestones, main use cases and detailed network architecture.

  14. The new Munich neutron source

    International Nuclear Information System (INIS)

    Herrmann, W.A.

    1998-01-01

    The Munich FRM II neutron source currently under construction is to replace the FRM I research reactor in Munich, also known as 'atomic egg'. The project is executed by the Free State of Bavaria as a construction project of the Munich Technical University and managed by the University. As main contractor for the construction project, Siemens AG is also co-applicant in the licensing procedure under the Atomic Energy Act for the construction phase. The project is carried out to build a modern high flux neutron source required for a broad range of applications in research and technology mainly with thermal and cold neutrons. The 'neutron gap' existing in Germany is to be closed with the FRM II. As a national research installation, the FRM II is available to all interested scientists from a variety of disciplines. (orig.) [de

  15. Resonance Ionization Laser Ion Sources

    CERN Document Server

    Marsh, B

    2013-01-01

    The application of the technique of laser resonance ionization to the production of singly charged ions at radioactive ion beam facilities is discussed. The ability to combine high efficiency and element selectivity makes a resonance ionization laser ion source (RILIS) an important component of many radioactive ion beam facilities. At CERN, for example, the RILIS is the most commonly used ion source of the ISOLDE facility, with a yearly operating time of up to 3000 hours. For some isotopes the RILIS can also be used as a fast and sensitive laser spectroscopy tool, provided that the spectral resolution is sufficiently high to reveal the influence of nuclear structure on the atomic spectra. This enables the study of nuclear properties of isotopes with production rates even lower than one ion per second and, in some cases, enables isomer selective ionization. The solutions available for the implementation of resonance laser ionization at radioactive ion beam facilities are summarized. Aspects such as the laser r...

  16. Management of disused sealed sources

    International Nuclear Information System (INIS)

    Lukauskas, D.; Skridaila, N.

    2003-01-01

    The report presents the requirements on management of disused sealed sources in Lithuania; disused sealed source disposal facilities; performed safety analysis and planed repository safety improvements. The requirements on pre-disposal management of Disused Sealed Sources (DSS) are presented. The requirements on disposal of short lived VLLW and LILW (A, B and C classes) radioactive waste approved in 2002-2003. Generic Waste Acceptance Criteria for Near Surface Disposal, P-2003-01 approved in 2003. Requirements on disposal of Low and intermediate level long lived waste do not exist (D and E classes). Requirements for the disposal of disused sealed sources (F class) do not exist. Disposal method for the F class - Near Surface or Deep geological repository, depending on the waste acceptance criteria. Only one repository for institutional radioactive waste exist in Lithuania - Maisiagala repository. It is near surface RADON type disposal facility, built in 1963 and closed in 1988. It was constructed of the monolithic reinforced concrete with the dimensions 5 m x 15 m x 3 m, the thickness of the sidewalls is about 0.25 m and the thickness of the bottom is about 0.2 m. The overall volume is about 200 m 3 . At time of closure only three fifths of the volume had been filled. The empty two fifths of the vault were filled with concrete, then with sand, then with the concrete (0.01 m), hot bitumen and the 0.05 m asphalt layers. Monolithic concrete that was covered with bitumen and 0.05 m thick layer of asphalt closed the vault. Sand layer the thickness of which was not less than 1.2 m formed the cap. Disused radioactive sources embedded in a biological shielding were buried together with their shielding, the sources without the shielding were buried in two stainless steel containers. The total activity of buried radioactive nuclides is 3.42.10 -15 Bq (calculated according the documentation). There are some uncertainties about the inventory: from 1963 to 1973. After the

  17. Tracing the source of campylobacteriosis.

    Directory of Open Access Journals (Sweden)

    Daniel J Wilson

    2008-09-01

    Full Text Available Campylobacter jejuni is the leading cause of bacterial gastro-enteritis in the developed world. It is thought to infect 2-3 million people a year in the US alone, at a cost to the economy in excess of US $4 billion. C. jejuni is a widespread zoonotic pathogen that is carried by animals farmed for meat and poultry. A connection with contaminated food is recognized, but C. jejuni is also commonly found in wild animals and water sources. Phylogenetic studies have suggested that genotypes pathogenic to humans bear greatest resemblance to non-livestock isolates. Moreover, seasonal variation in campylobacteriosis bears the hallmarks of water-borne disease, and certain outbreaks have been attributed to contamination of drinking water. As a result, the relative importance of these reservoirs to human disease is controversial. We use multilocus sequence typing to genotype 1,231 cases of C. jejuni isolated from patients in Lancashire, England. By modeling the DNA sequence evolution and zoonotic transmission of C. jejuni between host species and the environment, we assign human cases probabilistically to source populations. Our novel population genetics approach reveals that the vast majority (97% of sporadic disease can be attributed to animals farmed for meat and poultry. Chicken and cattle are the principal sources of C. jejuni pathogenic to humans, whereas wild animal and environmental sources are responsible for just 3% of disease. Our results imply that the primary transmission route is through the food chain, and suggest that incidence could be dramatically reduced by enhanced on-farm biosecurity or preventing food-borne transmission.

  18. An 'open source' networked identity

    DEFF Research Database (Denmark)

    Larsen, Malene Charlotte

    2013-01-01

    This paper examines the concept of identity in relation to youth practices on social network sites (SNS). The paper illustrates how writing “I love you” or other emotional statements on each other’s profiles on SNS is not only a common way for Danish teenagers to communicate and practice friendship...... communicative actions – are not only performing their own identity, but are becoming co-constructors of each other's identities, which the author characterizes as an 'open source' networked identity....

  19. Spallation neutron source moderator design

    International Nuclear Information System (INIS)

    Charlton, L.A.; Barnes, J.M.; Gabriel, T.A.; Johnson, J.O.

    1998-01-01

    This paper describes various aspects of the spallation neutron source (SNS) moderator design. Included are the effects of varying the moderator location, interaction effects between moderators, and the impact on neutron output when various reflector materials are used. Also included is a study of the neutron output from composite moderators, where it is found that a combination of liquid H 2 O and liquid H 2 can produce a spectrum very similar to liquid methane (L-CH 4 ). (orig.)

  20. Renewable energy sources and ecology

    International Nuclear Information System (INIS)

    Panajotova, Yu.

    1998-01-01

    The share of renewable energy sources (RES) in the world energy balance is estimated from 1-2 to 10% of the total primary energy sources consumption. In EU since 1990 until now the power energy production from these sources is growing continuously by over 3% annually. The features of the updated Environmental Strategy for Bulgaria (ESB) elaborated with the World Bank in 1994 are: increasing the energy efficiency; utilising RES; granting preference to the regional energy concept and establishing regional energy centres based on the EU experience. In ESB the basic priorities are linked with disease factors - pollutants as lead in the air and soils (from leaded petrol, resp. from metallurgical enterprises), dust particles in the air (from household heating, industry and thermo-electric power stations) and sulfur dioxide and other gases (also from energy sector and industry). There is consistent policy for harmonization of the Bulgarian standards with those of the WHO. Among the implemented projects preference is granting to ones concerning new energy saving technologies and RES. Bulgaria got an environmental protection law harmonized with the international legislation and adapted to the economic situation inflicted by the market economy transition. The development of RES needs high investment cost and has low efficiency factor compared to the classical methods of energy production. Implementation of Environmental Action Programme (EAP) in Bulgaria with an international co-operation includes: solid wastes management; water sources management; water pollution problems; soil degradation; transport and environment; nuclear safety and nuclear waste problems and full value utilization of the RES. The Ministry of Environment and local Authorities have to develop their policies and implementing them by a range of activities to identify pollution control strategies, to identify areas where the greatest environmental benefits can be achieved at least cost and to incorporate the