WorldWideScience

Sample records for vhe g-ray source

  1. The High Intensity g-ray Source (HIgS) based on the OK-5/Duke storage ring FEL

    Science.gov (United States)

    Litvinenko, Vladimir

    2001-10-01

    We report on the progress with the High Intensity g-ray Source (HIgS) facility and the plans. The OK-5/Duke electron storage ring free electron laser (FEL) is in operation since 1996 and generates coherent radiation in 193-730 nm (1.7 6.4 eV). The OK-4 FEL generates intense beams of g-ray via intra-cavity Compton back-scattering of FEL photons on ultra-relativistic electrons [1]. The HIgS facility, based on this source, provides the g-ray beams with tunable energy from 1.8 MeV to 58 MeV and total flux up to 5 108 g-rays per second for the extensive user program. A dedicated 100 m2 shielded g-ray vault for nuclear physics experiments and a 35-m long the g-ray beam-line were commissioned two years ago. A special shielded collimator hut is located at the end of the g-ray beam-line for reduction of the background in the g-ray vault. The generated g-ray beams are 100polarized. The high quality of the electron and FEL beam provides for high degree of correlation between the angle and the energy of g-rays. It allows monochromatizing the g-rays using simple on-axis collimators. The energy spread as low as 0.2Up-to-date, more than 2,000 hours of the beam time from the HIgS facility was provided for nuclear physics experiments. Within next four years, the HIgS facility will undergo major up-grades which will extend the available g-ray energy range to about 200 MeV and will We report on the present performance of the HIgS facility, its experimental program for next two years and the plans for HIgS facility up-grades. [1] V.N.Litvinenko et al., Phys. Rev. Lett. V. 78, N. 24 (1997) 4569. V.N. Litvinenko and J.M.J.Madey, SPIE vol. 2521 (1995) 55 [2] S.H.Park, Thesis, Duke University, January 2000

  2. Investigating the peculiar emission from the new VHE gamma-ray source H1722+119

    Science.gov (United States)

    Ahnen, M. L.; Ansoldi, S.; Antonelli, L. A.; Antoranz, P.; Babic, A.; Banerjee, B.; Bangale, P.; Barres de Almeida, U.; Barrio, J. A.; Becerra González, J.; Bednarek, W.; Bernardini, E.; Biasuzzi, B.; Biland, A.; Blanch, O.; Bonnefoy, S.; Bonnoli, G.; Borracci, F.; Bretz, T.; Buson, S.; Carosi, A.; Chatterjee, A.; Clavero, R.; Colin, P.; Colombo, E.; Contreras, J. L.; Cortina, J.; Covino, S.; Da Vela, P.; Dazzi, F.; De Angelis, A.; De Lotto, B.; de Oña Wilhelmi, E.; Di Pierro, F.; Doert, M.; Domínguez, A.; Dominis Prester, D.; Dorner, D.; Doro, M.; Einecke, S.; Eisenacher Glawion, D.; Elsaesser, D.; Fallah Ramazani, V.; Fernández-Barral, A.; Fidalgo, D.; Fonseca, M. V.; Font, L.; Frantzen, K.; Fruck, C.; Galindo, D.; García López, R. J.; Garczarczyk, M.; Garrido Terrats, D.; Gaug, M.; Giammaria, P.; Godinović, N.; González Muñoz, A.; Gora, D.; Guberman, D.; Hadasch, D.; Hahn, A.; Hanabata, Y.; Hayashida, M.; Herrera, J.; Hose, J.; Hrupec, D.; Hughes, G.; Idec, W.; Kodani, K.; Konno, Y.; Kubo, H.; Kushida, J.; La Barbera, A.; Lelas, D.; Lindfors, E.; Lombardi, S.; Longo, F.; López, M.; López-Coto, R.; Majumdar, P.; Makariev, M.; Mallot, K.; Maneva, G.; Manganaro, M.; Mannheim, K.; Maraschi, L.; Marcote, B.; Mariotti, M.; Martínez, M.; Mazin, D.; Menzel, U.; Miranda, J. M.; Mirzoyan, R.; Moralejo, A.; Moretti, E.; Nakajima, D.; Neustroev, V.; Niedzwiecki, A.; Nievas Rosillo, M.; Nilsson, K.; Nishijima, K.; Noda, K.; Nogués, L.; Orito, R.; Overkemping, A.; Paiano, S.; Palacio, J.; Palatiello, M.; Paneque, D.; Paoletti, R.; Paredes, J. M.; Paredes-Fortuny, X.; Pedaletti, G.; Perri, L.; Persic, M.; Poutanen, J.; Prada Moroni, P. G.; Prandini, E.; Puljak, I.; Rhode, W.; Ribó, M.; Rico, J.; Rodriguez Garcia, J.; Saito, T.; Satalecka, K.; Schultz, C.; Schweizer, T.; Sillanpää, A.; Sitarek, J.; Snidaric, I.; Sobczynska, D.; Stamerra, A.; Steinbring, T.; Strzys, M.; Takalo, L.; Takami, H.; Tavecchio, F.; Temnikov, P.; Terzić, T.; Tescaro, D.; Teshima, M.; Thaele, J.; Torres, D. F.; Toyama, T.; Treves, A.; Verguilov, V.; Vovk, I.; Ward, J. E.; Will, M.; Wu, M. H.; Zanin, R.; D'Ammando, F.; Berdyugin, A.; Hovatta, T.; Max-Moerbeck, W.; Raiteri, C. M.; Readhead, A. C. S.; Reinthal, R.; Richards, J. L.; Verrecchia, F.; Villata, M.

    2016-07-01

    The Major Atmospheric Gamma-ray Imaging Cherenkov (MAGIC) telescopes observed the BL Lac object H1722+119 (redshift unknown) for six consecutive nights between 2013 May 17 and 22, for a total of 12.5 h. The observations were triggered by high activity in the optical band measured by the KVA (Kungliga Vetenskapsakademien) telescope. The source was for the first time detected in the very high energy (VHE, E > 100 GeV) γ-ray band with a statistical significance of 5.9σ. The integral flux above 150 GeV is estimated to be (2.0 ± 0.5) per cent of the Crab nebula flux. We used contemporaneous high energy (HE, 100 MeV < E < 100 GeV) γ-ray observations from Fermi-Large Area Telescope to estimate the redshift of the source. Within the framework of the current extragalactic background light models, we estimate the redshift to be z = 0.34 ± 0.15. Additionally, we used contemporaneous X-ray to radio data collected by the instruments on board the Swift satellite, the KVA, and the Owens Valley Radio Observatory telescope to study multifrequency characteristics of the source. We found no significant temporal variability of the flux in the HE and VHE bands. The flux in the optical and radio wavebands, on the other hand, did vary with different patterns. The spectral energy distribution of H1722+119 shows surprising behaviour in the ˜3 × 1014-1018 Hz frequency range. It can be modelled using an inhomogeneous helical jet synchrotron self-Compton model.

  3. Peculiar emission from the new VHE gamma-ray source H1722+119

    Science.gov (United States)

    Terzić, T.; Stamerra, A.; D'Ammando, F.; Raiteri, C. M.; Villata, M.; Verrecchia, F.; Kurtanidze, O.

    The BL Lac object H1722+119 was observed in the very high energy band (VHE, E > 100 GeV) by the MAGIC (Major Atmospheric Gamma-ray Imaging Cherenkov) telescopes (Aleksić et al. 2016a, b)) between 2013 May 17 and 22, following a state of high activity in the optical band measured by the KVA (Kungliga Vetenskapsakademien) telescope. Optical high states are often used to trigger MAGIC observations, which result in the VHE γ-ray signal detection (see e.g. Aleksić et al. 2015, Ahnen et al. 2016 and references therein).

  4. Dicty_cDB: VHE418 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHE4-A/VHE418Q.Seq.d/ Representat...ive seq. ID VHE418P (Link to Original site) Representative DNA sequence >VHE418 (VHE418Q) /CSM/VH/VHE4-A/VHE418Q...ogy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHE418 (VHE418Q) /CSM/VH/VHE4-A/VHE418Q

  5. First detection of VHE γ-rays from SN 1006 by HESS

    NARCIS (Netherlands)

    Acero, F.; Aharonian, F.; Akhperjanian, A.G.; Anton, G.; Vink, J.|info:eu-repo/dai/nl/182880559

    2010-01-01

    Aims. Recent theoretical predictions of the lowest very high energy (VHE) luminosity of SN 1006 are only a factor 5 below the previously published HESS upper limit, thus motivating further in-depth observations of this source. Methods. Deep observations at VHE energies (above 100 GeV) were carried

  6. Dicty_cDB: VHE820 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available producing significant alignments: (bits) Value VHE820 (VHE820Q) /CSM/VH/VHE8-A/VHE820Q.Seq.d/ 32 2.0 SSL712...date 2004.12.24 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value

  7. Dicty_cDB: VHE138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE138 (Link to dictyBase) - - - Contig-U15767-1 VHE138P (Link... to Original site) VHE138F 569 VHE138Z 621 VHE138P 1170 - - Show VHE138 Library VH (Link to library) Clone ID VHE138 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...FVDNQAGDSXSAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQGF NDVSYP--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICT...rsi*i**fkllpn*rtrf q*ckls--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTPVDCG ANDEDKCKTWSCDPTKGG

  8. Dicty_cDB: VHE424 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE424 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHE424Z 667 - - - - Show VHE424 Library VH (Link to library) Clone ID VHE424 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...ino Acid sequence ---ASGSVVEQCSSVDSISNLPTTMQLFAGIKSICTEMAMDGCEKCSGNSPTTTCDVLPV YSSLCMAMPDMSQCANWTKMCSSSGQLYN...--ASGSVVEQCSSVDSISNLPTTMQLFAGIKSICTEMAMDGCEKCSGNSPTTTCDVLPV YSSLCMAMPDMSQCANWTKMCSSSGQLYNSQITSDYCVASVADAVPIM

  9. Dicty_cDB: VHE513 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE513 (Link to dictyBase) - - - Contig-U13028-1 VHE513P (Link to Original site)...VHE513Z 227 VHE513P 804 - - Show VHE513 Library VH (Link to library) Clone ID VHE513 (Link to dictyBase)...Physarum08327 Physarum polycephalum starvation stress library Physarum polycephalum cDNA clone PpolyN1d98h02...Physarum08344 Physarum polycephalum starvation stress library Physarum polycephalum cDNA clone PpolyN1d95e10...Physarum08350 Physarum polycephalum starvation stress library Physarum polycephalum cDNA clone PpolyN1d88e08

  10. Dicty_cDB: VHE495 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE495 (Link to dictyBase) - - - Contig-U11503-1 VHE495E (Link...) Clone ID VHE495 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Ori...uence kkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKDA...nce (All Frames) Frame A: kkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKDAVSRAFLL...ts: (bits) Value N AC115680 |AC115680.3 Dictyostelium discoideum chromosome 2 map 4915084-5005461 strain AX4

  11. VHE Gamma-ray Supernova Remnants

    Energy Technology Data Exchange (ETDEWEB)

    Funk, Stefan; /KIPAC, Menlo Park

    2007-01-22

    Increasing observational evidence gathered especially in X-rays and {gamma}-rays during the course of the last few years support the notion that Supernova remnants (SNRs) are Galactic particle accelerators up to energies close to the ''knee'' in the energy spectrum of Cosmic rays. This review summarizes the current status of {gamma}-ray observations of SNRs. Shell-type as well as plerionic type SNRs are addressed and prospect for observations of these two source classes with the upcoming GLAST satellite in the energy regime above 100 MeV are given.

  12. Measurement of the EBL spectral energy distribution using the VHE γ-ray spectra of H.E.S.S. blazars

    Science.gov (United States)

    H. E. S. S. Collaboration; Abdalla, H.; Abramowski, A.; Aharonian, F.; Ait Benkhali, F.; Akhperjanian, A. G.; Andersson, T.; Angüner, E. O.; Arakawa, M.; Arrieta, M.; Aubert, P.; Backes, M.; Balzer, A.; Barnard, M.; Becherini, Y.; Tjus, J. Becker; Berge, D.; Bernhard, S.; Bernlöhr, K.; Blackwell, R.; Böttcher, M.; Boisson, C.; Bolmont, J.; Bonnefoy, S.; Bordas, P.; Bregeon, J.; Brun, F.; Brun, P.; Bryan, M.; Büchele, M.; Bulik, T.; Capasso, M.; Carr, J.; Casanova, S.; Cerruti, M.; Chakraborty, N.; Chaves, R. C. G.; Chen, A.; Chevalier, J.; Coffaro, M.; Colafrancesco, S.; Cologna, G.; Condon, B.; Conrad, J.; Cui, Y.; Davids, I. D.; Decock, J.; Degrange, B.; Deil, C.; Devin, J.; de Wilt, P.; Dirson, L.; Djannati-Ataï, A.; Domainko, W.; Donath, A.; Drury, L. O.'C.; Dutson, K.; Dyks, J.; Edwards, T.; Egberts, K.; Eger, P.; Ernenwein, J.-P.; Eschbach, S.; Farnier, C.; Fegan, S.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Funk, S.; Füßling, M.; Gabici, S.; Gallant, Y. A.; Garrigoux, T.; Giavitto, G.; Giebels, B.; Glicenstein, J. F.; Gottschall, D.; Goyal, A.; Grondin, M.-H.; Hahn, J.; Haupt, M.; Hawkes, J.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hofmann, W.; Hoischen, C.; Holch, T. L.; Holler, M.; Horns, D.; Ivascenko, A.; Iwasaki, H.; Jacholkowska, A.; Jamrozy, M.; Janiak, M.; Jankowsky, D.; Jankowsky, F.; Jingo, M.; Jogler, T.; Jouvin, L.; Jung-Richardt, I.; Kastendieck, M. A.; Katarzyński, K.; Katsuragawa, M.; Katz, U.; Kerszberg, D.; Khangulyan, D.; Khélifi, B.; King, J.; Klepser, S.; Klochkov, D.; Kluźniak, W.; Kolitzus, D.; Komin, Nu.; Kosack, K.; Krakau, S.; Kraus, M.; Krüger, P. P.; Laffon, H.; Lamanna, G.; Lau, J.; Lees, J.-P.; Lefaucheur, J.; Lefranc, V.; Lemière, A.; Lemoine-Goumard, M.; Lenain, J.-P.; Leser, E.; Lohse, T.; Lorentz, M.; Liu, R.; López-Coto, R.; Lypova, I.; Marandon, V.; Marcowith, A.; Mariaud, C.; Marx, R.; Maurin, G.; Maxted, N.; Mayer, M.; Meintjes, P. J.; Meyer, M.; Mitchell, A. M. W.; Moderski, R.; Mohamed, M.; Mohrmann, L.; Morå, K.; Moulin, E.; Murach, T.; Nakashima, S.; de Naurois, M.; Niederwanger, F.; Niemiec, J.; Oakes, L.; O'Brien, P.; Odaka, H.; Ohm, S.; Ostrowski, M.; Oya, I.; Padovani, M.; Panter, M.; Parsons, R. D.; Pekeur, N. W.; Pelletier, G.; Perennes, C.; Petrucci, P.-O.; Peyaud, B.; Piel, Q.; Pita, S.; Poon, H.; Prokhorov, D.; Prokoph, H.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raab, S.; Rauth, R.; Reimer, A.; Reimer, O.; Renaud, M.; de los Reyes, R.; Richter, S.; Rieger, F.; Romoli, C.; Rowell, G.; Rudak, B.; Rulten, C. B.; Sahakian, V.; Saito, S.; Salek, D.; Sanchez, D. A.; Santangelo, A.; Sasaki, M.; Schlickeiser, R.; Schüssler, F.; Schulz, A.; Schwanke, U.; Schwemmer, S.; Seglar-Arroyo, M.; Settimo, M.; Seyffert, A. S.; Shafi, N.; Shilon, I.; Simoni, R.; Sol, H.; Spanier, F.; Spengler, G.; Spies, F.; Stawarz, Ł.; Steenkamp, R.; Stegmann, C.; Stycz, K.; Sushch, I.; Takahashi, T.; Tavernet, J.-P.; Tavernier, T.; Taylor, A. M.; Terrier, R.; Tibaldo, L.; Tiziani, D.; Tluczykont, M.; Trichard, C.; Tsuji, N.; Tuffs, R.; Uchiyama, Y.; van der Walt, D. J.; van Eldik, C.; van Rensburg, C.; van Soelen, B.; Vasileiadis, G.; Veh, J.; Venter, C.; Viana, A.; Vincent, P.; Vink, J.; Voisin, F.; Völk, H. J.; Vuillaume, T.; Wadiasingh, Z.; Wagner, S. J.; Wagner, P.; Wagner, R. M.; White, R.; Wierzcholska, A.; Willmann, P.; Wörnlein, A.; Wouters, D.; Yang, R.; Zaborov, D.; Zacharias, M.; Zanin, R.; Zdziarski, A. A.; Zech, A.; Zefi, F.; Ziegler, A.; Żywucka, N.

    2017-10-01

    Very high-energy γ rays (VHE, E ≳ 100 GeV) propagating over cosmological distances can interact with the low-energy photons of the extragalactic background light (EBL) and produce electron-positron pairs. The transparency of the Universe to VHE γ rays is then directly related to the spectral energy distribution (SED) of the EBL. The observation of features in the VHE energy spectra of extragalactic sources allows the EBL to be measured, which otherwise is very difficult. An EBL model-independent measurement of the EBL SED with the H.E.S.S. array of Cherenkov telescopes is presented. It was obtained by extracting the EBL absorption signal from the reanalysis of high-quality spectra of blazars. From H.E.S.S. data alone the EBL signature is detected at a significance of 9.5σ, and the intensity of the EBL obtained in different spectral bands is presented together with the associated γ-ray horizon.

  13. The origin and emission mechanism of VHE (>100GeV emission from FSRQs

    Directory of Open Access Journals (Sweden)

    Behera Bagmeet

    2013-12-01

    Full Text Available Flat Spectrum Radio Quasars, unlike BL Lac objects, are blazars that show prominent line-emission and strong thermal components associated with the accretion disk, the broad-line region (BLR, and/or the dusty torus. The low energy peak in the continuum is from synchrotron emission (of electrons, and the high energy peak is well explained by external-Compton emission. In these models the relativistic electrons in the jet up-scatter photons from the thermal photon fields up to GeV energies. Beyond a few tens of GeV such models predict cutoffs due to Klein-Nishina effect and internal absorption via pair production. While more than 300 FSRQs have been seen with Fermi-LAT (between 100MeV−30GeV, only three have been detected at VHE (Very High Energy, E > 100 GeV with Cherenkov telescopes. The detection of VHE emission constrains the location of the blazar zone based on internal absorption estimates, but challenges the emission models that predict cutoffs. While a number of GeV flaring states (in various FSRQs have been observed with Cherenkov telescopes only few have resulted in detection of a VHE signal. The broadband emission characteristics of VHE FSRQs (including the VHE-detected FSRQs are studied and put in context to better understand their location and emission mechanism.

  14. Maximizng the sensitivity of a low threshold VHE gamma ray telescope by the use of neural nets and other methods

    Energy Technology Data Exchange (ETDEWEB)

    Kertzman, M.P. (Department of Physics and Astronomy, DePauw University Greencastle, Indiana 46135 (USA)); Sembroski, G.H. (Department of Physcis, Purdue University West Lafayette, Indiana 47907 (USA))

    1991-04-05

    Detailed 3-dimensional Monte-Carlo computer simulations of the Cherenkov photons produced by VHE (10 GeV to 10 TeV) gamma ray and proton induced air shower cascades are used to calculate the sensitivity and threshold of a ground-based, single-mount, multi-mirror, single photo-electron sensitive gamma ray telescope. Such a telescope is designed to have the lowest possible energy threshold for gamma ray induced air showers for a given light collection area. The sensitivity and energy threshold of this design are determined for various triggering configurations, and the sources and properties of background triggers are investigated. In particular, it is found that up to 40% of the background triggers are due to single muons produced by proton induced showers with primary energies in the 25 to 75 GeV range. Two methods for increasing the sensitivity of such a telescope by discrimination against the single muon induced triggers are investigated. The first uses small outrider telescopes triggering in coincidence with the main telescope. The second uses software implemented neural nets trained to identify muon induced triggers by use of the temporal shape of the Cherenkov light pulse.

  15. Very High Energy γ- rays from Galactic Sources

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    found (main pulse region for Crab and around 0.6 for Geminga) displayed features expected from gamma ray events. 3. Recent PACT observations on galactic sources. A new atmospheric Cerenkov array to study cosmic sources of Very High Energy. (VHE) Gamma rays has been set up in Pachmarhi in central India.

  16. Seroprevalence for hepatitis E virus (HEV infection among volunteer blood donors of the Regional Blood Bank of Londrina, State of Paraná , Brazil Soroprevalência da infecção pelo virus da hepatite E (VHE em candidatos a doadores de sangue voluntários do Hemocentro Regional de Londrina, Londrina, Estado do Paraná, Brasil

    Directory of Open Access Journals (Sweden)

    André Luiz Bortoliero

    2006-04-01

    Full Text Available A cross-sectional study was carried out among 996 volunteer blood donors enrolled from May 1999 to December 1999 to determine the seroprevalence of hepatitis E virus (HEV infection among volunteer blood donors of the Regional Blood Bank of Londrina, State of Paraná, Brazil, and to evaluate whether the rate of seroprevalence of IgG anti-HEV antibodies is associated with sociodemographic variables and with seropositivity for hepatitis A virus (HAV infection. All participants answered the questionnaire regarding the sociodemographic characterisitcs. Serum samples were tested for IgG antibodies to HEV (anti-HEV by an enzyme linked immunoassay (ELISA. All serum samples positive for anti-HEV IgG and 237 serum samples negative for anti-HEV were also assayed for IgG anti-HAV antibodies by ELISA. Anti-HEV IgG was confirmed in 23/996 samples, resulting in a seroprevalence of 2.3% for HEV infection, similar to previous results obtained in developed countries. No significant association was found between the presence of anti-HEV IgG antibodies and the sociodemographic variables including gender, age, educational level, rural or urban areas, source of water, and sewer system (p > 0.05. Also, no association with seropositivity for anti-HAV IgG antibodies was observed (p > 0.05. Although this study revealed a low seroprevalence of HEV infection in the population evaluated, the results showed that this virus is circulating among the population from Londrina, South Brazil, and point out the need of further studies to define the clinical and epidemiological importance of HEV infection and to identify additional risk factors involved in the epidemiology and pathogenesis of this infection in this population.Os objetivos do estudo foram determinar a soroprevalência da infecção pelo vírus da hepatite E (VHE em candidatos a doadores de sangue voluntários do Hemocentro Regional de Londrina, Paraná, e avaliar se essa soroprevalência está associada com vari

  17. DETECCIÓN DEL GENOMA DEL VIRUS DE LA HEPATITIS E (VHE EN MUESTRAS DE HECES DE CERDOS EN PLANTAS DE BENEFICIO DE ANTIOQUIA, COLOMBIA

    Directory of Open Access Journals (Sweden)

    J. E. Forero

    2014-01-01

    Full Text Available El Virus de la Hepatitis E (VHE es uno de los agentes causales de enfermedad hepáticaaguda en humanos, aunque también puede inducir hepatitis crónica en pacientes in-munocomprometidos. Existen cuatro genotipos que generan enfermedad en humanos:los genotipos 1 y 2 asociados con brotes epidémicos por consumo de aguas contami-nadas y los genotipos 3 y 4 de trasmisión zoonótica, implicados en brotes esporádicosen países desarrollados donde el cerdo es el principal reservorio. En Colombia existeevidencia serológica de la infección en humanos y cerdos: se ha detectado el genomaviral en hígados de cerdos en plantas de beneficio y expendios de carne; sin embargono se conoce lo suficiente sobre la infección en el país. Con el fin de determinar si loscerdos del departamento de Antioquia (Colombia están excretando VHE en la edad delbeneficio, se obtuvieron 152 muestras de heces de cerdos en cinco plantas de beneficiode distintas regiones del departamento en las que se determinó la presencia del genomaviral por medio RT-PCR. El porcentaje de positividad hallado fue del 26.9% (41/152;se encontró, además, que los cerdos que provenían de las subregiones Norte y Orientede Antioquia tuvieron el menor (11.6% y mayor (58.3% porcentaje de muestraspositivas, respectivamente. Estos resultados indican que los cerdos en el momento desacrificio están excretando el virus a través de sus heces y que el VHE está circulando enlas diferentes subregiones del departamento.

  18. sources

    Directory of Open Access Journals (Sweden)

    Shu-Yin Chiang

    2002-01-01

    Full Text Available In this paper, we study the simplified models of the ATM (Asynchronous Transfer Mode multiplexer network with Bernoulli random traffic sources. Based on the model, the performance measures are analyzed by the different output service schemes.

  19. Search for a Correlation Between Radio Giant Pulses and VHE Photons of the Crab Pulsar

    Directory of Open Access Journals (Sweden)

    N. Lewandowska

    2011-01-01

    Full Text Available The Crab pulsar is a unique source of pulsar radio emission. Its regular pulse structure is visible over the entire electromagnetic spectrum from radio to GeV ranges. Among the regular pulses, radio giant pulses (GPs are known as a special form of pulsar radio emission. Although the Crab pulsar was discovered by its GPs, their origin and emission mechanisms are currently not understood. Within the framework of this report we give a review on radio GPs and present a new idea on how to examine the characteristics of this as yet not understood kind of pulsar emission.

  20. Sources

    OpenAIRE

    2015-01-01

    Sources Fondation Pablo Iglesias. Alcala de Henares. Sections : Archives privées de Manuel ArijaArchives extérieuresArchives FNJS de EspañaPrensa Archives Générales de l’Administration. Alcala de Henares. Sections : Opposition au franquismeSig. 653 Sig TOP 82/68.103-68.602.Índice de las cartas colectivas, Relaciones, Cartas al Ministro de Información de Marzo de 1965. c.662. Sources cinématographiques Filmothèque Nationale d’Espagne.NO.DO. N° 1157C. 08/03/1965.aguirre Javier, Blanco vertical....

  1. Sources

    OpenAIRE

    2014-01-01

    Archives Archivo Histórico del Estado de Jalisco Fondo Gobernación, Asunto Pasaportes y Salvoconductos : G-8-877/9773-9775 G-8-878/9774, 9776, 9777 et 9781 G-8-879/9782-9788 G-8-880/9789-9798 G-8-881-882/9803 G-8-882/9804-9805 G-8-883/9806-9811 G-8-884/9813 G-8-885/9817-9820 G-8-886/9822-9825 G-8-887/9826-9830 G-8-888/9835 G-8-889-890/9837 G-8-889/9839 Sources imprimées Livres et chroniques O’Farrill Romulo, (2004) Reseña histórica estadística y comercial de México y sus estados, directorio g...

  2. Discovery of the source HESS J1356-645 associated with the young and energetic PSR J1357-6429

    Science.gov (United States)

    H.E.S.S. Collaboration; Abramowski, A.; Acero, F.; Aharonian, F.; Akhperjanian, A. G.; Anton, G.; Balzer, A.; Barnacka, A.; Barres de Almeida, U.; Becherini, Y.; Becker, J.; Behera, B.; Bernlöhr, K.; Bochow, A.; Boisson, C.; Bolmont, J.; Bordas, P.; Brucker, J.; Brun, F.; Brun, P.; Bulik, T.; Büsching, I.; Carrigan, S.; Casanova, S.; Cerruti, M.; Chadwick, P. M.; Charbonnier, A.; Chaves, R. C. G.; Cheesebrough, A.; Chounet, L.-M.; Clapson, A. C.; Coignet, G.; Cologna, G.; Conrad, J.; Dalton, M.; Daniel, M. K.; Davids, I. D.; Degrange, B.; Deil, C.; Dickinson, H. J.; Djannati-Ataï, A.; Domainko, W.; O'C. Drury, L.; Dubois, F.; Dubus, G.; Dutson, K.; Dyks, J.; Dyrda, M.; Egberts, K.; Eger, P.; Espigat, P.; Fallon, L.; Farnier, C.; Fegan, S.; Feinstein, F.; Fernandes, M. V.; Fiasson, A.; Fontaine, G.; Förster, A.; Füssling, M.; Gallant, Y. A.; Gast, H.; Gérard, L.; Gerbig, D.; Giebels, B.; Glicenstein, J. F.; Glück, B.; Goret, P.; Göring, D.; Häffner, S.; Hague, J. D.; Hampf, D.; Hauser, M.; Heinz, S.; Heinzelmann, G.; Henri, G.; Hermann, G.; Hinton, J. A.; Hoffmann, A.; Hofmann, W.; Hofverberg, P.; Holler, M.; Horns, D.; Jacholkowska, A.; de Jager, O. C.; Jahn, C.; Jamrozy, M.; Jung, I.; Kastendieck, M. A.; Katarzynski, K.; Katz, U.; Kaufmann, S.; Keogh, D.; Khangulyan, D.; Khélifi, B.; Klochkov, D.; Kluzniak, W.; Kneiske, T.; Komin, Nu.; Kosack, K.; Kossakowski, R.; Laffon, H.; Lamanna, G.; Lennarz, D.; Lohse, T.; Lopatin, A.; Lu, C.-C.; Marandon, V.; Marcowith, A.; Masbou, J.; Maurin, D.; Maxted, N.; Mayer, M.; McComb, T. J. L.; Medina, M. C.; Méhault, J.; Moderski, R.; Moulin, E.; Naumann, C. L.; Naumann-Godo, M.; de Naurois, M.; Nedbal, D.; Nekrassov, D.; Nguyen, N.; Nicholas, B.; Niemiec, J.; Nolan, S. J.; Ohm, S.; de Ona Wilhelmi, E.; Opitz, B.; Ostrowski, M.; Oya, I.; Panter, M.; Paz Arribas, M.; Pedaletti, G.; Pelletier, G.; Petrucci, P.-O.; Pita, S.; Pühlhofer, G.; Punch, M.; Quirrenbach, A.; Raue, M.; Rayner, S. M.; Reimer, A.; Reimer, O.; Renaud, M.; de Los Reyes, R.; Rieger, F.; Ripken, J.; Rob, L.; Rosier-Lees, S.; Rowell, G.; Rudak, B.; Rulten, C. B.; Ruppel, J.; Sahakian, V.; Sanchez, D.; Santangelo, A.; Schlickeiser, R.; Schöck, F. M.; Schulz, A.; Schwanke, U.; Schwarzburg, S.; Schwemmer, S.; Sikora, M.; Skilton, J. L.; Sol, H.; Spengler, G.; Stawarz, L.; Steenkamp, R.; Stegmann, C.; Stinzing, F.; Stycz, K.; Sushch, I.; Szostek, A.; Tavernet, J.-P.; Terrier, R.; Tluczykont, M.; Valerius, K.; van Eldik, C.; Vasileiadis, G.; Venter, C.; Vialle, J. P.; Viana, A.; Vincent, P.; Völk, H. J.; Volpe, F.; Vorobiov, S.; Vorster, M.; Wagner, S. J.; Ward, M.; White, R.; Wierzcholska, A.; Zacharias, M.; Zajczyk, A.; Zdziarski, A. A.; Zech, A.; Zechlin, H.-S.

    2011-09-01

    Context. Several newly discovered very-high-energy (VHE; E > 100 GeV) γ-ray sources in the Galaxy are thought to be associated with energetic pulsars. Among them, middle-aged (≳ 104 yr) systems exhibit large centre-filled VHE nebulae, offset from the pulsar position, which result from the complex relationship between the pulsar wind and the surrounding medium, and reflect the past evolution of the pulsar. Aims: Imaging Atmospheric Cherenkov Telescopes (IACTs) have been successful in revealing extended emission from these sources in the VHE regime. Together with radio and X-ray observations, this observational window allows one to probe the energetics and magnetic field inside these large-scale nebulae. Methods: H.E.S.S., with its large field of view, angular resolution of ≲0.1° and unprecedented sensitivity, has been used to discover a large population of such VHE sources. In this paper, the H.E.S.S. data from the continuation of the Galactic Plane Survey (- 80° law dN/dE ∝ E-Γ with photon index Γ = 2.2 ± 0.2stat ± 0.2sys. The inspection of archival radio images at three frequencies and the analysis of X-ray data from ROSAT/PSPC and XMM-Newton/MOS reveal the presence of faint non-thermal diffuse emission coincident with HESS J1356-645. Conclusions: HESS J1356-645 is most likely associated with the young and energetic pulsar PSR J1357-6429 (d = 2.4 kpc, τc = 7.3 kyr and Ė = 3.1 × 1036 erg s-1), located at a projected distance of ~5 pc from the centroid of the VHE emission. HESS J1356-645 and its radio and X-ray counterparts would thus represent the nebula resulting from the past history of the PSR J1357-6429 wind. In a simple one-zone model,

  3. Observation of a VHE Cosmic-Ray Flare-Signal with the L3+C Muon Spectrometer

    CERN Document Server

    Adriani, O; Aziz, T; Bähr, J; Banerjee, S; Becattini, F; Bellucci, L; Betev, B L; Blaising, J J; Bobbink, G J; Bottai, S; Bourilkov, D; Cartacci, A; Chemarin, M; Chen, G; Chen, G M; Chen, H S; Chiarusi, T; Coignet, G; Ding, L K; Duran, I; Eline, A; El Mamouni, H; Faber, G; Fay, J; Filthaut, F; Ganguli, S N; Gong, Z F; Grabosch, H J; Groenstege, H; Guo, Y N; Gupta, S; Gurtu, A; Haller, Ch; Hayashi, Y; He, Z X; Hebbeker, T; Herve, A; Hofer, H; Hoferjun, H; Huo, A X; Ito, N; Jing, C L; Jones, L W; Kantserov, V; Kawakami, S; Kittel, W; König, A C; Kok, E; Kuang, H H; Kuijpers, J; Ladron de Guevara, P; Le Coultre, P; Lei, Y; Leich, H; Leiste, R; Li, L; Li, Z C; Liu, Z A; Lohmann, W; Lu, Y S; Ma, W G; Ma, X H; Ma, Y Q; Mele, S; Meng, X W; Meschini, M; Metzger, W J; van Mil, A; Milcent, H; Mohanty, G B; Monteleoni, B; Nahnhauer, R; Naumov, V A; Nowak, H; Parriaud, J -F; Pauss, F; Petersen, B; Pieri, M; Pohl, M; Pojidaev, V; Qing, C R; Ramelli, R; Ranieri, R; Ravindran, K C; Rewiersma, P; Riemann, S; Rojkov, A; Romero, L; Schmitt, V; Schoeneich, B; Schotanus, D J; Shen, C Q; Spillantini, P; Sulanke, H; Tang, X W; Timmermans, C; Tonwar, S C; Trowitzsch, G; Unger, M; Verkooijen, H; Van de Walle, R T; Vogt, H; Wang, R G; Wang, Q; Wang, X L; Wang, X W; Wang, Z M; Wijk, R van; Wijnen, T A M; Wilkens, H; Xu, Y P; Xu, J S; Xu, Z Z; Yang, C G; Yang, X F; Yao, Z G; Yu, Z Q; Zhang, C; Zhang, F; Zhang, J; Zhang, S; Zhou, S J; Zhu, G Y; Zhu, Q Q; Zhuang, H L; Zwart, A N M

    2010-01-01

    The data collected by the L3+C muon spectrometer at the CERN Large Electron-Positron collider, LEP, have been used to search for short duration signals emitted by cosmic point sources. A sky survey performed from July to November 1999 and from April to November 2000 has revealed one single flux enhancement (chance probability = 2.6X10^{-3}) between the 17th and 20th of August 2000 from a direction with a galactic longitude of (265.02+-0.42)^° and latitude of (55.58+-0.24)^°. The energy of the detected muons was above 15 GeV.

  4. MAGIC upper limits to the VHE gamma-ray flux of 3C 454.3 in high emission state

    Science.gov (United States)

    Anderhub, H.; Antonelli, L. A.; Antoranz, P.; Backes, M.; Baixeras, C.; Balestra, S.; Barrio, J. A.; Bartko, H.; Bastieri, D.; Becerra González, J.; Becker, J. K.; Bednarek, W.; Berger, K.; Bernardini, E.; Biland, A.; Bock, R. K.; Bonnoli, G.; Bordas, P.; Borla Tridon, D.; Bosch-Ramon, V.; Bretz, T.; Britvitch, I.; Camara, M.; Carmona, E.; Commichau, S.; Contreras, J. L.; Cortina, J.; Costado, M. T.; Covino, S.; Curtef, V.; Dazzi, F.; de Angelis, A.; de Cea Del Pozo, E.; de Los Reyes, R.; de Lotto, B.; de Maria, M.; de Sabata, F.; Delgado Mendez, C.; Dominguez, A.; Dorner, D.; Doro, M.; Elsaesser, D.; Errando, M.; Ferenc, D.; Fernández, E.; Firpo, R.; Fonseca, M. V.; Font, L.; Galante, N.; García López, R. J.; Garczarczyk, M.; Gaug, M.; Goebel, F.; Hadasch, D.; Hayashida, M.; Herrero, A.; Höhne-Mönch, D.; Hose, J.; Hsu, C. C.; Huber, S.; Jogler, T.; Kranich, D.; La Barbera, A.; Laille, A.; Leonardo, E.; Lindfors, E.; Lombardi, S.; Longo, F.; López, M.; Lorenz, E.; Majumdar, P.; Maneva, G.; Mankuzhiyil, N.; Mannheim, K.; Maraschi, L.; Mariotti, M.; Martínez, M.; Mazin, D.; Meucci, M.; Meyer, M.; Miranda, J. M.; Mirzoyan, R.; Moldón, J.; Moles, M.; Moralejo, A.; Nieto, D.; Nilsson, K.; Ninkovic, J.; Otte, N.; Oya, I.; Paoletti, R.; Paredes, J. M.; Pasanen, M.; Pascoli, D.; Pauss, F.; Pegna, R. G.; Perez-Torres, M. A.; Persic, M.; Peruzzo, L.; Prada, F.; Prandini, E.; Puchades, N.; Rhode, W.; Ribó, M.; Rico, J.; Rissi, M.; Robert, A.; Rügamer, S.; Saggion, A.; Saito, T. Y.; Salvati, M.; Sanchez-Conde, M.; Sartori, P.; Satalecka, K.; Scalzotto, V.; Scapin, V.; Schweizer, T.; Shayduk, M.; Shinozaki, K.; Shore, S. N.; Sidro, N.; Sierpowska-Bartosik, A.; Sillanpää, A.; Sitarek, J.; Sobczynska, D.; Spanier, F.; Stamerra, A.; Stark, L. S.; Takalo, L.; Tavecchio, F.; Temnikov, P.; Tescaro, D.; Teshima, M.; Tluczykont, M.; Torres, D. F.; Turini, N.; Vankov, H.; Venturini, A.; Vitale, V.; Wagner, R. M.; Wittek, W.; Zabalza, V.; Zandanel, F.; Zanin, R.; Zapatero, J.; Vercellone, S.; Donnarumma, I.; D'Ammando, F.; Tavani, M.

    2009-04-01

    Aims: We report upper limits to the very high energy flux (E>100 GeV) of the flat spectrum radio quasar 3C 454.3 (z=0.859) derived by the Cherenkov telescope MAGIC during the high states of July/August and November/December 2007. We compare the upper limits derived in both time slots with the available quasi-simultaneous MeV-GeV data from the AGILE γ-ray satellite and interpret the observational results in the context of leptonic emission models. Methods: The source was observed with the MAGIC telescope during the active phases of July-August 2007 and November-December 2007 and the data were analyzed with the MAGIC standard analysis tools. For the periods around the ends of July and November, characterized by the most complete multifrequency coverage, we constructed the spectral energy distributions using our data together with nearly simultaneous multifrequency (optical, UV, X-ray and GeV) data. Results: Only upper limits can be derived from the MAGIC data. The upper limits, once corrected for the expected absorption by the extragalactic background light, together with nearly simultaneous multifrequency data, allow us to constrain the spectral energy distribution of 3C 454.3. The data are consistent with the model expectations based on inverse Compton scattering of the ambient photons from the broad line region by relativistic electrons, which robustly predicts a sharp cut-off above 20-30 GeV.

  5. Gamma-ray constraints on maximum cosmogenic neutrino fluxes and UHECR source evolution models

    Energy Technology Data Exchange (ETDEWEB)

    Gelmini, Graciela B. [Department of Physics and Astronomy, UCLA, 475 Portola Plaza, Los Angeles, CA 90095 (United States); Kalashev, Oleg [INR RAS, 60th October Anniversary pr. 7a, 117312 Moscow (Russian Federation); Semikoz, Dmitri V., E-mail: gelmini@physics.ucla.edu, E-mail: kalashev@ms2.inr.ac.ru, E-mail: dmitri.semikoz@apc.univ-paris7.fr [APC, College de France, 11 pl. Marcelin Berthelot, Paris 75005 (France)

    2012-01-01

    The dip model assumes that the ultra-high energy cosmic rays (UHECRs) above 10{sup 18} eV consist exclusively of protons and is consistent with the spectrum and composition measure by HiRes. Here we present the range of cosmogenic neutrino fluxes in the dip-model which are compatible with a recent determination of the extragalactic very high energy (VHE) gamma-ray diffuse background derived from 2.5 years of Fermi/LAT data. We show that the largest fluxes predicted in the dip model would be detectable by IceCube in about 10 years of observation and are within the reach of a few years of observation with the ARA project. In the incomplete UHECR model in which protons are assumed to dominate only above 10{sup 19} eV, the cosmogenic neutrino fluxes could be a factor of 2 or 3 larger. Any fraction of heavier nuclei in the UHECR at these energies would reduce the maximum cosmogenic neutrino fluxes. We also consider here special evolution models in which the UHECR sources are assumed to have the same evolution of either the star formation rate (SFR), or the gamma-ray burst (GRB) rate, or the active galactic nuclei (AGN) rate in the Universe and found that the last two are disfavored (and in the dip model rejected) by the new VHE gamma-ray background.

  6. XMM-Newton Observations Reveal the X-ray Counterpart of the Very-high-energy gamma-ray Source HESS J1640-465

    Energy Technology Data Exchange (ETDEWEB)

    Funk, S.; Hinton, J.A.; Puhlhofer, G.; Aharonian, F.A.; Hofmann, W.; Reimer, O.; Wagner, S.; /KIPAC, Menlo Park /Heidelberg, Max Planck Inst. /Leeds U. /Dublin Inst. /Stanford U., HEPL; Funk, S.; Hinton, J.A.; Puehlhofer, G.; Aharonian, F.A.; Hofmann, W.; Reimer, O.; Wagner, S.

    2007-03-05

    We present X-ray observations of the as of yet unidentified very high-energy (VHE) {gamma}-ray source HESS J1640-465 with the aim of establishing a counterpart of this source in the keV energy range, and identifying the mechanism responsible for the VHE emission. The 21.8 ksec XMM-Newton observation of HESS J1640-465 in September 2005 represents a significant improvement in sensitivity and angular resolution over previous ASCA studies in this region. These new data show a hard-spectrum X-ray emitting object at the centroid of the H.E.S.S. source, within the shell of the radio Supernova Remnant (SNR) G338.3-0.0. This object is consistent with the position and flux previously measured by both ASCA and Swift-XRT but is now shown to be significantly extended. We argue that this object is very likely the counterpart to HESS J1640-465 and that both objects may represent the Pulsar Wind Nebula of an as of yet undiscovered pulsar associated with G338.3-0.0.

  7. Molecular characterization of swine hepatitis E virus from Southeastern Brazil Caracterização molecular do vírus suíno da hepatite E (vhe encontrado no Sudeste do Brasil

    Directory of Open Access Journals (Sweden)

    Helder Henrique Paiva

    2007-12-01

    Full Text Available Despite serological evidences of presence of hepatitis E virus (HEV in humans or other animals, until this study the virus had not been detected and molecular characterization of the isolate that circulates in Brazil had not been described. Thus, we collected stool samples of young pigs and tested for presence of HEV RNA by RT-PCR, using primers for partial amplification of ORF2 sequence. Phylogenetic analysis with sequence obtained from the amplified products revealed that the HEV isolate identified here was most closely related to HEV isolates of genotype 3, which is commonly detected in HEV infected pigs. Nucleotide sequence analyses carried out with the entire amplified fragment, ORF2/ORF3 overlapping and ORF2 non-overlapping sequences showed highest identities with the US isolate of genotype 3. Similarly, amino acid sequence analyses done with the entire amplified fragment, ORF2 non-overlapping, ORF2 and ORF3 overlapping sequences also showed highest identities with the genotype 3 isolate. Presence, in Brazil, of HEV of genotype 4, which also infects pigs, as well as HEV strains that infect humans still remain to be detected and characterized.Apesar de evidências sorológicas da presença do vírus da hepatite E (VHE em humanos ou outros animais, até o presente estudo o vírus não havia sido detectado e a caracterização molecular da cepa que circula no Brasil não havia sido descrita. Assim, amostras de fezes de porcos jovens foram colhidas e analizadas quanto a presença do ARN do VHE por RT-PCR, utilizando-se oligonucleotídeos para amplificação da seqüência parcial do ORF2 viral. Análise filogenética realizada com a seqüência obtida dos produtos amplificados revelou que a cepa encontrada apresentou relação próxima com cepas do genótipo 3 que são detectadas com freqüência em porcos. Análises das seqüências nucleotídicas realizadas com todo o segmento amplificado, com somente o segmento sobreposto do ORF2/ORF3 e

  8. Locating very high energy gamma-ray sources with arcminute accuracy

    Science.gov (United States)

    Akerlof, C. W.; Cawley, M. F.; Chantell, M.; Harris, K.; Lawrence, M. A.; Fegan, D. J.; Lang, M. J.; Hillas, A. M.; Jennings, D. G.; Lamb, R. C.

    1991-01-01

    The angular accuracy of gamma-ray detectors is intrinsically limited by the physical processes involved in photon detection. Although a number of pointlike sources were detected by the COS B satellite, only two have been unambiguously identified by time signature with counterparts at longer wavelengths. By taking advantage of the extended longitudinal structure of VHE gamma-ray showers, measurements in the TeV energy range can pinpoint source coordinates to arcminute accuracy. This has now been demonstrated with new data analysis procedures applied to observations of the Crab Nebula using Cherenkov air shower imaging techniques. With two telescopes in coincidence, the individual event circular probable error will be 0.13 deg. The half-cone angle of the field of view is effectively 1 deg.

  9. The GeV-TeV Connection in Galactic gamma-ray Sources

    Energy Technology Data Exchange (ETDEWEB)

    Funk, S.; /KIPAC, Menlo Park; Reimer, O.; /Stanford U., HEPL /KIPAC, Menlo Park; Torres, Diego F.; /ICREA, Barcelona; Hinton, J.A.; /Leeds U.

    2007-09-28

    Recent observations by atmospheric Cherenkov telescopes such as H.E.S.S. and MAGIC have revealed a large number of new sources of very-high-energy (VHE) gamma-rays above 100 GeV, mostly concentrated along the Galactic plane. At lower energies (100 MeV - 10 GeV) the satellite-based instrument EGRET revealed a population of sources clustering along the Galactic Plane. Given their adjacent energy bands a systematic correlation study between the two source classes seems appropriate. While only a few of the sources connect, both in terms of positional coincidence and spectral consistency, most of the detections occur only in one or the other energy domain. In these cases, for the first time consistent upper limits in the other energy band have been derived. Here, the populations of Galactic sources in both energy domains are characterized on observational as well as on theoretical grounds, followed by an interpretation on their similarities and differences. The observational data at this stage suggest rather different major source populations at GeV and TeV energies. With regards to preparations for the upcoming GLAST mission that will cover the energy range bridging GeV and TeV instruments this paper investigates the connection between the population of sources in these bands and concludes with predictions for commonly observable sources for GLAST-LAT detections.

  10. Observations of the unidentified gamma-ray source TeV J2032+4130 by Veritas

    Energy Technology Data Exchange (ETDEWEB)

    Aliu, E.; Errando, M. [Department of Physics and Astronomy, Barnard College, Columbia University, NY 10027 (United States); Aune, T. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Behera, B.; Chen, X.; Federici, S. [DESY, Platanenallee 6, D-15738 Zeuthen (Germany); Beilicke, M.; Buckley, J. H.; Bugaev, V. [Department of Physics, Washington University, St. Louis, MO 63130 (United States); Benbow, W.; Cerruti, M. [Fred Lawrence Whipple Observatory, Harvard-Smithsonian Center for Astrophysics, Amado, AZ 85645 (United States); Berger, K. [Department of Physics and Astronomy and the Bartol Research Institute, University of Delaware, Newark, DE 19716 (United States); Bird, R. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Cardenzana, J. V. [Department of Physics and Astronomy, Iowa State University, Ames, IA 50011 (United States); Ciupik, L. [Astronomy Department, Adler Planetarium and Astronomy Museum, Chicago, IL 60605 (United States); Connolly, M. P. [School of Physics, National University of Ireland Galway, University Road, Galway (Ireland); Cui, W. [Department of Physics, Purdue University, West Lafayette, IN 47907 (United States); Duke, C. [Department of Physics, Grinnell College, Grinnell, IA 50112-1690 (United States); Dumm, J. [School of Physics and Astronomy, University of Minnesota, Minneapolis, MN 55455 (United States); Falcone, A., E-mail: pratik.majumdar@saha.ac.in, E-mail: gareth.hughes@desy.de [Department of Astronomy and Astrophysics, 525 Davey Lab, Pennsylvania State University, University Park, PA 16802 (United States); and others

    2014-03-01

    TeV J2032+4130 was the first unidentified source discovered at very high energies (VHEs; E > 100 GeV), with no obvious counterpart in any other wavelength. It is also the first extended source to be observed in VHE gamma rays. Following its discovery, intensive observational campaigns have been carried out in all wavelengths in order to understand the nature of the object, which have met with limited success. We report here on a deep observation of TeV J2032+4130 based on 48.2 hr of data taken from 2009 to 2012 by the Very Energetic Radiation Imaging Telescope Array System experiment. The source is detected at 8.7 standard deviations (σ) and is found to be extended and asymmetric with a width of 9.'5 ± 1.'2 along the major axis and 4.'0 ± 0.'5 along the minor axis. The spectrum is well described by a differential power law with an index of 2.10 ± 0.14{sub stat} ± 0.21{sub sys} and a normalization of (9.5 ± 1.6{sub stat} ± 2.2{sub sys}) × 10{sup –13} TeV{sup –1} cm{sup –2} s{sup –1} at 1 TeV. We interpret these results in the context of multiwavelength scenarios which particularly favor the pulsar wind nebula interpretation.

  11. Source Water Protection Contaminant Sources

    Data.gov (United States)

    Iowa State University GIS Support and Research Facility — Simplified aggregation of potential contaminant sources used for Source Water Assessment and Protection. The data is derived from IDNR, IDALS, and US EPA program...

  12. Modeling the emission of the galactic very high energy {gamma}-ray sources G 1.9+0.3, G 330.2+1.0, HESS J1303-631 and PSR B1259-63/LS 2883 observed with H.E.S.S

    Energy Technology Data Exchange (ETDEWEB)

    Sushch, Iurii

    2012-10-19

    Recently, imaging atmospheric Cherenkov telescopes (IACTs) have discovered numerous new sources representing various source classes in the very high energy (VHE; E>100 GeV) sky. This work presents studies of representatives of three types of Galactic VHE emitters: the Supernova remnants (SNRs) G1.9+0.3 and G330.2+1.0, the pulsar wind nebula (PWN) HESS J1303.631 and the binary system PSR B1259.63/LS 2883. The analysis of the H.E.S.S. data and the broadband emission modeling are presented. G1.9+0.3 and G330.2+1.0 are synchrotron-dominated SNRs whose non-thermal X-ray emission implies that intensive particle acceleration occurs at their shock fronts. This makes them promising candidates for the detection at VHEs. They were observed by the High Energy Stereoscopic System (H.E.S.S.) yielding no signs of significant VHE {gamma}-ray emission from either SNR. The 99% confidence level upper limits on the TeV flux were determined. For an assumed spectral index of 2.5 the obtained upper limits are F{sub G1.9}(>260 GeV)<4.6 x 10{sup -13} cm{sup -2}s{sup -1} for G1.9+0.3 and F{sub G330}(>380 GeV)<1.6 x 10{sup -12} cm{sup -2}s{sup -1} for G330.2+1.0. Upper limits on the VHE emission provide constraints on the interior magnetic field in the context of a leptonic scenario and on the interstellar medium (ISM) density and cosmic-ray (CR) efficiency in a hadronic scenario. Lower limits on the interior magnetic fields were estimated at 15 {mu}G for G1.9+0.3 and 14 {mu}G for G330.2+1.0. In the case of the hadronic scenario, the H.E.S.S. upper limits are two orders of magnitude greater than the flux prediction. Obtained upper limits on the ISM densities are compatible with other estimates of the densities (from the thermal X-ray emission for G330.2+1.0 and from the expansion rate for G1.9+0.3). The CR efficiency cannot be constrained with the current H.E.S.S. upper limits. HESS J1303-631 is an initially unidentified H.E.S.S. source which was recently identified as a PWN associated with

  13. Terahertz sources

    National Research Council Canada - National Science Library

    Shumyatsky, Pavel; Alfano, Robert R

    2011-01-01

    We present an overview and history of terahertz (THz) sources for readers of the biomedical and optical community for applications in physics, biology, chemistry, medicine, imaging, and spectroscopy...

  14. Crowd Sourcing.

    Science.gov (United States)

    Baum, Neil

    2016-01-01

    The Internet has contributed new words and slang to our daily vernacular. A few terms, such as tweeting, texting, sexting, blogging, and googling, have become common in most vocabularies and in many languages, and are now included in the dictionary. A new buzzword making the rounds in industry is crowd sourcing, which involves outsourcing an activity, task, or problem by sending it to people or groups outside a business or a practice. Crowd sourcing allows doctors and practices to tap the wisdom of many instead of relying only on the few members of their close-knit group. This article defines "crowd sourcing," offers examples, and explains how to get started with this approach that can increase your ability to finish a task or solve problems that you don't have the time or expertise to accomplish.

  15. Source Water Protection Basics

    Science.gov (United States)

    Defines drinking water sources (source water), identifies drinking water sources, and describes source water assessments and protection, roles of government and organizations in drinking water source protection

  16. Sourcing Excellence

    DEFF Research Database (Denmark)

    Adeyemi, Oluseyi

    2011-01-01

    the competitiveness of manufacturing companies (7). Over the last couple of years, supplier’s development is an evolution in supply chain management and there is a growing interest in generating approaches for meaningful development of suppliers and SDI. This would allow businesses to snatch long-term strategic......Sourcing Excellence is one of the key performance indicators (KPIs) in this world of ever changing sourcing strategies. Manufacturing companies need to access and diagnose the reliability and competencies of existing suppliers in order to coordinate and develop them. This would help in managing....... In essence, this would allow the deployment of both internal and external skills and competencies to determine the new approaches towards organizing, supporting and improving supplier driven innovations (SDI) and supplier relationship management (SRM). This is to achieve operational excellence...

  17. Superluminal sources

    OpenAIRE

    1995-01-01

    Predictions for the apparent velocity statistics under simple beaming models are presented and compared to the observations. The potential applications for tests of unification models and for cosmology (source counts, measurements of the Hubble constant H0 and the deceleration parameter q0) are discussed. First results from a large homogeneous survey are presented. The data do not show compelling evidence for the existence of intrinsically different populations of galaxies, BL Lacertae object...

  18. Source rock

    Directory of Open Access Journals (Sweden)

    Abubakr F. Makky

    2014-03-01

    Full Text Available West Beni Suef Concession is located at the western part of Beni Suef Basin which is a relatively under-explored basin and lies about 150 km south of Cairo. The major goal of this study is to evaluate the source rock by using different techniques as Rock-Eval pyrolysis, Vitrinite reflectance (%Ro, and well log data of some Cretaceous sequences including Abu Roash (E, F and G members, Kharita and Betty formations. The BasinMod 1D program is used in this study to construct the burial history and calculate the levels of thermal maturity of the Fayoum-1X well based on calibration of measured %Ro and Tmax against calculated %Ro model. The calculated Total Organic Carbon (TOC content from well log data compared with the measured TOC from the Rock-Eval pyrolysis in Fayoum-1X well is shown to match against the shale source rock but gives high values against the limestone source rock. For that, a new model is derived from well log data to calculate accurately the TOC content against the limestone source rock in the study area. The organic matter existing in Abu Roash (F member is fair to excellent and capable of generating a significant amount of hydrocarbons (oil prone produced from (mixed type I/II kerogen. The generation potential of kerogen in Abu Roash (E and G members and Betty formations is ranging from poor to fair, and generating hydrocarbons of oil and gas prone (mixed type II/III kerogen. Eventually, kerogen (type III of Kharita Formation has poor to very good generation potential and mainly produces gas. Thermal maturation of the measured %Ro, calculated %Ro model, Tmax and Production index (PI indicates that Abu Roash (F member exciting in the onset of oil generation, whereas Abu Roash (E and G members, Kharita and Betty formations entered the peak of oil generation.

  19. RADIATION SOURCE

    Science.gov (United States)

    Gow, J.D.

    1961-06-27

    An improved version of a crossed electric and magnetic field plasma producing and containing device of the general character disclosed in U. S. Patent No. 2,967,943 is described. This device employs an annular magnet encased within an anode and a pair of cathodes respectively coaxially spaced from the opposite ends of the anode to establish crossed field electron trapping regions adjacent the ends of the anode. The trapping regions are communicably connected through the throat of the anode and the electric field negatively increases in opposite axial directions from the center of the throat. Electrons are trapped within the two trapping regions and throat to serve as a source of intense ionization to gas introduced thereto, the ions in copious quantities being attracted to the cathodes to bombard neutron productive targets dlsposed - thereat.

  20. Sources manuscrites

    OpenAIRE

    2014-01-01

    I. SOURCES CONSULTÉES AUX ARCHIVES NATIONALES Série E 1. Minutes d’arrêts du Conseil, arrêts simples en finances 1602 : E 4a, E 4b. 1605 : E 8a, E 8b, E 8c-9a, E 9b, E 9c. 1608 : E 16a, E 16b, E 18a, E 18b, E 19a, E 19b. 1620 : E 63a E 63b, E 64a, E 64b-65a, E 65b. 1689 : E 579a, E 579b, E 580, E 581, E 582, E 583, E 584a, E 584b, E 585a, E 585b, E 586a, E 586b 1750 : E 1260a E 1260b, E 1261a E 1261b, E 1262a, E 1262b, E 1262e, E 1263a, E 1263b, E 1264a, E 1264b, E 1265a, E 1265b, E 1266a, E ...

  1. Dicty_cDB: VHE179 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Method and nucleic acids for the improved treatment of breast cell proliferative disorders. 46 1.3 1 DD20925...lytica Sheared DNA Entamoeba histolytica genomic, DNA sequence. 34 1.2 3 DD391900 |DD391900.1 Method and nucleic acids for the improv...ed treatment of breast cell proliferative disorders. 46 1.3 1 DD391626 |DD391626.1

  2. Dicty_cDB: VHE404 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available UENCE, 2 unordered pieces. 50 0.077 1 DX414156 |DX414156.1 SOYC248TH LargeInsertSoybeanGenLibBuild4 Glycine ...max genomic clone H12A17:Build4MTP4H23, genomic survey sequence. 48 0.30 1 EJ712224 |EJ712224.1 109295608356

  3. Dicty_cDB: VHE205 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 86 5', genomic survey sequence. 48 0.45 1 DX414156 |DX414156.1 SOYC248TH LargeInsertSoybeanGenLibBuild...4 Glycine max genomic clone H12A17:Build4MTP4H23, genomic survey sequence. 48 0.45 1 CE

  4. Dicty_cDB: VHE781 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ---ISKNLDSLVAKGEKDDPMRIIMKELDEFGPPPDIAADDDREVQLXLSNKFQKTIEEE LSPGESLISQTKGDGHXFTS*sskssrtkrpi**ttq Translated...---ISKNLDSLVAKGEKDDPMRIIMKELDEFGPPPDIAADDDREVQLXLSNKFQKTIEEE LSPGESLISQTKGDGHXFTS*sskssrtkrpi**ttq Frame C:

  5. Dicty_cDB: VHE730 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available YNYVYQSLSLWQHILHDMFKLWYF AEIDLLCGHRYQLSNTGQGLNRIQQCPNVGKIMHSIXRQTQKKVGDDWVGSSVIHLGDHN VPXSLVFIDKYTQXSRIXSPIV...IQQCPNVGKIMHSIXRQTQKKVGDDWVGSSVIHLGDHN VPXSLVFIDKYTQXSRIXSPIVLTIEYIPKITDPNLVAYIKNTFGGPQTLTKIILCDFFK HAFDGSGA

  6. Dicty_cDB: VHE288 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ATTTTTTAAAGAGACATA TATACAGTAGGAGGCATAAAT sequence update 2002.10.25 Translated Amino Acid sequence yhfkatikii*t*yl*ilynn...lnekknsdiiffketyiq*RINSFFFKKKEXQKK--- ---KFNHYHFKAXIKII*t*yl*ilynnlkk...diytvedk*fff*kkrixkkk--- ---KFNHYHFKAXIKII*t*yl*ilynnlkkrsnrdiiffketyiq*ea* Frame B: yhfkatikii*t*yl*ilynnln

  7. Dicty_cDB: VHE539 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ENCE, 12 unordered pieces. 40 0.14 4 ED075230 |ED075230.1 AUAC-aat92d06.b1 Ascaris... suum whole genome shotgun library (PMAJ_4 GSS) Ascaris suum genomic, genomic survey sequence. 48 0.33 1 AC

  8. Dicty_cDB: VHE489 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DY913902 |DY913902.1 CHAX9334.b1_L05.ab1 CHA(XYZ) common wild sunflower Helianthus annuus cDNA clone CHAX9334...DY913225 |DY913225.1 CHAX8579.b1_F09.ab1 CHA(XYZ) common wild sunflower Helianthus annuus cDNA clone CHAX8579...DY906162 |DY906162.1 CHAX1327.b1_N19.ab1 CHA(XYZ) common wild sunflower Helianthus annuus cDNA clone CHAX1327...DY903778 |DY903778.1 CHAX10048.b1_O15.ab1 CHA(XYZ) common wild sunflower Helianthus annuus cDNA clone CHAX10048...DY903739 |DY903739.1 CHAX10007.b1_M05.ab1 CHA(XYZ) common wild sunflower Helianthus annuus cDNA clone CHAX10007

  9. Dicty_cDB: VHE875 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DY907212 |DY907212.1 CHAX1940.b1_G05.ab1 CHA(XYZ) common wild sunflower Helianthus annuus cDNA clone CHAX1940...DY905253 |DY905253.1 CHAX11663.b1_N11.ab1 CHA(XYZ) common wild sunflower Helianthus annuus cDNA clone CHAX11663...DY910258 |DY910258.1 CHAX5220.b1_G10.ab1 CHA(XYZ) common wild sunflower Helianthus annuus cDNA clone CHAX5220

  10. Dicty_cDB: VHE717 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TDLGAGLTVGXCGLAAGXAIGXV GXSGVRAFGQQPKLYVXMMLILIXSEALGLXGLXIGILLSSVSDTYCPGQALVPLNSGNV IGK Translated Amino...TDLGAGLTVGXCGLAAGXAIGXV GXSGVRAFGQQPKLYVXMMLILIXSEALGLXGLXIGILLSSVSDTYCPGQALVPLNSGNV IGK Homology vs

  11. Dicty_cDB: VHE211 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available F143854.1 Sinantherina socialis 82 kD heat shock protein (hsp82) gene, partial cd...Naegleria gruberi strain ATCC 30224 heat shock protein 90 (HSP-90) gene, partial cds. 86 3e-46 7 AF143854 |A

  12. Dicty_cDB: VHE244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 038.1 Dictyostelium dimigraformum 18S rRNA gene, isolate AR5b. 1146 0.0 1 AM168039 |AM168039.1 Dictyostelium...1 Dictyostelium discoideum 18S rRNA gene, isolate NC4. 1154 0.0 1 AM168038 |AM168

  13. Dicty_cDB: VHE675 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1043 0.0 3 AY040329 |AY040329.1 Dictyostelium dimigraformum 18S ribosomal RNA gene, partial sequence. 1037 0....0 3 AM168038 |AM168038.1 Dictyostelium dimigraformum 18S rRNA gene, isolate AR5b. 1029 0.0 3 AM168033 |AM16

  14. Dicty_cDB: VHE436 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DKRVIGLIVRLSGENQFSLANIQEFRNAISFFKSKGKRTVAFTDSFCEAGSGIGRYYMAS IFHDVYMAPSGTLNLINTQYDFAFI--- ---KIVALGATLTGSIGVLTAKFNLKGMW...DKRVIGLIVRLSGENQFSLANIQEFRNAISFFKSKGKRTVAFTDSFCEAGSGIGRYYMAS IFHDVYMAPSGTLNLINTQYDFAFI--- ---ikslhwvqh*lvqlvf*llnsi*kec

  15. Dicty_cDB: VHE526 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *ssttttttnysiyns*ttrntkscrrtkesr tntntktitktrtnncysnss*ttrntkscrrtkesrtsfny*n**kcsnistitres*r c*ktsci*ksn*s*...RVIPTIXLDQDLLLAKEILELYTKKYTY DQLVKKQYPKGIDGSRLEEYLSDEEFISIFKITLAQFKTLS Frame B: ktts*tscsskitscstttnninl*tci

  16. Dicty_cDB: VHE349 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available THRIVLPPPEYFTFSTRLPFFLQPSSSMGLLVKGLLLENLSLEQLEEIFPSFTNIKEDLA LASQFWDTAFKIVTTIHNEGNIISKTIYEAFVEADKEGEK*xkl*lgkkfnqn...THRIVLPPPEYFTFSTRLPFFLQPSSSMGLLVKGLLLENLSLEQLEEIFPSFTNIKEDLA LASQFWDTAFKIVTTIHNEGNIISKTIYEAFVEADKEGEK*xkl*lgkkfnqn

  17. Dicty_cDB: VHE535 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FNNFNLTIKKGTTVALVGDSGGGKSSVIGLLERFYD PDEGEVYLDGTNIKEINIHSLRRNIGLVSQEPVLFANSIAENIRYGNENATMDQIIEACK TA...FNNFNLTIKKGTTVALVGDSGGGKSSVIGLLERFYD PDEGEVYLDGTNIKEINIHSLRRNIGLVSQEPVLFANSIAENIRYGNENATMDQIIEACK TA

  18. Dicty_cDB: VHE559 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dered pieces. 44 2.2 2 EL426587 |EL426587.1 CHCM6020.b1_G18.ab1 CHC(LMS) Texas blueweed Helianthus ciliaris ...cDNA clone CHCM6020, mRNA sequence. 44 2.7 1 EL422662 |EL422662.1 CHCM2239.b1_N08.ab1 CHC(LMS) Texas

  19. Dicty_cDB: VHE254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lnqfqwtqqfilkvqflingq niiiilkkptqevmlkplew*kqn*tqqqkfqnflqmilklhqih*vlcniqsylnitl...*fyh*fwv*v**lqslnqfqwtqqfilkvqflingq niiiilkkptqevmlkplew*kqn*tqqqkfqnflqmilklhqih*vlcniqsylnitlh qmlmhqhpkt

  20. Dicty_cDB: VHE759 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available iypcgnqfqnqmnvqlkfkyvyhm*mltlsfvv*iv rislkslerxlxikqxl Frame B: n*hahiikili*siknlylfiyniflrglqytikvly*ykkk--- ---wwwwwwxss...mwcy*srpkh*chnsnlmqwsnlksiessh*ygndgitksre ill*defpitlsidrnwssrs*ilfihveinsrik*tfs*nsstfttcrc*lyxssfk** eyl*nr*kxsxxss

  1. Dicty_cDB: VHE468 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available PVAIADRSIKQDLEQIRNNTKWFNSFNKDLLNWIKK*ii*fnkdl*iwifiknkiyli fiifllsfinnkinfqink Tr...YMLWRVGNEFKPVVWKYFTENFKSINETFNQNVLFAYMISFALSSKMTDQQLQQVEDFFK QNPVAIADRSIKQDLEQIRNNTKWFNSFNKDLLNWIKK*ii*fnkdl*iwifi

  2. Dicty_cDB: VHE103 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 002 2 BV682656 |BV682656.1 GBL031815 Ensembl chicken genome sequences browser, chromosome 3 Gallus gallus ST...S genomic, sequence tagged site. 42 0.002 2 BV682655 |BV682655.1 GBL031814 Ensembl chicken genome sequences browser

  3. Dicty_cDB: VHE708 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SM-cDNA Score E Sequences producing significant alignments: (bits) Value VHI178 (VHI178Q) /CSM/VH/VHI1-D/VHI...ducing significant alignments: (bits) Value N CP000444 |CP000444.1 Shewanella sp....age group 15. 42 6.8 1 dna update 2007. 8.23 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value

  4. Dicty_cDB: VHE317 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 00000055 Neocallimastix patriciarum ZAP II cDNA library Neocallimastix patriciarum cDNA, mRNA sequence. 44 7...8761. 50 1e-09 3 AR003643 |AR003643.1 Sequence 3 from patent US 5744343. 50 1e-09 3 EH431858 |EH431858.1 NPE

  5. Dicty_cDB: VHE691 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NA, mRNA sequence. 74 7e-14 2 CV682854 |CV682854.1 service30_G09_sjs2-14-10C09-T3 SJS Schistosoma japonicum ...oides sonorensis female serum-fed midgut cDNA Library Culicoides sonorensis cDNA, mRNA sequence. 113 4e-22 2 CV682907 |CV682907.1 ser...vice43_H06_sjs2-16-2B11-T3 SJS Schistosoma japonicum cDNA, mRNA sequence. 74 7e-14

  6. Dicty_cDB: VHE733 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A Dictyocaulus viviparus cDNA, mRNA sequence. 82 2e-18 2 BI863585 |BI863585.1 kx46a06.y1 Parastrongyloides t...richosuri FL pAMP1 v1 Chiapelli McCarter Parastrongyloides trichosuri cDNA 5' similar to SW:EF2_CAEEL P29691...BI863575.1 kx45h07.y1 Parastrongyloides trichosuri FL pAMP1 v1 Chiapelli McCarter Parastrongyloides trichosu...yloides trichosuri FL pAMP1 v1 Chiapelli McCarter Parastrongyloides...ri cDNA 5' similar to SW:EF2_CHICK Q90705 ELONGATION FACTOR 2 ;, mRNA sequence. 66 1e-14 3 BI451383 |BI451383.1 kx23e09.y1 Parastrong

  7. Dicty_cDB: VHE278 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 480.1 POSM0605022_K24F porcine skeletal muscle cDNA library (PoSM) Sus scrofa cDNA 5', mRNA sequence. 48 0.6.... 26 0.19 5 DQ121094 |DQ121094.1 Hucho taimen clone ZA-87 microsatellite sequence. 34 0.29 3 DV902480 |DV902

  8. Dicty_cDB: VHE534 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cerevisiae strain YJ... 97 3e-19 DQ116815_1( DQ116815 |pid:none) Saccharomyces cerevisiae strain YJ... 97 3e-19...cerevisiae strain YJ... 97 3e-19 DQ116823_1( DQ116823 |pid:none) Saccharomyces cerevisiae strain YJ... 97 5e-19

  9. Dicty_cDB: VHE411 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DDFREAYRWIGQNTADDARIMSWW DYGYQLSAMANRTVLVDNNTWNNSHIAQVGKAFASTEEDAYIQMKALDVDYVLVIFGGLT GYSSDDINKFLWMV...DDFREAYRWIGQNTADDARIMSWW DYGYQLSAMANRTVLVDNNTWNNSHIAQVGKAFASTEEDAYIQMKALDVDYVLVIFGGLT GYSSDDINKFLWMV

  10. Dicty_cDB: VHE353 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LSPWFASNTAMVTYKFA--- ---GQNTADDARIMSWWDYGYQLSAMANRTVLVDNNTWNNSHIAQVGKAFASTEEDAYIQ MKALGVDYVLVIFGGLTGYSSDDINKFLWMV...vitmvcikysngnl*icq--- ---GQNTADDARIMSWWDYGYQLSAMANRTVLVDNNTWNNSHIAQVGKAFASTEEDAYIQ MKALGVDYVLVIFGGLTGYSSDDINKFLWMV

  11. Dicty_cDB: VHE556 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TASLVHWSLNSLNI--- ---MXWWDYGYQLYAMANRTVLVDNXTWNNSHIAQVGKAFASXEEDAYIQMKALDVDYVL VIFGGLTGYSSDDINKFXWMV...qqv*figh*ih*il--- ---MXWWDYGYQLYAMANRTVLVDNXTWNNSHIAQVGKAFASXEEDAYIQMKALDVDYVL VIFGGLTGYSSDDINKFXWMV

  12. Dicty_cDB: VHE119 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e-130 10 AY954892 |AY954892.1 Cryptosporidium andersoni strain HenanZhzhca heat shock protein 70 gene...e-115 10 AY954893 |AY954893.1 Cryptosporidium andersoni strain changchunca heat shock protein 70 gene...e-114 10 AY954894 |AY954894.1 Cryptosporidium andersoni strain bjcm heat shock protein 70 gene, partial...123 e-113 9 DQ060426 |DQ060426.1 Cryptosporidium andersoni strain zzca heat shock protein 70-like gene,

  13. Dicty_cDB: VHE787 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available F*sfdvgssyhceaeftk cwivhpltrnvswv*tvvrqvsftxllsivcviva*fstrgtvmpdhwsvglfdkivtcr yhpldng*txisqnpf*krkpnalecec...pltrnvswv*tvvrqvsftxllsivcviva*fstrgtvmpdhwsvglfdkivtcr yhpldng*txisqnpf*krkpnalecec

  14. Dicty_cDB: VHE866 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available va*fstrgtvmpdhwsvglfdkivtcryh pldng*txisqnpf*krkpnalececcr*h*vvgggplstlnhminrcyxavsfrlxwwv dkl*fissfrstlrl* ...eftkcw ivhpltrnvxwv*tvvrqvsftxllsivcviva*fstrgtvmpdhwsvglfdkivtcryh pldng*txisqnpf*krkpnalececcr*h*vvgggplst

  15. Dicty_cDB: VHE311 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0.001 1 CN586696 |CN586696.1 USDA-FP_129768 Acyrthosiphon pisum, Pea Aphid Acyrthosiphon pisum cDNA clone WH...AP088_G02, mRNA sequence. 56 0.001 1 CN585146 |CN585146.1 USDA-FP_128216 Acyrthosiphon pisum, Pea Aphid Acyr...thosiphon pisum cDNA clone WHAP068_H04, mRNA sequence. 56 0.001 1 CN582483 |CN582483.1 USDA-FP_125546 Acyrthosiphon pisum, Pea Aphid

  16. Dicty_cDB: VHE448 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available romosome 2 map 6445720-6776760 strain AX4, complete sequence. 1415 0.0 1 ES220188 |ES220188.1 MpGnorm_ag5_O10 Myzus... persicae, tobacco lineage, aphid digestive tract normalized library Myzus

  17. Dicty_cDB: VHE653 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ytica genomic, DNA sequence. 80 1e-10 1 ES217666 |ES217666.1 MpFVN_ag1_H24 Myzus persicae, line F001, PLRV f...ree, whole female aphid library Myzus persicae cDNA clone MpFVN_ag1_H24, mRNA seq

  18. Dicty_cDB: VHE613 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available equence. 113 4e-29 3 EC389036 |EC389036.1 G08_G08gm3l15_pDNRf_491362 Myzus persic...ae, line G006, whole aphid library Myzus persicae cDNA clone G08_G08gm3l15_pDNRf_491362, mRNA sequence. 88 6...quence. 94 2e-28 4 EC390223 |EC390223.1 B06_B06nb2m12_pDNR-f_449359 Myzus persica...e, tobacco lineage raised on Nicotiana benthamiana, whole aphid library Myzus persicae cDNA clone B06_B06nb2...m12_pDNR-f_449359, mRNA sequence. 80 8e-27 3 ES224191 |ES224191.1 MpHnorm_ag5_C21 Myzus persicae, tobacco li

  19. Dicty_cDB: VHE677 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available eavy chain gene, complete cds. 874 0.0 5 EC388470 |EC388470.1 C06_C06gm2n11_pDNRf_491054 Myzus persicae, lin...e G006, whole aphid library Myzus persicae cDNA clone C06_C06gm2n11_pDNRf_491054, mRNA sequence. 32 1.5 3 ES

  20. Dicty_cDB: VHE841 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Plasmodium berghei strain ANKA cDNA clone:SG022534, salivary grand sporozoite 5'-EST. 48 0.17 1 DC225984 |DC225984...Plasmodium berghei strain ANKA cDNA clone:SG004351, salivary grand sporozoite 5'-EST. 48 0.17 1 DC225924 |DC225924...Plasmodium berghei strain ANKA cDNA clone:SG004163, salivary grand sporozoite 5'-EST. 48 0.17 1 BB978439 |BB978439

  1. Dicty_cDB: VHE114 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DQ243641 |DQ243641.1 Bombyx mori chromosome 18 microsatellite S1805-R sequence. 54 0.005 1 DQ243069 |DQ243069...|DQ243069.1 Bombyx mori chromosome 18 microsatellite S1805-F sequence. 54 0.005 1 AC136652 |AC136652.1 Rattus

  2. Dicty_cDB: VHE440 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VNTTCPNILATCP--- ---XMXEVEILADKXVIMNEGVMACNGNSXRXKSKYGEGYSVNIVAKSPESIPXVVEFVX XSIPGCKFMKQSA*qlnfgfpvti...pkyfsyms--- ---XMXEVEILADKXVIMNEGVMACNGNSXRXKSKYGEGYSVNIVAKSPESIPXVVEFVX XSIPGCKFMKQSA*qlnfgfpvtidxqiianffxq

  3. Dicty_cDB: VHE891 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AGTIS KLNVQRIINEPTAAAIAYGL--- ---DEYEDKMKALEAVVXPIMSKXYQEGGMPQGGGMPGGMSNDSPKSSNRQSRRIRLTEF FRGKHLYXIDFLKNNKLVXXXKTSH...AGTIS KLNVQRIINEPTAAAIAYGL--- ---DEYEDKMKALEAVVXPIMSKXYQEGGMPQGGGMPGGMSNDSPKSSNRQSRRIRLTEF FRGKHLYXIDFLKNNKLVXXXKTSH

  4. Dicty_cDB: VHE650 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available roducing significant alignments: (bits) Value N AB239909 |AB239909.1 Dictyostelium discoideum scdA gene for similar to CCAAT displace...ment protein, complete cds. 839 0.0 5 AZ544736 |AZ544736

  5. Dicty_cDB: VHE105 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available instar 3rd period (spinning cocoon) Rhynchosciara americana cDNA, mRNA sequence. 84 8e-13 2 CK807987 |CK807987...instar 3rd period (spinning cocoon) Rhynchosciara americana cDNA, mRNA sequence. 84 8e-13 2 CK808524 |CK808524...instar 3rd period (spinning cocoon) Rhynchosciara americana cDNA, mRNA sequence. 84 9e-13 2 CK808261 |CK808261...instar 3rd period (spinning cocoon) Rhynchosciara americana cDNA, mRNA sequence. 84 9e-13 2 dna update 2007

  6. Dicty_cDB: VHE446 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available red pieces. 46 1.4 1 AC189916 |AC189916.1 Colobus guereza clone CH272-286M14, WORKING DRAFT SEQUENCE, 4 unor...dered pieces. 46 1.4 1 AC189915 |AC189915.1 Colobus guereza clone CH272-193F5, WORKING DRAFT SEQUENCE, 4 uno...rdered pieces. 46 1.4 1 AC185560 |AC185560.2 Colobus guereza clone CH272-309J7, WORKING DRAFT SEQUENCE, 2 or

  7. Dicty_cDB: VHE229 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ltasptllepiylveitapenaiggiysvlnrr rgivigeerrigsplfsvkahlpvlesfgftadlrshtagqafpqcvfdhwasigvvnkd kkatevalatrkr...SFVGAFQWATKEGVVCDENMRGIRFNLYXX HPPH*daihrgggqiiptarrvlyaaeltasptllepiylveitapenaiggiysvlnrr rgivigeerrigsplfsvkahl

  8. Dicty_cDB: VHE670 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TASPNILEPIYLVEITAPENA IGGI*svlnrrrgivigeerrigspllsvkahlpvlesfgfiddlrshtagqafpqcvfd xwasigvvnkdkkaxevalaxrkrk...DAIHRGGGQIIPTARRVXYADELTASPNILEPIYLVEITAPENA IGGI*svlnrrrgivigeerrigspllsvkahlpvlesfgfiddlrshtagqafpqcvfd xw

  9. Dicty_cDB: VHE705 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ' EST. 48 0.014 2 EC826598 |EC826598.1 SME00003256 esmbsro2 Sawyeria marylandensis cDNA, mRNA sequence. 52 0....044 1 EC821651 |EC821651.1 SME00005388 esmbsro2 Sawyeria marylandensis cDNA, mRNA sequence. 52 0.044 1 EC82...0433 |EC820433.1 SME00003343 esmbsro2 Sawyeria marylandensis cDNA, mRNA sequence.

  10. Dicty_cDB: VHE757 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tion factor 2 mRNA, partial cds. 103 1e-30 3 EC822839 |EC822839.1 SME00001738 esmbsro2 Sawyeria marylandensi...s cDNA, mRNA sequence. 123 1e-29 2 EC824047 |EC824047.1 SME00009166 esmbsro2 Sawyeria marylandensis cDNA, mR...NA sequence. 123 1e-29 2 EC825843 |EC825843.1 SME00002609 esmbsro2 Sawyeria marylandensis cDNA, mRNA sequenc...e. 123 2e-29 2 EC825885 |EC825885.1 SME00004608 esmbsro2 Sawyeria marylandensis c

  11. Dicty_cDB: VHE869 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |CR341305.1 mte1-73F15FM1 BAC end, cultivar Jemalong A17 of Medicago truncatula. 40 0.009 2 EC826598 |EC826598.1 SME00003256 esmbsr...o2 Sawyeria marylandensis cDNA, mRNA sequence. 52 0.042 1 EC821651 |EC821651.1 SME00005388 esmbsr...C820433.1 SME00003343 esmbsro2 Sawyeria marylandensis cDNA, mRNA sequence. 52 0.042 1 AL929357 |AL929357.1 P...o2 Sawyeria marylandensis cDNA, mRNA sequence. 52 0.042 1 EC820433 |E

  12. Dicty_cDB: VHE716 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available g significant alignments: (bits) Value N EC826322 |EC826322.1 SME00006460 esmbsro2 Sawyeria marylandensis cD...NA, mRNA sequence. 62 8e-09 2 EC826295 |EC826295.1 SME00006464 esmbsro2 Sawyeria marylandensis cDNA, mRNA se...quence. 62 8e-09 2 EC825669 |EC825669.1 SME00008059 esmbsro2 Sawyeria marylandens...is cDNA, mRNA sequence. 62 8e-09 2 EC825555 |EC825555.1 SME00002316 esmbsro2 Sawyeria marylandensis cDNA, mR...NA sequence. 62 8e-09 2 EC825347 |EC825347.1 SME00004009 esmbsro2 Sawyeria marylandensis cDNA, mRNA sequence

  13. Dicty_cDB: VHE502 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cing significant alignments: (bits) Value N EC826598 |EC826598.1 SME00003256 esmbsr...o2 Sawyeria marylandensis cDNA, mRNA sequence. 52 0.037 1 EC821651 |EC821651.1 SME00005388 esmbsro2 Sawyer...ia marylandensis cDNA, mRNA sequence. 52 0.037 1 EC820433 |EC820433.1 SME00003343 esmbsro2 Sawyeria maryland

  14. Dicty_cDB: VHE590 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |DY889811.1 CeleSEQ6761 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY889772.1 CeleSEQ11980 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY890935.1 CeleSEQ7425 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY887441.1 CeleSEQ3766 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY888936.1 CeleSEQ6366 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone

  15. Dicty_cDB: VHE591 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |DY889811.1 CeleSEQ6761 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY889772.1 CeleSEQ11980 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY890935.1 CeleSEQ7425 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY887441.1 CeleSEQ3766 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY888936.1 CeleSEQ6366 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone

  16. Dicty_cDB: VHE316 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |DY889811.1 CeleSEQ6761 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY889772.1 CeleSEQ11980 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY890935.1 CeleSEQ7425 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY887441.1 CeleSEQ3766 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY888936.1 CeleSEQ6366 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone

  17. Dicty_cDB: VHE235 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |DY889811.1 CeleSEQ6761 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY889772.1 CeleSEQ11980 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY890935.1 CeleSEQ7425 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY887441.1 CeleSEQ3766 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY888936.1 CeleSEQ6366 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone

  18. Dicty_cDB: VHE301 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |DY889811.1 CeleSEQ6761 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY889772.1 CeleSEQ11980 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY890935.1 CeleSEQ7425 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY887441.1 CeleSEQ3766 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY888936.1 CeleSEQ6366 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone

  19. Dicty_cDB: VHE269 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |DY889811.1 CeleSEQ6761 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY889772.1 CeleSEQ11980 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY890935.1 CeleSEQ7425 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY887441.1 CeleSEQ3766 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY888936.1 CeleSEQ6366 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone

  20. Dicty_cDB: VHE247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |DY889811.1 CeleSEQ6761 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY889772.1 CeleSEQ11980 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY890935.1 CeleSEQ7425 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY887441.1 CeleSEQ3766 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY888936.1 CeleSEQ6366 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone

  1. Dicty_cDB: VHE439 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |DY889811.1 CeleSEQ6761 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY889772.1 CeleSEQ11980 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY890935.1 CeleSEQ7425 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY887441.1 CeleSEQ3766 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY888936.1 CeleSEQ6366 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone

  2. Dicty_cDB: VHE688 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |DY889811.1 CeleSEQ6761 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY889772.1 CeleSEQ11980 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY890935.1 CeleSEQ7425 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY887441.1 CeleSEQ3766 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY888936.1 CeleSEQ6366 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone

  3. Dicty_cDB: VHE192 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |DY893926.1 CeleSEQ13391 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY886427.1 CeleSEQ2079 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY892961.1 CeleSEQ12104 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY895351.1 CeleSEQ15152 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...DY885896 |DY885896.1 CeleSEQ991 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone

  4. Dicty_cDB: VHE435 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |DY889811.1 CeleSEQ6761 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY889772.1 CeleSEQ11980 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY890935.1 CeleSEQ7425 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY887441.1 CeleSEQ3766 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY888936.1 CeleSEQ6366 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone

  5. Dicty_cDB: VHE610 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |DY889811.1 CeleSEQ6761 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY889772.1 CeleSEQ11980 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY890935.1 CeleSEQ7425 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY887441.1 CeleSEQ3766 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY888936.1 CeleSEQ6366 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone

  6. Dicty_cDB: VHE855 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |DY889811.1 CeleSEQ6761 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY889772.1 CeleSEQ11980 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY890935.1 CeleSEQ7425 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY887441.1 CeleSEQ3766 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY888936.1 CeleSEQ6366 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone

  7. Dicty_cDB: VHE116 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |DY889811.1 CeleSEQ6761 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY889772.1 CeleSEQ11980 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY890935.1 CeleSEQ7425 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY887441.1 CeleSEQ3766 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY888936.1 CeleSEQ6366 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone

  8. Dicty_cDB: VHE438 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |DY886427.1 CeleSEQ2079 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY892961.1 CeleSEQ12104 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY895351.1 CeleSEQ15152 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY893926.1 CeleSEQ13391 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY886077.1 CeleSEQ1581 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone

  9. Dicty_cDB: VHE611 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |DY886427.1 CeleSEQ2079 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY892961.1 CeleSEQ12104 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY888809.1 CeleSEQ6138 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...DY885119 |DY885119.1 CeleSEQ310 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY885952.1 CeleSEQ1408 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone

  10. Dicty_cDB: VHE661 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |DY889811.1 CeleSEQ6761 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY889772.1 CeleSEQ11980 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY890935.1 CeleSEQ7425 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY887441.1 CeleSEQ3766 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY888936.1 CeleSEQ6366 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone

  11. Dicty_cDB: VHE347 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |DY889811.1 CeleSEQ6761 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY889772.1 CeleSEQ11980 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY890935.1 CeleSEQ7425 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY887441.1 CeleSEQ3766 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY888936.1 CeleSEQ6366 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone

  12. Dicty_cDB: VHE876 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |DY889811.1 CeleSEQ6761 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY889772.1 CeleSEQ11980 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY890935.1 CeleSEQ7425 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY887441.1 CeleSEQ3766 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY888936.1 CeleSEQ6366 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone

  13. Dicty_cDB: VHE595 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IEDNNFENTKHKNYKFLHDENRKEKLFRIEKKVMNCGGDR NISKEVCLEVINDYRMVSLWEEMHKGHIGRDATYGNYKTKYYNMGLYSFVSDAVDTCDIC...IEDNNFENTKHKNYKFLHDENRKEKLFRIEKKVMNCGGDR NISKEVCLEVINDYRMVSLWEEMHKGHIGRDATYGNYKTKYYNMGLYSFVSDAVDTCDIC

  14. Dicty_cDB: VHE761 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available re Of The Bovine Lysosomal A-Mannosidase Suggests A Novel Mechanism For Low Ph Ac...s], mRNA sequence. 52 3e-16 4 DT613126 |A Chain A, The Structure Of The Bovine Lysosomal A-Mannosidase Suggests A Novel Mechanism...tivation, mRNA sequence. 52 1e-16 4 DN816506 |A Chain A, The Structure Of The Bovine Lysosomal A-Mannosidase Suggests A Novel Mechani...sm For Low Ph Activation, mRNA sequence. 52 2e-16 4 CX633815 |CX633815.1 taj44a03.y

  15. Dicty_cDB: VHE809 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -13 3 DN814237 |A Chain A, The Structure Of The Bovine Lysosomal A-Mannosidase Suggests A Novel Mechanism Fo...Mannosidase Suggests A Novel Mechanism For Low Ph Activation, mRNA sequence. 52 3e-13 3 CV682907 |CV682907.1

  16. Dicty_cDB: VHE586 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ain A, The Structure Of The Bovine Lysosomal A-Mannosidase Suggests A Novel Mechanism...omal A-Mannosidase Suggests A Novel Mechanism For Low Ph Activation, mRNA sequence. 52 2e-13 3 CV682907 |CV6

  17. Dicty_cDB: VHE212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DN816506 |A Chain A, The Structure Of The Bovine Lysosomal A-Mannosidase Suggests A Novel Mechanism For Low ...26 |A Chain A, The Structure Of The Bovine Lysosomal A-Mannosidase Suggests A Novel Mechanism For Low Ph Act...hanism For Low Ph Activation, mRNA sequence. 52 2e-16 4 ...rensis cDNA, mRNA sequence. 117 2e-23 3 DN814237 |A Chain A, The Structure Of The Bovine Lysosomal A-Mannosidase Suggests A Novel Mec

  18. Dicty_cDB: VHE814 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mRNA sequence. 117 1e-23 3 DN814237 |A Chain A, The Structure Of The Bovine Lysosomal A-Mannosidase Suggests A Novel Mechanism...Chain A, The Structure Of The Bovine Lysosomal A-Mannosidase Suggests A Novel Mechanism For Low Ph Activatio...A, The Structure Of The Bovine Lysosomal A-Mannosidase Suggests A Novel Mechanism For Low Ph Activation, mRN

  19. Dicty_cDB: VHE734 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence vshikmptrfskhrksrgdvcagygrvgkhrkhpggrgnagglthhrinfdkyhpgyfgk lgmrhfhllrnqyhcptvslekiwtlvpesvrk...gacilva*ifytnq*i*IKKVIKFKKYXXK--- ---ITHHRIXFDKYHPGYFGXLGXRHFHLLRNQYHCPTVSLXKXWXLVPESVRKSLAAKN DGTAP...clylsclnilyesininkksn*i*kixxkk--- ---ITHHRIXFDKYHPGYFGXLGXRHFHLLRNQYHCPTVSLXKXWXLVPESVRKSLAAKN DGTAP...Frame B: vshikmptrfskhrksrgdvcagygrvgkhrkhpggrgnagglthhrinfdkyhpgyfgk lgmrhfhllrnqyhcptvslekiwtlvpesvrk

  20. Dicty_cDB: VHE195 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IPADKRALVYYTTTQYSTGSLINYCNLASNAVLEWPNDGVVDNEHTPLEGG VYLNNFKDWCHSDGMHSPQQTTNTEYNKEMSSNSVW*ttlyyffflynn...YCNLASNAVLEWPNDGVVDNEHTPLEGG VYLNNFKDWCHSDGMHSPQQTTNTEYNKEMSSNSVW*ttlyyffflynncnkidly*i Homology vs CSM-cDNA

  1. Dicty_cDB: VHE408 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available yky*i*qrnefqlcl vnyfvlffflynnviksiyik Frame B: ik*KKKKMRLLLLLILIITINFSYGVLTPKNLAGEASEFGSFNIPNPMDVAQSSDSSLFG ...wcrfmvkinssr*ksfsllynysi*ywffn*ll*f gfqcslrmak*wcc***aystrrwcifk*l*rlvsl*wyaltttn

  2. Dicty_cDB: VHE863 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 463 |pid:none) Aeluroscalabotes felinus mitochond... 33 3.8 BC151674_1( BC151674 ...lym... 33 2.9 CP000302_382( CP000302 |pid:none) Shewanella denitrificans OS217, ... 33 2.9 AB308463_2( AB308

  3. Dicty_cDB: VHE601 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1cs4-c11 5', mRNA sequence. 54 0.004 1 CF445234 |CF445234.1 EST681579 normalized cDNA library of onion...62 normalized cDNA library of onion Allium cepa cDNA clone ACAGF91, mRNA sequence. 50 0.063 1 AL428358 |AL42

  4. Dicty_cDB: VHE719 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e lsfiqngqhpksp*dslcqvqqthptqgypiqsw*tksfrtr*ktlrs*tirfwwsnqts fpqesqnyqkdrtqngmfmwlqettsfkem*tfrtrw*ekikers...liv *k*r*tykkkp Frame B: lsfiqngqhpksp*dslcqvqqthptqgypiqsw*tksfrtr*ktlrs*tirfwwsnqts fpqesqnyqkdrtqngmfmwlq...ettsfkem*tfrtrw*ekikersy*dvnlf*y**SRNK DKPTKKNHLKCPFIRKKK--- ---lsfiqngqhpksp*dslcqvqqthptqgypiqsw*tksfrtr*ktlrs*tirf

  5. Dicty_cDB: VHE128 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available HTFVIDNIKINNHRDDPEMVADLYHRIADNNKSNADTR-- - ---nsietidqrtepisnevrskvpnpkntststsryskits*hwstgnl*sifgn*pnk wcl*...lsigtn*ks*rkvlslflgscsealfinkglvenqssqefqeemeqgyiqltdlme slgvlppegsyyptlnsnsngtssnnnlsnssiygssnnfggsgspviqln

  6. Dicty_cDB: VHE602 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Producing process of transformed plants with male sterility, plants obtained using the same, and use thereof...Producing process of monocotyledon with male sterility, plants produced by the process ,and use thereof

  7. Dicty_cDB: VHE516 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 84.2 Dictyostelium discoideum chromosome 2 map 2567470-3108875 strain AX4, complete sequence. 1219 0.0 1 EF216683 |EF216683.1 Karl...nsketolase; Short=TK; ... 262 7e-69 EF216683_1( EF216683 |pid:none) Karlodinium m... 2e-67 EF216685_1( EF216685 |pid:none) Bigelowiella natans transketolase ... 256 5e-67 EF216682_1( EF216682 |pid:none) Karl

  8. Dicty_cDB: VHE310 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 84 6e-12 1 EF216683 |EF216683.1 Karlodinium micrum transketolase mRNA, partial cd...88( CP001032 |pid:none) Opitutus terrae PB90-1, complet... 294 2e-78 EF216683_1( EF216683 |pid:none) Karlodi..... 279 7e-74 EF216682_1( EF216682 |pid:none) Karlodinium micrum transketolase m... 277 3e-73 EF216685_1( EF2

  9. Dicty_cDB: VHE280 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available some 2 map 2567470-3108875 strain AX4, complete sequence. 460 0.0 3 EF216682 |EF216682.1 Karlodinium micrum .... 58 2e-04 1 EF216683 |EF216683.1 Karlodinium micrum transketolase mRNA, partial ...e; Short=TK; ... 160 2e-55 EF216683_1( EF216683 |pid:none) Karlodinium micrum transketolase m... 113 1e-31 A...J821796_1( AJ821796 |pid:none) Guillardia theta partial mRNA for ... 109 1e-30 EF216682_1( EF216682 |pid:none) Karl

  10. Dicty_cDB: VHE843 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s musculus clone RP23-162B9, LOW-PASS SEQUENCE SAMPLING. 32 0.19 2 AC198823 |AC198823.2 Nomascus leucogenys ...1 AC193710 |AC193710.2 Nomascus leucogenys leucogenys clone CH271-332I6, WORKING DRAFT SEQUENCE, 5 ordered p

  11. Dicty_cDB: VHE188 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DPLLIQAVNSMVSLM--- ---LSYAPKSDQLGSPKTTNEVQFGQKLPLIEIPSNNIARIFFRIASEAQPYQAQQVGIR FYSPAREAVVPATYSADAHSYTFTNKDAC...DPLLIQAVNSMVSLM--- ---LSYAPKSDQLGSPKTTNEVQFGQKLPLIEIPSNNIARIFFRIASEAQPYQAQQVGIR FYSPAREAVVPATYSADAHSYTFTNKDAC

  12. Dicty_cDB: VHE461 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KGLVESGQLEFINGGYCMNDEATTYYDDTIDQMTLGHQFLWENFGVMPKIGWHIDPFGHS ATQARIFGQLGFDAFIIGRMDYQDIEARLENKQMEFMWRSTQSTPENQVFTSVLRAMYCT...KGLVESGQLEFINGGYCMNDEATTYYDDTIDQMTLGHQFLWENFGVMPKIGWHIDPFGHS ATQARIFGQLGFDAFIIGRMDYQDIEARLENKQMEFMWRSTQSTPENQVFTSVLRAMYCT

  13. Radioactive Ion Sources

    OpenAIRE

    Stora, T

    2014-01-01

    This chapter provides an overview of the basic requirements for ion sources designed and operated in radioactive ion beam facilities. The facilities where these sources are operated exploit the isotope separation online (ISOL) technique, in which a target is combined with an ion source to maximize the secondary beam intensity and chemical element selectivity. Three main classes of sources are operated, namely surface-type ion sources, arc discharge-type ion sources, and finally radio-frequenc...

  14. Sources management; La gestion des sources

    Energy Technology Data Exchange (ETDEWEB)

    Mansoux, H.; Gourmelon; Scanff, P.; Fournet, F. [Institut de Radioprotection et de Surete Nucleaire, 92 - Fontenay-aux-Roses (France); Murith, Ch. [Office Federal de la SantePublique (Switzerland); Saint-Paul, N. [NOVAR, 75 - Paris (France); Colson, P. [Electricite de France (EDF/DPN), 93 - Saint-Denis (France); Jouve, A.; Feron, F. [Direction Generale de al Surete Nucleaire et de la Radioprotection, 75 - Paris (France); Haranger, D. [Electricite de France (EDF), 75 - Paris (France); Mathieu, P. [Institut Pasteur, 75 - Paris (France); Paycha, F. [CHU Louis Mourier, Unitede Medecine Nucleaire Assistance Publique-Hopitaux de Paris, 92 - Colombes (France); Israel, S. [CEGELEC NDT et la gestion des sources radioactives (France); Auboiroux, B. [APAVE (France); Chartier, P. [DRIRE de Basse-Normandie, Div. Surete Nucleaire et Radioprotection, 14 - Caen (France)

    2005-07-01

    Organized by the section of technical protection of the French society of radiation protection ( S.F.R.P.), these two days had for objective to review the evolution of the rule relative to the sources of ionising radiations 'sealed and unsealed radioactive sources, electric generators'. They addressed all the actors concerned by the implementation of the new regulatory system in the different sectors of activities ( research, medicine and industry): Authorities, manufacturers, and suppliers of sources, holders and users, bodies involved in the approval of sources, carriers. (N.C.)

  15. Mesoscale, Sources and Models: Sources for Nitrogen in the Atmosphere

    DEFF Research Database (Denmark)

    Hertel, O.

    1994-01-01

    Projektet Mesoscales, Sources and Models: Sources for Nitrogen in the Atmosphere er opdelt i 3 delprojekter: Sources - farmland, Sources - sea og Sources - biogenic nitrogen.......Projektet Mesoscales, Sources and Models: Sources for Nitrogen in the Atmosphere er opdelt i 3 delprojekter: Sources - farmland, Sources - sea og Sources - biogenic nitrogen....

  16. Radioactive Ion Sources

    CERN Document Server

    Stora, T

    2013-01-01

    This chapter provides an overview of the basic requirements for ion sources designed and operated in radioactive ion beam facilities. The facilities where these sources are operated exploit the isotope separation online (ISOL) technique, in which a target is combined with an ion source to maximize the secondary beam intensity and chemical element selectivity. Three main classes of sources are operated, namely surface-type ion sources, arc discharge-type ion sources, and finally radio-frequency-heated plasma-type ion sources.

  17. Modeling Frequency Comb Sources

    Directory of Open Access Journals (Sweden)

    Li Feng

    2016-06-01

    Full Text Available Frequency comb sources have revolutionized metrology and spectroscopy and found applications in many fields. Stable, low-cost, high-quality frequency comb sources are important to these applications. Modeling of the frequency comb sources will help the understanding of the operation mechanism and optimization of the design of such sources. In this paper,we review the theoretical models used and recent progress of the modeling of frequency comb sources.

  18. Automated source classification of new transient sources

    Science.gov (United States)

    Oertel, M.; Kreikenbohm, A.; Wilms, J.; DeLuca, A.

    2017-10-01

    The EXTraS project harvests the hitherto unexplored temporal domain information buried in the serendipitous data collected by the European Photon Imaging Camera (EPIC) onboard the ESA XMM-Newton mission since its launch. This includes a search for fast transients, missed by standard image analysis, and a search and characterization of variability in hundreds of thousands of sources. We present an automated classification scheme for new transient sources in the EXTraS project. The method is as follows: source classification features of a training sample are used to train machine learning algorithms (performed in R; randomForest (Breiman, 2001) in supervised mode) which are then tested on a sample of known source classes and used for classification.

  19. Nonpoint Source: Forestry

    Science.gov (United States)

    Sources of nonpoint source (NPS) pollution associated with forestry activities include removal of streamside vegetation, road construction and use, timber harvesting, and mechanical preparation for the planting of trees. Information resources.

  20. 2011 NATA - Emissions Sources

    Data.gov (United States)

    U.S. Environmental Protection Agency — This dataset includes all emissions sources that were modeled in the 2011 National Air Toxics Assessment (NATA), inlcluding point, nonpoint, and mobile sources, and...

  1. Spallation Neutron Source (SNS)

    Data.gov (United States)

    Federal Laboratory Consortium — The SNS at Oak Ridge National Laboratory is a next-generation spallation neutron source for neutron scattering that is currently the most powerful neutron source in...

  2. Sodium and Food Sources

    Science.gov (United States)

    ... Sources Top 10 Sources of Sodium How to Reduce Sodium Sodium Reduction Resources for Everyone Sodium Reduction Fact ... in processed food [PDF-867K] and how to reduce sodium. Sodium Reduction Is Challenging Types of food matter: ...

  3. Radioactive sources service

    CERN Multimedia

    2006-01-01

    Dear Users, A new web interface is now available for requesting radioactive sources: http://cern.ch/rp-sources/request This link is also available from the radioactive sources service main page: http://cern.ch/rp-sources From now on, please submit your request via the above interface, which has been developed in order to improve the service. Thank you in advance for your collaboration!

  4. Open Source Business Solutions

    Directory of Open Access Journals (Sweden)

    Ion IVAN

    2008-01-01

    Full Text Available This analyses the Open source movement. Open source development process and management is seen different from the classical point of view. This focuses on characteristics and software market tendencies for the main Open source initiatives. It also points out the labor market future evolution for the software developers.

  5. Aeroacoustic sources in phonation

    Science.gov (United States)

    Krane, Michael

    2010-11-01

    An analysis of the flow through a time-varying duct constriction is used to identify the primary aeroacoustic source mechanisms in human vocalization. The acoustic fields on either side of the constriction are matched using equations describing the flow through the constriction. The form of the resulting sound fields indicates that the primary source of sound is the unsteady aerodynamic drag due to separated flow, and that secondary sources arise from changes in glottis volume and the movement of the separation point. The source strengths are shown to depend on the incident sound field, calling into question the "source-filter" theory of voice production. A control volume analysis supports these results.

  6. Global Sourcing Flexibility

    DEFF Research Database (Denmark)

    Ørberg Jensen, Peter D.; Petersen, Bent

    2013-01-01

    sourcing flexibility. Here we draw on prior research in the fields of organizational flexibility, international business and global sourcing as well as case examples and secondary studies. In the second part of the paper, we discuss the implications of global sourcing flexibility for firm strategy...... and operations against the backdrop of the theory-based definition of the construct. We discuss in particular the importance of global sourcing flexibility for operational performance stability, and the trade-off between specialization benefits, emerging from location and service provider specialization, versus...... flexibility. We finally discuss implications for management and international business research, within and beyond the domain of global services sourcing....

  7. Noise Source Location Optimization

    Directory of Open Access Journals (Sweden)

    Ed O’Keefe

    1994-01-01

    Full Text Available This article describes a method to determine locations of noise sources that minimize modal coupling in complex acoustic volumes. Using the acoustic source scattering capabilities of the boundary element method, predictions are made of mode shape and pressure levels due to various source locations. Combining knowledge of the pressure field with a multivariable function minimization technique, the source location generating minimum pressure levels can be determined. The analysis also allows for an objective comparison of “best/worst” locations. The technique was implemented on a personal computer for the U.S. Space Station, predicting 5–10 dB noise reduction using optimum source locations.

  8. Nonlinear Source Emulator

    DEFF Research Database (Denmark)

    Nguyen-Duy, Khiem

    and remains the prime source of energy in non-terrestrial applications such as those in sky-explorers. However, a renewable energy source is expensive, bulky, and its performance is weather dependent, which make testing of downstream converters very difficult. As a result, a nonlinear source emulator (NSE...... generator unit. Because nonlinear energy sources come in different sizes and power rating, a single NSE may not be sufficient to simulate a wide selection of nonlinear sources. For this reason, the proposed NSE system is realized as modules. Stacking or connecting multiple modules in parallel will allow...

  9. Global Sourcing of Services

    DEFF Research Database (Denmark)

    Ørberg Jensen, Peter D.; Petersen, Bent

    2013-01-01

    The global sourcing of services offers high returns but is also associated with high risks. The extent to which firms engage in ‘transformational’ global sourcing (i.e., global sourcing implying considerable changes in the home organization) chiefly depends on management's comfort zone which......, in turn, is determined by managers' risk perceptions, risk tolerance, and ability to employ risk-reducing measures. Many firms move into transformational global sourcing more or less deliberately. However, as the human asset specificity of the global sourcing operation increases, managers find themselves...

  10. Neuromagnetic source reconstruction

    Energy Technology Data Exchange (ETDEWEB)

    Lewis, P.S.; Mosher, J.C. [Los Alamos National Lab., NM (United States); Leahy, R.M. [University of Southern California, Los Angeles, CA (United States)

    1994-12-31

    In neuromagnetic source reconstruction, a functional map of neural activity is constructed from noninvasive magnetoencephalographic (MEG) measurements. The overall reconstruction problem is under-determined, so some form of source modeling must be applied. We review the two main classes of reconstruction techniques-parametric current dipole models and nonparametric distributed source reconstructions. Current dipole reconstructions use a physically plausible source model, but are limited to cases in which the neural currents are expected to be highly sparse and localized. Distributed source reconstructions can be applied to a wider variety of cases, but must incorporate an implicit source, model in order to arrive at a single reconstruction. We examine distributed source reconstruction in a Bayesian framework to highlight the implicit nonphysical Gaussian assumptions of minimum norm based reconstruction algorithms. We conclude with a brief discussion of alternative non-Gaussian approachs.

  11. Wavelength sweepable laser source

    DEFF Research Database (Denmark)

    2014-01-01

    Wavelength sweepable laser source is disclosed, wherein the laser source is a semiconductor laser source adapted for generating laser light at a lasing wavelength. The laser source comprises a substrate, a first reflector, and a second reflector. The first and second reflector together defines...... and having a rest position, the second reflector and suspension together defining a microelectromechanical MEMS oscillator. The MEMS oscillator has a resonance frequency and is adapted for oscillating the second reflector on either side of the rest position.; The laser source further comprises electrical...... connections adapted for applying an electric field to the MEMS oscillator. Furthermore, a laser source system and a method of use of the laser source are disclosed....

  12. Point Pollution Sources Dimensioning

    Directory of Open Access Journals (Sweden)

    Georgeta CUCULEANU

    2011-06-01

    Full Text Available In this paper a method for determining the main physical characteristics of the point pollution sources is presented. It can be used to find the main physical characteristics of them. The main physical characteristics of these sources are top inside source diameter and physical height. The top inside source diameter is calculated from gas flow-rate. For reckoning the physical height of the source one takes into account the relation given by the proportionality factor, defined as ratio between the plume rise and physical height of the source. The plume rise depends on the gas exit velocity and gas temperature. That relation is necessary for diminishing the environmental pollution when the production capacity of the plant varies, in comparison with the nominal one.

  13. Pulsed spallation Neutron Sources

    Energy Technology Data Exchange (ETDEWEB)

    Carpenter, J.M. [Argonne National Lab., IL (United States)

    1994-12-31

    This paper reviews the early history of pulsed spallation neutron source development at Argonne and provides an overview of existing sources world wide. A number of proposals for machines more powerful than currently exist are under development, which are briefly described. The author reviews the status of the Intense Pulsed Neutron Source, its instrumentation, and its user program, and provides a few examples of applications in fundamental condensed matter physics, materials science and technology.

  14. Acoustic emission source modeling

    Directory of Open Access Journals (Sweden)

    Hora P.

    2010-07-01

    Full Text Available The paper deals with the acoustic emission (AE source modeling by means of FEM system COMSOL Multiphysics. The following types of sources are used: the spatially concentrated force and the double forces (dipole. The pulse excitation is studied in both cases. As a material is used steel. The computed displacements are compared with the exact analytical solution of point sources under consideration.

  15. Dynamic radioactive particle source

    Science.gov (United States)

    Moore, Murray E; Gauss, Adam Benjamin; Justus, Alan Lawrence

    2012-06-26

    A method and apparatus for providing a timed, synchronized dynamic alpha or beta particle source for testing the response of continuous air monitors (CAMs) for airborne alpha or beta emitters is provided. The method includes providing a radioactive source; placing the radioactive source inside the detection volume of a CAM; and introducing an alpha or beta-emitting isotope while the CAM is in a normal functioning mode.

  16. Advanced Photon Source (APS)

    Data.gov (United States)

    Federal Laboratory Consortium — The Advanced Photon Source (APS) at the U.S. Department of Energy's Argonne National Laboratoryprovides this nation's (in fact, this hemisphere's) brightest storage...

  17. Source SDK development essentials

    CERN Document Server

    Bernier, Brett

    2014-01-01

    The Source Authoring Tools are the pieces of software used to create custom content for games made with Valve's Source engine. Creating mods and maps for your games without any programming knowledge can be time consuming. These tools allow you to create your own maps and levels without the need for any coding knowledge. All the tools that you need to start creating your own levels are built-in and ready to go! This book will teach you how to use the Authoring Tools provided with Source games and will guide you in creating your first maps and mods (modifications) using Source. You will learn ho

  18. Classification of Ion Sources

    OpenAIRE

    Scrivens, R.

    2014-01-01

    In this chapter, the anatomy of an ion source is briefly described, as well as a few features of particle motion in electric and magnetic fields, and of particle dynamics and plasmas. Using this information, different types of ion sources are described, highlighting their main mode of operation.

  19. Open source community organization

    CSIR Research Space (South Africa)

    Molefe, Onkgopotse M

    2009-05-01

    Full Text Available Open Source communities (OSCs), sometimes referred to as virtual or online communities play a significant role in terms of the contribution they continue to make in producing user-friendly Open Source Software (OSS) solutions. Many projects have...

  20. Variability in GPS sources

    NARCIS (Netherlands)

    Jauncey, DL; King, EA; Bignall, HE; Lovell, JEJ; Kedziora-Chudczer, L; Tzioumis, AK; Tingay, SJ; Macquart, JP; McCulloch, PM

    2003-01-01

    Flux density monitoring data at 2.3 and 8.4 GHz is presented for a sample of 33 southern hemisphere GPS sources, drawn from the 2.7 GHz Parkes survey. This monitoring data, together with VLBI monitoring data, shows that a small fraction of these sources, similar to10%, vary. Their variability falls

  1. Creating Open Source Conversation

    Science.gov (United States)

    Sheehan, Kate

    2009-01-01

    Darien Library, where the author serves as head of knowledge and learning services, launched a new website on September 1, 2008. The website is built with Drupal, an open source content management system (CMS). In this article, the author describes how she and her colleagues overhauled the library's website to provide an open source content…

  2. Radiation Source Replacement Workshop

    Energy Technology Data Exchange (ETDEWEB)

    Griffin, Jeffrey W.; Moran, Traci L.; Bond, Leonard J.

    2010-12-01

    This report summarizes a Radiation Source Replacement Workshop in Houston Texas on October 27-28, 2010, which provided a forum for industry and researchers to exchange information and to discuss the issues relating to replacement of AmBe, and potentially other isotope sources used in well logging.

  3. PORTABLE SOURCE OF RADIOACTIVITY

    Science.gov (United States)

    Goertz, R.C.; Ferguson, K.R.; Rylander, E.W.; Safranski, L.M.

    1959-06-16

    A portable source for radiogiaphy or radiotherapy is described. It consists of a Tl/sup 170/ or Co/sup 60/ source mounted in a rotatable tungsten alloy plug. The plug rotates within a brass body to positions of safety or exposure. Provision is made for reloading and carrying the device safely. (T.R.H.)

  4. Radioactive Sources Service

    CERN Multimedia

    2007-01-01

    Please note that the radioactive sources service will be open by appointment only every Monday, Wednesday and Friday during CERN working hours (instead of alternate weeks). In addition, please note that our 2007 schedule is available on our web site: http://cern.ch/service-rp-sources

  5. Radioactive Sources Service

    CERN Multimedia

    2007-01-01

    Please note that the radioactive sources service will be open by appointment only every Monday, Wednesday and Friday during CERN working hours (instead of alternate weeks). In addition, please note that our 2007 schedule is available on our web site. http://cern.ch/service-rp-sources

  6. Neutron sources and applications

    Energy Technology Data Exchange (ETDEWEB)

    Price, D.L. [ed.] [Argonne National Lab., IL (United States); Rush, J.J. [ed.] [National Inst. of Standards and Technology, Gaithersburg, MD (United States)

    1994-01-01

    Review of Neutron Sources and Applications was held at Oak Brook, Illinois, during September 8--10, 1992. This review involved some 70 national and international experts in different areas of neutron research, sources, and applications. Separate working groups were asked to (1) review the current status of advanced research reactors and spallation sources; and (2) provide an update on scientific, technological, and medical applications, including neutron scattering research in a number of disciplines, isotope production, materials irradiation, and other important uses of neutron sources such as materials analysis and fundamental neutron physics. This report summarizes the findings and conclusions of the different working groups involved in the review, and contains some of the best current expertise on neutron sources and applications.

  7. Photonic crystal light source

    Science.gov (United States)

    Fleming, James G [Albuquerque, NM; Lin, Shawn-Yu [Albuquerque, NM; Bur, James A [Corrales, NM

    2004-07-27

    A light source is provided by a photonic crystal having an enhanced photonic density-of-states over a band of frequencies and wherein at least one of the dielectric materials of the photonic crystal has a complex dielectric constant, thereby producing enhanced light emission at the band of frequencies when the photonic crystal is heated. The dielectric material can be a metal, such as tungsten. The spectral properties of the light source can be easily tuned by modification of the photonic crystal structure and materials. The photonic crystal light source can be heated electrically or other heating means. The light source can further include additional photonic crystals that exhibit enhanced light emission at a different band of frequencies to provide for color mixing. The photonic crystal light source may have applications in optical telecommunications, information displays, energy conversion, sensors, and other optical applications.

  8. MEG source detection revisited

    Science.gov (United States)

    Lei, Tianhu; Roberts, Timothy P. L.

    2010-04-01

    Magnetoencephalography (MEG) is a multi-channel imaging technique. It uses an array composed of a large number of Superconducting Quantum Interference Device (SQUID) to measure the magnetic fields produced by the primary electric currents inside the brain. The measured spatio-temporal magnetic fields are then used to estimate the locations and strengths of these electric currents, often known as MEG sources. The estimated quantities are finally superimposed with the images generated by magnetic resonance imaging (MRI). The combination of information from MEG and MRI forms the magnetic source image (MSI). A great variety of signal processing and modeling techniques such as Inverse problem, Subspace approach, Independent component analysis (ICA) method, and Beamforming (BF) are used to estimate these sources. The first three approaches require the number of sources be detected a priori. Several shortcomings exist in the currently used methods for detecting the source number. First, the source detection is completed only after - not before - MSI is generated. Secondly, the detection methods are somewhat subjective. In order to provide a solution to the problem of detecting MEG source number for all these approaches, a novel method is developed. The covariance matrix of MEG measurements over all channels is decomposed into the signal and the noise subspaces. The number of sources is shown to be equal to the dimension of the signal subspace. The selection of this dimension is translated into a problem of determining the order of the underlying statistics. This statistical identification is resolved by using Information theoretic criteria which are derived based on Kullback-Leibler divergence. Because the method utilizes originally acquired MEG measurements and implemented before magnetic source images are generated, it is an entirely data-driven approach, more efficient, and less likely to be subjective.

  9. Open source development

    DEFF Research Database (Denmark)

    Ulhøi, John Parm

    2004-01-01

    This paper addresses innovations based on open source or non-proprietary knowledge. Viewed through the lens of private property theory, such agency appears to be a true anomaly. However, by a further turn of the theoretical kaleidoscope, we will show that there may be perfectly justifiable reasons...... for not regarding open source innovations as anomalies. The paper is based on three sectorial and generic cases of open source innovation, which is an offspring of contemporary theory made possible by combining elements of the model of private agency with those of the model of collective agency. In closing...

  10. Polarized electron sources

    Energy Technology Data Exchange (ETDEWEB)

    Prepost, R. [Univ. of Wisconsin, Madison, WI (United States)

    1994-12-01

    The fundamentals of polarized electron sources are described with particular application to the Stanford Linear Accelerator Center. The SLAC polarized electron source is based on the principle of polarized photoemission from Gallium Arsenide. Recent developments using epitaxially grown, strained Gallium Arsenide cathodes have made it possible to obtain electron polarization significantly in excess of the conventional 50% polarization limit. The basic principles for Gallium and Arsenide polarized photoemitters are reviewed, and the extension of the basic technique to strained cathode structures is described. Results from laboratory measurements of strained photocathodes as well as operational results from the SLAC polarized source are presented.

  11. Vacuum Arc Ion Sources

    CERN Document Server

    Brown, I.

    2013-12-16

    The vacuum arc ion source has evolved into a more or less standard laboratory tool for the production of high-current beams of metal ions, and is now used in a number of different embodiments at many laboratories around the world. Applications include primarily ion implantation for material surface modification research, and good performance has been obtained for the injection of high-current beams of heavy-metal ions, in particular uranium, into particle accelerators. As the use of the source has grown, so also have the operational characteristics been improved in a variety of different ways. Here we review the principles, design, and performance of vacuum arc ion sources.

  12. EPA Sole Source Aquifers

    Data.gov (United States)

    U.S. Environmental Protection Agency — Information on sole source aquifers (SSAs) is widely used in assessments under the National Environmental Policy Act and at the state and local level. A national...

  13. Galactic Superluminal Sources

    Science.gov (United States)

    Harmon, B. Alan

    1998-01-01

    A new class of X-ray sources was clearly established with the discovery of highly relativistic radio jets from the two galactic sources GRS 1915+105 and GRO Jl655-40. Both of these objects have given us a broader view of black holes and the formation of jets, yet they also show the complexity of the accretion environment near relativistic objects. The fast apparent motion of the jets, their luminosity and variability, their high energy spectrum, and approximately scaling to the behavior of active galactic nuclei, certainly warrant the description "microquasar". A review of the observational data on these sources is presented, and where we stand on a physical picture of GRS 1915+105 and GRO J165540 as taken from multi-wavelength studies is also discussed. Other galactic sources which share some of the properties of the microquasars, and what to look for as a high energy "signature" in future observations is also discussed.

  14. Environmental Data Sources

    Data.gov (United States)

    Kansas Data Access and Support Center — This database includes gauging stations, climatic data centers, and storet sites. The accuracy of the locations is dependent on the source data for each of the...

  15. Advanced Light Source (ALS)

    Data.gov (United States)

    Federal Laboratory Consortium — The Advanced Light Source (ALS), a world leader in soft x-ray science, generates light in the wavelengths needed for examining the atomic and electronic structure of...

  16. Current Source Logic Gate

    Science.gov (United States)

    Krasowski, Michael J. (Inventor); Prokop, Norman F. (Inventor)

    2017-01-01

    A current source logic gate with depletion mode field effect transistor ("FET") transistors and resistors may include a current source, a current steering switch input stage, and a resistor divider level shifting output stage. The current source may include a transistor and a current source resistor. The current steering switch input stage may include a transistor to steer current to set an output stage bias point depending on an input logic signal state. The resistor divider level shifting output stage may include a first resistor and a second resistor to set the output stage point and produce valid output logic signal states. The transistor of the current steering switch input stage may function as a switch to provide at least two operating points.

  17. Public Water Sources

    Data.gov (United States)

    Vermont Center for Geographic Information — This GIS layer consists of the geographic location of active and inactive public (Community, non-transient non-community and transient non-community) water sources...

  18. Calcium source (image)

    Science.gov (United States)

    Getting enough calcium to keep bones from thinning throughout a person's life may be made more difficult if that person has ... as a tendency toward kidney stones, for avoiding calcium-rich food sources. Calcium deficiency also effects the ...

  19. Nonpoint Source: Agriculture

    Science.gov (United States)

    Agricultural runoff as a nonpoint source category of pollution. Resouces to learn more a bout conservation practices to reduce water quality impacts from storm water run off and ground water infiltration

  20. Hubble Source Catalog

    Science.gov (United States)

    Lubow, S.; Budavári, T.

    2013-10-01

    We have created an initial catalog of objects observed by the WFPC2 and ACS instruments on the Hubble Space Telescope (HST). The catalog is based on observations taken on more than 6000 visits (telescope pointings) of ACS/WFC and more than 25000 visits of WFPC2. The catalog is obtained by cross matching by position in the sky all Hubble Legacy Archive (HLA) Source Extractor source lists for these instruments. The source lists describe properties of source detections within a visit. The calculations are performed on a SQL Server database system. First we collect overlapping images into groups, e.g., Eta Car, and determine nearby (approximately matching) pairs of sources from different images within each group. We then apply a novel algorithm for improving the cross matching of pairs of sources by adjusting the astrometry of the images. Next, we combine pairwise matches into maximal sets of possible multi-source matches. We apply a greedy Bayesian method to split the maximal matches into more reliable matches. We test the accuracy of the matches by comparing the fluxes of the matched sources. The result is a set of information that ties together multiple observations of the same object. A byproduct of the catalog is greatly improved relative astrometry for many of the HST images. We also provide information on nondetections that can be used to determine dropouts. With the catalog, for the first time, one can carry out time domain, multi-wavelength studies across a large set of HST data. The catalog is publicly available. Much more can be done to expand the catalog capabilities.

  1. Diversification of energy sources

    Science.gov (United States)

    1975-01-01

    The concept of energy source diversification was introduced as a substitution conservation action. The current status and philosophy behind a diversification program is presented in the context of a national energy policy. Advantages, disadvantages (constraints), and methods of implementation for diversification are discussed. The energy source systems for diversification are listed and an example impact assessment is outlined which deals with the water requirements of the specific energy systems.

  2. EEG Source Analysis

    OpenAIRE

    Congedo, Marco

    2013-01-01

    Electroencephalographic data recorded on the human scalp can be modeled as a linear mixture of underlying dipolar source generators. The characterization of such generators is the aim of several families of signal processing methods. In this HDR we consider in several details three of such families, namely 1) EEG distributed inverse solutions, 2) diagonalization methods, including spatial filtering and blind source separation and 3) Riemannian geometry. We highlight our contributions in each ...

  3. Characteristics and locations of sources

    Energy Technology Data Exchange (ETDEWEB)

    Lahtinen, J.; Poellaenen, R.; Toivonen, H. [Finnish Centre for Radiation and Nuclear Safety, Helsinki (Finland)

    1997-12-31

    Ten artificial radiation sources were placed in the terrain in order to test the capability of airborne measuring teams to detect them. One of the sources was a line source, others were point sources (three of them collimated). The radionuclides used in the sources were {sup 60}Co, {sup 137}Cs, {sup 99m}Tc and {sup 192}Ir. The source activities ranged from about 26 MBq (one of the cobalt sources) to 0.56 TBq (iridium). (au).

  4. Open source posturography.

    Science.gov (United States)

    Rey-Martinez, Jorge; Pérez-Fernández, Nicolás

    2016-12-01

    The proposed validation goal of 0.9 in intra-class correlation coefficient was reached with the results of this study. With the obtained results we consider that the developed software (RombergLab) is a validated balance assessment software. The reliability of this software is dependent of the used force platform technical specifications. Develop and validate a posturography software and share its source code in open source terms. Prospective non-randomized validation study: 20 consecutive adults underwent two balance assessment tests, six condition posturography was performed using a clinical approved software and force platform and the same conditions were measured using the new developed open source software using a low cost force platform. Intra-class correlation index of the sway area obtained from the center of pressure variations in both devices for the six conditions was the main variable used for validation. Excellent concordance between RombergLab and clinical approved force platform was obtained (intra-class correlation coefficient =0.94). A Bland and Altman graphic concordance plot was also obtained. The source code used to develop RombergLab was published in open source terms.

  5. Nutrition information sources.

    Science.gov (United States)

    Farrell, L

    1972-10-01

    Medical personnel and medical librarians may tend to think of nutrition in medical terms and to forget its interdisciplinary aspects. For this reason, it is desirable for medical librarians to become familiar with a variety of sources of information on the composition of foods, nutrient values, food additives, and food protection. Many of these are government publications from such agencies as the U.S. Department of Agriculture, the National Research Council, and the Food and Agriculture Organization. Less familiar sources include nutrition materials from state agricultural experiment stations and extension services and important data published in a wide range of scientific or agricultural journals, which may be located through Nutrition Abstracts and Reviews, Food Science and Technology Abstracts, and the Bibliography of Agriculture. Sources of current information on nutrition research in progress include the Department of Agriculture's Current Research Information System (CRIS) and selective listings from the Smith-sonian Information Exchange.

  6. Dual source heat pump

    Science.gov (United States)

    Ecker, Amir L.; Pietsch, Joseph A.

    1982-01-01

    What is disclosed is a heat pump apparatus for conditioning a fluid characterized by a fluid handler and path for circulating the fluid in heat exchange relationship with a refrigerant fluid; at least two refrigerant heat exchangers, one for effecting heat exchange with the fluid and a second for effecting heat exchange between refrigerant and a heat exchange fluid and the ambient air; a compressor for efficiently compressing the refrigerant; at least one throttling valve for throttling liquid refrigerant; a refrigerant circuit; refrigerant; a source of heat exchange fluid; heat exchange fluid circulating device and heat exchange fluid circuit for circulating the heat exchange fluid in heat exchange relationship with the refrigerant; and valves or switches for selecting the heat exchangers and direction of flow of the refrigerant therethrough for selecting a particular mode of operation. The heat exchange fluid provides energy for defrosting the second heat exchanger when operating in the air source mode and also provides a alternate source of heat.

  7. INEEL Source Water Assessment

    Energy Technology Data Exchange (ETDEWEB)

    Sehlke, Gerald

    2003-03-01

    The Idaho National Engineering and Environmental Laboratory (INEEL) covers approximately 890 mi2 and includes 12 public water systems that must be evaluated for Source water protection purposes under the Safe Drinking Water Act. Because of its size and location, six watersheds and five aquifers could potentially affect the INEEL’s drinking water sources. Based on a preliminary evaluation of the available information, it was determined that the Big Lost River, Birch Creek, and Little Lost River Watersheds and the eastern Snake River Plain Aquifer needed to be assessed. These watersheds were delineated using the United States Geologic Survey’s Hydrological Unit scheme. Well capture zones were originally estimated using the RESSQC module of the Environmental Protection Agency’s Well Head Protection Area model, and the initial modeling assumptions and results were checked by running several scenarios using Modflow modeling. After a technical review, the resulting capture zones were expanded to account for the uncertainties associated with changing groundwater flow directions, a thick vadose zone, and other data uncertainties. Finally, all well capture zones at a given facility were merged to a single wellhead protection area at each facility. A contaminant source inventory was conducted, and the results were integrated with the well capture zones, watershed and aquifer information, and facility information using geographic information system technology to complete the INEEL’s Source Water Assessment. Of the INEEL’s 12 public water systems, three systems rated as low susceptibility (EBR-I, Main Gate, and Gun Range), and the remainder rated as moderate susceptibility. No INEEL public water system rated as high susceptibility. We are using this information to develop a source water management plan from which we will subsequently implement an INEEL-wide source water management program. The results are a very robust set of wellhead protection areas that will

  8. Valorization of ECR sources

    CERN Document Server

    2003-01-01

    One way to limit the size of particle accelerators is to use intense multicharged ion beams. Thus, compact, low cost and reliable sources have been developed. These sources are based on the electron cyclotron resonance (ECR) principle and need no cathode nor filament. A prototype named Nanogan has been developed for the Spiral project of the Ganil accelerator (Caen, France). Then, this technology has been transferred toward other research domains and industrial applications, like the ion implantation in micro-electronics components. (J.S.)

  9. Galactic Superluminal Sources

    OpenAIRE

    Harmon, B. A.

    1998-01-01

    A new class of X-ray sources was clearly established with the discovery of highly relativistic radio jets from the galactic sources GRS 1915+105 and GRO J1655-40. Both of these objects have given us a broader view of black holes and the formation of jets, yet they also show the complexity of the accretion environment near relativistic objects. The fast apparent motion of the jets, their luminosity and variability, their high energy spectrum, and approximate scaling to the behavior of active g...

  10. Open source molecular modeling.

    Science.gov (United States)

    Pirhadi, Somayeh; Sunseri, Jocelyn; Koes, David Ryan

    2016-09-01

    The success of molecular modeling and computational chemistry efforts are, by definition, dependent on quality software applications. Open source software development provides many advantages to users of modeling applications, not the least of which is that the software is free and completely extendable. In this review we categorize, enumerate, and describe available open source software packages for molecular modeling and computational chemistry. An updated online version of this catalog can be found at https://opensourcemolecularmodeling.github.io. Copyright © 2016 The Author(s). Published by Elsevier Inc. All rights reserved.

  11. Intense XUV Radiation Sources.

    Science.gov (United States)

    1987-09-30

    eisl dilos energ-- NU perra dIIj i lj a tpIs- e firc linte, or otiher subs ~true! L reS is ouhd aIppear It dile con1- t ak inrg the spectra. 11nut~ %sere...dependence of the VUV output vs laser the imaged source relative to the spectrograph slit, the energy for the Ng:YAG laser. Analysis of the depen...Mcllrath and M.L. Ginter, "Rare-Earth Plasma Light Source for VUV Applications" Appl. Opt. 20, 3043 (1981). 7. Standard Methods of Water Analysis , 6th

  12. Hahmosuunnittelu Source Engine -pelimoottorille

    OpenAIRE

    Korpilaakso, Joonas

    2010-01-01

    Tämän opinnäytetyön tarkoitus oli tutkia videopelien hahmosuunnittelua nykypäivänä ja selvittää mitä eri työvaiheita hahmosuunnittelu pitää sisällään sekä suunnitella ja toteuttaa pelihahmo Source Engine-pelimoottorille. Tutkimusten pohjalta suunniteltiin pelihahmo Valve Softwaren kehittämälle Source Engine-pelimoottorille. Hahmo suunniteltiin Half-Life 2-pelin modifikaatioon ”The Keep”, jonka tarinan ympärille hahmo rakennettiin. Työn tavoitteena oli suunnitella ja toteuttaa pelihahmo, joka ...

  13. Sources of Financial Sociability

    DEFF Research Database (Denmark)

    Thompson, Grahame

    2011-01-01

    This article investigates the sources of sociability in modern financial systems as a prelude to assessing the prospects for financial regulation. Three sources are identified: sociality dependent upon contract, upon relational interdependency, and upon the operation of will and passion. Each...... of the article which is to explore further the nature of ‘irrationality’ as manifest in financial crises. When the contours of both these aspects of financial calculation have been elaborated, the article moves on to consider how they might shape regulatory responses to the seeming inevitability of financial...

  14. Y-source inverter

    DEFF Research Database (Denmark)

    Siwakoti, Yam P.; Town, Graham; Loh, Poh Chiang

    2014-01-01

    This paper introduces a new 3-phase Y-source inverter whose gain is presently not matched by classical impedance-network-based inverters operating at the same duty ratio. The proposed network uses a tightly coupled transformer with three windings. By squeezing the shoot-through range while keeping...... higher boost, the inverter can operate at a higher modulation index, thereby minimizing switching device stress and providing better output power quality. In addition, the inverter has more degrees of freedom for setting the voltage gain and modulation index than other classical impedance-source networks...

  15. International Entrepreneurship and Sourcing

    DEFF Research Database (Denmark)

    Servais, Per; Zucchella, Antonella; Palamera, Giada

    2006-01-01

    This contribution focuses on international sourcing as an entrepreneurial act and aims at demonstrating that it is actually at the core of internationalization processes of small firms, both established and international new ventures. Another issue of this research is to understand how these firm...

  16. New sources of radiation

    Energy Technology Data Exchange (ETDEWEB)

    Schimmerling, W.

    1979-09-01

    An attempt is made to select examples of radiation sources whose application may make new or unconventional demands on radiation protection and dosimetry. A substantial body of knowledge about high energy facilities exists and, partly for this reason, the great high energy accelerators are mentioned only briefly.

  17. Open Source Software Acquisition

    DEFF Research Database (Denmark)

    Holck, Jesper; Kühn Pedersen, Mogens; Holm Larsen, Michael

    2005-01-01

    Lately we have seen a growing interest from both public and private organisations to adopt OpenSource Software (OSS), not only for a few, specific applications but also on a more general levelthroughout the organisation. As a consequence, the organisations' decisions on adoption of OSS arebecoming...

  18. Alternative Energy Sources

    CERN Document Server

    Michaelides, Efstathios E (Stathis)

    2012-01-01

    Alternative Energy Sources is designed to give the reader, a clear view of the role each form of alternative energy may play in supplying the energy needs of the human society in the near and intermediate future (20-50 years).   The two first chapters on energy demand and supply and environmental effects, set the tone as to why the widespread use of alternative energy is essential for the future of human society. The third chapter exposes the reader to the laws of energy conversion processes, as well as the limitations of converting one energy form to another. The sections on exergy give a succinct, quantitative background on the capability/potential of each energy source to produce power on a global scale. The fourth, fifth and sixth chapters are expositions of fission and fusion nuclear energy. The following five chapters (seventh to eleventh) include detailed descriptions of the most common renewable energy sources – wind, solar, geothermal, biomass, hydroelectric – and some of the less common sources...

  19. Electrochemical Power Sources

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 7. Electrochemical Power Sources - Rechargeable Batteries. A K Shukla S K Martha. General Article Volume 6 Issue 7 July 2001 pp 52-63. Fulltext. Click here to view fulltext PDF. Permanent link:

  20. Open-Source Colorimeter

    Science.gov (United States)

    Anzalone, Gerald C.; Glover, Alexandra G.; Pearce, Joshua M.

    2013-01-01

    The high cost of what have historically been sophisticated research-related sensors and tools has limited their adoption to a relatively small group of well-funded researchers. This paper provides a methodology for applying an open-source approach to design and development of a colorimeter. A 3-D printable, open-source colorimeter utilizing only open-source hardware and software solutions and readily available discrete components is discussed and its performance compared to a commercial portable colorimeter. Performance is evaluated with commercial vials prepared for the closed reflux chemical oxygen demand (COD) method. This approach reduced the cost of reliable closed reflux COD by two orders of magnitude making it an economic alternative for the vast majority of potential users. The open-source colorimeter demonstrated good reproducibility and serves as a platform for further development and derivation of the design for other, similar purposes such as nephelometry. This approach promises unprecedented access to sophisticated instrumentation based on low-cost sensors by those most in need of it, under-developed and developing world laboratories. PMID:23604032

  1. Open Source in Education

    Science.gov (United States)

    Lakhan, Shaheen E.; Jhunjhunwala, Kavita

    2008-01-01

    Educational institutions have rushed to put their academic resources and services online, beginning the global community onto a common platform and awakening the interest of investors. Despite continuing technical challenges, online education shows great promise. Open source software offers one approach to addressing the technical problems in…

  2. Evaluating Open Source Portals

    Science.gov (United States)

    Goh, Dion; Luyt, Brendan; Chua, Alton; Yee, See-Yong; Poh, Kia-Ngoh; Ng, How-Yeu

    2008-01-01

    Portals have become indispensable for organizations of all types trying to establish themselves on the Web. Unfortunately, there have only been a few evaluative studies of portal software and even fewer of open source portal software. This study aims to add to the available literature in this important area by proposing and testing a checklist for…

  3. Oceanography Information Sources 70.

    Science.gov (United States)

    Vetter, Richard C.

    This booklet lists oceanography information sources in the first section under industries, laboratories and departments of oceanography, and other organizations which can provide free information and materials describing programs and activities. Publications listed in the second section include these educational materials: bibliographies, career…

  4. Accessing vs Sourcing Knowledge

    DEFF Research Database (Denmark)

    Awate, Snehal; Larsen, Marcus M.; Mudambi, Ram

    2015-01-01

    to get on par with industry leaders. An in-depth comparison of knowledge flows reveals that within AMNEs, headquarters often serves the primary source of knowledge for R&D subsidiaries. In contrast, within EMNEs, headquarters accesses knowledge from R&D subsidiaries in advanced economies for innovation...

  5. OMNIDIRECTIONAL SOUND SOURCE

    DEFF Research Database (Denmark)

    1996-01-01

    A sound source comprising a loudspeaker (6) and a hollow coupler (4) with an open inlet which communicates with and is closed by the loudspeaker (6) and an open outlet, said coupler (4) comprising rigid walls which cannot respond to the sound pressures produced by the loudspeaker (6). According...

  6. Open Source Physics

    CERN Document Server

    Wee, Loo Kang

    2013-01-01

    Open Source Physics (Brown, 2012; Christian, 2010; Esquembre, 2012; Hwang, 2010) empowers teachers and students to create and use these free tools with the associated intellectual property rights given to customise (Wee & Mak, 2009) the computer models/tools to suit their teaching and learning needs. Open Source Physics (OSP) focuses on design of computer models, such as Easy Java Simulations (EJS) and the use of video modeling and analysis (Tracker). They allow students to investigate, explore and analyse data which is either real or simulated. The OSP approach helps users overcome barriers in creating, using and scaling up meaningful ICT use in education. In Singapore, teachers and students have created or customised existing computer models to design and re-purpose EJS models to suit their context and learning needs. Tracker tools allow students to analyse different aspects of a physics phenomena to deepen their understanding of abstract physics concepts. Using Tracker, students record the motion of ob...

  7. Calibrated vapor generator source

    Science.gov (United States)

    Davies, J.P.; Larson, R.A.; Goodrich, L.D.; Hall, H.J.; Stoddard, B.D.; Davis, S.G.; Kaser, T.G.; Conrad, F.J.

    1995-09-26

    A portable vapor generator is disclosed that can provide a controlled source of chemical vapors, such as, narcotic or explosive vapors. This source can be used to test and calibrate various types of vapor detection systems by providing a known amount of vapors to the system. The vapor generator is calibrated using a reference ion mobility spectrometer. A method of providing this vapor is described, as follows: explosive or narcotic is deposited on quartz wool, placed in a chamber that can be heated or cooled (depending on the vapor pressure of the material) to control the concentration of vapors in the reservoir. A controlled flow of air is pulsed over the quartz wool releasing a preset quantity of vapors at the outlet. 10 figs.

  8. Photon Sources for Brachytherapy

    Science.gov (United States)

    Rijnders, Alex

    As introduction a short overview of the history of brachytherapy (BT) is given, with a focus on the evolution in the photon sources that have been used over the years. A major step in this evolution was the introduction of the automatic afterloading devices, which could be compared to the introduction of linear accelerators in external beam radiotherapy (EBRT). The modern afterloaders allow for optimization of the dose delivery and the use of different dose rates (low dose rate, high dose rate and pulsed dose rate) in function of tumor biology and patient comfort. Still today new sources are under investigation, and these developments together with the improvements in treatment planning and treatment techniques will enforce the role and place of BT as a valuable alternative for or supplementary to EBRT.

  9. The Hubble Source Catalog

    Science.gov (United States)

    Lubow, Stephen H.

    2017-06-01

    The Hubble Source Catalog (HSC) is designed to enhance the science obtained from the Hubble Space Telescope by combining the tens of thousands of visit-based source lists in the Hubble Legacy Archive (HLA) across filters and detectors into a single master catalog. The catalog contains data from the major Hubble imaging instruments: Wide Field Planetary Camera 2 (WFPC2), Advanced Camera for Surveys (ACS), and Wide Field Camera 3 (WFC3). It is based on cross matching and astrometry algorithms developed by Budavari & Lubow (2012). We recently released Version 2 that is three times the size of Version 1 and includes some new features. The catalog can be accessed through a variety of interfaces (see http://archive.stsci.edu/hst/hsc/). The HSC provides descriptions of astronomical objects involving multiple wavelengths and epochs. High relative positional accuracy of objects is achieved across the Hubble images, often with sub-pixel precision of a few milliarcseconds.

  10. Synchrotron radiation sources

    Energy Technology Data Exchange (ETDEWEB)

    van Steenbergen, A.

    1979-01-01

    As a result of the exponential growth of the utilization of synchrotron radiation for research in the domain of the material sciences, atomic and molecular physics, biology and technology, a major construction activity has been generated towards new dedicated electron storage rings, designed optimally for synchrotron radiation applications, also, expansion programs are underway at the existing facilities, such as DORIS, SPEAR, and VEPP. In this report the basic properties of synchrotron radiation will be discussed, a short overview will be given of the existing and new facilities, some aspects of the optimization of a structure for a synchrotron radiation source will be discussed and the addition of wigglers and undulators for spectrum enhancement will be described. Finally, some parameters of an optimized synchrotron radiation source will be given.

  11. Feed sources for livestock

    OpenAIRE

    Zanten, van, JH Harry

    2016-01-01

    Production of food has re-emerged at the top of the global political agenda, driven by two contemporary challenges: the challenge to produce enough nutritious food to feed a growing and more prosperous human population, and the challenge to produce this food in an environmentally sustainable way. Current levels of production of especially animal-source food (ASF), pose severe pressure on the environment via their emissions to air, water, and soil; and their use of scarce resources, such as la...

  12. Neutrino Sources and Properties

    OpenAIRE

    Vissani, Francesco

    2014-01-01

    In this lecture, prepared for PhD students, basic considerations on neutrino interactions, properties and sites of production are overviewed. The detailed content is as follows: Sect. 1, Weak interactions and neutrinos: Fermi coupling; definition of neutrinos; global numbers. Sect. 2, A list of neutrino sources: Explanatory note and examples (solar pp- and supernova-neutrinos). Sect. 3, Neutrinos oscillations: Basic formalism (Pontecorvo); matter effect (Mikheev, Smirnov, Wolfenstein); status...

  13. Future Synchrotron Radiation Sources

    CERN Document Server

    Winick, Herman

    2003-01-01

    Sources of synchrotron radiation (also called synchrotron light) and their associated research facilities have experienced a spectacular growth in number, performance, and breadth of application in the past two to three decades. In 1978 there were eleven electron storage rings used as light sources. Three of these were small rings, all below 500 mega-electron volts (MeV), dedicated to this purpose; the others, with energy up to 5 giga-electron volts (GeV), were used parasitically during the operation of the ring for high energy physics research. In addition, at that time synchrotron radiation from nine cyclic electron synchrotrons, with energy up to 5 GeV, was also used parasitically. At present no cyclic synchrotrons are used, while about 50 electron storage rings are in operation around the world as fully dedicated light sources for basic and applied research in a wide variety of fields. Among these fields are structural molecular biology, molecular environmental science, materials, analytic chemistry, micr...

  14. Intersunspot Microwave Sources

    Science.gov (United States)

    Bakunina, I. A.; Melnikov, V. F.; Solov'ev, A. A.; Abramov-Maximov, V. E.

    2015-01-01

    We studied a number of solar active regions using two-dimensional spatially resolved microwave observations. Data from the Nobeyama Radioheliograph and the Siberian Solar Radio Telescope together with observations by the Michelson Doppler Imager (MDI) onboard the Solar and Heliospheric Observatory (SOHO) have allowed us to identify long-lived intersunspot sources (ISSs) in most of the investigated active regions. Their centers are often located above the line-of-sight magnetic field inversion line that separates the leading and following polarities of a full active region (first type of ISS) or above the inversion line that separates magnetic polarities inside of a complex of sunspots (second type of ISS). ISSs of the first type are extended and, in general, they are sources of bremsstrahlung emission. ISSs of the second type are compact and are, most likely, sources of gyroresonance or gyrosynchrotron emission. We propose a qualitative model involving three types of magnetic connectivity to explain how long-lasting ISSs may be generated.

  15. Extended HXR Sources - Albedo Patches or Coronal Sources

    Science.gov (United States)

    Dennis, Brian R.

    2011-01-01

    Extended HXR sources in the presence of compact footpoints have been reported based on visibility amplitudes from different detectors. Attempts have been made to determine the location and extent of these sources through direct imaging. Results of this work will be described for simulated sources and for specific flares at different solar longitudes, with a discussion of the possible nature of the extended sources as either albedo patches or coronal sources or a combination of the two.

  16. Online Sources of Competitive Intelligence.

    Science.gov (United States)

    Wagers, Robert

    1986-01-01

    Presents an approach to using online sources of information for competitor intelligence (i.e., monitoring industry and tracking activities of competitors); identifies principal sources; and suggests some ways of making use of online databases. Types and sources of information and sources and database charts are appended. Eight references are…

  17. Source Monitoring in Alzheimer's Disease

    Science.gov (United States)

    El Haj, Mohamad; Fasotti, Luciano; Allain, Philippe

    2012-01-01

    Source monitoring is the process of making judgments about the origin of memories. There are three categories of source monitoring: reality monitoring (discrimination between self- versus other-generated sources), external monitoring (discrimination between several external sources), and internal monitoring (discrimination between two types of…

  18. PLANTS, SOURCE FOR BIOFUELS

    Directory of Open Access Journals (Sweden)

    Irina Ramona PECINGINĂ

    2016-12-01

    Full Text Available The most affordable alternative energy sources to fossil plants with hydropower are some oils that accumulate in different organs other accumulating carbohydrates with high energy value. They are known worldwide and cultivated a number of plant species entering the oilseeds, which provides significant production of edible oil (soybean, sunflower, etc. Vegetable oils or their product derived biodiesel fuels are potential diesel engines, representing an alternative to fuels. The most promising suitable for the production of oil crops "with short circuit "or biodiesel are fruits and seeds, both herbaceous and tree.

  19. Data source handbook

    CERN Document Server

    Warden, Pete

    2011-01-01

    If you''re a developer looking to supplement your own data tools and services, this concise ebook covers the most useful sources of public data available today. You''ll find useful information on APIs that offer broad coverage, tie their data to the outside world, and are either accessible online or feature downloadable bulk data. You''ll also find code and helpful links. This guide organizes APIs by the subjects they cover-such as websites, people, or places-so you can quickly locate the best resources for augmenting the data you handle in your own service. Categories include: Website tools

  20. Compact synchrotron light sources

    CERN Document Server

    Weihreter, Ernst

    1996-01-01

    This book covers a new niche in circular accelerator design, motivated by the promising industrial prospects of recent micromanufacturing methods - X-ray lithography, synchrotron radiation-based micromachining and microanalysis techniques. It describes the basic concepts and the essential challenges for the development of compact synchrotron radiation sources from an accelerator designer's point of view and gives an outline of the actual state of the art. The volume is intended as an introduction and as a reference for physicists, engineers and managers involved in this rapidly developing fiel

  1. New nuclear power sources

    Science.gov (United States)

    Nuclear electric-power generation sources for the future include two viable candidates as viewed now: the fast breeder and the nuclear fusion reactors. Breeder reactors, which produce more radioactive fuels than they consume, are in the realm of existing technology. They are also categorized as potentially most harmful to the environment. Nuclear fusion reactors, on the other hand, will not be available in this century, based on current levels of development. However, they will be categorized as inherently much safer and thus potentially least harmful to the environment of all fueled electric-power generators.

  2. Organizing for Global Sourcing

    DEFF Research Database (Denmark)

    Bals, Lydia; Turkulainen, Virpi

    Research on Purchasing Organization is dominated by studies on centralization versus decentralization. While global sourcing relates to the integrated activities of purchasing and other functions in line with the company’s strategic objectives and while it has been put forward that hybrid...... organizations are on the rise, the exact ways in which companies employ hybrid organizations in this context have not been studied in further detail. By presenting a multi-year case study from 2010 to 2013 at a pharmaceutical company, we elaborate on the existing knowledge regarding hybrid organizations......, putting forward several structural variants that lie beneath the surface....

  3. Evaluation of Electroencephalography Source Localization Algorithms with Multiple Cortical Sources.

    Directory of Open Access Journals (Sweden)

    Allison Bradley

    Full Text Available Source localization algorithms often show multiple active cortical areas as the source of electroencephalography (EEG. Yet, there is little data quantifying the accuracy of these results. In this paper, the performance of current source density source localization algorithms for the detection of multiple cortical sources of EEG data has been characterized.EEG data were generated by simulating multiple cortical sources (2-4 with the same strength or two sources with relative strength ratios of 1:1 to 4:1, and adding noise. These data were used to reconstruct the cortical sources using current source density (CSD algorithms: sLORETA, MNLS, and LORETA using a p-norm with p equal to 1, 1.5 and 2. Precision (percentage of the reconstructed activity corresponding to simulated activity and Recall (percentage of the simulated sources reconstructed of each of the CSD algorithms were calculated.While sLORETA has the best performance when only one source is present, when two or more sources are present LORETA with p equal to 1.5 performs better. When the relative strength of one of the sources is decreased, all algorithms have more difficulty reconstructing that source. However, LORETA 1.5 continues to outperform other algorithms. If only the strongest source is of interest sLORETA is recommended, while LORETA with p equal to 1.5 is recommended if two or more of the cortical sources are of interest. These results provide guidance for choosing a CSD algorithm to locate multiple cortical sources of EEG and for interpreting the results of these algorithms.

  4. Open source clustering software.

    Science.gov (United States)

    de Hoon, M J L; Imoto, S; Nolan, J; Miyano, S

    2004-06-12

    We have implemented k-means clustering, hierarchical clustering and self-organizing maps in a single multipurpose open-source library of C routines, callable from other C and C++ programs. Using this library, we have created an improved version of Michael Eisen's well-known Cluster program for Windows, Mac OS X and Linux/Unix. In addition, we generated a Python and a Perl interface to the C Clustering Library, thereby combining the flexibility of a scripting language with the speed of C. The C Clustering Library and the corresponding Python C extension module Pycluster were released under the Python License, while the Perl module Algorithm::Cluster was released under the Artistic License. The GUI code Cluster 3.0 for Windows, Macintosh and Linux/Unix, as well as the corresponding command-line program, were released under the same license as the original Cluster code. The complete source code is available at http://bonsai.ims.u-tokyo.ac.jp/mdehoon/software/cluster. Alternatively, Algorithm::Cluster can be downloaded from CPAN, while Pycluster is also available as part of the Biopython distribution.

  5. Optimization of neutron source

    Energy Technology Data Exchange (ETDEWEB)

    Hooper, E.B.

    1993-11-09

    I consider here the optimization of the two component neutron source, allowing beam species and energy to vary. A simple model is developed, based on the earlier publications, that permits the optimum to be obtained simply. The two component plasma, with one species of hot ion (D{sup +} or T{sup +}) and the complementary species of cold ion, is easy to analyze in the case of a spatially uniform cold plasma, as to good approximation the total number of hot ions is important but not their spatial distribution. Consequently, the optimization can ignore spatial effects. The problem of a plasma with both types of hot ions and cold ions is rather more difficult, as the neutron production by hot-hot interactions is sensitive to their spatial distributions. Consequently, consideration of this problem will be delayed to a future memorandum. The basic model is that used in the published articles on the two-component, beam-plasma mirror source. I integrate the Fokker-Planck equation analytically, obtaining good agreement with previous numerical results. This simplifies the optimization, by providing a functional form for the neutron production. The primary result is expressed in terms of the power efficiency: watts of neutrons/watts of primary power. The latter includes the positive ion neutralization efficiency. At 150 keV, the present model obtains an efficiency of 0.66%, compared with 0.53% of the earlier calculation.

  6. [Microbial sources of pigments].

    Science.gov (United States)

    Cañizares-Villanueva, R O; Ríos-Leal, E; Olvera Ramírez, R; Ponce Noyola, T; Márquez Rocha, F

    1998-01-01

    Pigments from natural sources has been obtained since long time ago, and their interest has increased due to the toxicity problems caused by those of synthetic origin. In this way the pigments from microbial sources are a good alternative. Some of more important natural pigments, are the carotenoids, flavonoids (anthocyanins) and some tetrapirroles (chloropyls, phycobilliproteins). Another group less important are the betalains and quinones. The carotenoids are molecules formed by isoprenoids units and the most important used as colorant are the alpha and beta carotene which are precursors of vitamin A, and some xantophylls as astaxanthin. The pigment more used in the industry is the beta-carotene which is obtained from some microalgae and cyanobacteria. The astaxanthin another important carotenoid is a red pigment of great commercial value, and it is used in the pharmaceutical feed and acuaculture industries. This pigments is mainly obtained from Phaffia rhodozyma and Haematococcus pluvialis and other organisms. The phycobilliproteins obtained from cyanobacteria and some group of algae, have recently been increased on the food industries. In the last years it has been used as fluorescent marker in biochemical assays. Our research group have carried out studies about the factors that improve the production of these pigments obtained from different microbial species as well as the methods for their extraction and application.

  7. Open Source vs. Closed Source Software: Towards Measuring Security

    OpenAIRE

    Schryen, Guido; Kadura, Rouven

    2009-01-01

    The increasing availability and deployment of open source software in personal and commercial environments makes open source software highly appealing for hackers, and others who are interested in exploiting software vulnerabilities. This deployment has resulted in a debate “full of religion” on the security of open source software compared to that of closed source software. However, beyond such arguments, only little quantitative analysis on this research issue has taken place. We discuss th...

  8. Vortex and source rings

    DEFF Research Database (Denmark)

    Branlard, Emmanuel Simon Pierre

    2017-01-01

    The velocity field, vector potential and velocity gradient of a vortex ring is derived in this chapter. The Biot-Savart law for the vector potential and velocity is expressed in a first section. Then, the flow is derived at specific locations: on the axis, near the axis and in the far field where...... the analogy to a doublet field is made. The following section derive the value of the vector potential and velocity field in the full domain. The expression for the velocity gradient is also provided since it may be relevant in a simulation with vortex particles and vortex rings. Most of this chapter...... is dedicated to vortex rings. Source rings are only briefly mentioned....

  9. Infrared source test

    Energy Technology Data Exchange (ETDEWEB)

    Ott, L.

    1994-11-15

    The purpose of the Infrared Source Test (IRST) is to demonstrate the ability to track a ground target with an infrared sensor from an airplane. The system is being developed within the Advance Technology Program`s Theater Missile Defense/Unmanned Aerial Vehicle (UAV) section. The IRST payload consists of an Amber Radiance 1 infrared camera system, a computer, a gimbaled mirror, and a hard disk. The processor is a custom R3000 CPU board made by Risq Modular Systems, Inc. for LLNL. The board has ethernet, SCSI, parallel I/O, and serial ports, a DMA channel, a video (frame buffer) interface, and eight MBytes of main memory. The real-time operating system VxWorks has been ported to the processor. The application code is written in C on a host SUN 4 UNIX workstation. The IRST is the result of a combined effort by physicists, electrical and mechanical engineers, and computer scientists.

  10. Swiss Light Source SLS

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-09-01

    The Paul Scherrer Institute has begun work on the implementation of the Swiss Synchrotron Light Source (SLS). The construction of this facility, which will have international scope, is intended to provide a national focus for co-operation between various disciplines and for research in material sciences. Although basic research in physics and chemistry, biology, medicine and environmental sciences would seem to be in the foreground, industrial users also have an interest in the SLS. At present, this mainly centres on investigations into the structure of biological and chemical molecules, the use of high-performance methods of analysis, and the manufacture and investigation of microstructures. SLS is planned to be taken into service with an initial experimental installation by the middle of 2001. In this brochure an overview is presented on the main characteristics of the SLS facility and on its significance as a tool for interdisciplinary research.

  11. SOURCES OF ENTERPRISE VALUE

    Directory of Open Access Journals (Sweden)

    Viorica Mădălina Ion

    2016-05-01

    Full Text Available The value of the enterprise has an increased importance in business valuation, so maximizing it becomes a priority for the interested parties, such as its shareholders or investors. The purpose of this article is the analysis of the sources of enterprise value and its factors, in order to understand the causes of the decrease or the possibilities for maximizing the enterprise value, passing over the main concepts in the literature. The analysis refers to the listed companies on the Bucharest Stock Exchange (BVB from the energy sector, including the largest Romanian company as per its capitalization, OMV Petrom. The research took into account the fact that the analysis of a large company with a long history is facilitated by the existence of multi-annual information, unlike the firms in the early life cycle operating in an emerging market.

  12. Compact Neutrino Source

    CERN Document Server

    LoSecco, John

    2015-01-01

    Some evidence for sterile neutrinos has been found in short baseline observations where the measured neutrino flux did not agree with expectations. Systematic uncertainties from the expected values has limited the sensitivity of this approach. Observation at multiple distances can remove the normalization uncertainty by isolating the distance dependence. This doesn't work for high $\\Delta m^{2}$ sterile neutrinos since they are fully mixed at most observation distances and only shift the normalization of the flux. A compact intense source of neutrinos based on a subcritical fission reactor would permit observation of oscillations on submeter distance scales and clearly distinguish between a systematic normalization and the $L/E$ dependence expected from oscillations.

  13. Multiple source heat pump

    Science.gov (United States)

    Ecker, Amir L.

    1983-01-01

    A heat pump apparatus for conditioning a fluid characterized by a fluid handler and path for circulating a fluid in heat exchange relationship with a refrigerant fluid, at least three refrigerant heat exchangers, one for effecting heat exchange with the fluid, a second for effecting heat exchange with a heat exchange fluid, and a third for effecting heat exchange with ambient air; a compressor for compressing the refrigerant; at least one throttling valve connected at the inlet side of a heat exchanger in which liquid refrigerant is vaporized; a refrigerant circuit; refrigerant; a source of heat exchange fluid; heat exchange fluid circuit and pump for circulating the heat exchange fluid in heat exchange relationship with the refrigerant; and valves or switches for selecting the heat exchangers and directional flow of refrigerant therethrough for selecting a particular mode of operation. Also disclosed are a variety of embodiments, modes of operation, and schematics therefor.

  14. EV-GHG Mobile Source

    Data.gov (United States)

    U.S. Environmental Protection Agency — The EV-GHG Mobile Source Data asset contains measured mobile source GHG emissions summary compliance information on light-duty vehicles, by model, for certification...

  15. SOFTWARE OPEN SOURCE, SOFTWARE GRATIS?

    Directory of Open Access Journals (Sweden)

    Nur Aini Rakhmawati

    2006-01-01

    Full Text Available Normal 0 false false false IN X-NONE X-NONE MicrosoftInternetExplorer4 Berlakunya Undang – undang Hak Atas Kekayaan Intelektual (HAKI, memunculkan suatu alternatif baru untuk menggunakan software open source. Penggunaan software open source menyebar seiring dengan isu global pada Information Communication Technology (ICT saat ini. Beberapa organisasi dan perusahaan mulai menjadikan software open source sebagai pertimbangan. Banyak konsep mengenai software open source ini. Mulai dari software yang gratis sampai software tidak berlisensi. Tidak sepenuhnya isu software open source benar, untuk itu perlu dikenalkan konsep software open source mulai dari sejarah, lisensi dan bagaimana cara memilih lisensi, serta pertimbangan dalam memilih software open source yang ada. Kata kunci :Lisensi, Open Source, HAKI

  16. Source memory, aging and culture.

    Science.gov (United States)

    Chua, Hannah Faye; Chen, Wenfeng; Park, Denise C

    2006-01-01

    The present study investigates the possibility that culture affects age differences in context memory. There is evidence that East-Asians process scenes more holistically and show better context memory than Americans. We examined evidence for differences in binding source to context in young and old Americans and native Chinese. We hypothesized that age effects on source memory could be mitigated due to these cultural differences in processing style. During incidental encoding, younger and older Chinese and Americans watched a video with statements spoken by four distinct speakers. After a brief interval, participants identified source (experiment 1) or item and source (experiment 2). We observed substantial age-related deficits in source memory in both cultures but little evidence for cultural differences in source or item memory. Basic source memory processes operate similarly across culture and age. The source of holistic processing differences observed between cultures may occur in cognitive operations that are more highly bound to a social context.

  17. Helping Residents Protect Water Sources

    Science.gov (United States)

    Building on the successful early engagement of the Plain Sect agricultural community, the Eastern Lancaster County Source Water Protection Collaborative is expanding its efforts to involve local residents in the work of protecting drinking water sources.

  18. Independent EEG sources are dipolar

    National Research Council Canada - National Science Library

    Delorme, Arnaud; Palmer, Jason; Onton, Julie; Oostenveld, Robert; Makeig, Scott

    2012-01-01

    Independent component analysis (ICA) and blind source separation (BSS) methods are increasingly used to separate individual brain and non-brain source signals mixed by volume conduction in electroencephalographic (EEG...

  19. Mobile Source Observation Database (MSOD)

    Science.gov (United States)

    The Mobile Source Observation Database (MSOD) is a relational database developed by the Assessment and Standards Division (ASD) of the U.S. EPA Office of Transportation and Air Quality (formerly the Office of Mobile Sources).

  20. Mot-croisé : Source(s.

    Directory of Open Access Journals (Sweden)

    Emmanuelle Cherel

    2006-03-01

    Full Text Available    Le point de vue de l’informatique. Le source (contraction de code source d'un logiciel informatique est sa forme la plus compréhensible pour les êtres humains. Les ordinateurs utilisent la forme exécutable (ou binaire du logiciel, qui est créé à partir du source par le biais d'un compilateur. Quand on installe un programme, on installe un exécutable. Tous les logiciels ont leur source, qui est soit distribué librement (logiciels open source , ou ouverts, ou bien ...

  1. Sources for charged particles; Les sources de particules chargees

    Energy Technology Data Exchange (ETDEWEB)

    Arianer, J.

    1997-09-01

    This document is a basic course on charged particle sources for post-graduate students and thematic schools on large facilities and accelerator physics. A simple but precise description of the creation and the emission of charged particles is presented. This course relies on every year upgraded reference documents. Following relevant topics are considered: electronic emission processes, technological and practical considerations on electron guns, positron sources, production of neutral atoms, ionization, plasma and discharge, different types of positive and negative ion sources, polarized particle sources, materials for the construction of ion sources, low energy beam production and transport. (N.T.).

  2. Software Open Source, Software Gratis?

    OpenAIRE

    Rakhmawati, Nur Aini

    2006-01-01

    Berlakunya Undang – undang Hak Atas Kekayaan Intelektual (HAKI), memunculkan suatu alternatif baru untuk menggunakan software open source. Penggunaan software open source menyebar seiring dengan isu global pada Information Communication Technology (ICT) saat ini. Beberapa organisasi dan Perusahaan mulai menjadikan software open source sebagai pertimbangan. Banyak konsep mengenai software open source ini. Mulai dari software yang gratis sampai software tidak berlisensi. Tidak sepenuhnya isu so...

  3. Global Sourcing and Firm Selection

    DEFF Research Database (Denmark)

    Kohler, Wilhelm; Smolka, Marcel

    2014-01-01

    We analyze the sourcing strategies of firms active in the Spanish manufacturing sector. We show that firms that select strategies of vertical integration and of foreign sourcing ex post tend to have been more productive, ex ante, than other firms.......We analyze the sourcing strategies of firms active in the Spanish manufacturing sector. We show that firms that select strategies of vertical integration and of foreign sourcing ex post tend to have been more productive, ex ante, than other firms....

  4. Quasi-Y-source inverter

    DEFF Research Database (Denmark)

    Siwakoti, Yam Prasad; Blaabjerg, Frede; Loh, Poh Chiang

    2015-01-01

    This paper introduces a new inverter topology called a “quasi-Y-source inverter”. The proposed inverter inherits all the advantages of the original Y-source inverter. In addition, the new topology draws continuous current from the source which is required for many renewable sources. It also has dc-current......-blocking capacitors, which avoids saturation in the transformer core. Simulations and experimental results have proved the validity of the proposed inverter....

  5. Authorship Attribution of Source Code

    Science.gov (United States)

    Tennyson, Matthew F.

    2013-01-01

    Authorship attribution of source code is the task of deciding who wrote a program, given its source code. Applications include software forensics, plagiarism detection, and determining software ownership. A number of methods for the authorship attribution of source code have been presented in the past. A review of those existing methods is…

  6. Convolutive Blind Source Separation Methods

    DEFF Research Database (Denmark)

    Pedersen, Michael Syskind; Larsen, Jan; Kjems, Ulrik

    2008-01-01

    During the past decades, much attention has been given to the separation of mixed sources, in particular for the blind case where both the sources and the mixing process are unknown and only recordings of the mixtures are available. In several situations it is desirable to recover all sources fro...

  7. Source-space ICA for MEG source imaging.

    Science.gov (United States)

    Jonmohamadi, Yaqub; Jones, Richard D

    2016-02-01

    One of the most widely used approaches in electroencephalography/magnetoencephalography (MEG) source imaging is application of an inverse technique (such as dipole modelling or sLORETA) on the component extracted by independent component analysis (ICA) (sensor-space ICA + inverse technique). The advantage of this approach over an inverse technique alone is that it can identify and localize multiple concurrent sources. Among inverse techniques, the minimum-variance beamformers offer a high spatial resolution. However, in order to have both high spatial resolution of beamformer and be able to take on multiple concurrent sources, sensor-space ICA + beamformer is not an ideal combination. We propose source-space ICA for MEG as a powerful alternative approach which can provide the high spatial resolution of the beamformer and handle multiple concurrent sources. The concept of source-space ICA for MEG is to apply the beamformer first and then singular value decomposition + ICA. In this paper we have compared source-space ICA with sensor-space ICA both in simulation and real MEG. The simulations included two challenging scenarios of correlated/concurrent cluster sources. Source-space ICA provided superior performance in spatial reconstruction of source maps, even though both techniques performed equally from a temporal perspective. Real MEG from two healthy subjects with visual stimuli were also used to compare performance of sensor-space ICA and source-space ICA. We have also proposed a new variant of minimum-variance beamformer called weight-normalized linearly-constrained minimum-variance with orthonormal lead-field. As sensor-space ICA-based source reconstruction is popular in EEG and MEG imaging, and given that source-space ICA has superior spatial performance, it is expected that source-space ICA will supersede its predecessor in many applications.

  8. OASYS (OrAnge SYnchrotron Suite): an open-source graphical environment for x-ray virtual experiments

    Science.gov (United States)

    Rebuffi, Luca; Sanchez del Rio, Manuel

    2017-08-01

    The evolution of the hardware platforms, the modernization of the software tools, the access to the codes of a large number of young people and the popularization of the open source software for scientific applications drove us to design OASYS (ORange SYnchrotron Suite), a completely new graphical environment for modelling X-ray experiments. The implemented software architecture allows to obtain not only an intuitive and very-easy-to-use graphical interface, but also provides high flexibility and rapidity for interactive simulations, making configuration changes to quickly compare multiple beamline configurations. Its purpose is to integrate in a synergetic way the most powerful calculation engines available. OASYS integrates different simulation strategies via the implementation of adequate simulation tools for X-ray Optics (e.g. ray tracing and wave optics packages). It provides a language to make them to communicate by sending and receiving encapsulated data. Python has been chosen as main programming language, because of its universality and popularity in scientific computing. The software Orange, developed at the University of Ljubljana (SLO), is the high level workflow engine that provides the interaction with the user and communication mechanisms.

  9. Earthquake Source Mechanics

    Science.gov (United States)

    The past 2 decades have seen substantial progress in our understanding of the nature of the earthquake faulting process, but increasingly, the subject has become an interdisciplinary one. Thus, although the observation of radiated seismic waves remains the primary tool for studying earthquakes (and has been increasingly focused on extracting the physical processes occurring in the “source”), geological studies have also begun to play a more important role in understanding the faulting process. Additionally, defining the physical underpinning for these phenomena has come to be an important subject in experimental and theoretical rock mechanics.In recognition of this, a Maurice Ewing Symposium was held at Arden House, Harriman, N.Y. (the former home of the great American statesman Averill Harriman), May 20-23, 1985. The purpose of the meeting was to bring together the international community of experimentalists, theoreticians, and observationalists who are engaged in the study of various aspects of earthquake source mechanics. The conference was attended by more than 60 scientists from nine countries (France, Italy, Japan, Poland, China, the United Kingdom, United States, Soviet Union, and the Federal Republic of Germany).

  10. The heliospheric energy source

    Science.gov (United States)

    Parker, E. N.

    1986-01-01

    The solar wind and the heliosphere exist as a consequence of the heat input to the corona, particularly the coronal holes. The necessary energy input to coronal holes has been estimated to be 10 to the 6th erg/sq cm sec, requiring Alfven waves with rms fluid velocities of 100 km/sec. Observational upper limits on coronal fluid velocities are of the order of 25 km/sec, which may not apply to the transparent coronal hole. Alternatively it has been suggested that coronal holes may be heated by agitation from neighboring active regions, suggesting that the vigor of a coronal hole depends upon its location. The Ulysses Mission will provide a direct comparison of the strength of the high speed wind from coronal holes at low latitude and coronal holes at high latitude, from which the nature of the presently unknown energy sources of the coronal holes and the resulting structure of the heliosphere may be better judged. The question is fundamental to the dynamics of the windspheres of all stars.

  11. Pi a source book

    CERN Document Server

    Berggren, Lennart; Borwein, Peter

    2004-01-01

    This book documents the history of pi from the dawn of mathematical time to the present. One of the beauties of the literature on pi is that it allows for the inclusion of very modern, yet accessible, mathematics. The articles on pi collected herein include selections from the mathematical and computational literature over four millennia, a variety of historical studies on the cultural significance of the number, and an assortment of anecdotal, fanciful, and simply amusing pieces. For this new edition, the authors have updated the original material while adding new material of historical and cultural interest. There is a substantial exposition of the recent history of the computation of digits of pi, a discussion of the normality of the distribution of the digits, new translations of works by Viete and Huygen, as well as Kaplansky's never-before-published "Song of Pi." From the reviews of earlier editions: "Few mathematics books serve a wider potential readership than does a source book and this particular on...

  12. Novel laser ion sources

    CERN Document Server

    Fournier, P; Kugler, H; Lisi, N; Scrivens, R; Rodríguez, F V; Düsterer, S; Sauerbrey, R; Schillinger, H; Theobald, W; Veisz, L; Tisch, J W G; Smith, R A

    2000-01-01

    Development in the field of high-power laser systems with repetition rates of several Hz and energies of few joules is highly active and opening, giving new possibilities for the design of laser ions sources. Preliminary investigations on the use of four different laser and target configurations are presented: (1) A small CO/sub 2/ laser (100 mJ, 10.6 mu m) focused onto a polyethylene target to produce C ions at 1 Hz repetition rate (CERN). (2) An excimer XeCl laser (6 J, 308 nm) focused onto solid targets (Frascati). (3) A femtosecond Ti: sapphire laser (250 mJ, 800 nm) directed onto a solid targets (Jena). (4) A picosecond Nd: yttrium-aluminum-garnet (0.3 J, 532 nm) focused into a dense medium of atomic clusters and onto solid targets (London). The preliminary experimental results and the most promising schemes will be discussed with respect to the scaling of the production of high numbers of highly charged ions. Different lasers are compared in terms of current density at 1 m distance for each charge state...

  13. Defining Open Source

    Directory of Open Access Journals (Sweden)

    Russ Nelson

    2007-09-01

    Full Text Available The Open Source Initiative and the Free Software Foundation share a common goal: that everyone should be free to modify and redistribute the software they commonly use. 'Should' is of course a normative word. For the FSF, 'should' is a moral imperative. Anything else is an immoral restriction on people's activities, just as are restrictions on speech, press, movement, and religion. For the OSI, freedom is a necessary precondition for a world where "software doesn't suck", in the words of a founder of the OSI. The FSF started from its founder's GNU Manifesto widely published in 1985. Given the manifesto's hostility to copyright, and given the failure of the Free Software Foundation to gain any traction amongst commercial users of software even with a 13-year head start, a group of people gathered together in 1998 to talk about a new strategy to get the corporate world to listen to hackers. They were impressed by Eric Raymond's Cathedral and the Bazaar's take-up among business leaders.

  14. Economic explanations for concurrent sourcing

    DEFF Research Database (Denmark)

    Mols, Niels Peter

    2010-01-01

    Concurrent sourcing is a phenomenon where firms simultaneously make and buy the same good, i.e. they simultaneously use the governance modes of market and hierarchy. Though concurrent sourcing seems to be widespread, few studies of sourcing have focused on this phenomenon. This paper reviews diff...... different economic explanations for why firms use concurrent sourcing. The distinctive features of the explanations are compared, and it is discussed how they may serve as a springboard for research on concurrent sourcing. Managerial implications are also offered....

  15. Radiation sources working group summary

    Energy Technology Data Exchange (ETDEWEB)

    Fazio, M.V.

    1998-12-31

    The Radiation Sources Working Group addressed advanced concepts for the generation of RF energy to power advanced accelerators. The focus of the working group included advanced sources and technologies above 17 GHz. The topics discussed included RF sources above 17 GHz, pulse compression techniques to achieve extreme peak power levels, components technology, technology limitations and physical limits, and other advanced concepts. RF sources included gyroklystrons, magnicons, free-electron masers, two beam accelerators, and gyroharmonic and traveling wave devices. Technology components discussed included advanced cathodes and electron guns, high temperature superconductors for producing magnetic fields, RF breakdown physics and mitigation, and phenomena that impact source design such as fatigue in resonant structures due to RF heating. New approaches for RF source diagnostics located internal to the source were discussed for detecting plasma and beam phenomena existing in high energy density electrodynamic systems in order to help elucidate the reasons for performance limitations.

  16. Coaxial slow source

    Energy Technology Data Exchange (ETDEWEB)

    Brooks, R.D.; Jarboe, T.R.

    1990-01-01

    Field reversed configurations (FRCs) are a class of compact toroid with not toroidal field. The field reversed theta pinch technique has been successfully used for formation of FRCs since their inception in 1958. In this method an initial bias field is produced. After ionization of the fill gas, the current in the coil is rapidly reversed producing the radial implosion of a current sheath. At the ends of the coil the reversed field lines rapidly tear and reconnect with the bias field lines until no more bias flux remains. At this point, vacuum reversed field accumulates around the configuration which contracts axially until an equilibrium is reached. When extrapolating the use of such a technique to reactor size plasmas two main shortcomings are found. First, the initial bias field, and hence flux in a given device, which can be reconnected to form the configuration is limited from above by destructive axial dynamics. Second, the voltages required to produce rapid current reversal in the coil are very large. Clearly, a low voltage formation technique without limitations on flux addition is desirable. The Coaxial Slow Source (CSS) device was designed to meet this need. It has two coaxial theta pinch coils. Coaxial coil geometry allows for the addition of as much magnetic flux to the annular plasma between them as can be generated inside the inner coil. Furthermore the device can be operated at charging voltages less than 10 kV and on resistive diffusion, rather than implosive time scales. The inner coil is a novel, concentric, helical design so as to allow it to be cantilevered on one end to permit translation of the plasma. Following translation off the inner coil the Annular Field Reversed Configuration would be re-formed as a true FRC. In this paper we investigate the formation process in the new parallel configuration., CSSP, in which the inner and outer coils are connected in parallel to the main capacitor bank.

  17. Coaxial slow source

    Science.gov (United States)

    Brooks, R. D.; Jarboe, T. R.

    Field reversed configurations (FRC's) are a class of compact toroid with no toroidal field. The field reversed theta pinch technique has been successfully used for formation of FRC's since their inception in 1958. In this method an initial bias field is produced. After ionization of the fill gas, the current in the coil is rapidly reversed producing the radial implosion of a current sheath. At the ends of the coil the reversed field lines rapidly tear and reconnect with the bias field lines until no more bias flux remains. At this point, vacuum reversed field accumulates around the configuration which contracts axially until an equilibrium is reached. When extrapolating the use of such a technique to reactor size plasmas two main shortcomings are found. First, the initial bias field, and hence flux in a given device, which can be reconnected to form the configuration is limited from above by destructive axial dynamics. Second, the voltages required to produce rapid current reversal in the coil are very large. Clearly, a low voltage formation technique without limitations on flux addition is desirable. The Coaxial Slow Source (CSS) device was designed to meet this need. It has two coaxial theta pinch coils. Coaxial coil geometry allows for the addition of as much magnetic flux to the annular plasma between them as can be generated inside the inner coil. Furthermore the device can be operated at charging voltages less than 10 kV and on resistive diffusion, rather than implosive time scales. The inner coil is a novel, concentric, helical design so as to allow it to be cantilevered on one end to permit translation of the plasma. Following translation off the inner coil the Annular Field Reversed Configuration would be re-formed as a true FRC. In this paper, we investigate the formation process in the new parallel configuration, CSSP, in which the inner and outer coils are connected in parallel to the main capacitor bank.

  18. Portable Source Identification Device

    Energy Technology Data Exchange (ETDEWEB)

    Andersen, Eric S.; Samuel, Todd J.; Gervais, Kevin L.

    2005-08-01

    U.S. Customs and Border Protection (CBP) is the primary enforcement agency protecting the nation’s ports of entry. CBP is enhancing its capability to interdict the illicit import of nuclear and radiological materials and devices that may be used by terrorists. Pacific Northwest National Laboratory (PNNL) is providing scientific and technical support to CBP in their goal to enable rapid deployment of nuclear and radiation detection systems at U. S. ports of entry to monitor 100% of the incoming international traffic and cargo while not adversely impacting the operations or throughput of the ports. As the deployment of radiation detection systems proceeds, there is a need to adapt the baseline radiation portal monitor (RPM) system technology to operations at these diverse ports of entry. When screening produces an alarm in the primary inspection RPM, the alarming vehicle is removed from the flow of commerce and the alarm is typically confirmed in a secondary inspection RPM. The portable source identification device (PSID) is a radiation sensor panel (RSP), based on thallium-doped sodium iodide (NaI(Tl)) scintillation detector and gamma spectroscopic analysis hardware and software, mounted on a scissor lift on a small truck. The lift supports a box containing a commercial off-the-shelf (COTS) sodium iodide detector that provides real-time isotopic identification, including neutron detectors to interdict Weapons of Mass Destruction (WMD) and radiation dispersion devices (RDD). The scissor lift will lower the detectors to within a foot off the ground and raise them to approximately 24 feet in the air, allowing a wide vertical scanning range.

  19. Portable source identification device

    Science.gov (United States)

    Andersen, Eric S.; Samuel, Todd J.; Gervais, Kevin L.

    2005-05-01

    U.S. Customs and Border Protection (CBP) is the primary enforcement agency protecting the nation"s ports of entry. CBP is enhancing its capability to interdict the illicit import of nuclear and radiological materials and devices that may be used by terrorists. Pacific Northwest National Laboratory (PNNL) is providing scientific and technical support to CBP in their goal to enable rapid deployment of nuclear and radiation detection systems at U. S. ports of entry to monitor 100% of the incoming international traffic and cargo while not adversely impacting the operations or throughput of the ports. As the deployment of radiation detection systems proceeds, there is a need to adapt the baseline radiation portal monitor (RPM) system technology to operations at these diverse ports of entry. When screening produces an alarm in the primary inspection RPM, the alarming vehicle is removed from the flow of commerce and the alarm is typically confirmed in a secondary inspection RPM. The portable source identification device (PSID) is a radiation sensor panel (RSP), based on thallium-doped sodium iodide (NaI(Tl)) scintillation detector and gamma spectroscopic analysis hardware and software, mounted on a scissor lift on a small truck. The lift supports a box containing a commercial off-the-shelf (COTS) sodium iodide detector that provides real-time isotopic identification, including neutron detectors to interdict Weapons of Mass Destruction (WMD) and radiation dispersion devices (RDD). The scissor lift will lower the detectors to within a foot off the ground and raise them to approximately 24 feet (7.3 m) in the air, allowing a wide vertical scanning range.

  20. Os Retratos de Dorian G(ray – corpo, imagem e subjetividade em um site de relacionamentos

    Directory of Open Access Journals (Sweden)

    Luiz Felipe Zago

    2014-12-01

    como utiliza entrevistas realizadas com usuários do site. Foca nas relações entre corpo, imagem e produção de subjetividade no tempo presente, empregando aportes teóricos do pós-estruturalismo. Considera a ligação entre imagem e corpo como legitimação da “verdade” dos corpos, coagidos pelo espectro da velhice e pela exortação à visibilidade.

  1. Industrial ion sources broadbeam gridless ion source technology

    CERN Document Server

    Zhurin, Viacheslav V

    2012-01-01

    Due to the large number of uses of ion sources in academia and industry, those who utilize these sources need up to date and coherent information to keep themselves abreast of developments and options, and to chose ideal solutions for quality and cost-effectiveness. This book, written by an author with a strong industrial background and excellent standing, is the comprehensive guide users and developers of ion sources have been waiting for. Providing a thorough refresher on the physics involved, this resource systematically covers the source types, components, and the operational parameters.

  2. Editorial: Open Source in Government

    Directory of Open Access Journals (Sweden)

    Dru Lavigne

    2009-04-01

    Full Text Available Last summer, the Center for Strategic and International Studies published the sixth update to their Open Source Policy survey. The survey "tracks governmental policies on the use of open source software as reported in the press or other media." The report lists 275 open source policy initiatives. It also breaks down by country and by government level whether the policy on the use of open source is considered to be advisory, preferential, or mandatory. The editorial theme for the May issue of the OSBR is "open source in government" and we are pleased that the authors have drawn upon their experiences to provide insight into public policy regarding open source for many parts of the world.

  3. Embedded EZ-Source Inverters

    DEFF Research Database (Denmark)

    Chiang Loh, Poh; Gao, Feng; Blaabjerg, Frede

    2010-01-01

    Z-source inverters are recent topological options proposed for buck–boost energy conversion with a number of possible voltage- and current-type circuitries already reported in the literature. Comparing them, a common feature noted is their inclusion of an LC impedance network, placed between the dc...... input source and inverter bridge. This impedance network allows the output end of a voltage-type Z-source inverter to be shorted for voltage boosting without causing a large current flow and the terminal current of a current-type inverter to be interrupted for current boosting without introducing...... of embedded EZ-source inverters that can produce the same gain as the Z-source inverters but with smoother and smaller current/voltage maintained across the dc input source and within the impedance network. These latter features are attained without using any additional passive filter, which surely...

  4. DESIGN OF ALTERNATIVE ENERGY SOURCES

    Directory of Open Access Journals (Sweden)

    Popa Stefania

    2013-11-01

    Full Text Available By energy sources we understand technologies and materials used to obtain various forms of energy necessary for the development of society. These sources must be in adequate quantities and be conveniently exploited in terms of technical, economic and sustainable perspective. Alternative energy uses the inherent power of natural sources like wind, tides, the sun. Alternative energy is a term used for some energy sources and energy storage technologies. Generally it indicates energies that are nontraditional and have low impact to the environment. The alternative energy term is used in contrast with the term fossil fuel according to some sources, while other sources use it with the meaning of renewable energy purposes.

  5. Constricted glow discharge plasma source

    Science.gov (United States)

    Anders, Andre; Anders, Simone; Dickinson, Michael; Rubin, Michael; Newman, Nathan

    2000-01-01

    A constricted glow discharge chamber and method are disclosed. The polarity and geometry of the constricted glow discharge plasma source is set so that the contamination and energy of the ions discharged from the source are minimized. The several sources can be mounted in parallel and in series to provide a sustained ultra low source of ions in a plasma with contamination below practical detection limits. The source is suitable for applying films of nitrides such as gallium nitride and oxides such as tungsten oxide and for enriching other substances in material surfaces such as oxygen and water vapor, which are difficult process as plasma in any known devices and methods. The source can also be used to assist the deposition of films such as metal films by providing low-energy ions such as argon ions.

  6. Optically pumped polarized ion sources

    Energy Technology Data Exchange (ETDEWEB)

    Zelenski, A.N.

    1995-12-31

    Polarization transfer collisions between protons, atomic hydrogen, or deuterium and optically pumped alkali-metal vapour are implemented in the high current optically pumped polarized ion source (OPPIS) and the laser driven source (LDS) of nuclear polarized atoms for target applications. The OPPIS technique overcomes the limitations on intensity of the conventional atomic beam source technique and meets the requirements of the new generation of polarization experiments at multi-GeV accelerators and colliders. 17 refs., 3 figs.

  7. Impedance Source Power Electronic Converters

    DEFF Research Database (Denmark)

    Liu, Yushan; Abu-Rub, Haitham; Ge, Baoming

    control methods. Presents the latest power conversion solutions that aim to advance the role of power electronics into industries and sustainable energy conversion systems. Compares impedance source converter/inverter applications in renewable energy power generation and electric vehicles as well......Impedance Source Power Electronic Converters brings together state of the art knowledge and cutting edge techniques in various stages of research related to the ever more popular impedance source converters/inverters. Significant research efforts are underway to develop commercially viable...

  8. Sources of coal reserve data

    Energy Technology Data Exchange (ETDEWEB)

    Skolits, D.; Lee, R.

    1982-11-01

    This report is a partially annotated bibliography of sources of coal reserve data and information for the United States. The references are divided into General Sources, including those containing data for all or large portions of the United States, and into individual sections for each state. Items that are parts of recurring series are identified by an asterick. In addition to the bibliographies, the authors conducted an independent survey of appropriate data sources. Attention was given primarily to those data sources having estimates of the quantity and geographical location of coal resources. Studies that report only on carbonizing properties, preparation characteristics, sulfur content or other analyses were not included.

  9. Microseismic sources of rotational type

    Science.gov (United States)

    Pasternak, Elena; Dyskin, Arcady; He, Junxian

    2017-04-01

    Traditionally the sources of seismic and microseismic events are related to shear fractures. The analysis of the seismic moment tensors of the sources associated with rock fracturing and hydraulic fracturing in the laboratory experiments and in-situ reveals that while there exist tensile and compressive sources, the shear sources prevail. The appearance of multiple shear sources, accompanied rock fracturing contradicts the results of the direct experiments suggesting that the rock as well as other materials not exhibiting clear plastic flow fail in tension. This contradiction is conventionally resolved by assuming the presence of multiple pre-existing shear fractures (faults or microfaults) whose sudden sliding provides microseismic events of shear type. We consider alternative mechanisms associated with bending of links between rotating particles and fragments of geomaterial and bending of bridges connecting opposite sides of hydraulic fractures. In both cases the fracturing is caused by the action of moments (or moment stresses) leading to bending, while at microscale the failure is associated with tensile microstresses leading to formation of tensile microcracks. In other words, at microscale the moment-related failure is failure in tension, as routinely observed in materials even in compression. It is easy to demonstrate that from a distance the sources of rotational type are equivalent to a standard double couple, similar to the one associated with shear fracturing. In other words what is currently interpreted as shear microseismic sources can in fact be rotational sources. This calls for new methods of detecting and interpreting microseismic sources; some possible methods are discussed.

  10. Radiation Safety and Orphan Sources

    Energy Technology Data Exchange (ETDEWEB)

    Janzekovic, H.; Krizman, M. [Slovenian Nuclear Safety Administration, Ljubljana (Slovenia)

    2006-07-01

    The wide spread use of radioactive and particularly of nuclear materials which started in the last century very quickly also demonstrated negative sides. The external exposure and radiotoxicity of these materials could be easily used in a malevolent act. Due to the fact that these materials could not be detected without special equipment designed for that purpose, severe control over their use in all phases of a life cycle is required. An orphan source is a radioactive source which is not under regulatory control, either because it has never been under regulatory or because it has been abandoned, lost, misplaced, stolen or transferred without proper authorization. In the last ten years a few international conferences were dedicated to the improvement of the safety and security of radioactive sources. Three main tasks are focused, the maintenance of data bases related to events with orphan sources and the publications of such events, the preparation of recommendations and guidelines to national regulatory bodies in order to prevent and detect the events related to orphan sources as well as to develop the response strategies to radiological or nuclear emergency, appraisals of the national strategies of radioactive sources control. Concerning Slovenia, strengthening control over orphan sources in Slovenia started after the adoption of new legislation in 2002. It was carried out through several tasks with the aim to prevent orphan sources, as well as to identify the sources which could be potentially orphan sources. The comprehensive methodology was developed by the Slovenian nuclear safety administration (S.N.S.A.) based on international guidelines as well as on the study of national lesson learned cases. The methodology was developed and used in close cooperation with all parties involved, namely other regulatory authorities, police, customs, agency for radioactive waste management (A.R.A.O.), technical support organisations (T.S.O.), users of source, authorised

  11. Status of spallation neutron source

    Energy Technology Data Exchange (ETDEWEB)

    Oyama, Yukio [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1997-03-01

    Existing and planned facilities using proton accelerator driven spallation neutron source are reviewed. These include new project of neutron science proposed from Japan Atomic Energy Research Institute. The present status of facility requirement and accelerator technology leads us to new era of neutron science such as neutron scattering research and nuclear transmutation study using very intense neutron source. (author)

  12. High average power supercontinuum sources

    Indian Academy of Sciences (India)

    The physical mechanisms and basic experimental techniques for the creation of high average spectral power supercontinuum sources is briefly reviewed. We focus on the use of high-power ytterbium-doped fibre lasers as pump sources, and the use of highly nonlinear photonic crystal fibres as the nonlinear medium.

  13. The Open Source Hardening Project

    Science.gov (United States)

    2009-07-01

    Corbett, M. Dwyer, J. Hatcliff, S. Laubach, C. Pasareanu, Robby, and H. Zheng. Bandera : Extracting finite-state models from Java source code. In ICSE 2000...AND ZHENG, H. Bandera : Extracting finite-state models from Java source code. In Proceedings of the International Conference on Software Engineering

  14. High current polarized proton sources

    Energy Technology Data Exchange (ETDEWEB)

    Alessi, J.G.

    1988-01-01

    Polarized proton sources are now being used more frequently on linacs. In pulsed operation up to 10 mA of /rvec H//sup +/ and 0.4 mA of /rvec H//sup /minus// have been produced. The present status of these sources, and developments to reach even higher intensities, are reviewed. 39 refs., 1 tab.

  15. Urban Sources of Air Pollution

    DEFF Research Database (Denmark)

    Sorenson, Spencer C.

    1998-01-01

    A discusion of the relative importance of different mobile sources, effects of driving on emissions, history of emissions standards, and technological methods to reduce emissions.......A discusion of the relative importance of different mobile sources, effects of driving on emissions, history of emissions standards, and technological methods to reduce emissions....

  16. Impedance source power electronic converters

    CERN Document Server

    Liu, Yushan; Ge, Baoming; Blaabjerg, Frede; Ellabban, Omar; Loh, Poh Chiang

    2016-01-01

    Impedance Source Power Electronic Converters brings together state of the art knowledge and cutting edge techniques in various stages of research related to the ever more popular impedance source converters/inverters. Significant research efforts are underway to develop commercially viable and technically feasible, efficient and reliable power converters for renewable energy, electric transportation and for various industrial applications. This book provides a detailed understanding of the concepts, designs, controls, and application demonstrations of the impedance source converters/inverters. Key features: Comprehensive analysis of the impedance source converter/inverter topologies, including typical topologies and derived topologies. Fully explains the design and control techniques of impedance source converters/inverters, including hardware design and control parameter design for corresponding control methods. Presents the latest power conversion solutions that aim to advance the role of pow...

  17. Analyzing and Interpreting Historical Sources

    DEFF Research Database (Denmark)

    Kipping, Matthias; Wadhwani, Dan; Bucheli, Marcelo

    2014-01-01

    This chapter outlines a methodology for the interpretation of historical sources, helping to realize their full potential for the study of organization, while overcoming their challenges in terms of distortions created by time, changes in context, and selective production or preservation. Drawing...... on social scientific methods as well as the practice and reflections of historians, the chapter describes analytical and interpretive process based on three basic elements, illustrating them with exemplars from management research: source criticism to identify possible biases and judge the extent to which...... a source can be trusted to address the research question; triangulation with additional sources to confirm or question an interpretation and strengthen the overall findings; hermeneutics to relate sources to their original contexts and make their interpretation by a researcher today more robust...

  18. Testing earthquake source inversion methodologies

    KAUST Repository

    Page, Morgan T.

    2011-01-01

    Source Inversion Validation Workshop; Palm Springs, California, 11-12 September 2010; Nowadays earthquake source inversions are routinely performed after large earthquakes and represent a key connection between recorded seismic and geodetic data and the complex rupture process at depth. The resulting earthquake source models quantify the spatiotemporal evolution of ruptures. They are also used to provide a rapid assessment of the severity of an earthquake and to estimate losses. However, because of uncertainties in the data, assumed fault geometry and velocity structure, and chosen rupture parameterization, it is not clear which features of these source models are robust. Improved understanding of the uncertainty and reliability of earthquake source inversions will allow the scientific community to use the robust features of kinematic inversions to more thoroughly investigate the complexity of the rupture process and to better constrain other earthquakerelated computations, such as ground motion simulations and static stress change calculations.

  19. A-Source Impedance Network

    DEFF Research Database (Denmark)

    Siwakoti, Yam Prasad; Blaabjerg, Frede; Galigekere, Veda Prakash

    2016-01-01

    A novel A-source impedance network is proposed in this letter. The A-source impedance network uses an autotransformer for realizing converters for any application that demand a very high dc voltage gain. The network utilizes a minimal turns ratio compared to other Magnetically Coupled Impedance...... Source (MCIS) networks to attain a high voltage gain. In addition, the proposed converter draws a continuous current from the source, and hence it is suitable for many types of renewable energy sources. The derived network expressions and theoretical analysis are finally validated experimentally...... with an example single-switch 400 W dc-dc converter. For the closed-loop control design and stability assessment, a small signal model and its analysis of the proposed network are also presented in brief....

  20. Embedded EZ-Source Inverters

    DEFF Research Database (Denmark)

    Blaabjerg, Frede; Loh, Poh Chiang; Gao, F.

    2008-01-01

    Z-source inverters are recent topological options proposed for buck-boost energy conversion with a number of possible voltage and current-type circuitries already reported in the literature. Comparing them, a common feature noted is their inclusion of a LC impedance network, placed between the dc...... input source and inverter bridge. This impedance network allows the output end of a voltage-type Z-source inverter to be shorted for voltage-boosting without causing a large current flow, and the terminal current of a current-type inverter to be interrupted for current boosting without introducing over...... inverters that can produce the same gain as the Z-source inverters, but with smoother and smaller current / voltage maintained across the dc input source and within the impedance network. These latter features are attained without using any additional passive filter, which surely is a favorable advantage...

  1. Sealed source peer review plan

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, Alexander [Los Alamos National Laboratory; Leonard, Lee [RETIRED; Burns, Ron [CONTRACTOR

    2009-01-01

    Sealed sources are known quantities of radioactive materials that have been encapsulated in quantities that produce known radiation fields. Sealed sources have multiple uses ranging from instrument calibration sources to sources that produce radiation fields for experimental applications. The Off-Site Source Recovery (OSR) Project at Los Alamos National Laboratory (LANL), created in 1999, under the direction of the Waste Management Division of the U.S. Department of Energy (DOE) Albuquerque has been assigned the responsibility to recover and manage excess and unwanted radioactive sealed sources from the public and private sector. LANL intends to ship drums containing qualified sealed sources to the Waste Isolation Pilot Plant (WIPP) for disposal. Prior to shipping, these drums must be characterized with respect to radiological content and other parameters. The U. S. Environmental Protection Agency (EPA) requires that ten radionulcides be quantified and reported for every container of waste to be disposed in the WIPP. The methods traditionally approved by the EPA include non-destructive assay (NDA) in accordance with Appendix A of the Contact-Handled Transuranic Waste Acceptance Criteria for the Waste Isolation Pilot Plant (DOE, 2002) (CH WAC). However, because of the nature and pedigree of historical records for sealed sources and the technical infeasibility of performing NDA on these sources, LANL proposes to characterize the content of these waste drums using qualified existing radiological data in lieu of direct measurement. This plan describes the process and documentation requirements for the use of the peer review process to qualify existing data for sealed radiological sources in lieu of perfonning radioassay. The peer review process will be performed in accordance with criteria provided in 40 CFR {section} 194.22 which specifies the use of the NUREG 1297 guidelines. The plan defines the management approach, resources, schedule, and technical requirements

  2. A rubidium vapor source for a plasma source for AWAKE

    Science.gov (United States)

    Plyushchev, G.; Kersevan, R.; Petrenko, A.; Muggli, P.

    2018-01-01

    We present the scheme for a rubidium vapor source that is used as a plasma source in the AWAKE plasma wakefield acceleration experiment. The plasma wakefield acceleration process requires a number of stringent parameters for the plasma: electron density adjustable in the (1–10)  ×  10 14 cm‑3 range, 0.25% relative density uniformity, sharp (the beginning the plasma column. We show with analytical and direct simulation Monte Carlo results that the rubidium density in the proposed source should meet these requirements. Laser ionization then transfers the above neutral vapor parameters to the plasma.

  3. Multiwavelength observations of Mrk 501 in 2008

    Energy Technology Data Exchange (ETDEWEB)

    Aleksic, J.; Ansoldi, S.; Antonelli, L. A.; Antoranz, P.; Babic, A.; Bangale, P.; Barres de Almeida, U.; Barrio, J. A.; Gonzalez, Becerra; Bednarek, W.; Zitzer, B.

    2015-01-01

    Context. Blazars are variable sources on various timescales over a broad energy range spanning from radio to very high energy (>100 GeV, hereafter VHE). Mrk 501 is one of the brightest blazars at TeV energies and has been extensively studied since its first VHE detection in 1996. However, most of the γ-ray studies performed on Mrk 501 during the past years relate to flaring activity, when the source detection and characterization with the available γ-ray instrumentation was easier toperform. Aims. Our goal is to characterize the source γ-ray emission in detail, together with the radio-to-X-ray emission, during the non-flaring (low) activity, which is less often studied than the occasional flaring (high) activity. Methods. We organized a multiwavelength (MW) campaign on Mrk 501 between March and May 2008. This multi-instrument effort included the most sensitive VHE γ-ray instruments in the northern hemisphere, namely the imaging atmospheric Cherenkov telescopes MAGIC and VERITAS, as well as Swift, RXTE, the F-GAMMA, GASP-WEBT, and other collaborations and instruments. This provided extensive energy and temporal coverage of Mrk 501 throughout the entire campaign. Results. Mrk 501 was found to be in a low state of activity during the campaign, with a VHE flux in the range of 10%–20% of the Crab nebula flux. Nevertheless, significant flux variations were detected with various instruments, with a trend of increasing variability with energy and a tentative correlation between the X-ray and VHE fluxes. The broadband spectral energy distribution during the two different emission states of the campaign can be adequately described within the homogeneous one-zone synchrotron self-Compton model, with the (slightly) higher state described by an increase in the electron number density. Conclusions. The one-zone SSC model can adequately describe the broadband spectral energy distribution of the source during the two months covered by the MW campaign. This agrees with

  4. CADDIS Volume 2. Sources, Stressors and Responses: Urbanization - Energy Sources

    Science.gov (United States)

    Introduction to changes in basal energy sources with urbanization, overview of terrestrial leaf litter dynamics in urban streams, overview of how urbanization can affect primary production, respiration, and dissolved organic carbon quantity and quality.

  5. Diversity employment and recruitment sources

    Energy Technology Data Exchange (ETDEWEB)

    1994-08-01

    Effective human resources management has been identified as one of four critical success factors in the Department of Energy Strategic Plan. The Plan states relative to this factor: ``The Department seeks greater alignment of resources with agency priorities and increased diversification of the workforce, including gender, ethnicity, age, and skills. This diversification will bring new thinking and perspectives that heretofore have not had a voice in departmental decision-making.`` This Guide has been developed as a key tool to assist Department of Energy management and administrative staff in achieving Goal 2 of this critical success factor, which is to ``Ensure a diverse and talented workforce.`` There are numerous sources from which to recruit minorities, women and persons with disabilities. Applying creativity and proactive effort, using traditional and non-traditional approaches, and reaching out to various professional, academic and social communities will increase the reservoir of qualified candidates from which to make selections. In addition, outreach initiatives will undoubtedly yield further benefits such as a richer cultural understanding and diversity awareness. The resource listings presented in this Guide are offered to encourage active participation in the diversity recruitment process. This Guide contains resource listings by state for organizations in the following categories: (1) African American Recruitment Sources; (2) Asian American/Pacific Islander Recruitment Sources; (3) Hispanic Recruitment Sources; (4) Native American/Alaskan Native Recruitment Sources; (5) Persons with Disabilities Recruitment Sources; and (6) Women Recruitment Sources.

  6. Spallation neutron source and other high intensity froton sources

    Energy Technology Data Exchange (ETDEWEB)

    Weiren Chou

    2003-02-06

    This lecture is an introduction to the design of a spallation neutron source and other high intensity proton sources. It discusses two different approaches: linac-based and synchrotron-based. The requirements and design concepts of each approach are presented. The advantages and disadvantages are compared. A brief review of existing machines and those under construction and proposed is also given. An R&D program is included in an appendix.

  7. The cohesiveness of sourcing teams

    DEFF Research Database (Denmark)

    Lidegaard, Nina

    2015-01-01

    Sourcing teams are introduced as an approach to achieving the interdepartmental integration necessary for companies to address the complexity of strategic sourcing. Companies aim at facilitating teams capable of balancing the goals and tasks of the team with departmental expectations; however......, the practical implementation is often unsuccessful leading to poor performance. Originating in PSM literature, factors influencing sourcing team performance are categorised into three: top management support, organisational structures, and those related to team members. In this paper, the concept...... of cohesiveness is introduced as an explanatory factor and, consequently, linkages between team cohesiveness and team performance are proposed....

  8. Empirical multi-wavelength prediction method for very high energy gamma-ray emitting BL Lacertae objects

    Science.gov (United States)

    Fallah Ramazani, V.; Lindfors, E.; Nilsson, K.

    2017-12-01

    Aim: We have collected the most complete multi-wavelength (6.0-6.0 × 10-18 cm) dataset of very high energy (VHE) γ-ray emitting (TeV) BL Lacs, which are the most numerous extragalactic VHE sources. Using significant correlations between different bands, we aim to identify the best TeV BL Lac candidates that can be discovered by the current and next generation of imaging air Cherenkov telescopes. Methods: We formed five datasets from lower energy data, i.e. radio, mid-infrared, optical, X-rays, and GeV γ-ray, and five VHE γ-ray datasets to perform a correlation study between different bands and to construct the prediction method. The low energy datasets were averaged for individual sources, while the VHE γ-ray data were divided into subsets according to the flux state of the source. We then looked for significant correlations and determined their best-fit parameters. Using the best-fit parameters we predicted the level of VHE γ-ray flux for a sample of 182 BL Lacs, which have not been detected at TeV energies. We identified the most promising TeV BL Lac candidates based on the predicted VHE γ-ray flux for each source. Results: We found 14 significant correlations between radio, mid-infrared, optical, γ-ray, and VHE γ-ray bands. The correlation between optical and VHE γ-ray luminosity is established for the first time. We attribute this to the more complete sample and more accurate handling of host galaxy flux in our work. We found nine BL Lac candidates whose predicted VHE γ-ray flux is high enough for detection in less than 25 h with current imaging air Cherenkov telescopes. Full Tables A.1 and A.2 are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/608/A68

  9. Perspectives on Open Source Software

    National Research Council Canada - National Science Library

    Hissam, Scott

    2001-01-01

    Open source software (OSS) is emerging as the software community's next "silver bullet" and appears to be playing a significant role in the acquisition and development plans of the Department of Defense (DoD) and industry...

  10. Mobile Source Observation Database (MSOD)

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Mobile Source Observation Database (MSOD) is a relational database being developed by the Assessment and Standards Division (ASD) of the US Environmental...

  11. Educational Stress: Sources, Reactions, Preventions.

    Science.gov (United States)

    Kaiser, Jeffrey S.; Polczynski, James J.

    1982-01-01

    Effects of stress on educators and efforts to understand and cope with stress are discussed. Sources of stress, common reactions to stress, the effects of stress on educator performance, and suggested preventive methods are examined. (JN)

  12. Polar source analysis : technical memorandum

    Science.gov (United States)

    2017-09-29

    The following technical memorandum describes the development, testing and analysis of various polar source data sets. The memorandum also includes recommendation for potential inclusion in future releases of AEDT. This memorandum is the final deliver...

  13. Impedance Source Power Electronic Converters

    DEFF Research Database (Denmark)

    Liu, Yushan; Abu-Rub, Haitham; Ge, Baoming

    control methods. Presents the latest power conversion solutions that aim to advance the role of power electronics into industries and sustainable energy conversion systems. Compares impedance source converter/inverter applications in renewable energy power generation and electric vehicles as well......Impedance Source Power Electronic Converters brings together state of the art knowledge and cutting edge techniques in various stages of research related to the ever more popular impedance source converters/inverters. Significant research efforts are underway to develop commercially viable...... and technically feasible, efficient and reliable power converters for renewable energy, electric transportation and for various industrial applications. This book provides a detailed understanding of the concepts, designs, controls, and application demonstrations of the impedance source converters/inverters. Key...

  14. Source Modeling Sleep Slow Waves

    National Research Council Canada - National Science Library

    Michael Murphy; Brady A. Riedner; Reto Huber; Marcello Massimini; Fabio Ferrarelli; Giulio Tononi; Marcus E. Raichle

    2009-01-01

    .... Here we use high-density EEG (hd-EEG) source modeling to show that individual spontaneous slow waves have distinct cortical origins, propagate uniquely across the cortex, and involve unique subsets of cortical structures...

  15. High average power supercontinuum sources

    Indian Academy of Sciences (India)

    .uk. Abstract. The physical mechanisms and basic experimental techniques for the creation of high average spectral power supercontinuum sources is briefly reviewed. We focus on the use of high-power ytterbium-doped fibre lasers as pump ...

  16. Impedance Source Power Electronic Converters

    DEFF Research Database (Denmark)

    Liu, Yushan; Abu-Rub, Haitham; Ge, Baoming

    and technically feasible, efficient and reliable power converters for renewable energy, electric transportation and for various industrial applications. This book provides a detailed understanding of the concepts, designs, controls, and application demonstrations of the impedance source converters/inverters. Key......Impedance Source Power Electronic Converters brings together state of the art knowledge and cutting edge techniques in various stages of research related to the ever more popular impedance source converters/inverters. Significant research efforts are underway to develop commercially viable...... control methods. Presents the latest power conversion solutions that aim to advance the role of power electronics into industries and sustainable energy conversion systems. Compares impedance source converter/inverter applications in renewable energy power generation and electric vehicles as well...

  17. Intermediate-energy light sources

    CERN Document Server

    Corbett, W

    2003-01-01

    Increasingly, atomic scale information underlies scientific and technological progress in disciplines ranging from pharmaceutical development to materials synthesis to environmental remediation. While a variety of research tools are used to provide atomic scale information, synchrotron radiation has proved invaluable in this quest. The rapid growth of soft- and hard X-ray synchrotron light sources stands as stark testimony to the importance and utility of synchrotron radiation. Starting from just a handful of synchrotron light sources in the early 1970s, this burgeoning field now includes over 70 proposed, in-construction, or operating facilities in 23 countries on five continents. Along the way, synchrotron light facilities have evolved from small laboratories extracting light parasitically from storage rings designed for high-energy physics research to large, dedicated sources using the latest technology to produce extraordinarily bright photon beams. The basic layout of a multi-GeV storage ring light sourc...

  18. The Sources and Solutions: Wastewater

    Science.gov (United States)

    Wastewater treatment plants process water from homes and businesses, which contains nitrogen and phosphorus from human waste, food and certain soaps and detergents, and they can be a major source of nutrient pollution.

  19. Source Retrieval for Plagiarism Detection

    OpenAIRE

    Suchomel Šimon; Brandejs Michal

    2015-01-01

    Plagiarism has become a serious problem mainly because of the electronically available documents. An online document retrieval is a weighty part of a modern anti-plagiarism tool. This paper describes an architecture and concepts of a real-world document retrieval system, which is a part of a general anti-plagiarism software. Up to date systems for plagiarism detection are discussed from the source retrieval perspective. The key approaches of source retrieval are compared. The system recommend...

  20. Strategic Sourcing in the Army

    Science.gov (United States)

    2013-09-01

    assist. While DoD’s reviews are not all- inclusive with regard to its strategic sourcing initiatives, they do provide useful highlights of the...formal Strategic Sourcing office has not been implemented. The Army Business Council, which is all inclusive of business systems, does capture a...agency’s Chief Acquisition Officer (CAO), Chief Financial Officer ( CFO ), and Chief Information Officer (CIO) are responsible for the overall development

  1. Open Source Vulnerability Database Project

    OpenAIRE

    Jake Kouns

    2008-01-01

    This article introduces the Open Source Vulnerability Database (OSVDB) project which manages a global collection of computer security vulnerabilities, available for free use by the information security community. This collection contains information on known security weaknesses in operating systems, software products, protocols, hardware devices, and other infrastructure elements of information technology. The OSVDB project is intended to be the centralized global open source vulnerability co...

  2. Open Source Vulnerability Database Project

    Directory of Open Access Journals (Sweden)

    Jake Kouns

    2008-06-01

    Full Text Available This article introduces the Open Source Vulnerability Database (OSVDB project which manages a global collection of computer security vulnerabilities, available for free use by the information security community. This collection contains information on known security weaknesses in operating systems, software products, protocols, hardware devices, and other infrastructure elements of information technology. The OSVDB project is intended to be the centralized global open source vulnerability collection on the Internet.

  3. Asymmetrical Γ-Source Inverters

    DEFF Research Database (Denmark)

    Wei, Mo; Poh Chiang, Loh; Blaabjerg, Frede

    2014-01-01

    Impedance-source inverters are inverters with voltage-buck-boost capability that cannot be achieved by the traditional inverters. Their boost capability is introduced by shorting their phase legs without causing damages. Impedance-source inverters are therefore less prone to false triggering caus...... current drawn by the proposed inverters is smoother and, hence, more adaptable by the source. Theories and experimental results have been presented in this paper for validating the concepts proposed.......Impedance-source inverters are inverters with voltage-buck-boost capability that cannot be achieved by the traditional inverters. Their boost capability is introduced by shorting their phase legs without causing damages. Impedance-source inverters are therefore less prone to false triggering caused...... by electromagnetic interference. Present impedance-source inverters are, however, burdened by their low modulation ratio at high input-to-output gain. Such low modulation usually leads to high-voltage stresses across the components and poor spectral performance at the inverter output. To avoid these problems...

  4. The Compact Light Source A Miniature Synchrotron Light Source

    CERN Document Server

    Ruth, Ronald D

    2005-01-01

    During the past 30 years, synchrotron light sources have become the x-ray probe of choice for physicists, chemists, biologists and research physicians. With their high-quality, intense x-ray beams, these national research facilities have spawned a broad array of applications. Past research at Stanford Linear Accelerator Center has led to a new x-ray source concept that can substantially reduce the size of the required synchrotron.* This research has spawned a new corporation, Lyncean Technologies, Inc. which is now developing the Compact Light Source (CLS). The CLS is a tunable, homelab x-ray source with up to three beamlines that can be used like the x-ray beamlines at the synchrotrons-but it is about 200 times smaller than a synchrotron light source. The compact size is achieved using a laser undulator and a miniature electron-beam storage ring. The photon flux on a sample will be comparable to the flux of highly productive synchrotron beamlines. At Lyncean Technologies, Inc. we have constructed a prototype...

  5. Sources

    OpenAIRE

    2017-01-01

    1 - Archives départementales de l’Isère (AD38) Série B, Chambre des comptes du Dauphiné B 2611 (1331)B 2635 (1213-1282)B 3006, fos 743v°-744r°B 3120, fos 220-221v° (1339)B 3138 (1398)B 3139 1251)B 3158 (1231)B 3159 (1214-1284)B 3551B 3637-B 3698B 3735 (1257)B 3791 (1262)B 3850 (1298-1379)B 3978 (1270-1331)B 4000 (1290)B 4077B 4079 (1242-1247-1428)B 4083 (1263)B 4086 (1235-1306)B 4454 (1364-1433) Série B, visites du maître des œuvres delphinales Libri visitationis receptionis castrorum et domo...

  6. Quantitative estimation of source complexity in tsunami-source inversion

    Science.gov (United States)

    Dettmer, Jan; Cummins, Phil R.; Hawkins, Rhys; Jakir Hossen, M.

    2016-04-01

    This work analyses tsunami waveforms to infer the spatiotemporal evolution of sea-surface displacement (the tsunami source) caused by earthquakes or other sources. Since the method considers sea-surface displacement directly, no assumptions about the fault or seafloor deformation are required. While this approach has no ability to study seismic aspects of rupture, it greatly simplifies the tsunami source estimation, making it much less dependent on subjective fault and deformation assumptions. This results in a more accurate sea-surface displacement evolution in the source region. The spatial discretization is by wavelet decomposition represented by a trans-D Bayesian tree structure. Wavelet coefficients are sampled by a reversible jump algorithm and additional coefficients are only included when required by the data. Therefore, source complexity is consistent with data information (parsimonious) and the method can adapt locally in both time and space. Since the source complexity is unknown and locally adapts, no regularization is required, resulting in more meaningful displacement magnitudes. By estimating displacement uncertainties in a Bayesian framework we can study the effect of parametrization choice on the source estimate. Uncertainty arises from observation errors and limitations in the parametrization to fully explain the observations. As a result, parametrization choice is closely related to uncertainty estimation and profoundly affects inversion results. Therefore, parametrization selection should be included in the inference process. Our inversion method is based on Bayesian model selection, a process which includes the choice of parametrization in the inference process and makes it data driven. A trans-dimensional (trans-D) model for the spatio-temporal discretization is applied here to include model selection naturally and efficiently in the inference by sampling probabilistically over parameterizations. The trans-D process results in better

  7. Compton Sources of Electromagnetic Radiation

    Energy Technology Data Exchange (ETDEWEB)

    Geoffrey Krafft,Gerd Priebe

    2011-01-01

    When a relativistic electron beam interacts with a high-field laser beam, intense and highly collimated electromagnetic radiation will be generated through Compton scattering. Through relativistic upshifting and the relativistic Doppler effect, highly energetic polarized photons are radiated along the electron beam motion when the electrons interact with the laser light. For example, X-ray radiation can be obtained when optical lasers are scattered from electrons of tens-of-MeV beam energy. Because of the desirable properties of the radiation produced, many groups around the world have been designing, building, and utilizing Compton sources for a wide variety of purposes. In this review article, we discuss the generation and properties of the scattered radiation, the types of Compton source devices that have been constructed to date, and the prospects of radiation sources of this general type. Due to the possibilities of producing hard electromagnetic radiation in a device that is small compared to the alternative storage ring sources, it is foreseen that large numbers of such sources may be constructed in the future.

  8. LIGHT SOURCE: Conceptual design of Hefei advanced light source

    Science.gov (United States)

    Li, Wei-Min; Wang, Lin; Feng, Guang-Yao; Zhang, Shan-Cai; Wu, Cong-Feng; Xu, Hong-Liang; Liu, Zu-Ping

    2009-06-01

    The conceptual of Hefei Advanced Light Source, which is an advanced VUV and Soft X-ray source, was developed at NSRL of USTC. According to the synchrotron radiation user requirements and the trends of SR source development, some accelerator-based schemes were considered and compared; furthermore storage ring with ultra low emittance was adopted as the baseline scheme of HALS. To achieve ultra low emittance, some focusing structures were studied and optimized in the lattice design. Compromising of emittance, on-momentum and off-momentum dynamic aperture and ring scale, five bend acromat (FBA) was employed. In the preliminary design of HALS, the emittance was reduced to sub nm · rad, thus the radiation up to water window has full lateral coherence. The brilliance of undulator radiation covering several eVs to keVs range is higher than that of HLS by several orders. The HALS should be one of the most advanced synchrotron radiation light sources in the world.

  9. Source Segregation and Collection of Source-Segregated Waste

    DEFF Research Database (Denmark)

    Christensen, Thomas Højlund; Matsufuji, Y.

    2011-01-01

    of optimal handling of the waste. But in a few cases, the waste must also be separated at source, for example removing the protective plastic cover from a commercial advertisement received by mail, prior to putting the advertisement into the waste collection bin for recyclable paper. These issues are often...

  10. Ion source antenna development for the Spallation Neutron Source

    Science.gov (United States)

    Welton, R. F.; Stockli, M. P.; Kang, Y.; Janney, M.; Keller, R.; Thomae, R. W.; Schenkel, T.; Shukla, S.

    2002-02-01

    The operational lifetime of a radio-frequency (rf) ion source is generally governed by the length of time the insulating structure protecting the antenna survives during exposure to the plasma. Coating the antenna with a thin layer of insulating material is a common means of extending the life of such antennas. When low-power/low-duty factor rf excitation is employed, antenna lifetimes of several hundred hours are typical. When high-power, >30 kW, and high-duty cycles, ˜6%, are employed, as is the case of the Spallation Neutron Source (SNS) ion source, antenna lifetime becomes unacceptably short. This work addresses this problem by first showing the results of microanalysis of failed antennas from the SNS ion source, developing a model of the damage mechanism based on plasma-insulator interaction, using the model to determine the dimensional and material properties of an ideal coating, and describing several approaches currently under way to develop a long-lived antenna for the SNS accelerator. These approaches include thermal spray coatings, optimized porcelain enamel coatings, refractory enamel coatings, and novel antenna geometries designed to operate with low rf electric fields.

  11. Compact portable electric power sources

    Energy Technology Data Exchange (ETDEWEB)

    Fry, D.N.; Holcomb, D.E.; Munro, J.K.; Oakes, L.C.; Matson, M.J.

    1997-02-01

    This report provides an overview of recent advances in portable electric power source (PEPS) technology and an assessment of emerging PEPS technologies that may meet US Special Operations Command`s (SOCOM) needs in the next 1--2- and 3--5-year time frames. The assessment was performed through a literature search and interviews with experts in various laboratories and companies. Nineteen PEPS technologies were reviewed and characterized as (1) PEPSs that meet SOCOM requirements; (2) PEPSs that could fulfill requirements for special field conditions and locations; (3) potentially high-payoff sources that require additional R and D; and (4) sources unlikely to meet present SOCOM requirements. 6 figs., 10 tabs.

  12. Source and LINAC3 studies

    CERN Document Server

    Bellodi, G

    2017-01-01

    In the framework of the LHC Ion Injector Upgrade pro-gramme (LIU), several activities have been carried out in2016 to improve the ion source and Linac3 performance,with the goal to increase the beam current routinely deliv-ered to LEIR. The extraction region of the GTS-LHC ionsource was upgraded with enlarged vacuum chamber aper-tures and the addition of an einzel lens, yielding highertransmission through the rest of the machine. Also, a seriesof experiments have been performed to study the effects ofdouble frequency mixing on the afterglow performance ofthe source after installation of a Travelling Wave Tube Am-plifier (TWTA) as secondary microwave source at variablefrequency. Measurements have been carried out at a dedi-cated oven test stand for better understanding of the ionsource performance. Finally, several MD sessions werededicated to the study and characterization of the strippingfoils, after evidence of degradation in time was discoveredin the 2015 run.

  13. Materials for spallation neutron sources

    Energy Technology Data Exchange (ETDEWEB)

    Sommer, W.F.; Daemen, L.L. [comps.

    1996-03-01

    The Workshop on Materials for Spallation Neutron Sources at the Los Alamos Neutron Science Center, February 6 to 10, 1995, gathered scientists from Department of Energy national laboratories, other federal institutions, universities, and industry to discuss areas in which work is needed, successful designs and use of materials, and opportunities for further studies. During the first day of the workshop, speakers presented overviews of current spallation neutron sources. During the next 3 days, seven panels allowed speakers to present information on a variety of topics ranging from experimental and theoretical considerations on radiation damage to materials safety issues. An attempt was made to identify specific problems that require attention within the context of spallation neutron sources. This proceedings is a collection of summaries from the overview sessions and the panel presentations.

  14. Source counting in MEG neuroimaging

    Science.gov (United States)

    Lei, Tianhu; Dell, John; Magee, Ralphy; Roberts, Timothy P. L.

    2009-02-01

    Magnetoencephalography (MEG) is a multi-channel, functional imaging technique. It measures the magnetic field produced by the primary electric currents inside the brain via a sensor array composed of a large number of superconducting quantum interference devices. The measurements are then used to estimate the locations, strengths, and orientations of these electric currents. This magnetic source imaging technique encompasses a great variety of signal processing and modeling techniques which include Inverse problem, MUltiple SIgnal Classification (MUSIC), Beamforming (BF), and Independent Component Analysis (ICA) method. A key problem with Inverse problem, MUSIC and ICA methods is that the number of sources must be detected a priori. Although BF method scans the source space on a point-to-point basis, the selection of peaks as sources, however, is finally made by subjective thresholding. In practice expert data analysts often select results based on physiological plausibility. This paper presents an eigenstructure approach for the source number detection in MEG neuroimaging. By sorting eigenvalues of the estimated covariance matrix of the acquired MEG data, the measured data space is partitioned into the signal and noise subspaces. The partition is implemented by utilizing information theoretic criteria. The order of the signal subspace gives an estimate of the number of sources. The approach does not refer to any model or hypothesis, hence, is an entirely data-led operation. It possesses clear physical interpretation and efficient computation procedure. The theoretical derivation of this method and the results obtained by using the real MEG data are included to demonstrates their agreement and the promise of the proposed approach.

  15. SOURCE PHENOMENOLOGY EXPERIMENTS IN ARIZONA

    Energy Technology Data Exchange (ETDEWEB)

    Jessie L. Bonner; Brian Stump; Mark Leidig; Heather Hooper; Xiaoning (David) Yang; Rongmao Zhou; Tae Sung Kim; William R. Walter; Aaron Velasco; Chris Hayward; Diane Baker; C. L. Edwards; Steven Harder; Travis Glenn; Cleat Zeiler; James Britton; James F. Lewkowicz

    2005-09-30

    The Arizona Source Phenomenology Experiments (SPE) have resulted in an important dataset for the nuclear monitoring community. The 19 dedicated single-fired explosions and multiple delay-fired mining explosions were recorded by one of the most densely instrumented accelerometer and seismometer arrays ever fielded, and the data have already proven useful in quantifying confinement and excitation effects for the sources. It is very interesting to note that we have observed differences in the phenomenology of these two series of explosions resulting from the differences between the relatively slow (limestone) and fast (granodiorite) media. We observed differences at the two SPE sites in the way the rock failed during the explosions, how the S-waves were generated, and the amplitude behavior as a function of confinement. Our consortium's goal is to use the synergy of the multiple datasets collected during this experiment to unravel the phenomenological differences between the two emplacement media. The data suggest that the main difference between single-fired chemical and delay-fired mining explosion seismograms at regional distances is the increased surface wave energy for the latter source type. The effect of the delay-firing is to decrease the high-frequency P-wave amplitudes while increasing the surface wave energy because of the longer source duration and spall components. The results suggest that the single-fired explosions are surrogates for nuclear explosions in higher frequency bands (e.g., 6-8 Hz Pg/Lg discriminants). We have shown that the SPE shots, together with the mining explosions, are efficient sources of S-wave energy, and our next research stage is to postulate the possible sources contributing to the shear-wave energy.

  16. The Brazilian Synchrotron Light Source

    CERN Document Server

    Tavares, P F

    2005-01-01

    The Brazilian Synchrotron Radiation Laboratory has been operating the only light source in the southern hemisphere since July 1997. Over this 7 year period, approximately 22000 hours of beam time were delivered to users from all over Brazil as well as from 10 other countries. In this article, we report on the present configuration of the 1.37 GeV electron storage ring and associated instrumentation, describe recent improvements to the light source and analyze future prespectives including the installation of insertion devices and additional beamlines.

  17. Open source systems security certification

    CERN Document Server

    Damiani, Ernesto; El Ioini, Nabil

    2009-01-01

    Open Source Advances in Computer Applications book series provides timely technological and business information for: Enabling Open Source Systems (OSS) to become an integral part of systems and devices produced by technology companies; Inserting OSS in the critical path of complex network development and embedded products, including methodologies and tools for domain-specific OSS testing (lab code available), plus certification of security, dependability and safety properties for complex systems; Ensuring integrated systems, including OSS, meet performance and security requirements as well as achieving the necessary certifications, according to the overall strategy of OSS usage on the part of the adopter

  18. Consumer Trust in Information Sources

    Directory of Open Access Journals (Sweden)

    Brad Love

    2013-06-01

    Full Text Available Trust is essential to understanding public reaction to innovative issues. This research focuses on trust in information sources by explicating the construct of trust and testing a comprehensive model on several information sources about genetically modified foods. Results from a survey of 369 participants reveal the significance of projecting competence and the role of the environment in which a target public receives information. Perceptions of regulatory, social, business, and technical environments affect how likely individuals are to follow advice from institutions like the Food and Drug Administration and the news media. Future research should incorporate knowledge levels and personal relevance as variables likely to influence trusting relationships.

  19. Impedance Source Power Electronic Converters

    DEFF Research Database (Denmark)

    Liu, Yushan; Abu-Rub, Haitham; Ge, Baoming

    and technically feasible, efficient and reliable power converters for renewable energy, electric transportation and for various industrial applications. This book provides a detailed understanding of the concepts, designs, controls, and application demonstrations of the impedance source converters/inverters. Key...... control methods. Presents the latest power conversion solutions that aim to advance the role of power electronics into industries and sustainable energy conversion systems. Compares impedance source converter/inverter applications in renewable energy power generation and electric vehicles as well...... as different industrial applications. Provides an overview of existing challenges, solutions and future trends. Supported by calculation examples, simulation models and results....

  20. Energy source for comet outbursts

    Science.gov (United States)

    Patashnick, H.; Schuerman, D. W.; Rupprecht, G.

    1974-01-01

    Development of a mechanism explaining the internal source of energy of comet outbursts. A mechanism is proposed which automatically provides a source of particulate matter which creates a huge surface area which contains a substantial percentage of amorphous ice, so that the phase transition of the amorphous ice to a cubic structure provides a release of energy which may be responsible for the outbursts observed in many comets. In addition, the volume into which the transition can propagate is estimated for a spherical comet with a radius of 5 km.

  1. Sourcing teams and interdepartmental integration

    DEFF Research Database (Denmark)

    Lidegaard, Nina; Ellegaard, Chris; Møller, Morten Munksgaard

    2015-01-01

    Internal integration is often mentioned as a prerequisite for conducting strategic sourcing, as multiple functional departments must collaborate on creating value-creating activities amongst them. Though it is one of many possibilities, the use of cross-functional teams is often the most commonly...... proposed solution to ensure internal integration. This paper presents an exploratory case study evaluating the use of internal integration mechanisms in a cross-functional sourcing process. Two commodity categories are examined. One is organised in a cross-functional team, while the other is not. Findings...

  2. Modulation of Current Source Inverter

    Directory of Open Access Journals (Sweden)

    Golam Reza Arab Markadeh

    2011-04-01

    Full Text Available Direct torque control with Current Source Inverter (CSI instead of voltage source inverter is so appropriate because of determining the torque of induction motor with machine current and air gap flux. In addition, Space-Vector Modulation (SVM is a more proper method for CSI because of low order harmonics reduction, lower switching frequency and easier implementation. This paper introduces the SVM method for CSI and uses the proposed inverter for vector control of an induction motor. The simulation results illustrate fast dynamic response and desirable torque and speed output. Fast and accurate response to changes of speed and load torque reference completely proves the prominence of this method.

  3. Penetration Tester's Open Source Toolkit

    CERN Document Server

    Faircloth, Jeremy

    2011-01-01

    Great commercial penetration testing tools can be very expensive and sometimes hard to use or of questionable accuracy. This book helps solve both of these problems. The open source, no-cost penetration testing tools presented do a great job and can be modified by the user for each situation. Many tools, even ones that cost thousands of dollars, do not come with any type of instruction on how and in which situations the penetration tester can best use them. Penetration Tester's Open Source Toolkit, Third Edition, expands upon existing instructions so that a professional can get the most accura

  4. Alternative sources of natural rubber

    NARCIS (Netherlands)

    Mooibroek, H.; Cornish, K.

    2000-01-01

    Rubber (cis-1,4-polyisoprene) is one of the most important polymers naturally produced by plants because it is a strategic raw material used in more than 40,000 products, including more than 400 medical devices. The sole commercial source, at present, is natural rubber harvested from the Brazilian

  5. Open Source and Open Standards

    NARCIS (Netherlands)

    Koper, Rob

    2006-01-01

    Publication reference: Koper, R. (2008). Open Source and Open Standards. In J. M. Spector, M. Merrill, J. van Merriënboer & M. P. Driscol (Eds.), Handbook of Research on Educational Communications and Technology (3rd ed., pp. 355-368). New York: Routledge.

  6. Open source in Experimental Psychology

    OpenAIRE

    Dalmaijer, Edwin

    2015-01-01

    Talk on using open-source software in experimental psychology. Presented on 3 March 2015, at the Attention, Brain and Cognitive Development group (http://www.psy.ox.ac.uk/research/attention-brain-and-cognitive-development-group) at the University of Oxford's Department of Experimental Psychology.

  7. Primary Sources Enliven Civil War

    Science.gov (United States)

    Robelen, Erik W.

    2011-01-01

    Today, a growing number of teachers are moving beyond the textbook in teaching about the war, and U.S. history more broadly. Teachers are digging directly into primary sources and harnessing technology, all in an attempt to help students better understand the past and bring it to life. Doing so may be especially important with the Civil War,…

  8. Synchrotron-driven spallation sources

    CERN Document Server

    Bryant, P J

    1996-01-01

    The use of synchrotrons for pulsed neutron spallation sources is an example of scientific and technological spin-off from the accelerator development for particle physics. Accelerator-driven sources provide an alternative to the continuous-flux, nuclear reactors that currently furnish the majority of neutrons for research and development. Although the present demand for neutrons can be adequately met by the existing reactors, this situation is unlikely to continue due to the increasing severity of safety regulations and the declared policies of many countries to close down their reactors within the next decade or so. Since the demand for neutrons as a research tool is, in any case,expected to grow, there has been a corresponding interest in sources that are synchrotron-driven or linac-driven with a pulse compression ring and currently several design studies are being made. These accelerator-driven sources also have the advantage of a time structure with a high peak neutron flux. The basic requirement is for a...

  9. Govt. Pubs.: NTIS Reference Sources.

    Science.gov (United States)

    Korman, Richard; Aluri, Rao

    1980-01-01

    Cites review sources for NTIS (National Technical Information Service) publications and provides an annotated list of 22 reports on child abuse, Chinese language romanization, criminal justice, energy, environment, ethnic data, fire technology, genealogy, health care, local communities and federal assistance, mainstreaming, political leadership in…

  10. Open Source Wifi Hotspot Implementation

    Directory of Open Access Journals (Sweden)

    Tyler Sondag

    2007-06-01

    Full Text Available The goal of this paper is to describe a design—including the hardware, software, and configuration––for an open source wireless network. The network designed will require authentication. While care will be taken to keep the authentication exchange secure, the network will otherwise transmit data without encryption.

  11. Osteophytes - an alternative source of

    African Journals Online (AJOL)

    condyle (usually from the posterior cuts) were also enzymatically digested as for the cartilage from the ... articular cartilage defects, they may provide an alternative source of chondrocytes for transplantation in cases .... collagens and anti-mouse HRP conjugated secondary antibody was used for type II collagen. Results.

  12. PARTICULATE SOURCES IN LAGOS, NIGERIA

    African Journals Online (AJOL)

    Elemental concentrations of airborne particulate matter 9 sampled at three urban site classes m Lagos (an industrial city) 1n southWest Nigeria were subjected to statistical -' analysis to determine the number and nature of sources impacting the receptor sites. Inter-elemental Correlation, , '. Principal COmponent Factor ...

  13. Escaping "localisms" in IT sourcing

    DEFF Research Database (Denmark)

    Mola, L.; Carugati, Andrea

    2012-01-01

    Organizations are limited in their choices by the institutional environment in which they operate. This is particularly true for IT sourcing decisions that go beyond cost considerations and are constrained by traditions, geographical location, and social networks. This article investigates how a ...

  14. Finding radiant-energy sources

    Science.gov (United States)

    Schaffer, G. J.

    1978-01-01

    Antenna is scanned in orthogonal directions to pinpoint interfering sources. Satellite system locates ground-based microwave transmitter to accuracy of about 100 miles. When data on misalinement of satellite antenna boresight are used to correct antenna pointing, accuracy is improved to better than 70 miles.

  15. (SPWM) Voltage Source Inverter (VSI)

    African Journals Online (AJOL)

    The quest to achieve less-distorted dc-ac power conversion has resulted in the proliferation of many multilevel inverter configurations. This paper presents an experimental report of a simplified topology for single-phase, SPWM, three-level voltage source inverter wit R-L load. To keep the power circuit component count to a ...

  16. Organizing for External Knowledge Sourcing

    DEFF Research Database (Denmark)

    Rabbiosi, Larissa; Reichstein, Toke

    2011-01-01

    The aim of this article is to provide an introduction to the special issue. We briefly consider the external knowledge sourcing and organizing for innovation literatures, which offer a background for the special issue, and we highlight their mutual dialogue. We then illustrate the main findings...

  17. Anthropology: Guide to Reference Sources.

    Science.gov (United States)

    Mason, Mary G., Ed.

    More than 80 anthropology source materials concentrating on cultural and social anthropology are cited in this annotated bibliography. Materials, located in the McLennan Library at McGill University (Montreal), are listed according to type of material. Library of Congress call numbers are presented; dates of publication range from 1950 to 1985.…

  18. Land Streamer Surveying Using Multiple Sources

    KAUST Repository

    Mahmoud, Sherif

    2014-12-11

    Various examples are provided for land streamer seismic surveying using multiple sources. In one example, among others, a method includes disposing a land streamer in-line with first and second shot sources. The first shot source is at a first source location adjacent to a proximal end of the land streamer and the second shot source is at a second source location separated by a fixed length corresponding to a length of the land streamer. Shot gathers can be obtained when the shot sources are fired. In another example, a system includes a land streamer including a plurality of receivers, a first shot source located adjacent to the proximal end of the land streamer, and a second shot source located in-line with the land streamer and the first shot source. The second shot source is separated from the first shot source by a fixed overall length corresponding to the land streamer.

  19. EPA Region 1 Sole Source Aquifers

    Data.gov (United States)

    U.S. Environmental Protection Agency — This coverage contains boundaries of EPA-approved sole source aquifers. Sole source aquifers are defined as an aquifer designated as the sole or principal source of...

  20. Miniaturized cathodic arc plasma source

    Science.gov (United States)

    Anders, Andre; MacGill, Robert A.

    2003-04-15

    A cathodic arc plasma source has an anode formed of a plurality of spaced baffles which extend beyond the active cathode surface of the cathode. With the open baffle structure of the anode, most macroparticles pass through the gaps between the baffles and reflect off the baffles out of the plasma stream that enters a filter. Thus the anode not only has an electrical function but serves as a prefilter. The cathode has a small diameter, e.g. a rod of about 1/4 inch (6.25 mm) diameter. Thus the plasma source output is well localized, even with cathode spot movement which is limited in area, so that it effectively couples into a miniaturized filter. With a small area cathode, the material eroded from the cathode needs to be replaced to maintain plasma production. Therefore, the source includes a cathode advancement or feed mechanism coupled to cathode rod. The cathode also requires a cooling mechanism. The movable cathode rod is housed in a cooled metal shield or tube which serves as both a current conductor, thus reducing ohmic heat produced in the cathode, and as the heat sink for heat generated at or near the cathode. Cooling of the cathode housing tube is done by contact with coolant at a place remote from the active cathode surface. The source is operated in pulsed mode at relatively high currents, about 1 kA. The high arc current can also be used to operate the magnetic filter. A cathodic arc plasma deposition system using this source can be used for the deposition of ultrathin amorphous hard carbon (a-C) films for the magnetic storage industry.

  1. Discovery of TeV gamma-ray emission from the pulsar wind nebula 3C 58 by MAGIC

    Directory of Open Access Journals (Sweden)

    López-Coto Rubén

    2016-01-01

    Full Text Available The pulsar wind nebula (PWN 3C 58 is one of the historical very-high-energy (VHE; E>100 GeV gamma-ray source candidates. It has been compared to the Crab Nebula due to their morphological similarities. This object was detected by Fermi-LAT with a spectrum extending beyond 100 GeV. We analyzed 81 hours of 3C 58 data taken with the MAGIC telescopes and we detected VHE gamma-ray emission for the first time at TeV energies with a significance of 5.7 sigma and an integral flux of 0.65% C.U. above 1 TeV. According to our results 3C 58 is the least luminous PWN ever detected at VHE and the one with the lowest flux at VHE to date. We compare our results with the expectations of time-dependent models in which electrons up-scatter photon fields. The best representation favors a distance to the PWN of 2 kpc and Far Infrared (FIR comparable to CMB photon fields. Hadronic contribution from the hosting supernova remnant (SNR requires unrealistic energy budget given the density of the medium, disfavoring cosmic ray acceleration in the SNR as origin of the VHE gamma-ray emission.

  2. TSUNAMI INFORMATION SOURCES - PART 4

    Directory of Open Access Journals (Sweden)

    Robert L. Wiegel

    2006-01-01

    Full Text Available I have expanded substantially my list of information sources on: tsunami generation (sources, impulsive mechanisms, propagation, effects of nearshore bathymetry, and wave run-up on shore - including physical (hydraulic modeling and numerical modeling. This expanded list includes the subjects of field investigations of tsunamis soon after an event; damage effects in harbors on boats, ships, and facilities; tsunami wave-induced forces; damage by tsunami waves to structures on shore; scour/erosion; hazard mitigation; land use planning; zoning; siting, design, construction and maintenance of structures and infrastructure; public awareness and education; distant and local sources; tsunami warning and evacuation programs; tsunami probability and risk criteria. A few references are on "sedimentary signatures" useful in the study of historic and prehistoric tsunamis (paleo-tsunamis. In addition to references specifically on tsunamis, there are references on long water wave and solitary wave theory; wave refraction, diffraction, and reflection; shelf and basin free and forced oscillations (bay and harbor response; seiches; edge waves; Mach- reflection of long water waves ("stem waves"; wave run-up on shore; energy dissipation. All are important in understanding tsunamis, and in hazard mitigation. References are given on subaerial and submarine landslide (and rockfall generated waves in reservoirs, fjords, bays, and ocean; volcano explosive eruptions/collapse; underwater and surface explosions; asteroid impact. This report is in two parts: 1 Bibliographies, books and pamphlets, catalogs, collections, journals and newsletters, maps, organizations, proceedings, videos and photos; 2 Articles, papers, reports listed alphabetically by author.Many papers on the Indian Ocean (Sumatra tsunami of 26 December 2004, were given at the 22nd IUGG International Tsunami Symposium, Chania, Crete, 27-29 June 2005, but had not been published at the date of this report. For

  3. Leveraging External Sources of Innovation

    DEFF Research Database (Denmark)

    West, Joel; Bogers, Marcel

    2014-01-01

    suggests several gaps in prior research. One is a tendency to ignore the importance of business models, despite their central role in distinguishing open innovation from earlier research on interorganizational collaboration in innovation. Another gap is a tendency in open innovation to use “innovation......This paper reviews research on open innovation that considers how and why firms commercialize external sources of innovations. It examines both the “outside-in” and “coupled” modes of open innovation. From an analysis of prior research on how firms leverage external sources of innovation......, it suggests a four-phase model in which a linear process—(1) obtaining, (2) integrating, and (3) commercializing external innovations—is combined with (4) interaction between the firm and its collaborators. This model is used to classify papers taken from the top 25 innovation journals, complemented by highly...

  4. Resonance Ionization Laser Ion Sources

    CERN Document Server

    Marsh, B

    2013-01-01

    The application of the technique of laser resonance ionization to the production of singly charged ions at radioactive ion beam facilities is discussed. The ability to combine high efficiency and element selectivity makes a resonance ionization laser ion source (RILIS) an important component of many radioactive ion beam facilities. At CERN, for example, the RILIS is the most commonly used ion source of the ISOLDE facility, with a yearly operating time of up to 3000 hours. For some isotopes the RILIS can also be used as a fast and sensitive laser spectroscopy tool, provided that the spectral resolution is sufficiently high to reveal the influence of nuclear structure on the atomic spectra. This enables the study of nuclear properties of isotopes with production rates even lower than one ion per second and, in some cases, enables isomer selective ionization. The solutions available for the implementation of resonance laser ionization at radioactive ion beam facilities are summarized. Aspects such as the laser r...

  5. H$^-$ source developments at CERN

    CERN Document Server

    Hill, C E; Mastrostefano, C; O'Neill, M; Scrivens, R; Steiner, T

    2006-01-01

    Future CERN programs for the large hadron collider (LHC) and the isotope online separator (ISOLDE) require increasing the beam intensity and brightness from the proton synchrotron booster (PSB). This could be achieved by charge-exchange injection with phase-space painting into the PSB acceptance from a higher energy H/sup negative linac. A new injector will require a high performance, high reliability, negative hydrogen-ion source. This article will present the results achieved so far with a prototype microwave-driven source operated with three different magnetic structures (multicusp, solenoidal, and a combination of both). The experiments were carried out with different mixing gases, different chamber inserts, and under a wide range of operational conditions.

  6. Russian Virtual Observatory: data sources

    Science.gov (United States)

    Malkov, O.; Dluzhnevskaya, O.; Bakanas, E.; Kilpio, E.; Kniazev, A.; Kovaleva, D.; Mironov, A.; Pakhomov, Yu.; Ryabchikova, T.; Rykhlova, L.; Sachkov, M.; Sazonov, S.; Zhukov, A.

    The purpose of this review is to analyze main directions of creation and functioning of major data sources developed by Russian astronomers or with their participation and to compare them with the worldwide trends in these fields. We discuss astronomical space missions of the past, present, and future (Astron, INTEGRAL, WSO-UV, Spectrum Roentgen Gamma, Lyra-B), high-quality photometric atlases and catalogues, and spectroscopic data sources, primarily VALD and the global VAMDC framework for the maintenance and distribution of atomic and molecular data. We describe collection, analysis, and dissemination of astronomical data on minor bodies of the Solar System and on variable stars. Also described is the project joining data for all observational types of binary and multiple stars, Binary star DataBase (BDB).

  7. Distributed source coding of video

    DEFF Research Database (Denmark)

    Forchhammer, Søren; Van Luong, Huynh

    2015-01-01

    A foundation for distributed source coding was established in the classic papers of Slepian-Wolf (SW) [1] and Wyner-Ziv (WZ) [2]. This has provided a starting point for work on Distributed Video Coding (DVC), which exploits the source statistics at the decoder side offering shifting processing...... steps, conventionally performed at the video encoder side, to the decoder side. Emerging applications such as wireless visual sensor networks and wireless video surveillance all require lightweight video encoding with high coding efficiency and error-resilience. The video data of DVC schemes differ from...... the assumptions of SW and WZ distributed coding, e.g. by being correlated in time and nonstationary. Improving the efficiency of DVC coding is challenging. This paper presents some selected techniques to address the DVC challenges. Focus is put on pin-pointing how the decoder steps are modified to provide...

  8. The ILC polarized electron source

    CERN Document Server

    Brachmann, Axel; Garwin, Edward; Kirby, Robert; Luh Dah An; Maruyama, Takashi; Prepost, Richard; Schultz, David; Sheppard, John

    2005-01-01

    The SLC polarized electron source (PES) can meet the expected requirements of the International Linear Collider (ILC) for polarization, charge and lifetime. However, experience with newer and successful PES designs at JLAB, Mainz and elsewhere can be incorporated into a first-generation ILC source that will emphasize reliability and stability without compromising the photocathode performance. The long pulse train for the ILC may introduce new challenges for the PES, and in addition more reliable and stable operation of the PES may be achievable if appropriate R&D is carried out for higher voltage operation and for a simpler load-lock system. The outline of the R&D program currently taking shape at SLAC and elsewhere is discussed. The principal components of the proposed ILC PES, including the laser system necessary for operational tests, are described.

  9. The ILC Polarized Electron Source

    Energy Technology Data Exchange (ETDEWEB)

    Brachmann, A.

    2005-04-15

    The SLC polarized electron source (PES) can meet the expected requirements of the International Linear Collider (ILC) for polarization, charge and lifetime. However, experience with newer and successful PES designs at JLAB, Mainz, Nagoya and elsewhere can be incorporated into a first-generation ILC source that will emphasize reliability and stability without compromising the photocathode performance. The long pulse train for the ILC may introduce new challenges for the PES, and in addition more reliable and stable operation of the PES may be achievable if appropriate R&D is carried out for higher voltage operation and for a simpler load-lock system. The outline of the R&D program currently taking shape at SLAC and elsewhere is discussed. The principal components of the proposed ILC PES, including the laser system necessary for operational tests, are described.

  10. Water: Source of Future Conflict

    Science.gov (United States)

    2013-03-01

    United States. The lack of access to fresh water around the globe increases the risk of famine , instability, state failure, and regional tensions. Water...no other water source. Sudan, Ethiopia , and Uganda have constructed various river projects to increase their annual water withdrawals. These actions...share of the Nile water. The four countries included: Tanzania, Uganda, Rwanda, and Ethiopia . The new treaty was partially funded through loans from

  11. Environmental Source of Arsenic Exposure

    OpenAIRE

    Chung, Jin-Yong; Yu, Seung-Do; Hong, Young-Seoub

    2014-01-01

    Arsenic is a ubiquitous, naturally occurring metalloid that may be a significant risk factor for cancer after exposure to contaminated drinking water, cigarettes, foods, industry, occupational environment, and air. Among the various routes of arsenic exposure, drinking water is the largest source of arsenic poisoning worldwide. Arsenic exposure from ingested foods usually comes from food crops grown in arsenic-contaminated soil and/or irrigated with arsenic-contaminated water. According to a ...

  12. Tracing the source of campylobacteriosis.

    Directory of Open Access Journals (Sweden)

    Daniel J Wilson

    2008-09-01

    Full Text Available Campylobacter jejuni is the leading cause of bacterial gastro-enteritis in the developed world. It is thought to infect 2-3 million people a year in the US alone, at a cost to the economy in excess of US $4 billion. C. jejuni is a widespread zoonotic pathogen that is carried by animals farmed for meat and poultry. A connection with contaminated food is recognized, but C. jejuni is also commonly found in wild animals and water sources. Phylogenetic studies have suggested that genotypes pathogenic to humans bear greatest resemblance to non-livestock isolates. Moreover, seasonal variation in campylobacteriosis bears the hallmarks of water-borne disease, and certain outbreaks have been attributed to contamination of drinking water. As a result, the relative importance of these reservoirs to human disease is controversial. We use multilocus sequence typing to genotype 1,231 cases of C. jejuni isolated from patients in Lancashire, England. By modeling the DNA sequence evolution and zoonotic transmission of C. jejuni between host species and the environment, we assign human cases probabilistically to source populations. Our novel population genetics approach reveals that the vast majority (97% of sporadic disease can be attributed to animals farmed for meat and poultry. Chicken and cattle are the principal sources of C. jejuni pathogenic to humans, whereas wild animal and environmental sources are responsible for just 3% of disease. Our results imply that the primary transmission route is through the food chain, and suggest that incidence could be dramatically reduced by enhanced on-farm biosecurity or preventing food-borne transmission.

  13. An 'open source' networked identity

    DEFF Research Database (Denmark)

    Larsen, Malene Charlotte

    2013-01-01

    This paper examines the concept of identity in relation to youth practices on social network sites (SNS). The paper illustrates how writing “I love you” or other emotional statements on each other’s profiles on SNS is not only a common way for Danish teenagers to communicate and practice friendship...... communicative actions – are not only performing their own identity, but are becoming co-constructors of each other's identities, which the author characterizes as an 'open source' networked identity....

  14. Silicon sources for rice crop

    Directory of Open Access Journals (Sweden)

    Pereira Hamilton Seron

    2004-01-01

    Full Text Available Although silicon is not an essential nutrient, its application is beneficial for plant growth and development. To evaluate silicon sources in relation to agronomic efficiency and economic viability in rice crops (Oryza sativa L., a greenhouse experiment was conducted, Quartzipsamment soil, in a completely randomized experimental design (n = 4. Treatments were 12 silicon sources and a control. Silicon was applied at the rate of 125 kg Si ha-1. Data were compared to a standard response curve for Si using the standard source Wollastonite at rates of 0, 125, 250, 375, and 500 kg Si ha-1. All treatments received CaCO3 and MgCO3 to balance pH, Ca and Mg. One hundred and fifty days after sowing, evaluations on dry matter yield in the above-ground part of plants, grain yield, and Si contents in the soil and plant tissues were performed. Wollastonite had linear response, increasing silicon in the soil and plants with increasing application rates. Differences between silicon sources in relation to Si uptake were observed. Phosphate slag provided the highest Si uptake, followed by Wollastonite and electric furnace silicates which however, did not show differed among themselves. The highest Si accumulation in grain was observed for stainless steel, which significantly differed from the control, silicate clay, Wollastonite, and AF2 (blast furnace of the company 2 slag. Silicate clay showed the lowest Si accumulation in grain and did not differ from the control, AF2 slag, AF1 slag, schist ash, schist, and LD4 (furnace steel type LD of the company 4 slag.

  15. Increased security through open source

    OpenAIRE

    Hoepman, J.H.; Jacobs, B.P.F.

    2007-01-01

    In this paper we discuss the impact of open source on both the security and transparency of a software system. We focus on the more technical aspects of this issue, combining and extending arguments developed over the years. We stress that our discussion of the problem only applies to software for general purpose computing systems. For embedded systems, where the software usually cannot easily be patched or upgraded, different considerations may apply.

  16. Trust Revision for Conflicting Sources

    Science.gov (United States)

    2017-02-01

    analyst wants to include the realistic possibility that there can be rain and sunshine simultaneously, then the domain would need to include a...tative and idempotent; but it is not associative. IV. TRUST DISCOUNTING The general idea behind trust discounting is to express degrees of trust in an...A:C X is revised. Trust revision consists of increasing distrust at the cost of trust and uncertainty. The idea is that sources found to be unreliable

  17. 10 CFR 35.67 - Requirements for possession of sealed sources and brachytherapy sources.

    Science.gov (United States)

    2010-01-01

    ... brachytherapy sources. 35.67 Section 35.67 Energy NUCLEAR REGULATORY COMMISSION MEDICAL USE OF BYPRODUCT... brachytherapy sources. (a) A licensee in possession of any sealed source or brachytherapy source shall follow... brachytherapy sources, except for gamma stereotactic radiosurgery sources, shall conduct a semi-annual physical...

  18. Canonical Source Reconstruction for MEG

    Directory of Open Access Journals (Sweden)

    Jérémie Mattout

    2007-01-01

    Full Text Available We describe a simple and efficient solution to the problem of reconstructing electromagnetic sources into a canonical or standard anatomical space. Its simplicity rests upon incorporating subject-specific anatomy into the forward model in a way that eschews the need for cortical surface extraction. The forward model starts with a canonical cortical mesh, defined in a standard stereotactic space. The mesh is warped, in a nonlinear fashion, to match the subject's anatomy. This warping is the inverse of the transformation derived from spatial normalization of the subject's structural MRI image, using fully automated procedures that have been established for other imaging modalities. Electromagnetic lead fields are computed using the warped mesh, in conjunction with a spherical head model (which does not rely on individual anatomy. The ensuing forward model is inverted using an empirical Bayesian scheme that we have described previously in several publications. Critically, because anatomical information enters the forward model, there is no need to spatially normalize the reconstructed source activity. In other words, each source, comprising the mesh, has a predetermined and unique anatomical attribution within standard stereotactic space. This enables the pooling of data from multiple subjects and the reporting of results in stereotactic coordinates. Furthermore, it allows the graceful fusion of fMRI and MEG data within the same anatomical framework.

  19. Modelling Mt. Etna mantle sources

    Science.gov (United States)

    Casetta, Federico; Giacomoni, Pier Paolo; Coltorti, Massimo; Ferlito, Carmelo; Bonadiman, Costanza

    2017-04-01

    The mantle source beneath Mt. Etna is matter of a longstanding and controversial debate, due to the absence of mantle xenoliths, the evolved nature of the erupted magmas and their geochemical variations. This study is focused on the modelling of the petrogenetic processes responsible for the production of Mt. Etna magmas and their variation through time, by means of a comparison with the Hyblean lavas (Southern Sicily), their evolution and mantle source(s). Samples from all Mt. Etna eruptive events, from the tholeiites to the nowadays K-rich eruptions, were used to a backward reconstruction of the primitive magma compositions, taking into account the fO2 of the magmatic system and its effect on mineral-melt Fe partitioning. The eutectic melting proportions and the modal composition of the Mt. Etna mantle source, obtained by a mass balance melting model, allowed to: i) compare the etnean inferred primary magmas with the Ol-hosted melt inclusions (MI) composition and with the Hyblean real primary magmas; ii) define some petrologic and geodynamic constraints on the Hyblean-Mt. Etna area taking also in account the compositions of the Hyblean xenoliths. A 2% to 17% addition of dunitic to wehrlitic assemblages (Ol + Cpx in progressive equilibrium) to Mt. Etna less evolved lavas allowed to equilibrate the Mt. Etna primitive magmas (mg# = 68) compositions for Timpe, AAV, Ellittico, Mongibello and Post-1971 stages to mantle conditions; Ol with Fo=88). The calculated Lh source is constituted by Ol + Opx + Cpx + Cr-Sp, with addition of small amounts (4.3%) of Amph and Phlog. Decreasing partial melting degrees (from 19% to 13-10%) and a change in Amph and Phlog eutectic melting proportions can explain the entire Mt. Etna compositional range, from the tholeiitic event to the Post-1971 LILE-enriched episodes, leading to the production of primary magmas characterized by a 0.6 to 1.2 wt% H2O content. Some speculation between geodynamic and magmatic evolution of the articulated and

  20. Iranian Light Source Facility, A third generation light source laboratory

    Directory of Open Access Journals (Sweden)

    J Rahighi

    2015-09-01

    Full Text Available The Iranian Light Source Facility (ILSF project is the first large scale accelerator facility which is currently under planning in Iran. On the basis of the present design, circumference of the 3 GeV storage ring is 528 m. Beam current and natural beam emittance are 400 mA and 0.477 nm.rad, respectively. Some prototype accelerator components such as high power solid state radio frequency amplifiers, low level RF system, thermionic RF gun, H-type dipole and quadruple magnets, magnetic measurement laboratory and highly stable magnet power supplies have been constructed at ILSF R&D laboratory

  1. Characterization of ISOLDE ion source and ion source chemistry

    CERN Document Server

    Barbeau, Marion

    2014-01-01

    This report presents results of measurements made with the ISOLDE OFF-LINE mass separator [1]. The first part shows measurements of the ionization characteristics of noble gases in a VADIS ion source. The goal of the measurements was to determine the dependency of the extractable current of first and second noble gases ions with the electron energy. In the second part, investigation on in-target chemistry are presented. Here, the effect of injected sulfur hexafluoride ($SF_6$) on the release of oxygen from aluminium oxide ($Al_2 O_3$) was studied.

  2. When to make proprietary software open source

    NARCIS (Netherlands)

    Caulkins, J.P.; Feichtinger, G.; Grass, D.; Hartl, R.F.; Kort, P.M.; Seidl, A.

    Software can be distributed closed source (proprietary) or open source (developed collaboratively). While a firm cannot sell open source software, and so loses potential sales revenue, the open source software development process can have a substantial positive impact on the quality of a software,

  3. 21 CFR 640.60 - Source Plasma.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 7 2010-04-01 2010-04-01 false Source Plasma. 640.60 Section 640.60 Food and... ADDITIONAL STANDARDS FOR HUMAN BLOOD AND BLOOD PRODUCTS Source Plasma § 640.60 Source Plasma. The proper name of the product shall be Source Plasma. The product is defined as the fluid portion of human blood...

  4. Practical open source software for libraries

    CERN Document Server

    Engard, Nicole

    2010-01-01

    Open source refers to an application whose source code is made available for use or modification as users see fit. This means libraries gain more flexibility and freedom than with software purchased with license restrictions. Both the open source community and the library world live by the same rules and principles. Practical Open Source Software for Libraries explains the facts and dispels myths about open source. Chapters introduce librarians to open source and what it means for libraries. The reader is provided with links to a toolbox full of freely available open source products to use in

  5. ALTERNATIVE SOURCES OF ENERGY - ALTERNATIVE SOURCES OF POLLUTION?

    Directory of Open Access Journals (Sweden)

    Marius-Razvan SURUGIU

    2007-06-01

    Full Text Available In many countries of the world investments are made for obtaining energy efficiency, pursuing to increase the generation of non-polluting fuels due to the fact that energy is vital for any economy. The increase in non-polluting fuels and in renewable energy generation might lead to diminishing the dependence of countries less endowed with conventional energy resources on oil and natural gas from Russia or from Arab countries. Nevertheless, environmental issues represent serious questions facing the mankind, requiring the identification, prevention, and why not, their total solving.European Union countries depend on imports of energy, especially on oil imports. At the same time, the European Union countries record a high volume of greenhouse gas emissions, substances adding to global warming. The transport sector is the main consumer of fossil fuels and generator of greenhouse gas emissions. Therefore, diversifying the energy supply used in the transport sector with less polluting sources is an essential objective of the European Union policy in the transport, energy and environment sector. Road transports’ is the sector recording the highest consumption of energy and the highest volume of greenhouse gas emissions.The use of ecologic fuels in the transport sector is an important factor for achieving the objectives of European policies in the field. It is yet to be seen to what extent alternative energy sources are damaging to the environment, as it is a known fact that even for them is recorded a certain level of negative externalities.

  6. The HYPE Open Source Community

    Science.gov (United States)

    Strömbäck, L.; Pers, C.; Isberg, K.; Nyström, K.; Arheimer, B.

    2013-12-01

    The Hydrological Predictions for the Environment (HYPE) model is a dynamic, semi-distributed, process-based, integrated catchment model. It uses well-known hydrological and nutrient transport concepts and can be applied for both small and large scale assessments of water resources and status. In the model, the landscape is divided into classes according to soil type, vegetation and altitude. The soil representation is stratified and can be divided in up to three layers. Water and substances are routed through the same flow paths and storages (snow, soil, groundwater, streams, rivers, lakes) considering turn-over and transformation on the way towards the sea. HYPE has been successfully used in many hydrological applications at SMHI. For Europe, we currently have three different models; The S-HYPE model for Sweden; The BALT-HYPE model for the Baltic Sea; and the E-HYPE model for the whole Europe. These models simulate hydrological conditions and nutrients for their respective areas and are used for characterization, forecasts, and scenario analyses. Model data can be downloaded from hypeweb.smhi.se. In addition, we provide models for the Arctic region, the Arab (Middle East and Northern Africa) region, India, the Niger River basin, the La Plata Basin. This demonstrates the applicability of the HYPE model for large scale modeling in different regions of the world. An important goal with our work is to make our data and tools available as open data and services. For this aim we created the HYPE Open Source Community (OSC) that makes the source code of HYPE available for anyone interested in further development of HYPE. The HYPE OSC (hype.sourceforge.net) is an open source initiative under the Lesser GNU Public License taken by SMHI to strengthen international collaboration in hydrological modeling and hydrological data production. The hypothesis is that more brains and more testing will result in better models and better code. The code is transparent and can be changed

  7. PERSPECTIVE: Dust, fertilization and sources

    Science.gov (United States)

    Remer, Lorraine A.

    2006-11-01

    fraction that arrives at another continent [2]. At the deposition end of the chain, it is still unclear how the limited minerals in the dust such as iron are released for uptake by organisms either on land or in the ocean. Not all dust deposited into oceans results in a phytoplankton bloom. The process requires a chemical pathway that mobilizes a fraction of the iron into soluble form. Meskhidze et al [3] show that phytoplankton blooms following dust transport from the Gobi desert in Asia into the Pacific ocean result in a phytoplankton bloom only if the dust is accompanied by high initial SO2-to-dust ratios, suggesting that sulfuric acid coatings on the dust particle mobilize the embedded iron in the dust for phytoplankton uptake. Quantifying transport, deposition and nutrient availability are the latter ends of a puzzle that must begin by identifying and quantifying dust emission at the sources. The emission process is complex at the microscale requiring the right conditions for saltation and bombardment, which makes identification and inclusion of sources in global transport models very difficult. The result is that estimates of annual global dust emissions range from 1000 to 3000 Tg per year [4]. Even as global estimates of dust emissions are uncertain, localizing the sources brings even greater uncertainty. It has been recognized for several years that dust sources are not uniformly distributed over the arid regions of the Earth, but are regulated to topographic lows associated with dried lake deposits [5]. Using aerosol information from satellites, a comprehensive map of the world's source regions shows sources localized to specific areas of the Earth's arid regions [6]. Still these maps suggest broad emission sources covering several degrees of latitude and longitude. In the paper by Koren and co-authors [7] appearing in this issue, one particular dust source, the Bodélé depression in Chad, is analyzed in detail. They find that the specific topography of the

  8. Constraints on particle acceleration in SS433/W50 from MAGIC and H.E.S.S. observations

    OpenAIRE

    MAGIC Collaboration; Ahnen, M. L.; Ansoldi, S.; Antonelli, L. A.; Arcaro, C.; Babić, A.; B. Banerjee(Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Salt Lake, Sector-1, Kolkata 700064, India); P. Bangale(Max-Planck-Institut für Physik, D-80805 München, Germany); de Almeida, U. Barres; Barrio, J. A.; González, J. Becerra; Bednarek, W.; Bernardini, E.; Berti, A; B. Biasuzzi(b)

    2017-01-01

    The large jet kinetic power and non-thermal processes occurring in the microquasar SS 433 make this source a good candidate for a very high-energy (VHE) gamma-ray emitter. Gamma-ray fluxes have been predicted for both the central binary and the interaction regions between jets and surrounding nebula. Also, non-thermal emission at lower energies has been previously reported. We explore the capability of SS 433 to emit VHE gamma rays during periods in which the expected flux attenuation due to ...

  9. Testing the emission models of blazar jets with the MAGIC telescopes

    OpenAIRE

    Becerra-González, J.; Stamerra, A.; Saito, K.; Mazin, D.; Tavecchio, F.; Maraschi, L.; Prandini, E.; Sitarek, J.; Berger, K.; Collaboration, for the MAGIC

    2011-01-01

    The MAGIC telescopes discovered very high energy (VHE, E>100 GeV) gamma-ray emission coming from the distant Flat Spectrum Radio Quasar (FSRQ) PKS 1222+21 (4C +21.35, z=0.432). It is the second most distant VHE gamma-ray source, with well measured redshift, detected until now. The observation was performed on 2010 June 17 (MJD 55364.9) using the two 17 m diameter imaging Cherenkov telescopes on La Palma (Canary Islands, Spain). The MAGIC detection coincides with high energy MeV/GeV gamma-ray ...

  10. Towards a network of atmospheric Cherenkov detectors 7

    Energy Technology Data Exchange (ETDEWEB)

    Robin, M. [Ecole Polytechnique, 91 - Palaiseau (France); Weekes, T.C. [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA (United States); Mori, M. [Tokyo Univ., Institute for Cosmic Ray Research (Japan); Mariotti, M. [Padova Univ., INFN (Italy); Hofmann, W.; Aharonian, F. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Sinitsyna, V. [P.N. Lebedev Physical Institute, Moscow (Russian Federation); Smith, D. [Centre d' Etudes Nucleaires de Bordeaux Gradignan, 33 - Gradignan (France); Marleau, P. [California Univ., Davis, CA (United States); Sinnis, G. [Los Alamos National Lab., NM (United States); Volk, H. [Max-Planck-Institut fur Kernphysik (Germany); Jager, O. de [South Africa Univ., North-West (South Africa); Harding, A. [NASA Goddard Space Flight Center (United States); Coppi, P. [Yale Univ., New Haven, CT (United States); Dermer, C. [Naval Research Laboratory (United States); Goldwurm, A.; Paul, J. [CEA Saclay, Dept. d' Astrophysique, de Physique des Particules de Physique Nucleaire et de l' Instrumentation Associee, 91- Gif sur Yvette (France); Puhlhofer, G. [Landessternwarte Heidelberg (Germany); Bernardini, E. [DESy-Zeuthen (Germany); Swordy, S. [Chicago Univ., IL (United States); Yoshikoshi, T. [Tokyo Univ., Tanashi (Japan). Inst. for Cosmic Ray Research; Teshima, M. [Max-Planck-Institute for Physics, Munich (Germany); Punch, M. [Astrophysique et Cosmologie (APC), College de France, 75 - Paris (France)

    2005-07-01

    This document gathers the papers and transparencies presented at the conference. The main part of the conference was organized into 6 sessions: 1) the review of present experiments (Veritas, Cangaroo-3, Magic, Hess-1, Shalon, Cactus, Cygnus-X-3...), 2) calibration and analysis techniques in VHE (very high energy) astrophysics, 3) multi-wavelength observations and phenomenology of sources, 4) the future of ground-based VHE astronomy, 5) developments in instrumentation for Cherenkov telescopes, and 6) the evolution of the field and its link with mainstream astrophysics.

  11. Gamma source for active interrogation

    Science.gov (United States)

    Leung, Ka-Ngo; Lou, Tak Pui; Barletta, William A.

    2012-10-02

    A cylindrical gamma generator includes a coaxial RF-driven plasma ion source and target. A hydrogen plasma is produced by RF excitation in a cylindrical plasma ion generator using an RF antenna. A cylindrical gamma generating target is coaxial with the ion generator, separated by plasma and extraction electrodes which has many openings. The plasma generator emanates ions radially over 360.degree. and the cylindrical target is thus irradiated by ions over its entire circumference. The plasma generator and target may be as long as desired.

  12. Organising purchasing and (strategic) sourcing

    DEFF Research Database (Denmark)

    Lidegaard, Nina; Boer, Harry; Munkgaard Møller, Morten

    2015-01-01

    The role of purchasing has changed over the past two to three decades. The focus is no longer limited to purchasing manufacturing inputs, but also includes sourcing of innovations from, and even co-developing technologies together with, suppliers. Furthermore, purchasing has obtained a much more...... mature role in corporate strategy. These changes have serious implications for the purchasing process, its characteristics and organisation. Previous research indicates that none of the prevailing solutions, functional departments and cross-functional teams, embedded in a centralised, decentralised...

  13. Gamma source for active interrogation

    Science.gov (United States)

    Leung, Ka-Ngo [Hercules, CA; Lou, Tak Pui [Berkeley, CA; Barletta, William A [Oakland, CA

    2009-09-29

    A cylindrical gamma generator includes a coaxial RF-driven plasma ion source and target. A hydrogen plasma is produced by RF excitation in a cylindrical plasma ion generator using an RF antenna. A cylindrical gamma generating target is coaxial with the ion generator, separated by plasma and extraction electrodes which has many openings. The plasma generator emanates ions radially over 360.degree. and the cylindrical target is thus irradiated by ions over its entire circumference. The plasma generator and target may be as long as desired.

  14. A source book in physics

    CERN Document Server

    Magie, William Francis

    1969-01-01

    This is the reprint of a well-known and valuable work that has been out of print and widely sought for a number of years. A volume in the series of Source Books in the History of the Sciences, it consists of selections from the writings of the great physicists from the 16th through the 19th century - such figures as Galileo and Newton, Franklin and Faraday, Rowland, Hertz, and the Curies - making available to the student in English translation their most important contributions, described in their own words, together with biographical and explanatory notes by the editor.

  15. Source Code Management and Software Distribution using Open Source Technologies

    Science.gov (United States)

    Bly, M. J.; Allan, A.; Jenness, T.

    The Starlink Software Collection (USSC) runs on three different platforms and contains approximately 130 separate software items, totaling over 6 million lines of code. Distribution of such large software systems and installation at multiple remote sites has always been problematic due to the complex web of inter-dependencies such systems invariably generate. The rise of the Open Source movement has brought standard tools into common use to cope with such large and complex tasks. The RedHat Package Manager (RPM) software is one such which is available for many platforms. We have shown it is possible to automate the distribution and installation of the Starlink Software using RPM. We anticipate that this will vastly simplify installation and package management for Systems Administrators who must support the USSC in production data processing environments.

  16. DHAid™ – The vegetarian source

    Directory of Open Access Journals (Sweden)

    Freitas Ulla

    2008-07-01

    Full Text Available In humans, DHA occurs naturally as a cell membrane fatty acid in the brain, retina, testes and sperm, and has been reported to be essential in the development of these organs and cells. There it is crucial for the functioning of embedded proteins, i.e. rhodopsin for vision and postsynaptic receptors for neurotransmission. In phospholipids in general, DHA contributes to membrane properties such as fluidity, flexibility and permeability. A deficiency in DHA can lead to memory loss, learning disabilities and impaired visual acuity. Limited storage of DHA in adipose tissue suggests that a continuous supply is needed. These facts clearly demonstrate the physiological importance of DHA for humans and have resulted, for example, in the recommendation of increasing dietary intake of DHA during pregnancy and lactation. Also in the maintenance of cardiovascular health, DHA plays an important role. DHAid™ is a pure vegetarian source of omega-3 docosahexaenoic acid (DHA. It is produced from microalgae in a controlled process in fermentation vessels by the Swiss life-science company Lonza. Due to its renewable sources, DHAid™ is environmentally friendly. DHAid™ is allergen free and is free of potential contaminants that are discussed for seafood.

  17. Fungi: the neglected allergenic sources.

    Science.gov (United States)

    Crameri, R; Garbani, M; Rhyner, C; Huitema, C

    2014-02-01

    Allergic diseases are considered the epidemics of the twentieth century estimated to affect more than 30% of the population in industrialized countries with a still increasing incidence. During the past two decades, the application of molecular biology allowed cloning, production and characterization of hundreds of recombinant allergens. In turn, knowledge about molecular, chemical and biologically relevant allergens contributed to increase our understanding of the mechanisms underlying IgE-mediated type I hypersensitivity reactions. It has been largely demonstrated that fungi are potent sources of allergenic molecules covering a vast variety of molecular structures including enzymes, toxins, cell wall components and phylogenetically highly conserved cross-reactive proteins. Despite the large knowledge accumulated and the compelling evidence for an involvement of fungal allergens in the pathophysiology of allergic diseases, fungi as a prominent source of allergens are still largely neglected in basic research as well as in clinical practice. This review aims to highlight the impact of fungal allergens with focus on asthma and atopic dermatitis. © 2013 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  18. TSUNAMI INFORMATION SOURCES PART 2

    Directory of Open Access Journals (Sweden)

    Robert L. Wiegel

    2006-01-01

    Full Text Available Tsunami Information Sources (Robert L. Wiegel, University of California, Berkeley, CA, UCB/HEL 2005-1, 14 December 2005, 115 pages, is available in printed format, and on a diskette. It is also available in electronic format at the Water Resources Center Archives, University of California, Berkeley, CA http:www.lib.berkeley.edu/WRCA/tsunamis.htmland in the International Journal of The Tsunami Society, Science of Tsunami Hazards (Vol. 24, No. 2, 2006, pp 58-171 at http://www.sthjournal.org/sth6.htm.This is Part 2 of the report. It has two components. They are: 1.(Sections A and B. Sources added since the first report, and corrections to a few listed in the first report. 2.(Sections C and D. References from both the first report and this report, listed in two categories:Section C. Planning and engineering design for tsunami mitigation/protection; adjustments to the hazard; damage to structures and infrastructureSection D. Tsunami propagation nearshore; induced oscillations; runup/inundation (flooding and drawdown.

  19. Environmental source of arsenic exposure.

    Science.gov (United States)

    Chung, Jin-Yong; Yu, Seung-Do; Hong, Young-Seoub

    2014-09-01

    Arsenic is a ubiquitous, naturally occurring metalloid that may be a significant risk factor for cancer after exposure to contaminated drinking water, cigarettes, foods, industry, occupational environment, and air. Among the various routes of arsenic exposure, drinking water is the largest source of arsenic poisoning worldwide. Arsenic exposure from ingested foods usually comes from food crops grown in arsenic-contaminated soil and/or irrigated with arsenic-contaminated water. According to a recent World Health Organization report, arsenic from contaminated water can be quickly and easily absorbed and depending on its metabolic form, may adversely affect human health. Recently, the US Food and Drug Administration regulations for metals found in cosmetics to protect consumers against contaminations deemed deleterious to health; some cosmetics were found to contain a variety of chemicals including heavy metals, which are sometimes used as preservatives. Moreover, developing countries tend to have a growing number of industrial factories that unfortunately, harm the environment, especially in cities where industrial and vehicle emissions, as well as household activities, cause serious air pollution. Air is also an important source of arsenic exposure in areas with industrial activity. The presence of arsenic in airborne particulate matter is considered a risk for certain diseases. Taken together, various potential pathways of arsenic exposure seem to affect humans adversely, and future efforts to reduce arsenic exposure caused by environmental factors should be made.

  20. Environmental Source of Arsenic Exposure

    Directory of Open Access Journals (Sweden)

    Jin-Yong Chung

    2014-09-01

    Full Text Available Arsenic is a ubiquitous, naturally occurring metalloid that may be a significant risk factor for cancer after exposure to contaminated drinking water, cigarettes, foods, industry, occupational environment, and air. Among the various routes of arsenic exposure, drinking water is the largest source of arsenic poisoning worldwide. Arsenic exposure from ingested foods usually comes from food crops grown in arsenic-contaminated soil and/or irrigated with arsenic-contaminated water. According to a recent World Health Organization report, arsenic from contaminated water can be quickly and easily absorbed and depending on its metabolic form, may adversely affect human health. Recently, the US Food and Drug Administration regulations for metals found in cosmetics to protect consumers against contaminations deemed deleterious to health; some cosmetics were found to contain a variety of chemicals including heavy metals, which are sometimes used as preservatives. Moreover, developing countries tend to have a growing number of industrial factories that unfortunately, harm the environment, especially in cities where industrial and vehicle emissions, as well as household activities, cause serious air pollution. Air is also an important source of arsenic exposure in areas with industrial activity. The presence of arsenic in airborne particulate matter is considered a risk for certain diseases. Taken together, various potential pathways of arsenic exposure seem to affect humans adversely, and future efforts to reduce arsenic exposure caused by environmental factors should be made.

  1. Light Sources and Lighting Circuits

    Science.gov (United States)

    Honda, Hisashi; Suwa, Takumi; Yasuda, Takeo; Ohtani, Yoshihiko; Maehara, Akiyoshi; Okada, Atsunori; Komatsu, Naoki; Mannami, Tomoaki

    According to the Machinery Statistics of the Ministry of Economy, Trade and Industry, the production of incandescent lamps in Japan in 2007 was 990 million units (90.0% of the previous year's total), in which the production of incandescent lamps for general lighting was 110 million units (90.0% of the previous year's total) and of tungsten-halogen lamps was 44 million units (96.6% of the previous year's total). The production of fluorescent lamps was 927 million units (93.9% of the previous year's total), in which general fluorescent lamps, excluding those for LCD back lighting, was 320 million units (87.2% of the previous year's total). Also, the production of HID lamps was 10 million units (101.5% of the previous year's total). On the other hand, when the numbers of sales are compared with the sales of the previous year, incandescent lamps for general use was 99.8%, tungsten-halogen lamps was 96.9%, fluorescent lamps was 95.9%, and HID lamps was 98.9%. Self-ballasted fluorescent lamps alone showed an increase in sales as strong as 29 million units, or 121.7% of the previous year's sales. It is considered that the switchover of incandescent lamps to HID lamps was promoted for energy conservation and carbon dioxide reduction with the problem of global warming in the background. In regard to exhibitions, Lighting Fair 2007 was held in Tokyo in March, and LIGHTFAIR INTERNATIONAL 2007 was held in New York in May. Regarding academic conferences, LS:11 (the 11th International Symposium on the Science & Technology of Light Sources) was held in Shanghai in May, and the First International Conference on White LEDs and Solid State Lighting was held in Tokyo in November. Both conferences suggested that there are strong needs and concerns now about energy conservation, saving natural resources, and restrictions of hazardous materials. In regard to incandescent lamps, the development of products aiming at higher efficacy, electric power savings, and longer life was advanced by

  2. Electromagnetic tomography via source-space-ICA.

    Science.gov (United States)

    Jonmohamadi, Yaqub; Poudel, Govinda; Innes, Carrie; Jones, Richard D

    2013-01-01

    We propose a technique, called source-space-ICA to provide spatiotemporal reconstruction of brain sources. First, the weight-vector-normalized minimum variance beamformer is applied to reconstruct the electrical activity of a 3D scanning grid which covers the whole brain. Second, principal component analysis is used to reduce the dimension of the reconstructed signal matrix of the source-space, then independent component analysis (ICA) is applied on the resulting matrix to identify multiple signal sources in the source-space. Third, the demixing weight vectors obtained by ICA for the identified independent components are projected back into the SS to obtain tomographic maps of the sources. Besides localization, the proposed source-space-ICA approach reconstructs the time-course of each source in a single time-series without requiring prior knowledge of location, orientation, and number of sources for a given segment of EEG/MEG. Simulated EEG was used to evaluate the source-space-ICA. The results show that the source-space-ICA approach is able to separate and localize multiple weak sources and is robust to interference from other sources as it identifies the sources based on their statistical independence.

  3. Experimental study on partial coherence source

    CERN Document Server

    Zhao Xue Qing; Yuan Xiao; LiuJingRu; Wang Long Hua; Tang Ying; Huang, Kerson

    2002-01-01

    Partial coherence source is a key part in the laser system using echelon-free introduced spatial incoherence beam smoothing technique. Different kinds of partial coherence sources have been studied experimentally for improving the uniformity of laser intensity distribution. It is found that the source produced by excimer laser scattering on the surface of a teflon plate is ideal. The properties of this kind of source are studied. As a result, the uniformity of source beam intensity distribution, the beam spatial coherence and energy transfer efficiency of the source are obtained

  4. Leveraging Synergiesn in Global Sourcing

    DEFF Research Database (Denmark)

    Englyst, Linda; Stegmann Mikkelsen, Ole; Johansen, John

    2005-01-01

    Leveraging synergies in global sourcing is not a straightforward task, and requires a balanced approach to organizing, taking into consideration a number of situational factors. These include, but are not limited to, strategic significance, product specificity, market complexity, coherency...... and the need to involve low-interest parties to obtain synergies. The research advances three dimensions of purchasing organisation, namely coordination structure, compliance mechanism and synergy content. It is argued that these dimensions may be combined to yield various hybrid organisational forms, while...... it is recognised that some combinations are probably likely to occur more naturally and beneficially than others, as contingency factors may impact more than one dimension. In that sense, the dimensions are not entirely independent. The research findings are based primarily on empirical evidence from an industrial...

  5. Future of Open Source systems

    Directory of Open Access Journals (Sweden)

    Karel Charvát

    2010-02-01

    Full Text Available Software distribution strategies have many aspects and can be analysed by reviewing different incisions of a strategy. The focus of this paper is on Licensing aspect involves licensing strategy, licensing risks, licensing enforcement costs. Furthermore, by formulating licensing strategy main technical and logistical aspects are predicted also. The key issues of this paper are different business modes for FOSS software and also SWOT analysis of usage and development of FOSS software from point of view of different user groups. This analysis was provided as part of work of Humboldt IP and collaborative@rural IP. Currently this strategy are important issue of members of Czech Centre for Science and Society and WirelessInfo Living Lab, where the models based on dual licensing are key strategy.Keywords: Open Source, Licensing, FOSS base business models. SWOT analysis, Knowledge society, Knowledge economy

  6. Source mechanisms of volcanic tsunamis.

    Science.gov (United States)

    Paris, Raphaël

    2015-10-28

    Volcanic tsunamis are generated by a variety of mechanisms, including volcano-tectonic earthquakes, slope instabilities, pyroclastic flows, underwater explosions, shock waves and caldera collapse. In this review, we focus on the lessons that can be learnt from past events and address the influence of parameters such as volume flux of mass flows, explosion energy or duration of caldera collapse on tsunami generation. The diversity of waves in terms of amplitude, period, form, dispersion, etc. poses difficulties for integration and harmonization of sources to be used for numerical models and probabilistic tsunami hazard maps. In many cases, monitoring and warning of volcanic tsunamis remain challenging (further technical and scientific developments being necessary) and must be coupled with policies of population preparedness. © 2015 The Author(s).

  7. Capillary Discharge XUV Radiation Source

    Directory of Open Access Journals (Sweden)

    M. Nevrkla

    2009-01-01

    Full Text Available A device producing Z-pinching plasma as a source of XUV radiation is described. Here a ceramic capacitor bank pulse-charged up to 100 kV is discharged through a pre-ionized gas-filled ceramic tube 3.2 mm in diameter and 21 cm in length. The discharge current has amplitude of 20 kA and a rise-time of 65 ns. The apparatus will serve as experimental device for studying of capillary discharge plasma, for testing X-ray optics elements and for investigating the interaction of water-window radiation with biological samples. After optimization it will be able to produce 46.9 nm laser radiation with collision pumped Ne-like argon ions active medium. 

  8. Hybrid-Source Impedance Networks

    DEFF Research Database (Denmark)

    Li, Ding; Gao, Feng; Loh, Poh Chiang

    2010-01-01

    Hybrid-source impedance networks have attracted attention among researchers because of their flexibility in performing buck-boost energy conversion. To date, three distinct types of impedance networks can be summarized for implementing voltage-type inverters with another three types summarized...... for current-type inverters. These impedance networks can in principle be combined into two generic network entities, before multiple of them can further be connected together by applying any of the two proposed generalized cascading concepts. The resulting two-level and three-level inverters implemented using...... the cascaded networks would have a higher output voltage gain and other unique advantages that currently have not been investigated yet. It is anticipated that these advantages would help the formed inverters find applications in photovoltaic and other renewable systems, where a high voltage gain is usually...

  9. Radio Frequency Energy Harvesting Sources

    Directory of Open Access Journals (Sweden)

    Action NECHIBVUTE

    2017-12-01

    Full Text Available This radio frequency (RF energy harvesting is an emerging technology and research area that promises to produce energy to run low-power wireless devices. The great interest that has recently been paid to RF harvesting is predominantly driven by the great progress in both wireless communication systems and broadcasting technologies that have availed a lot of freely propagating ambient RF energy. The principle aim of an RF energy harvesting system is to convert the received ambient RF energy into usable DC power. This paper presents a state of the art concise review of RF energy harvesting sources for low power applications, and also discusses open research questions and future research directions on ambient RF energy harvesting.

  10. General Purpose Heat Source Simulator

    Science.gov (United States)

    Emrich, Bill

    2008-01-01

    The General Purpose Heat Source (GPHS) simulator project is designed to replicate through the use of electrical heaters, the form, fit, and function of actual GPHS modules which generate heat through the radioactive decay of Pu238. The use of electrically heated modules rather than modules containing Pu238 facilitates the testing of spacecraft subsystems and systems without sacrificing the quantity and quality of the test data gathered. Previous GPHS activities are centered around developing robust heater designs with sizes and weights that closely matched those of actual Pu238 fueled GPHS blocks. These efforts were successful, although their maximum temperature capabilities were limited to around 850 C. New designs are being pursued which also replicate the sizes and weights of actual Pu238 fueled GPHS blocks but will allow operation up to 1100 C.

  11. Gravitational energy sources in Jupiter

    Science.gov (United States)

    Flasar, F. M.

    1973-01-01

    Gravitational sources of the intrinsic luminosity of Jupiter are examined in the context of current hydrogen-helium models. When no gravitational separation of matter occurs, the amount of heat which can be released over the remaining lifetime of the planet is necessarily limited by the size of its existing reservoir of thermal energy. This conclusion rests only on the assumption that its interior is relatively cold and degenerate. If gravitational unmixing occurs, the size of the thermal reservoir does not necessarily limit the heat output. If core formation occurs, for example, then the size of the core formed will be a limiting factor. The energy released with the formation of a helium core is computed for Jupiter. A core growth rate, averaged over several billion years, of 20 trillionths of Jupiter's mass per year is required if gravitational separation is to play a significant role in the thermal evolution.

  12. [Perinatal sources of stem cells].

    Science.gov (United States)

    Piskorska-Jasiulewicz, Magdalena Maria; Witkowska-Zimny, Małgorzata

    2015-03-08

    Recently, stem cell biology has become an interesting topic. Several varieties of human stem cells have been isolated and identified in vivo and in vitro. Successful application of hematopoietic stem cells in hematology has led to the search for other sources of stem cells and expanding the scale of their application. Perinatal stem cells are a versatile cell population, and they are interesting for both scientific and practical objectives. Stem cells from perinatal tissue may be particularly useful in the clinic for autologous transplantation for fetuses and newborns, and after banking in later stages of life, as well as for in utero transplantation in the case of genetic disorders. In this review paper we focus on the extraction and therapeutic potential of stem cells derived from perinatal tissues such as the placenta, the amnion, amniotic fluid, umbilical cord blood and Wharton's jelly.

  13. Patients experience of source isolation

    DEFF Research Database (Denmark)

    Johansen, Kamilla; Pedersen, Didde; Kragbak, Nina

    2014-01-01

    , Nursing education in Århus, Hedeager 2, 8200 Aarhus N, Denmark. Background: Medical treatment and care of patients with infections may include source isolation of the patient, to avoid spreading of the infection. However, isolation is a potential physiological and psychological stress factor...... of the patients perspectives of being isolated to identify areas of potential interest for developing new caring strategies to minimize the negative side effects of isolation. Methods: Literature was systematically searched in CINAHL, Nursing Reference Center, Social Care Online, SveMed+, The Cochrane Library...... of Care: The patients felt abandoned and forgotten by the nurses, because of fewer visits and time limited communication. This led to emotions such as frustrations, insecurity and neglect. While isolated the patients felt it difficult to achieve contact and have an optimal relation with the nurses...

  14. Coherent source radius in ppbar collisions

    OpenAIRE

    Zhang, Q. H.; Li, X. Q.

    1997-01-01

    We use a recently derived result to extract from two-pion interferometry data from $p\\bar{p}$ collisions the radius of the coherent component in the source. We find a coherent source radius of about $2 fm$.

  15. Renewable Sources of Energy and Development.

    Science.gov (United States)

    Diatta, Christian Sina

    1979-01-01

    Reviewed are the status of conventional sources of energy, prospects for the development of alternative sources of energy, and the consequences of that development on countries that are in the process of industrialization. (BT)

  16. LAT Monitored Source List Light Curves

    Data.gov (United States)

    National Aeronautics and Space Administration — The LAT team monitors flux values for a number of bright sources and transient sources that have shown flares during the mission. (See up-to-date weekly reports on...

  17. Driver circuit for solid state light sources

    Science.gov (United States)

    Palmer, Fred; Denvir, Kerry; Allen, Steven

    2016-02-16

    A driver circuit for a light source including one or more solid state light sources, a luminaire including the same, and a method of so driving the solid state light sources are provided. The driver circuit includes a rectifier circuit that receives an alternating current (AC) input voltage and provides a rectified AC voltage. The driver circuit also includes a switching converter circuit coupled to the light source. The switching converter circuit provides a direct current (DC) output to the light source in response to the rectified AC voltage. The driver circuit also includes a mixing circuit, coupled to the light source, to switch current through at least one solid state light source of the light source in response to each of a plurality of consecutive half-waves of the rectified AC voltage.

  18. Cascaded trans-z-source inverters

    DEFF Research Database (Denmark)

    Li, Ding; Loh, Poh Chiang; Zhu, Miao

    2011-01-01

    Z-source inverter is a recently proposed single-stage inverter with added voltage-boost capability for complementing the usual voltage-buck operation of a traditional voltage-source inverter. As long as the transformer element added in to the z-source concept, a trans-z-source inverter with one...... transformer and one capacitor is reported recently. This paper has adapted the cascaded concept into the trans-z-source and trans-quasi-z-source inverters to extend each to the cascaded topologies before combination is made with allowing more sources embedded which reduces the capacitor voltage and enhanced...... the compatibility for distributed sources. Unlike existing techniques, voltage stresses within the proposed inverters are better distributed among the passive components. Theoretical analysis for explaining these operating features has already been discussed before simulation were performed and an experimental...

  19. HYBRID POWER HARVESTER USING ENGINE SOURCE

    OpenAIRE

    Meeran Mydeen, A.Ahmed; Inasu, Kelwin; Venkatesh, M.; Suthesh, C.

    2017-01-01

    In mainly we present a compact, multisource and battery-free energy harvesting from engine source. This battery free generator captures energy from its environment transient thermal gradients as a main source, and vibration as a secondary source allowing early biasing of the generator and stores this energy in ultra-capacitors .In this way, this multi-source architecture benefits from the synergy between energy scavenging and harvesting.

  20. Evolution of open source networks in industry

    NARCIS (Netherlands)

    de Laat, P.B.

    2004-01-01

    The open source software movement has become a threat to corporate software development. In response, companies started to develop products and services related to open source software. Subsequently, they also tried to come to terms with the processes that are characteristic of open source software

  1. Learning the Semantics of Structured Data Sources

    Science.gov (United States)

    Taheriyan, Mohsen

    2015-01-01

    Information sources such as relational databases, spreadsheets, XML, JSON, and Web APIs contain a tremendous amount of structured data, however, they rarely provide a semantic model to describe their contents. Semantic models of data sources capture the intended meaning of data sources by mapping them to the concepts and relationships defined by a…

  2. Optimising carbon and nitrogen sources for Azotobacter ...

    African Journals Online (AJOL)

    The present work deals with selecting and optimization of carbon and nitrogen sources for producing biomass from Azotobacter chroococcum. Four carbon sources (glucose, sucrose, manitol and sodium benzoate) and four nitrogen sources (yeast extract, meat extract, NH4Cl and (NH4)2SO4) were evaluated during the first ...

  3. Visualizing spikes in source-space

    DEFF Research Database (Denmark)

    Beniczky, Sándor; Duez, Lene; Scherg, Michael

    2016-01-01

    signals in source-space was developed using a source-montage of 29 brain-regions and two spatial components to remove magnetocardiographic (MKG) artefacts. Our objective was to evaluate the accuracy of reviewing MEG in source-space. METHODS: In 60 consecutive patients with epilepsy, we prospectively...

  4. Backup power sources for DOE facilities

    Energy Technology Data Exchange (ETDEWEB)

    1994-09-01

    This standard establishes fundamental requirements and guidance for backup power sources at DOE facilities. Purpose is to document good engineering practices for installation, testing, and maintenance of these backup power sources, which also covers emergency power sources. Examples are those which supply power to nuclear safety systems, radiation monitors and alarms, fire protection systems, security systems, and emergency lighting.

  5. Highly efficient sources of single indistinguishable photons

    DEFF Research Database (Denmark)

    Gregersen, Niels

    2013-01-01

    Solid-state sources capable of emitting single photons on demand are of great interest in quantum information applications. Ideally, such a source should emit exactly one photon into the collection optics per trigger, the emitted photons should be indistinguishable and the source should...

  6. Upgrade and performance of the VERITAS telescope array

    Energy Technology Data Exchange (ETDEWEB)

    Rajotte, Jean-Francois

    2014-12-01

    The VERITAS collaboration has been observing VHE (E>100GeV) gamma rays since 2007. It has recently completed major upgrades of the photomultiplier tubes and pattern trigger. More than a year after these implementations, these efforts have shown to improve the performance with better noise reduction, faster source detection and lowered energy threshold. Further benefits are also expected from these upgrades.

  7. Foundations of DC plasma sources

    Science.gov (United States)

    Tomas Gudmundsson, Jon; Hecimovic, Ante

    2017-12-01

    A typical dc discharge is configured with the negative cathode at one end and a positive anode at the other end, separated by a gas filled gap, placed inside a long glass cylinder. A few hundred volts between the cathode and anode is required to maintain the discharge. The type of discharge that is formed between the two electrodes depends upon the pressure of the working gas, the nature of the working gas, the applied voltage and the geometry of the discharge. We discuss the current–voltage characteristics of the discharge as well as the distinct structure that develops in the glow discharge region. The dc glow discharge appears in the discharge current range from μA to mA at 0.5–300 Pa pressure. We discuss the various phenomena observed in the dc glow discharge, including the cathode region, the positive column, and striations. The dc glow discharge is maintained by the emission of secondary electrons from the cathode target due to the bombardment of ions. For decades, the dc glow discharge has been used as a sputter source. Then it is often operated as an obstructed abnormal glow discharge and the required applied voltage is in the range 2–5 kV. Typically, the cathode target (the material to be deposited) is connected to a negative voltage supply (dc or rf) and the substrate holder faces the target. The relatively high operating pressure, in the range from 2 to 4 Pa, high applied voltages, and the necessity to have a conductive target limit the application of dc glow discharge as a sputter source. In order to lower the discharge voltage and expand the operation pressure range, the lifetime of the electrons in target vicinity is increased through applying magnetic field, by adding permanent magnets behind the cathode target. This arrangement is coined the magnetron sputtering discharge. The various configurations of the magnetron sputtering discharge and its applications are described. Furthermore, the use of dc discharges for chemical analysis, the

  8. Source attribution of tropospheric ozone

    Science.gov (United States)

    Butler, T. M.

    2015-12-01

    Tropospheric ozone is a harmful pollutant with adverse effects on human health and ecosystems. As well as these effects, tropospheric ozone is also a powerful greenhouse gas, with an anthropogenic radiative forcing one quarter of that of CO2. Along with methane and atmospheric aerosol, tropospheric ozone belongs to the so-called Short Lived Climate forcing Pollutants, or SLCP. Recent work has shown that efforts to reduce concentrations of SLCP in the atmosphere have the potential to slow the rate of near-term climate change, while simultaneously improving public health and reducing crop losses. Unlike many other SLCP, tropospehric ozone is not directly emitted, but is instead influenced by two distinct sources: transport of air from the ozone-rich stratosphere; and photochemical production in the troposphere from the emitted precursors NOx (oxides of nitrogen), CO (Carbon Monoxide), and VOC (volatile organic compounds, including methane). Better understanding of the relationship between ozone production and the emissions of its precursors is essential for the development of targeted emission reduction strategies. Several modeling methods have been employed to relate the production of tropospheric ozone to emissions of its precursors; emissions perturbation, tagging, and adjoint sensitivity methods all deliver complementary information about modelled ozone production. Most studies using tagging methods have focused on attribution of tropospheric ozone production to emissions of NOx, even though perturbation methods have suggested that tropospheric ozone is also sensitive to VOC, particularly methane. In this study we describe the implementation into a global chemistry-climate model of a scheme for tagging emissions of NOx and VOC with an arbitrary number of labels, which are followed through the chemical reactions of tropospheric ozone production in order to perform attribution of tropospehric ozone to its emitted precursors. Attribution is performed to both

  9. Commissioning of SAGA Light Source

    CERN Document Server

    Tomimasu, Takio; Koda, Shigeru; Ohgaki, Hideaki; Takabayashi, Yuichi; Toyokawa, Hiroyuki; Yasumoto, Masato; Yoshida, Katuhide

    2005-01-01

    The SAGA Light Source (SAGA-LS) consists of a 250-MeV electron linac injector and an eight-hold symmetry 1.4-GeV storage ring with eight double-bend (DB) cell and eight 2.93-m long straight sections. The DB cell structure with a distributed dispersion system was chosen to produce a compact ring of 75.6-m long circumference. The machine construction begun September 29, 2003. The ring magnets of steel laminated structure, vacuum chambers made of aluminum alloy, pumping systems and four temperature controlled cooling water systems for the linac accelerating wave guides etc. were installed in March, 2004. The injector, a 500-MHz ring rf damped cavity, rf klystrons, beam transport systems for injection and their controlled systems were installed in July, 2004. The commissioning begun August 25, 2004. A 250-MeV beam was accelerated on September 29. The beam size is 1-mm in diameter and the energy spread is 0.8 % (FWHM). The first revolution of 250-MeV beam around the ring took place October 22. Beam was stored on N...

  10. Economics of alternative energy sources.

    Science.gov (United States)

    Ryle, M

    1977-05-12

    An important part of the oil and natural gas at present consumed in the UK is used for the heating of buildings, a demand which shows large diurnal, day-to-day and annual fluctuations. The replacement of this energy by nuclear-generated electricity, as at present envisaged, would require the construction of some 250 GW of additional capacity by the end of the century, a progamme which does not seem feasible. By incorporating relatively cheap, short term storage in the form of low-grade heat, the generating capacity required to fulfil peak demand could be reduced by more than 50%. As soon as such storage is provided, however, other sources of energy become viable and attractive alternatives, and the UK is well situated to make use of wind, wave, and tidal power. It seems likely that the value of North Sea oil/gas reserves as feedstock to the chemical industry will rise sufficiently to make an early reduction in their consumption as fuel of great economic importance.

  11. Polymer biocomposites with renewable sources

    Directory of Open Access Journals (Sweden)

    S. Kuciel

    2010-07-01

    Full Text Available Nowadays production of natural biodegradable polymer composites is an important research topic on the stage of renewable sourcesimplementation instead of petrochemical sources. In this work, possibilities of processing biocomposites on the base on different types of biopolymers – polylactide (PLA, thermoplastic starch (TPS, polyhydroxybutyrate (PHB, cellulose acetate (CA - filled with natural fibers such as wood, kenaf, horse hair and nettle are presented. Large variety of natural fibers and their developed surface which increases adhesion to matrix makes them an attractive filler material. The fibers serve as reinforcement by giving strength and stiffness to the structure while the polymer matrix holds the fibers in place so that suitable structural composites can be made. Main physic-mechanical properties of natural fibers and biopolymers are presented. Modulus of elasticity and tensile strength increased with rising content of natural fibers in composite. The results show that biocomposites based on starch or PHB filled with kenaf fibers has the best mechanical properties. Modulus of elasticity achieves 10-12 GPa and tensile strength 50 MPa. This property can be interesting for packaging especially for fresh food like fruits or vegetables and for technical products with short-time life cycles. In future prospects, biocomposites based on biopolymers with a long time of decomposition can be interesting alternative as a construction material in automotive sectors.

  12. Discharge-pumped XUV source

    Science.gov (United States)

    Schmidt, Jiri; Kolacek, Karel; Straus, Jaroslav; Frolov, Oleksandr

    2016-09-01

    We have built two experimental devices (CAPEX and CAPEX-U) working as XUV sources, which are based on the fast, pinching capillary discharge. On both these devices we have observed lasing at 46.9 nm (Ne-like Ar line). However, besides lasing at the above mentioned relatively long wavelength, they are also used for testing a possibility of amplification at the wavelengths below 20 nm that have more practical applications. Particularly, at present nitrogen-filled capillary (?4 mm x 90 mm) discharge is studied for the development of XUV (soft X-ray) laser based on recombination pumping scheme: the fully stripped nitrogen nuclei recombine to hydrogen-like atoms, where Balmer-alpha transition (wavelength 13.4 nm) is - according to theoretical predictions - capable of creating population inversion. The modified electrical parameters (peak current 60 kA with quarter period of 45 ns) meet the necessary theoretical conditions. The only question remains, if suitable pre-pulse can suppress the capillary-wall-ablation, which in all presently known cases has quashed the amplification. In this paper the recent results obtained from both these discharge systems (argon-, nitrogen-filled capillaries) will be presented. Acknowledgement: This work was performed under auspices and with the support of the Grant Agency of the Czech Republic (Contract 14-29772S) and of the Ministry of Education, Youth, and Sports of the Czech Republic (INGO contract LG15013).

  13. New Magnetically Coupled Impedance (Z-) Source Networks

    DEFF Research Database (Denmark)

    Siwakoti, Yam Prasad; Blaabjerg, Frede; Loh, Poh Chiang

    2016-01-01

    by their discontinuous currents drawn from the sources and/or high stresses experienced by their components. This paper thus proposes three new MCIS networks named respectively as quasi-Y-source, quasi-Γ-Z-source and quasi-T-source or quasi-Trans-Z-source networks. These new networks inherit all advantages....... Derivations of all two-winding MCIS networks, including existing and new networks, from the generalized three-winding MCIS networks are then systematically illustrated, before comparing them. Operational principles, mathematical derivations, simulation and experimental results of all studied networks have...

  14. Isotope and machine sources for food irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Balcazar G, M

    1992-05-15

    Artificial radioactive sources as Co-60 and Cs- 137 are produced by bombarding Co-59 with neutrons in a nuclear reactor and by chemical separation of spent nuclear fuel respectively. Both radioactive sources emit very high frequency electromagnetic radiation called y-rays. This highly penetrating radiation is employed for preservation of food. Each y-ray emitted from a radioactive source transports energy from the source to the irradiated food. Penetration of y-rays and their intensity depend on y-energy. Inside this study the advantages and disadvantages of both sources are compared. (Author)

  15. Life cycle assessment of renewable energy sources

    CERN Document Server

    Singh, Anoop; Olsen, Stig Irving

    2013-01-01

    Governments are setting challenging targets to increase the production of energy and transport fuel from sustainable sources. The emphasis is increasingly on renewable sources including wind, solar, geothermal, biomass based biofuel, photovoltaics or energy recovery from waste. What are the environmental consequences of adopting these other sources? How do these various sources compare to each other? Life Cycle Assessment of Renewable Energy Sources tries to answer these questions based on the universally adopted method of Life Cycle Assessment (LCA). This book introduces the concept and impor

  16. The prototype of radioactive ion source

    CERN Document Server

    Aleksandrov, A V; Kot, N K; Andrighetto, A; Stroe, L

    2001-01-01

    The design and experimental results of the RIB source prototype are presented.A source will have the container of sup 2 sup 3 sup 5 U compounds heated up to 2200-2500 degree C. Vapors of uranium fission obtained when the ion source is irradiated by the high-energy neutron flux, are then ionized and extracted from the source. In the experiments with the prototype loaded by sup 1 sup 2 C the source working temperature 2700 degree C was reached, the carbon ion current 10 nA was obtained. The total operation time of more than 100 hours with no performance degradation was demonstrated.

  17. MSSC: Multi-Source Self-Calibration

    Science.gov (United States)

    Radcliffe, Jack F.

    2017-09-01

    Multi-Source Self-Calibration (MSSC) provides direction-dependent calibration to standard phase referencing. The code combines multiple faint sources detected within the primary beam to derive phase corrections. Each source has its CLEAN model divided into the visibilities which results in multiple point sources that are stacked in the uv plane to increase the S/N, thus permitting self-calibration. This process applies only to wide-field VLBI data sets that detect and image multiple sources within one epoch.

  18. Global Sourcing of Services Versus Manufacturing Activities

    DEFF Research Database (Denmark)

    Ørberg Jensen, Peter D.; Petersen, Bent

    2012-01-01

    between the attributes of the globally sourced activities and the international sourcing operations of firms is presented. This paper discusses the implications for global sourcing research and the strategic and organizational implications for managers, and it argues that finding the right match between......International sourcing strategies and operations are usually described distinctively for manufacturing and services. In this paper, the theoretical and strategic relevance of this distinction is questioned. As an alternative, an activity-based theoretical framework for exploring the linkages...... strategy, activity and organization is a key determinant of the success of the sourcing process and outcome....

  19. Basic Testing of the DUCHAMP Source Finder

    Science.gov (United States)

    Westmeier, T.; Popping, A.; Serra, P.

    2012-01-01

    This paper presents and discusses the results of basic source finding tests in three dimensions (using spectroscopic data cubes) with DUCHAMP, the standard source finder for the Australian Square Kilometre Array Pathfinder. For this purpose, we generated different sets of unresolved and extended Hi model sources. These models were then fed into DUCHAMP, using a range of different parameters and methods provided by the software. The main aim of the tests was to study the performance of DUCHAMP on sources with different parameters and morphologies and assess the accuracy of DUCHAMP's source parametrisation. Overall, we find DUCHAMP to be a powerful source finder capable of reliably detecting sources down to low signal-to-noise ratios and accurately measuring their position and velocity. In the presence of noise in the data, DUCHAMP's measurements of basic source parameters, such as spectral line width and integrated flux, are affected by systematic errors. These errors are a consequence of the effect of noise on the specific algorithms used by DUCHAMP for measuring source parameters in combination with the fact that the software only takes into account pixels above a given flux threshold and hence misses part of the flux. In scientific applications of DUCHAMP these systematic errors would have to be corrected for. Alternatively, DUCHAMP could be used as a source finder only, and source parametrisation could be done in a second step using more sophisticated parametrisation algorithms.

  20. Measuring Source Code Similarity Using Reference Vectors

    Science.gov (United States)

    Ohno, Asako; Murao, Hajime

    In this paper, we propose a novel method to measure similarity between program source codes. Different to others, our method doues not compare two source codes directly but compares two reference vectors, where a reference vector is calculated from one source code and a set of reference source codes. This means that our method requires no original source code when considering an application open to public such as a search engine for the program source code on the internet. We have built a simple search system and have evaluated with Java source codes made in the university course of basic programming. Results show that the system can achieve quite high average precision rate in very short time which means the proposed method can measure correct similarity very fast.

  1. Conditioning of Spent Sealed Sources in Singapore

    Energy Technology Data Exchange (ETDEWEB)

    Hong, Dae Seok; Kang, Il Sik; Jang, Kyung Duk; Shon, Jong Sik [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2012-05-15

    In 2010, IAEA (International Atomic Energy Agency) requested KAERI (Korea Atomic Energy Research Institute) to support Singapore for conditioning spent sealed sources. Once had been used for lightning conductor, check source or smoke detector, various sealed sources were collected and temporarily have been stored at HSA (Health Science Authority) under control of NEA (National Environment Agency) in Singapore. Based on experiences for conditioning of Ra-226 sources in various Asian countries since 2000, KAERI sent an expert team of three members to Singapore for safe management of spent sealed sources in 2011. As a result of conditioning operation, about 575.21 mCi of sealed sources were safely conditioned in 3 cement packages with cooperation of KAERI expert team, IAEA supervisor, NEA staffs and local labors. In this paper, procedure and result of the conditioning operation for the spent sealed sources in Singapore are discussed

  2. Development of a radon standard source

    Science.gov (United States)

    Sakamoto, Shigeyasu; Ishimori, Yuu; Maruo, Yoshihiro

    2005-06-01

    The present paper describes the development of a radon standard source for use in establishing the traceability of radon concentration measurements in air. Previously, radon generated by bubbling air through a radium salt solution was widely used for calibration of radon measurement equipment; however, the handling of a solid-phase radon source is easier. In the present study, the radioactivity of radon released in a vapor phase was determined from the difference between the radioactivity of the radium and the residual radon progenies in the source. A germanium detector, calibrated using gamma reference sources, was used for these radioactivity measurements. Under equilibrium conditions the radioactivity of the radon released from the radium source was found to be 988 Bq. The source was sealed in a stainless-steel container having a nominal capacity of 6 l to produce a radon standard source of density of 167.5 [Bq/l].

  3. International workshop on cold neutron sources

    Energy Technology Data Exchange (ETDEWEB)

    Russell, G.J.; West, C.D. (comps.) (Los Alamos National Lab., NM (United States))

    1991-08-01

    The first meeting devoted to cold neutron sources was held at the Los Alamos National Laboratory on March 5--8, 1990. Cosponsored by Los Alamos and Oak Ridge National Laboratories, the meeting was organized as an International Workshop on Cold Neutron Sources and brought together experts in the field of cold-neutron-source design for reactors and spallation sources. Eighty-four people from seven countries attended. Because the meeting was the first of its kind in over forty years, much time was spent acquainting participants with past and planned activities at reactor and spallation facilities worldwide. As a result, the meeting had more of a conference flavor than one of a workshop. The general topics covered at the workshop included: Criteria for cold source design; neutronic predictions and performance; energy deposition and removal; engineering design, fabrication, and operation; material properties; radiation damage; instrumentation; safety; existing cold sources; and future cold sources.

  4. Light Sources and Ballast Circuits

    Science.gov (United States)

    Yorifuji, Takashi; Sakai, Makoto; Yasuda, Takeo; Maehara, Akiyoshi; Okada, Atsunori; Gouriki, Takeshi; Mannami, Tomoaki

    discharge models were reported. Further, studies on ultra high-pressure mercury lamps as light sources for projectors are becoming the mainstream of HID lamp related researches. For high-pressure sodium lamps, many studies on plant growing and pest control utilizing low insect attracting aspects were also reported in 2006. Additionally, for discharge lamps, the minimum sustaining electric power for arc tubes employed in electrode-less compact fluorescent lamps was investigated. For Hg-free rare-gas fluorescent lamps, a luminance of 10,000cd/m2 was attained by a 1 meter-long external duplex spiral electrode prototype using Xe/Ne barrier discharge. As to startup circuits, the commercialization of energy saving and high value added products mainly associated with fluorescent lamps and HID lamps are becoming common. Further, the miniaturization of startup circuits for self electronic-ballasted lamps has advanced. Speaking of the overall light sources and startup circuits in 2006 and with the enforcement of RoHS in Europe in July, the momentum toward hazardous substance-free and energy saving initiatives has been enhanced from the perspective of protecting the global environment. It is anticipated that similar restrictions will be globally enforced in the future.

  5. Source-space ICA for EEG source separation, localization, and time-course reconstruction.

    Science.gov (United States)

    Jonmohamadi, Yaqub; Poudel, Govinda; Innes, Carrie; Jones, Richard

    2014-11-01

    We propose source-space independent component analysis (ICA) for separation, tomography, and time-course reconstruction of EEG and MEG source signals. Source-space ICA is based on the application of singular value decomposition and ICA on the neuroelectrical signals from all brain voxels obtained post minimum-variance beamforming of sensor-space EEG or MEG. We describe the theoretical background and equations, then evaluate the performance of this technique in several different situations, including weak sources, bilateral correlated sources, multiple sources, and cluster sources. In this approach, tomographic maps of sources are obtained by back-projection of the ICA mixing coefficients into the source-space (3-D brain template). The advantages of source-space ICA over the popular alternative approaches of sensor-space ICA together with dipole fitting and power mapping via minimum-variance beamforming are demonstrated. Simulated EEG data were produced by forward head modeling to project the simulated sources onto scalp sensors, then superimposed on real EEG background. To illustrate the application of source-space ICA to real EEG source reconstruction, we show the localization and time-course reconstruction of visual evoked potentials. Source-space ICA is superior to the minimum-variance beamforming in the reconstruction of multiple weak and strong sources, as ICA allows weak sources to be identified and reconstructed in the presence of stronger sources. Source-space ICA is also superior to sensor-space ICA on accuracy of localization of sources, as source-space ICA applies ICA to the time-courses of voxels reconstructed from minimum-variance beamforming on a 3D scanning grid and these time-courses are optimally unmixed via the beamformer. Each component identified by source-space ICA has its own tomographic map which shows the extent to which each voxel has contributed to that component. Copyright © 2014 Elsevier Inc. All rights reserved.

  6. Convergent Bayesian formulations of blind source separation and electromagnetic source estimation

    OpenAIRE

    Knuth, Kevin H.; Vaughan Jr, Herbert G.

    2015-01-01

    We consider two areas of research that have been developing in parallel over the last decade: blind source separation (BSS) and electromagnetic source estimation (ESE). BSS deals with the recovery of source signals when only mixtures of signals can be obtained from an array of detectors and the only prior knowledge consists of some information about the nature of the source signals. On the other hand, ESE utilizes knowledge of the electromagnetic forward problem to assign source signals to th...

  7. Synchro-Compton emission from superluminal sources

    Science.gov (United States)

    Marscher, Alan P.

    1987-01-01

    The application of synchro-Compton theory to real compact radio sources, the question of a self-Compton origin of the X-rays in radio-loud quasars and active galactic nuclei, and the phenomenology of superluminal motion are discussed in a review of research concerning synchro-Compton emission from superluminal sources. After examining the basic synchro-Compton theory of ideal sources, applications of the theory to real sources is discussed. It is concluded that the Compton problem and total energy requirements are not substantially mitigated by considering source structures more complicated than the multiple, uniform-component model used by most investigators. Also, alternatives to the standard model of superluminal motion are discussed, focusing on the assumptions usually made when interpreting superluminal sources.

  8. The source issue in infrared microspectroscopy

    CERN Document Server

    Smith, T I

    2002-01-01

    Infrared spectroscopy using a Fourier Transform Infrared (FTIR) spectrometer is routine. These instruments are sophisticated and mature, and generally use a blackbody radiator as their infrared source. However, because the brightness of a thermal source is limited, the signal-to-noise ratio of these instruments begins to degrade at spatial resolutions not much better than 1 mm and they are rarely useful at resolutions smaller than 20 mu m. Synchrotrons provide much brighter infrared beams than thermal sources, and Free-Electron Lasers (FELs) provide even brighter beams than synchrotrons. We will discuss the limitations of thermal sources, and show that a synchrotron is an excellent source for infrared spectroscopy at spatial resolutions on the order of the wavelength (lambda). Even better spatial resolution, about lambda/10, can be expected if an FEL is used as a source.

  9. A Plasma Ion Source for ISOLTRAP

    CERN Document Server

    Skov, Thomas Guldager

    2016-01-01

    In this report, my work testing the new Penning ion source as a summer student at ISOLTRAP is described. The project was composed of three stages: (1) Setting up a test laboratory in building 275, (2) characterizing the ion source, and (3) implementing and testing the source in the ISOLTRAP setup. After setting up the test laboratory, the ion source was tested in a constant pressure environment with produced ion currents in the range of nA . An extensive scan of the source ion current versus operating parameters (pressure, voltage) was performed. A setup with pulsed gas flow was also tested, allowing a reduction of the gas load on the vacuum system. The behavior of the ion source together with the ISOLTRAP setup was also investigated, allowing to understand current limitations and future directions of improvement.

  10. Tutorial: Linking content in unstructured sources

    OpenAIRE

    Moens, Marie-Francine

    2010-01-01

    This tutorial focuses on the task of automated information linking in text and multimedia sources. In any task where information is fused from different sources, this linking is a necessary step. To solve the problem we borrow methods from computational linguistics, computer vision and data mining. Although the main focus is on finding equivalence relations in the sources, the tutorial opens views on the recognition of other relation types.

  11. Recent Advances in Electron and Positron Sources

    Energy Technology Data Exchange (ETDEWEB)

    Clendenin, James E

    2000-07-20

    Recent advances in electron and positron sources have resulted in new capabilities driven in most cases by the increasing demands of advanced accelerating systems. Electron sources for brighter beams and for high average-current beams are described. The status and remaining challenges for polarized electron beams are also discussed. For positron sources, recent activity in the development of polarized positron beams for future colliders is reviewed. Finally, a new proposal for combining laser cooling with beam polarization is presented.

  12. Verification Games: Crowd-Sourced Formal Verification

    Science.gov (United States)

    2016-03-01

    VERIFICATION GAMES : CROWD-SOURCED FORMAL VERIFICATION UNIVERSITY OF WASHINGTON MARCH 2016 FINAL TECHNICAL REPORT...DATES COVERED (From - To) JUN 2012 – SEP 2015 4. TITLE AND SUBTITLE VERIFICATION GAMES : CROWD-SOURCED FORMAL VERIFICATION 5a. CONTRACT NUMBER FA8750...clarification memorandum dated 16 Jan 09. 13. SUPPLEMENTARY NOTES 14. ABSTRACT Over the more than three years of the project Verification Games : Crowd-sourced

  13. Co-sourcing in software development offshoring

    DEFF Research Database (Denmark)

    Schlichter, Bjarne Rerup; Persson, John Stouby

    2013-01-01

    -sourcing shapes the perception and alleviation of the well-known risks related to offshoring is limited. We present a case study of how a certified CMMI-level 5 Danish software supplier approaches these risks in offshore co-sourcing. The paper explains how co-sourcing from a mature software company may shape......-taking by high attention to of the closely interrelated structure and technology components in terms of CMMI and the actors’ cohesion and integration in terms of Scrum....

  14. Logistics Sourcing Strategies in Supply Chain Design

    OpenAIRE

    Liu, Liwen

    2007-01-01

    A company's logistics sourcing strategy determines whether it structures and organizeslogistics within the company or company group or integrates logistics upstream and downstreamin the supply chain. First, three different types of logistics sourcing strategies in supply chaindesign are described and the theoretical background for the development of these strategies,including both transaction cost theory and network theory, is analyzed. Two special casesabout logistics sourcing strategy decis...

  15. Advanced Neutron Source (ANS) Project progress report

    Energy Technology Data Exchange (ETDEWEB)

    McBee, M.R.; Chance, C.M. (eds.) (Oak Ridge National Lab., TN (USA)); Selby, D.L.; Harrington, R.M.; Peretz, F.J. (Oak Ridge National Lab., TN (USA))

    1990-04-01

    This report discusses the following topics on the advanced neutron source: quality assurance (QA) program; reactor core development; fuel element specification; corrosion loop tests and analyses; thermal-hydraulic loop tests; reactor control concepts; critical and subcritical experiments; material data, structural tests, and analysis; cold source development; beam tube, guide, and instrument development; hot source development; neutron transport and shielding; I C research and development; facility concepts; design; and safety.

  16. Information Source Quality in Intelligent Transport Systems

    OpenAIRE

    Niko Jelušić; Mario Anžek; Božidar Ivanković

    2010-01-01

    Advanced automatic traffic control systems and various other ITS (Intelligent Transport Systems) applications and services rely on real-time information from the traffic system. This paper presents the overview and general functions of different information sources which provide real-time information that are used or could be used in ITS. The objective is to formally define the quality of information sources suitable for ITS based on formal models of the traffic system and information sources...

  17. Free for All: Open Source Software

    Science.gov (United States)

    Schneider, Karen

    2008-01-01

    Open source software has become a catchword in libraryland. Yet many remain unclear about open source's benefits--or even what it is. So what is open source software (OSS)? It's software that is free in every sense of the word: free to download, free to use, and free to view or modify. Most OSS is distributed on the Web and one doesn't need to…

  18. Open source innovation phenomenon, participant behaviour, impact

    CERN Document Server

    Herstatt, Cornelius

    2015-01-01

    Open Source Innovation (OSI) has gained considerable momentum within the last years. Academic and management practice interest grows as more and more end-users consider and even participate in Open Source product development like Linux, Android, or Wikipedia. Open Source Innovation: Phenomenon, Participant Behaviour, Impact brings together rigorous academic research and business importance in scrutinizing OCI from three perspectives: The Phenomenon, Participants' Behavior, and Business Implications. The first section introduces OCI artefacts, including who is participating and why, and provide

  19. High-Energy Compton Scattering Light Sources

    CERN Document Server

    Hartemann, Fred V; Barty, C; Crane, John; Gibson, David J; Hartouni, E P; Tremaine, Aaron M

    2005-01-01

    No monochromatic, high-brightness, tunable light sources currently exist above 100 keV. Important applications that would benefit from such new hard x-ray sources include: nuclear resonance fluorescence spectroscopy, time-resolved positron annihilation spectroscopy, and MeV flash radiography. The peak brightness of Compton scattering light sources is derived for head-on collisions and found to scale with the electron beam brightness and the drive laser pulse energy. This gamma 2

  20. Ground Water-Source Heat Pump

    OpenAIRE

    Iganatovna, Dinara Kumasheva

    2016-01-01

    Nowadays, most issues are associated with the growth of population and an increase in energy needs is no exception. Therefore, one of the ways to solve this problem is use of technologies based on renewable energy sources. In this thesis, the effectiveness of the ground water-source heat pump (GWHP) is being analyzed in Famagusta conditions. Famagusta has been chosen because it has potential for renewable energy sources such as groundwater with a practically constant temperature throughout...

  1. HTGR Mechanistic Source Terms White Paper

    Energy Technology Data Exchange (ETDEWEB)

    Wayne Moe

    2010-07-01

    The primary purposes of this white paper are: (1) to describe the proposed approach for developing event specific mechanistic source terms for HTGR design and licensing, (2) to describe the technology development programs required to validate the design methods used to predict these mechanistic source terms and (3) to obtain agreement from the NRC that, subject to appropriate validation through the technology development program, the approach for developing event specific mechanistic source terms is acceptable

  2. ECR ion source for high current linac

    CERN Document Server

    Cui Bao Qun; Jiang Wei; LiLiQiang; WangRongWen

    2002-01-01

    An intense ECR ion source for ADS (accelerator driven sub-critical system) is described. Two configurations of the source has been developed and tested. 100 mA hydrogen beam has been extracted from the ion source at 30 keV, the proton ratio is greater than 85%, estimated emittance is 0.11 pi mm centre dot mrad, the maximum extracted beam density is 340 mA/cm sup 2 . A 100 hours reliability test of the source is also described

  3. Open Source Intelligence - Doctrine's Neglected Child

    National Research Council Canada - National Science Library

    Pham, Tuan

    2003-01-01

    .... The causes of this neglect are many, ranging from previously mentioned predisposition toward classified intelligence sources to the technical challenge of information excess that overloads the users...

  4. Source analysis of underground chemical explosions

    Science.gov (United States)

    Chiang, A.; Ford, S. R.; Pitarka, A.

    2016-12-01

    Several physical mechanisms have been proposed to explain the generation of S-waves from underground explosions, such as asymmetries in the source, release of tectonic pre-stress, interactions with the free-surface, and heterogeneities in the Earth. An accurate description of the explosion source processes is an important step towards understanding which of these plausible mechanisms are actively contributing to the generation of S-waves and under what conditions. In this study we investigate the sensitivity of far-field waveforms to seismic source mechanisms by comparing simulated and recorded data from underground chemical explosions performed during the Source Physics Experiment. We use both forward and inverse waveform modeling approaches to estimate the source properties of the explosions, and compare solutions using different velocity models and at different frequency bands and distances. 1D and 3D velocity models are used to characterize wave propagation between the source and receiver. The 3D velocity models are constructed using available geological and geophysical data, and ambient noise seismic tomography. The 3D Green's functions are computed using a numerical finite-difference approach. We will investigate the sensitivity of far-field ground motion to different levels of source complexities, such as a single isotropic source or complex sources with non-isotropic radiation in the frequency range of 0.5 to 6 Hz.

  5. New science at the European Spallation Source

    Energy Technology Data Exchange (ETDEWEB)

    Finney, J.L. [University Coll., London (United Kingdom). Dept. of Physics and Astronomy

    1996-05-01

    The European Spallation Source is a trans-European project aimed at the ultimate construction of a next-generation pulsed spallation neutron source that will deliver 30 times the beam power of ISIS. The reference design for the proposed source has been set, and work is in progress to develop an updated scientific case for the construction of the source early in the next century. Together with improvements in instrumentation, effective flux gains of over two orders of magnitude are likely in some areas, opening up major new opportunities for the exploitation of neutron studies in fundamental, strategic, and applied science. (author)

  6. Sourcing Strategies to Keep up with Competition

    DEFF Research Database (Denmark)

    Antero, Michelle; Hedman, Jonas; Henningsson, Stefan

    2014-01-01

    This paper applies the Red Queen theory to explain how organizations utilize various sourcing arrangements in order to compete in an evolutionary arms race where only the strongest competitors will survive. The case study incorporates competition, and views sourcing strategies as a means to improve...... the firm’s viability to survive competition in the marketplace. The study begins by positioning the Red Queen theory within the sourcing literature. It subsequently applies the framework to a case study of SAP AG to illustrate how sourcing strategies have changed over time in response to the logic...

  7. Free software and open source databases

    Directory of Open Access Journals (Sweden)

    Napoleon Alexandru SIRITEANU

    2006-01-01

    Full Text Available The emergence of free/open source software -FS/OSS- enterprises seeks to push software development out of the academic stream into the commercial mainstream, and as a result, end-user applications such as open source database management systems (PostgreSQL, MySQL, Firebird are becoming more popular. Companies like Sybase, Oracle, Sun, IBM are increasingly implementing open source strategies and porting programs/applications into the Linux environment. Open source software is redefining the software industry in general and database development in particular.

  8. Integrating multiple data sources for malware classification

    Science.gov (United States)

    Anderson, Blake Harrell; Storlie, Curtis B; Lane, Terran

    2015-04-28

    Disclosed herein are representative embodiments of tools and techniques for classifying programs. According to one exemplary technique, at least one graph representation of at least one dynamic data source of at least one program is generated. Also, at least one graph representation of at least one static data source of the at least one program is generated. Additionally, at least using the at least one graph representation of the at least one dynamic data source and the at least one graph representation of the at least one static data source, the at least one program is classified.

  9. Power-law Schell-model sources

    Science.gov (United States)

    Hyde, Milo W.

    2017-11-01

    A new type of Schell-model source is developed that has a spectral degree of coherence, or spatial power spectrum, which is described by a power-law function. These power-law sources generally produce cusped, or peaked far-zone spectral density patterns making them potentially useful in directed energy applications. The spectral degrees of coherence, spatial power spectra, and spatial coherence radii for power-law sources are derived and discussed. Two power-law sources are then synthesized in the laboratory using a liquid crystal spatial light modulator. The experimental spectral densities are compared to the corresponding theoretical predictions to serve as a proof of concept.

  10. Open Source Data Warehousing and Business Intelligence

    CERN Document Server

    Bulusu, Lakshman

    2012-01-01

    Open Source Data Warehousing and Business Intelligence is an all-in-one reference for developing open source based data warehousing (DW) and business intelligence (BI) solutions that are business-centric, cross-customer viable, cross-functional, cross-technology based, and enterprise-wide. Considering the entire lifecycle of an open source DW & BI implementation, its comprehensive coverage spans from basic concepts all the way through to customization. Highlighting the key differences between open source and vendor DW and BI technologies, the book identifies end-to-end solutions that are scala

  11. Attributing Atmospheric Methane to Anthropogenic Emission Sources.

    Science.gov (United States)

    Allen, David

    2016-07-19

    Methane is a greenhouse gas, and increases in atmospheric methane concentration over the past 250 years have driven increased radiative forcing of the atmosphere. Increases in atmospheric methane concentration since 1750 account for approximately 17% of increases in radiative forcing of the atmosphere, and that percentage increases by approximately a factor of 2 if the effects of the greenhouse gases produced by the atmospheric reactions of methane are included in the assessment. Because of the role of methane emissions in radiative forcing of the atmosphere, the identification and quantification of sources of methane emissions is receiving increased scientific attention. Methane emission sources include biogenic, geogenic, and anthropogenic sources; the largest anthropogenic sources are natural gas and petroleum systems, enteric fermentation (livestock), landfills, coal mining, and manure management. While these source categories are well-known, there is significant uncertainty in the relative magnitudes of methane emissions from the various source categories. Further, the overall magnitude of methane emissions from all anthropogenic sources is actively debated, with estimates based on source sampling extrapolated to regional or national scale ("bottom-up analyses") differing from estimates that infer emissions based on ambient data ("top-down analyses") by 50% or more. To address the important problem of attribution of methane to specific sources, a variety of new analytical methods are being employed, including high time resolution and highly sensitive measurements of methane, methane isotopes, and other chemical species frequently associated with methane emissions, such as ethane. This Account describes the use of some of these emerging measurements, in both top-down and bottom-up methane emission studies. In addition, this Account describes how data from these new analytical methods can be used in conjunction with chemical mass balance (CMB) methods for source

  12. 11. international conference on ion sources

    Energy Technology Data Exchange (ETDEWEB)

    Leitner, D.; Lyneis, C.; Cheng, D.; Galloway, M.L.; Leitner, M.; Todd, D.S.; Ciavola, G.; Gammino, S.; Celona, L.; Ando, L.; Torrisi, L.; Cavenago, M.; Galata, A.; Spaedtke, P.; Tinschert, K.; Lang, R.; Iannucci, R.; Leroy, R.; Barue, C.; Hitz, D.; Koivisto, H.; Suominen, P.; Tarvainen, O.; Beijers, H.; Brandenburg, S.; Vanrooyen, D.; Hillo, C.; Kuchler, D.; Homeyer, H.; Rohrich, J.; Schachter, L.; Dobrescu, S.; Nakagawa, T.; Higurashi, Y.; Kidera, M.; Aihara, T.; Kase, M.; Goto, A.; Yang, Y.; Zhao, H.W.; Zhang, Z.M.; Zhang, X.Z.; Guo, X.H.; He, W.E.; Sun, L.T.; Yuan, P.; Song, M.T.; Xie, Z.Q.; Cao, Y.; Zhan, W.L.; Wei, B.W.; Bricault, P.; Lau, C.; Essabaa, S.; Cheikh Mhamed, M.; Bajeat, O.; Ducourtieux, M.; Lefort, H.; Panteleev, V.N.; Barzakh, A.E.; Fedorov, D.V.; Ionan, A.M.; Mezilev, K.A.; Moroz, F.V.; Orlov, S.Y.; Volkov, Y.M.; Andrighetto, A.; Lhersonneau, G.; Rizzi, V.; Tecchio, L.B.; Dubois, M.; Gaubert, G.; Jardins, P.; Lecesne, N.; Leroy, R.; Pacquet, J.Y.; Saint Laurent, M.G.; Villari, A.C.O.; Bajeat, O.; Essabaa, S.; Lau, C.; Menna, M.; Franberg, H.; Ammann, M.; Gdggeler, H.W.; Koster, U.; Allen, F.; Biedermann, C.; Radtke, R.; Ames, F.; Baartman, R.; Bricault, P.; Jayamanna, K.; Lamy, T.; McDonald, M.; Olivo, M.; Schmorl, P.; Yuan, D.H.L.; Asaji, T.; Sasaki, H.; Kato, Y.; Atabaev, B.; Radjabov, S.S.; Akhmadjanova, M.K.; Yuzikaeva, F.R.; Baoqun, Cui; Liqiang, Li; Yingjun, Ma; Shengyun, Zhu; Cong, Jiang

    2005-07-01

    This document gathers the summaries of the presentations made at ICIS05 (international conference on ion sources). It can be organized into 3 main topics: 1) 'fundamentals and theory' that deals with plasma, beam extraction, transport and emittance, diagnostics and simulation; 2) 'various types of ion sources' that include ECRIS, EBIS, microwave, negative, radioactive, polarized and laser ion sources, and charge breeders; and 3) 'ion sources and applications' in fields like accelerator injection, fusion energy, space propulsion, mass spectrometry, and neutron and cluster and rare nuclide production.

  13. Open-source hardware for medical devices.

    Science.gov (United States)

    Niezen, Gerrit; Eslambolchilar, Parisa; Thimbleby, Harold

    2016-04-01

    Open-source hardware is hardware whose design is made publicly available so anyone can study, modify, distribute, make and sell the design or the hardware based on that design. Some open-source hardware projects can potentially be used as active medical devices. The open-source approach offers a unique combination of advantages, including reducing costs and faster innovation. This article compares 10 of open-source healthcare projects in terms of how easy it is to obtain the required components and build the device.

  14. Confirmed and Potential Sources of Legionella Reviewed.

    Science.gov (United States)

    van Heijnsbergen, Eri; Schalk, Johanna A C; Euser, Sjoerd M; Brandsema, Petra S; den Boer, Jeroen W; de Roda Husman, Ana Maria

    2015-04-21

    Legionella bacteria are ubiquitous in natural matrices and man-made systems. However, it is not always clear if these reservoirs can act as source of infection resulting in cases of Legionnaires' disease. This review provides an overview of reservoirs of Legionella reported in the literature, other than drinking water distribution systems. Levels of evidence were developed to discriminate between potential and confirmed sources of Legionella. A total of 17 systems and matrices could be classified as confirmed sources of Legionella. Many other man-made systems or natural matrices were not classified as a confirmed source, since either no patients were linked to these reservoirs or the supporting evidence was weak. However, these systems or matrices could play an important role in the transmission of infectious Legionella bacteria; they might not yet be considered in source investigations, resulting in an underestimation of their importance. To optimize source investigations it is important to have knowledge about all the (potential) sources of Legionella. Further research is needed to unravel what the contribution is of each confirmed source, and possibly also potential sources, to the LD disease burden.

  15. Geolocating Russian sources for Arctic black carbon

    Science.gov (United States)

    Cheng, Meng-Dawn

    2014-08-01

    To design and implement an effective emission control strategy for black carbon (BC), the locations and strength of BC sources must be identified. Lack of accurate source information from the Russian Federation has created difficulty for a range of research and policy activities in the Arctic because Russia occupies the largest landmass in the Arctic Circle. A project was initiated to resolve emission sources of BC in the Russian Federation by using the Potential Source Contribution Function (PSCF). It used atmospheric BC data from two Arctic sampling stations at Alert Nunavut, Canada, and Tiksi Bay, Russia. The geographical regions of BC emission sources in Russia were identified and summarized as follows: (1) a region surrounding Moscow, (2) regions in Eurasia stretching along the Ural Mountains from the White Sea to the Black Sea, and (3) a number of scattered areas from western Siberia to the Russian Far East. Particulate potassium ions, non-marine sulfate, and vanadium were used to assist in resolving the source types: forest fire/biomass burning, coal-fired power plant, and oil combustion. Correlating these maps with the BC map helped to resolve source regions of BC emissions and connect them to their corresponding source types. The results imply that a region south of Moscow and another north of the Ural Mountains could be significant BC sources, but none of the grid cells in these regions could be linked to forest fires, oil combustion, or coal-fired power plants based on these three markers.

  16. [Review of urban nonpoint source pollution models].

    Science.gov (United States)

    Wang, Long; Huang, Yue-Fei; Wang, Guang-Qian

    2010-10-01

    The development history of urban nonpoint source pollution models is reviewed. Features, applicability and limitations of seven popular urban nonpoint source pollution models (SWMM, STORM, SLAMM, HSPF, DR3M-QUAL, MOUSE, and HydroWorks) are discussed. The methodology and research findings of uncertainty in urban nonpoint source pollution modeling are presented. Analytical probabilistic models for estimation of urban nonpoint sources are also presented. The research achievements of urban nonpoint source pollution models in China are summarized. The shortcomings and gaps of approaches on urban nonpoint source pollution models are pointed out. Improvements in modeling of pollutants buildup and washoff, sediments and pollutants transport, and pollutants biochemical reactions are desired for those seven popular models. Most of the models developed by researchers in China are empirical models, so that they can only applied for specific small areas and have inadequate accuracy. Future approaches include improving capability in fate and transport simulation of sediments and pollutants, exploring methodologies of modeling urban nonpoint source pollution in regions with little data or incomplete information, developing stochastic models for urban nonpoint source pollution simulation, and applying GIS to facilitate urban nonpoint source pollution simulation.

  17. An overview of LINAC ion sources

    Energy Technology Data Exchange (ETDEWEB)

    Keller, Roderich [Los Alamos National Laboratory

    2008-01-01

    This paper discusses ion sources used in high-duty-factor proton and H{sup -} Linacs as well as in accelerators utilizing multi-charged heavy ions, mostly for nuclear physics applications. The included types are Electron Cyclotron Resonance (ECR) sources as well as filament and rf driven multicusp sources. The paper does not strive to attain encyclopedic character but rather to highlight major lines of development, peak performance parameters and type-specific limitations and problems of these sources. The main technical aspects being discussed are particle feed, plasma generation and ion production by discharges, and plasma confinement.

  18. New renewable energy sources; Nye fornybare energikilder

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-07-01

    This booklet describes in simple terms the so-called new renewable energy sources: solar energy, biomass, wind power and wave power. In addition, there are brief discussions on hydrogen, ocean thermal energy conversion (OTEC), tidal power, geothermal energy, small hydropower plants and energy from salt gradients. The concept of new renewable energy sources is used to exclude large hydropower plants as these are considered conventional energy sources. The booklet also discusses the present energy use, the external frames for new renewable energy sources, and prospects for the future energy supply.

  19. Possible Sources of Polar Volatiles

    Science.gov (United States)

    Schultz, P. H.

    2011-12-01

    : surface layer of atomic/molecules over a regolith containing an assortment of cold-trapped elements (Na/Ca/Mg/K/Ag/Hg) and compounds (OH, CO, H2). In addition to the solar flux, cometary dust dominates the impact flux for particles less than 1g and dominates impact flashes observed telescopically (Cooke, pers. comm.). While large, volatile-rich impactors may be less frequent, they have the potential for injecting significant quantities (10-15%) into impact melts (Harris and Schultz, 2011). In addition, laboratory impact experiments at the NASA Ames Vertical Gun Range used high-speed spectroscopy to illustrate the capture of volatile fractions below the surface during hypervelocity impacts. On the Moon, melt-trapped volatiles comprising the regolith would be gradually recycled during each lunation during impact gardening, thereby titrating the supply of volatiles to the polar deep freeze. Consequently, diverse sources likely contributed this potpourri of trapped cold-trapped volatile

  20. An ideal sealed source life-cycle

    Energy Technology Data Exchange (ETDEWEB)

    Tompkins, Joseph Andrew [Los Alamos National Laboratory

    2009-01-01

    In the last 40 years, barriers to compliant and timely disposition of radioactive sealed sources have become apparent. The story starts with the explosive growth of nuclear gauging technologies in the 1960s. Dozens of companies in the US manufactured sources and many more created nuclear solutions to industrial gauging problems. Today they do not yet know how many Cat 1, 2, or 3 sources there are in the US. There are, at minimum, tens of thousands of sources, perhaps hundreds of thousands of sources. Affordable transportation solutions to consolidate all of these sources and disposition pathways for these sources do not exist. The root problem seems to be a lack of necessary regulatory framework that has allowed all of these problems to accumulate with no national plan for solving the problem. In the 1960s, Pu-238 displaced Pu-239 for most neutron and alpha source applications. In the 1970s, the availability of inexpensive Am-241 resulted in a proliferation of low energy gamma sources used in nuclear gauging, well logging, pacemakers, and X-ray fluorescence applications for example. In the 1980s, rapid expansion of worldwide petroleum exploration resulted in the expansion of Am-241 sources into international locations. Improvements of technology and regulation resulted in a change in isotopic distribution as Am-241 made Pu-239 and Pu-238 obsolete. Many early nuclear gauge technologies have been made obsolete as they were replaced by non-nuclear technoogies. With uncertainties in source end of life disposition and increased requirements for sealed source security, nuclear gauging technology is the last choice for modern process engineering gauging solutions. Over the same period, much was learned about licensing LLW disposition facilities as evident by the closure of early disposition facilities like Maxey Flats. The current difficulties in sealed source disposition start with adoption of the NLLW policy act of 1985, which created the state LLW compact system they

  1. Increasing the brightness of light sources

    Energy Technology Data Exchange (ETDEWEB)

    Fu, Ling

    2006-11-16

    In this work the principle of light recycling is applied to artificial light sources in order to achieve brightness enhancement. Firstly, the feasibilities of increasing the brightness of light sources via light recycling are examined theoretically, based on the fundamental laws of thermodynamics including Kirchhoff's law on radiation, Planck's law, Lambert-Beer's law, the etendue conservation and the brightness theorem. From an experimental viewpoint, the radiation properties of three different kinds of light sources including short-arc lamps, incandescent lamps and LEDs characterized by their light-generating mechanisms are investigated. These three types of sources are used in light recycling experiments, for the purpose of 1. validating the intrinsic light recycling effect in light sources, e. g. the intrinsic light recycling effect in incandescent lamps stemming from the coiled filament structure. 2. acquiring the required parameters for establishing physical models, e.g. the emissivity/absorptivity of the short-arc lamps, the intrinsic reflectivity and the external quantum efficiency of LEDs. 3. laying the foundations for designing optics aimed at brightness enhancement according to the characteristics of the sources and applications. Based on the fundamental laws and experiments, two physical models for simulating the radiance distribution of light sources are established, one for thermal filament lamps, the other for luminescent sources, LEDs. As validation of the theoretical and experimental investigation of the light recycling effect, an optical device, the Carambola, is designed for achieving deterministic and multiple light recycling. The Carambola has the function of a concentrator. In order to achieve the maximum possible brightness enhancement with the Carambola, several combinations of sources and Carambolas are modelled in ray-tracing simulations. Sources with different light-emitting mechanisms and different radiation properties

  2. Indigenous Manufacturing realization of TWIN Source

    Science.gov (United States)

    Pandey, R.; Bandyopadhyay, M.; Parmar, D.; Yadav, R.; Tyagi, H.; Soni, J.; Shishangiya, H.; Sudhir Kumar, D.; Shah, S.; Bansal, G.; Pandya, K.; Parmar, K.; Vuppugalla, M.; Gahlaut, A.; Chakraborty, A.

    2017-04-01

    TWIN source is two RF driver based negative ion source that has been planned to bridge the gap between single driver based ROBIN source (currently operational) and eight river based DNB source (to be operated under IN-TF test facility). TWIN source experiments have been planned at IPR keeping the objective of long term domestic fusion programme to gain operational experiences on vacuum immersed multi driver RF based negative ion source. High vacuum compatible components of twin source are designed at IPR keeping an aim on indigenous built in attempt. These components of TWIN source are mainly stainless steel and OFC-Cu. Being high heat flux receiving components, one of the major functional requirements is continuous heat removal via water as cooling medium. Hence for the purpose stainless steel parts are provided with externally milled cooling lines and that shall be covered with a layer of OFC-cu which would be on the receiving side of high heat flux. Manufacturability of twin source components requires joining of these dissimilar materials via process like electrode position, electron beam welding and vacuum brazing. Any of these manufacturing processes shall give a vacuum tight joint having proper joint strength at operating temperature and pressure. Taking the indigenous development effort vacuum brazing (in non-nuclear environment) has been opted for joining of dissimilar materials of twin source being one of the most reliable joining techniques and commercially feasible across the suppliers of country. Manufacturing design improvisation for the components has been done to suit the vacuum brazing process requirement and to ease some of the machining without comprising over the functional and operational requirements. This paper illustrates the details on the indigenous development effort, design improvisation to suits manufacturability, vacuum brazing basics and its procedures for twin source components.

  3. Calibration of Photon Sources for Brachytherapy

    Science.gov (United States)

    Rijnders, Alex

    Source calibration has to be considered an essential part of the quality assurance program in a brachytherapy department. Not only it will ensure that the source strength value used for dose calculation agrees within some predetermined limits to the value stated on the source certificate, but also it will ensure traceability to international standards. At present calibration is most often still given in terms of reference air kerma rate, although calibration in terms of absorbed dose to water would be closer to the users interest. It can be expected that in a near future several standard laboratories will be able to offer this latter service, and dosimetry protocols will have to be adapted in this way. In-air measurement using ionization chambers (e.g. a Baldwin—Farmer ionization chamber for 192Ir high dose rate HDR or pulsed dose rate PDR sources) is still considered the method of choice for high energy source calibration, but because of their ease of use and reliability well type chambers are becoming more popular and are nowadays often recommended as the standard equipment. For low energy sources well type chambers are in practice the only equipment available for calibration. Care should be taken that the chamber is calibrated at the standard laboratory for the same source type and model as used in the clinic, and using the same measurement conditions and setup. Several standard laboratories have difficulties to provide these calibration facilities, especially for the low energy seed sources (125I and 103Pd). Should a user not be able to obtain properly calibrated equipment to verify the brachytherapy sources used in his department, then at least for sources that are replaced on a regular basis, a consistency check program should be set up to ensure a minimal level of quality control before these sources are used for patient treatment.

  4. Sealed source dismantling hot cell - startup

    Energy Technology Data Exchange (ETDEWEB)

    Dellamano, Jose Claudio; Ferreira, Robson de Jesus, E-mail: jcdellam@ipen.br, E-mail: rojefer@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil). Gerencia de Rejeitos radioativos

    2013-07-01

    Sealed radioactive sources are widely used in many applications of nuclear technology and at the end of the useful life, most sources become radioactive waste. In Brazil, this waste is received by the Institutes of the National Nuclear Energy Commission and kept under centralized storage. The Waste Management Department at the Nuclear and Energy Research Institute is the main storage center, having received around 20,000 disused sources. A hot cell was designed and constructed to manage Co-60 spent sealed sources with activity up to 3.7 10{sup 1}0 Bq and other sources with equivalent activities. In the hot cell the sources are withdraw from their original shielding and transferred to a standard shielding for further disposal off. The original shielding disassembling is made outside the hot cell and after opening, it is transferred inside the hot cell and the sealed source is removed remotely. The source is checked in relation to external contamination and its activity is checked. After this, the source is positioned in the standard shielding located inside an overpack at the bottom of the hot cell. This paper describes some pre-operational tests carried out in it, that include: opening and closing doors and locks, checking of all electrical and pneumatic controls, the original shielding movement inside the hot-cell, dose rate measurements outside the hot-cell, insertion of the sealed sources inside the activity meter chamber, transferring the sealed source to the standard shielding, movement of the overpack with the standard shielding to outside of the hot-cell and plugging of the standard shielding. (author)

  5. GANIL Workshop on Ion Sources; Journees Sources d'Ions

    Energy Technology Data Exchange (ETDEWEB)

    Leroy, Renan [Grand Accelerateur National d' Ions Lourds (GANIL), 14 - Caen (France)

    1999-07-01

    The proceedings of the GANIL Workshop on Ion Sources held at GANIL - Caen on 18-19 March 1999 contains 13 papers aiming at improving the old source operation and developing new types of sources for nuclear research and studies of ion physics. A number of reports are devoted to applications like surface treatment, ion implantation or fusion injection. The 1+{yields}n+ transformation, charged particle transport in ECR sources, addition of cesium and xenon in negative ion sources and other basic issues in ion sources are also addressed.

  6. 40 CFR 417.84 - Pretreatment standards for existing sources.

    Science.gov (United States)

    2010-07-01

    ...) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps Subcategory § 417.84 Pretreatment standards for existing sources. Any existing source...

  7. The Efficient Utilization of Open Source Information

    Energy Technology Data Exchange (ETDEWEB)

    Baty, Samuel R. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Intelligence and Systems Analysis

    2016-08-11

    These are a set of slides on the efficient utilization of open source information. Open source information consists of a vast set of information from a variety of sources. Not only does the quantity of open source information pose a problem, the quality of such information can hinder efforts. To show this, two case studies are mentioned: Iran and North Korea, in order to see how open source information can be utilized. The huge breadth and depth of open source information can complicate an analysis, especially because open information has no guarantee of accuracy. Open source information can provide key insights either directly or indirectly: looking at supporting factors (flow of scientists, products and waste from mines, government budgets, etc.); direct factors (statements, tests, deployments). Fundamentally, it is the independent verification of information that allows for a more complete picture to be formed. Overlapping sources allow for more precise bounds on times, weights, temperatures, yields or other issues of interest in order to determine capability. Ultimately, a "good" answer almost never comes from an individual, but rather requires the utilization of a wide range of skill sets held by a team of people.

  8. Supplementary household water sources to augment potable ...

    African Journals Online (AJOL)

    An end-use model is presented and used to assess the theoretical impact of household water sources on potable water demand in formal residential areas. Reliable potable municipal supply to urban consumers via the water distribution system is typically linked to relatively low uptake of household water sources. However ...

  9. Measuring TGV source strength with Syntacan

    NARCIS (Netherlands)

    Toorn, J.D. van der; Hendriks, H.; Dool, T.C. van den

    1996-01-01

    A 10 m high, vertical, synthetic acoustic antenna (Syntacan) has been used to measure the acoustic source strength and the vertical source distribution of a French TGV, as a function of the speed of the train, the frequency of the sound and the coach type (passenger coach, power car). The results

  10. Portable thermo-photovoltaic power source

    Science.gov (United States)

    Zuppero, Anthony C.; Krawetz, Barton; Barklund, C. Rodger; Seifert, Gary D.

    1997-01-14

    A miniature thermo-photovoltaic (TPV) device for generation of electrical power for use in portable electronic devices. A TPV power source is constructed to provide a heat source chemical reactor capable of using various fuels, such as liquid hydrocarbons, including but not limited to propane, LPG, butane, alcohols, oils and diesel fuels to generate a source of photons. A reflector dish guides misdirected photon energy from the photon source toward a photovoltaic array. A thin transparent protector sheet is disposed between the photon source and the array to reflect back thermal energy that cannot be converted to electricity, and protect the array from thermal damage. A microlens disposed between the protector sheet and the array further focuses the tailored band of photon energy from the photon source onto an array of photovoltaic cells, whereby the photon energy is converted to electrical power. A heat recuperator removes thermal energy from reactor chamber exhaust gases, preferably using mini- or micro-bellows to force air and fuel past the exhaust gases, and uses the energy to preheat the fuel and oxidant before it reaches the reactor, increasing system efficiency. Mini- or micro-bellows force ambient air through the system both to supply oxidant and to provide cooling. Finally, an insulator, which is preferably a super insulator, is disposed around the TPV power source to reduce fuel consumption, and to keep the TPV power source cool to the touch so it can be used in hand-held devices.

  11. Usability in open source software development

    DEFF Research Database (Denmark)

    Andreasen, M. S.; Nielsen, H. V.; Schrøder, S. O.

    2006-01-01

    Open Source Software (OSS) development has gained significant importance in the production of soft-ware products. Open Source Software developers have produced systems with a functionality that is competitive with similar proprietary software developed by commercial software organizations. Yet OSS...

  12. Scalable Open Source Smart Grid Simulator (SGSim)

    DEFF Research Database (Denmark)

    Ebeid, Emad Samuel Malki; Jacobsen, Rune Hylsberg; Stefanni, Francesco

    2017-01-01

    . This paper presents an open source smart grid simulator (SGSim). The simulator is based on open source SystemC Network Simulation Library (SCNSL) and aims to model scalable smart grid applications. SGSim has been tested under different smart grid scenarios that contain hundreds of thousands of households...

  13. Russian History; A Guide to Reference Sources.

    Science.gov (United States)

    McGill Univ., Montreal (Quebec). McLennan Library.

    This guide identifies reference sources for the study of Russian and Soviet history available in the McGill University (Montreal) McLennan Library. Russian, English, French, and German language works covering Russian history from its origins to World War II are included. The guide is arranged in two parts: general reference sources and…

  14. Unconventional neutron sources for oil well logging

    Energy Technology Data Exchange (ETDEWEB)

    Frankle, C.M., E-mail: cfrankle@lanl.gov; Dale, G.E.

    2013-09-21

    Americium–Beryllium (AmBe) radiological neutron sources have been widely used in the petroleum industry for well logging purposes. There is strong desire on the part of various governmental and regulatory bodies to find alternate sources due to the high activity and small size of AmBe sources. Other neutron sources are available, both radiological ({sup 252}Cf) and electronic accelerator driven (D–D and D–T). All of these, however, have substantially different neutron energy spectra from AmBe and thus cause significantly different responses in well logging tools. We report on simulations performed using unconventional sources and techniques to attempt to better replicate the porosity and carbon/oxygen ratio responses a well logging tool would see from AmBe neutrons. The AmBe response of these two types of tools is compared to the response from {sup 252}Cf, D–D, D–T, filtered D–T, and T–T sources. -- Highlights: • AmBe sources are widely used for well logging purposes. • Governmental bodies would prefer to minimize AmBe use. • Other neutron sources are available, both radiological and electronic. • Tritium–tritium spectrum neutrons have similar logging tool response to AmBe. • A tritium–tritium neutron generator may be a viable AmBe replacement.

  15. On-chip entangled photon source

    Science.gov (United States)

    Soh, Daniel B. S.; Bisson, Scott E.

    2016-11-22

    Various technologies pertaining to an on-chip entangled photon source are described herein. A light source is used to pump two resonator cavities that are resonant at two different respective wavelengths and two different respective polarizations. The resonator cavities are coupled to a four-wave mixing cavity that receives the light at the two wavelengths and outputs polarization-entangled photons.

  16. Blended acquisition with dispersed source arrays

    NARCIS (Netherlands)

    Berkhout, A.J.

    2012-01-01

    Blended source arrays are historically configured with equal source units, such as broadband vibrators (land) and broadband air-gun arrays (marine). I refer to this concept as homogeneous blending. I have proposed to extend the blending concept to inhomogeneous blending, meaning that a blended

  17. From Open Source to Open Collaboration

    CERN Multimedia

    CERN. Geneva

    2015-01-01

    Open source is the right to modify, not the right to contribute. Are external contributions absent from your project? Have you ever thought about what is it like to be a new contributor on your project? I challenge you to transform your project from Open Source to an Open Collaboration.

  18. American Folklore: A Guide to Reference Sources.

    Science.gov (United States)

    Kibbee, Jo

    1989-01-01

    This annotated bibliography represents a core collection of reference sources on American folklore. In addition to general references, genre specific reference sources are listed in the following areas: folk narrative; folk music; customary folklore; material culture; ethnic and regional bibliographies; and applied folklore. (39 references) (CLB)

  19. The Stress Sources of Nursing Students

    Science.gov (United States)

    Oner Altiok, Hatice; Ustun, Besti

    2013-01-01

    Overall, nursing training is a stressful process. Especially when second year nursing students are evaluated within the professional socialization theory, they are stated to be affected by these sources of stress more negatively. This research was carried out in order to determine the stress sources of second year nursing students. 15 nursing…

  20. Identification of major sources controlling groundwater chemistry ...

    Indian Academy of Sciences (India)

    The plot for Na to Cl indicates higher Cl in both seasons, derived from Anthropogenic (human) sources from fertilizer, road salt, human and animal waste, and industrial applications, minor representations of Na also indicates source from weathering of silicate-bearing minerals. The plot for Na/Cl to EC indicates Na released ...

  1. Composition methods, Maxwell's equations and source terms

    NARCIS (Netherlands)

    J.G. Verwer (Jan)

    2010-01-01

    htmlabstractThis paper is devoted to high-order numerical time integration of first-order wave equation systems originating from spatial discretization of Maxwell’s equations. The focus lies on the accuracy of high-order composition in the presence of source functions. Source functions are known

  2. Composition methods, Maxwell's equations, and source terms

    NARCIS (Netherlands)

    J.G. Verwer (Jan)

    2012-01-01

    htmlabstractThis paper is devoted to high-order numerical time integration of first-order wave equation systems originating from spatial discretization of Maxwell's equations. The focus lies on the accuracy of high-order composition in the presence of source functions. Source functions are known to

  3. Nuclear Power Sources for Space Systems

    Science.gov (United States)

    Kukharkin, N. E.; Ponomarev-Stepnoi, N. N.; Usov, V. A.

    This chapter contains the information about nuclear power sources for space systems. Reactor nuclear sources are considered that use the energy of heavy nuclei fission generated by controlled chain fission reaction, as well as the isotope ones producing heat due to the energy of nuclei radioactive decay. Power of reactor nuclear sources is determined by the rate of heavy nuclei fission that may be controlled within a wide range from the zero up to the nominal one. Thermal power of isotope sources cannot be controlled. It is determined by the type and quantity of isotopes and decreases in time due to their radioactive decay. Both, in the reactor sources and in the isotope ones, nuclear power is converted into the thermal one that may be consumed for the coolant heating to produce thrust (Nuclear Power Propulsion System, NPPS) or may be converted into electricity (Nuclear Power Source, NPS) dynamically (a turbine generator) or statically (thermoelectric or thermionic converters). Electric power is supplied to the airborne equipment or is used to produce thrust in electric (ionic, plasma) low-thrust engines. A brief description is presented of the different nuclear systems with reactor and isotopic power sources implemented in Russia and the USA. The information is also given about isotopic sources for the ground-based application, mainly for navigation systems.

  4. Γ-source Neutral Point Clamped Inverter

    DEFF Research Database (Denmark)

    Mo, Wei; Loh, Poh Chiang; Blaabjerg, Frede

    Transformer based Z-source inverters are recently proposed to achieve promising buck-boost capability. They have improved higher buck-boost capability, smaller size and less components count over Z-source inverters. On the other hand, neutral point clamped inverters have less switching stress...

  5. Coding for Correlated Sources with Unknown Parameters.

    Science.gov (United States)

    1980-05-01

    D. Davisson , "Universal source coding," IEEE Transactions on Information Theory, vol. IT-19, pp. 783-795, 1973. 13. D. Neuhoff, R. Gray, and L... Davisson , "Fixed rate universal source coding with a fidelity criterion," IEEE Transactions on Information Theory, vol. IT-21, pp. 511-523, 1975. 14. D

  6. Spontaneous Sourcing among Students Reading Multiple Documents

    Science.gov (United States)

    Stromso, Helge I.; Braten, Ivar; Britt, M. Anne; Ferguson, Leila E.

    2013-01-01

    This study used think-aloud methodology to explore undergraduates' spontaneous attention to and use of source information while reading six documents that presented conflicting views on a controversial social scientific issue in a Google-like environment. Results showed that students explicitly and implicitly paid attention to sources of documents…

  7. Source Code Plagiarism--A Student Perspective

    Science.gov (United States)

    Joy, M.; Cosma, G.; Yau, J. Y.-K.; Sinclair, J.

    2011-01-01

    This paper considers the problem of source code plagiarism by students within the computing disciplines and reports the results of a survey of students in Computing departments in 18 institutions in the U.K. This survey was designed to investigate how well students understand the concept of source code plagiarism and to discover what, if any,…

  8. Detecting hidden sources-STUK/HUT team

    Energy Technology Data Exchange (ETDEWEB)

    Nikkinen, M.; Aarnio, P. [Helsinki Univ. of Technology, Espoo (Finland); Honkamaa, T.; Tiilikainen, H. [Finnish Centre for Radiation and Nuclear Safety, Helsinki (Finland)

    1997-12-31

    The task of the team was to locate and to identify hidden sources in a specified area in Padasjoki Auttoinen village. The team used AB-420 helicopter of the Finnish Frontier Guard. The team had two measuring systems: HPGe system (relative efficiency 18%) and 5`x5` NaI system. The team found two sources in real-time and additional two sources after 24 h analysis time. After the locations and characteristics of the sources were announced it was found out that altogether six sources would have been possible to find using the measured data. The total number of sources was ten. The NaI detector was good at detecting and locating the sources and HPGe was most useful in identification and calculation of the activity estimates. The following development should be made: 1) larger detectors are needed, 2) the software has to be improved. (This has been performed after the exercise) and 3) the navigation must be based on DGPS. visual navigation causes easily gaps between the flight lines and some sources may not be detected. (au).

  9. Source attribution of human campylobacteriosis in Denmark

    DEFF Research Database (Denmark)

    Boysen, Louise; Rosenquist, Hanne; Rosenquist, J. T.

    2014-01-01

    This study assesses the contribution of different sources of human campylobacteriosis in Denmark using two different source-attribution approaches. In total, 794 non-human isolates and 406 isolates from human cases (domestic, travel related, and cases with unknown travel history) were collected...

  10. 7 Questions to Ask Open Source Vendors

    Science.gov (United States)

    Raths, David

    2012-01-01

    With their budgets under increasing pressure, many campus IT directors are considering open source projects for the first time. On the face of it, the savings can be significant. Commercial emergency-planning software can cost upward of six figures, for example, whereas the open source Kuali Ready might run as little as $15,000 per year when…

  11. Electron-cyclotron-resonance ion sources (review)

    Energy Technology Data Exchange (ETDEWEB)

    Golovanivskii, K.S.; Dougar-Jabon, V.D. [People`s Friendship Univ., Moscow (Russian Federation)

    1992-01-01

    The physical principles are described and a brief survey of the present state is given of ion sources based on electron-cyclotron heating of plasma in a mirror trap. The characteristics of ECR sources of positive and negative ions used chiefly in accelerator technology are presented. 20 refs., 10 figs., 3 tabs.

  12. Source localization of rhythmic ictal EEG activity

    DEFF Research Database (Denmark)

    Beniczky, Sándor; Lantz, Göran; Rosenzweig, Ivana

    2013-01-01

    Although precise identification of the seizure-onset zone is an essential element of presurgical evaluation, source localization of ictal electroencephalography (EEG) signals has received little attention. The aim of our study was to estimate the accuracy of source localization of rhythmic ictal ...

  13. All-fiber femtosecond Cherenkov source

    DEFF Research Database (Denmark)

    Liu, Xiaomin; Lægsgaard, Jesper; Møller, Uffe Visbech

    2013-01-01

    An all-fiber femtosecond Cherenkov radiation source is demonstrated for the first time, to the best of our knowledge. Using a stable monolithic femtosecond Ybdoped fiber laser as the pump source, and the combination of photonic crystal fibers as the wave-conversion medium, we have generated tunable...

  14. Electrical source imaging of sleep spindles.

    Science.gov (United States)

    Del Felice, Alessandra; Arcaro, Chiara; Storti, Silvia Francesca; Fiaschi, Antonio; Manganotti, Paolo

    2014-07-01

    To identify and compare cortical source generators of slow and fast sleep spindles in healthy subjects, electroencephalographic (EEG) signals were obtained from 256 channels, and sources on neuroanatomical Montreal Neurological Institute (MNI) space estimated with low-resolution brain electromagnetic tomography analysis (LORETA). Spindle activity was recorded in 18 healthy volunteers during daytime napping. Because of lack of sleep or excessive artifacts, data from 13 subjects were analyzed off-line. Spindles were visually scored, marked, and bandpass filtered (slow 10-12 Hz or fast 12-14 Hz). EEG was segmented on the marker, and segments separately averaged. LORETA projected cortical sources on the MNI brain. Maximal intra- and inter-individual intensities were compared using the Wilcoxon test (P generators were consistently identified in frontal lobes, with additional sources in parietal and limbic lobes in half cases. Fast spindles had multiple temporo-parietal sources, with an inconstant frontal source. Inter-individual (P = 0.44), and intra-individual (P = 0.09 slow and P = 0.10 fast spindles) source intensities were comparable. Slow spindles sources were preferentially concentrated over frontal cortices in comparison with fast spindles (P = 0.0009). Our results demonstrate multiple, synchronous, and equipotent spindles cortical generators in healthy subjects, with more anterior generators for slow spindles.

  15. Source Monitoring by Children with Autism.

    Science.gov (United States)

    Farrant, Annette; Blades, Mark; Boucher, Jill

    1998-01-01

    The term "source monitoring" refers to the ability to distinguish the origin of memories. Comparison of source monitoring with 15 autistic, 15 mildly mentally retarded, and 15 non-disabled children found no differences among groups in the ability to identify which words the child had said and which words another person had said. (Author/DB)

  16. A Conceptual Framework for Primary Source Practices

    Science.gov (United States)

    Ensminger, David C.; Fry, Michelle L.

    2012-01-01

    This article introduces a descriptive conceptual framework to provide teachers with a means of recognizing and describing instructional activities that use primary sources. The framework provides structure for professional development programs that have been established to train teachers to access and integrate primary sources into lessons. The…

  17. Power conditioning system for energy sources

    Science.gov (United States)

    Mazumder, Sudip K [Chicago, IL; Burra, Rajni K [Chicago, IL; Acharya, Kaustuva [Chicago, IL

    2008-05-13

    Apparatus for conditioning power generated by an energy source includes an inverter for converting a DC input voltage from the energy source to a square wave AC output voltage, and a converter for converting the AC output voltage from the inverter to a sine wave AC output voltage.

  18. Sourcing from an Enterprise Architecture Perspective

    DEFF Research Database (Denmark)

    Gøtze, John; Axél, Mette

    2013-01-01

    Enterprise architecture offers direct input in order to define the appropriate combination of people, components and services used to produce and deliver products and services. Sourcing, as the process of optimally organizing and procuring this inside and outside an organization, is therefore...... a central enterprise architecture concern. In this chapter we will discuss how enterprise architecture can benefit an enterprise’s sourcing strategy....

  19. STATUS OF ITEP DECABORANE ION SOURCE PROGRAM.

    Energy Technology Data Exchange (ETDEWEB)

    KULEVOY,T.V.; PETRENKO, S.V.; KUIBEDA, R.P.; SELEZNEV, D.N.; KOZLOV, A.V.; STASEVICH, YU.B.; SITNIKOV, A.L.; SHAMAILOV, I.M.; PERSHIN, V.I.; HERSHCOVITCH, A.; JOHNSON, B.M.; GUSHENETS, V.I.; OKS, E.M.; POOLE, H.J.; MASUNOV, E.S.; POLOZOV, S.M.

    2007-08-26

    The joint research and development program is continued to develop steady-state ion source of decaborane beam for ion implantation industry. Both Freeman and Bemas ion sources for decaborane ion beam generation were investigated. Decaborane negative ion beam as well as positive ion beam were generated and delivered to the output of mass separator. Experimental results obtained in ITEP are presented.

  20. Intrusion Detection using Open Source Tools

    Directory of Open Access Journals (Sweden)

    Jack TIMOFTE

    2008-01-01

    Full Text Available We have witnessed in the recent years that open source tools have gained popularity among all types of users, from individuals or small businesses to large organizations and enterprises. In this paper we will present three open source IDS tools: OSSEC, Prelude and SNORT.