The Proposed Model of Collaborative Virtual Learning Environment for Introductory Programming Course

Science.gov (United States)

Othman, Mahfudzah; Othman, Muhaini

2012-01-01

This paper discusses the proposed model of the collaborative virtual learning system for the introductory computer programming course which uses one of the collaborative learning techniques known as the "Think-Pair-Share". The main objective of this study is to design a model for an online learning system that facilitates the…

The Role of an Actuarial Director in the Development of an Introductory Program

Science.gov (United States)

Staples, Susan G.

2014-01-01

We describe the roles and duties of a director in developing an introductory actuarial program. Degree plan design, specialized exam courses, internship classes, coordination of efforts with Economics and Finance Departments, opportunities for creating a minor in actuarial mathematics, actuarial clubs, career advice, and interaction with actuarial…

Predicting introductory programming performance: A multi-institutional multivariate study

Science.gov (United States)

Bergin, Susan; Reilly, Ronan

2006-12-01

A model for predicting student performance on introductory programming modules is presented. The model uses attributes identified in a study carried out at four third-level institutions in the Republic of Ireland. Four instruments were used to collect the data and over 25 attributes were examined. A data reduction technique was applied and a logistic regression model using 10-fold stratified cross validation was developed. The model used three attributes: Leaving Certificate Mathematics result (final mathematics examination at second level), number of hours playing computer games while taking the module and programming self-esteem. Prediction success was significant with 80% of students correctly classified. The model also works well on a per-institution level. A discussion on the implications of the model is provided and future work is outlined.

Student Performance in Introductory Psychology Following Termination of the Programmed Achievement Contingency at Mid-Semester

Science.gov (United States)

Nation, Jack R.; And Others

1977-01-01

Discusses the Programmed Achievement learning system in an introductory psychology course. This system is based on an instructional system of motivation and reward in which a crucial ingredient is the testing procedure. (Author/JR)

Fish: A New Computer Program for Friendly Introductory Statistics Help

Science.gov (United States)

Brooks, Gordon P.; Raffle, Holly

2005-01-01

All introductory statistics students must master certain basic descriptive statistics, including means, standard deviations and correlations. Students must also gain insight into such complex concepts as the central limit theorem and standard error. This article introduces and describes the Friendly Introductory Statistics Help (FISH) computer…

Introductory speeches

International Nuclear Information System (INIS)

2001-01-01

This CD is multimedia presentation of programme safety upgrading of Bohunice V1 NPP. This chapter consist of introductory commentary and 4 introductory speeches (video records): (1) Introductory speech of Vincent Pillar, Board chairman and director general of Slovak electric, Plc. (SE); (2) Introductory speech of Stefan Schmidt, director of SE - Bohunice Nuclear power plants; (3) Introductory speech of Jan Korec, Board chairman and director general of VUJE Trnava, Inc. - Engineering, Design and Research Organisation, Trnava; Introductory speech of Dietrich Kuschel, Senior vice-president of FRAMATOME ANP Project and Engineering

Mindstorms robots and the application of cognitive load theory in introductory programming

Science.gov (United States)

Mason, Raina; Cooper, Graham

2013-12-01

This paper reports on a series of introductory programming workshops, initially targeting female high school students, which utilised Lego Mindstorms robots. Cognitive load theory (CLT) was applied to the instructional design of the workshops, and a controlled experiment was also conducted investigating aspects of the interface. Results indicated that a truncated interface led to better learning by novice programmers as measured by test performance by participants, as well as enhanced shifts in self-efficacy and lowered perception of difficulty. There was also a transfer effect to another programming environment (Alice). It is argued that the results indicate that for novice programmers, the mere presence on-screen of additional (redundant) entities acts as a form of tacit distraction, thus impeding learning. The utility of CLT to analyse, design and deliver aspects of computer programming environments and instructional materials is discussed.

A Demonstration of Evidence-Based Action Research Using Information Dashboard in Introductory Programming Education

OpenAIRE

Matsuzawa , Yoshiaki; Tanaka , Yoshiki; Kitani , Tomoya; Sakai , Sanshiro

2017-01-01

Part 3: Computer Science Education and Its Future Focus and Development; International audience; In this paper, we demonstrated an evidence-based action research in an introductory programming class with the use of an information dashboard which provides coding metrics to visualize students’ engagement of their assignments. The information dashboard was designed for teachers to improve their classroom teaching using the same coding metrics which was verified in our previous research [9]. The ...

A Three-Year Reflective Writing Program as Part of Introductory Pharmacy Practice Experiences

Science.gov (United States)

Vaughn, Jessica; Kerr, Kevin; Zielenski, Christopher; Toppel, Brianna; Johnson, Lauren; McCauley, Patrina; Turner, Christopher J.

2013-01-01

Objectives. To implement and evaluate a 3-year reflective writing program incorporated into introductory pharmacy practice experiences (IPPEs) in the first- through third-year of a doctor of pharmacy (PharmD) program. Design. Reflective writing was integrated into 6 IPPE courses to develop students’ lifelong learning skills. In their writing, students were required to self-assess their performance in patient care activities, identify and describe how they would incorporate learning opportunities, and then evaluate their progress. Practitioners, faculty members, and fourth-year PharmD students served as writing preceptors. Assessment. The success of the writing program was assessed by reviewing class performance and surveying writing preceptor’s opinions regarding the student’s achievement of program objectives. Class pass rates averaged greater than 99% over the 8 years of the program and the large majority of the writing preceptors reported that student learning objectives were met. A support pool of 99 writing preceptors was created. Conclusions. A 3-year reflective writing program improved pharmacy students’ reflection and reflective writing skills. PMID:23788811

Does Participation in a Computer-Based Learning Program in Introductory Financial Accounting Course Lead to Choosing Accounting as a Major?

Science.gov (United States)

Owhoso, Vincent; Malgwi, Charles A.; Akpomi, Margaret

2014-01-01

The authors examine whether students who completed a computer-based intervention program, designed to help them develop abilities and skills in introductory accounting, later declared accounting as a major. A sample of 1,341 students participated in the study, of which 74 completed the intervention program (computer-based assisted learning [CBAL])…

Graphical User Interface Programming in Introductory Computer Science.

Science.gov (United States)

Skolnick, Michael M.; Spooner, David L.

Modern computing systems exploit graphical user interfaces for interaction with users; as a result, introductory computer science courses must begin to teach the principles underlying such interfaces. This paper presents an approach to graphical user interface (GUI) implementation that is simple enough for beginning students to understand, yet…

A Case Study of Prior Knowledge, Learning Approach and Conceptual Change in an Introductory College Chemistry Tutorial Program.

Science.gov (United States)

Braathen, Per Christian; Hewson, Peter W.

This paper presents a case study involving a small group of students enrolled in a tutorial program learning introductory college chemistry. The underlying theoretical framework of this investigation was a constructivist view of learning, but more specifically it was based on Ausubel's theory of meaningful learning. The findings of this…

Four-Year Turfgrass Management Programs in the United States: II. Organization and Content of Introductory Turfgrass Management Courses.

Science.gov (United States)

Karnok, Keith J.; And Others

1993-01-01

A survey of 32 land-grant institutions was conducted to determine format, topical content, and teaching methods of introductory turfgrass management courses of 4-year turfgrass management programs in the United States. Required courses included a basic soils class and a course in biology or botany, usually transmitted by the lecture method. (MDH)

Towards a Virtual Teaching Assistant to Answer Questions Asked by Students in Introductory Computer Science

Science.gov (United States)

Heiner, Cecily

2009-01-01

Students in introductory programming classes often articulate their questions and information needs incompletely. Consequently, the automatic classification of student questions to provide automated tutorial responses is a challenging problem. This dissertation analyzes 411 questions from an introductory Java programming course by reducing the…

Introductory Overviews

NARCIS (Netherlands)

Jakeman, A.J.; Hamilton, S.H.; Athanasiadis, I.N.; Pierce, S.A.

2015-01-01

Introductory Overview articles are designed to provide introductory level background to key themes and topics that caters to the eclectic readership of EMS. It is envisaged that these articles will help to break down barriers to shared understanding and dialogue within multidisciplinary teams, and

Teaching Introductory Geoscience: A Cutting Edge Workshop Report

Science.gov (United States)

Manduca, C.; Tewksbury, B.; Egger, A.; MacDonald, H.; Kirk, K.

2008-12-01

Introductory undergraduate courses play a pivotal role in the geosciences. They serve as recruiting grounds for majors and future professionals, provide relevant experiences in geoscience for pre-service teachers, and offer opportunities to influence future policy makers, business people, professionals, and citizens. An introductory course is also typically the only course in geoscience that most of our students will ever take. Because the role of introductory courses is pivotal in geoscience education, a workshop on Teaching Introductory Courses in the 21st Century was held in July 2008 as part of the On the Cutting Edge faculty development program. A website was also developed in conjunction with the workshop. One of the central themes of the workshop was the importance of considering the long-term impact a course should have on students. Ideally, courses can be designed with this impact in mind. Approaches include using the local geology to focus the course and illustrate concepts; designing a course for particular audience (such as Geology for Engineers); creating course features that help students understand and interpret geoscience in the news; and developing capstone projects to teach critical thinking and problem solving skills in a geologic context. Workshop participants also explored strategies for designing engaging activities including exploring with Google Earth, using real-world scenarios, connecting with popular media, or making use of campus features on local field trips. In addition, introductory courses can emphasize broad skills such as teaching the process of science, using quantitative reasoning and developing communication skills. Materials from the workshop as well as descriptions of more than 150 introductory courses and 350 introductory-level activities are available on the website: http://serc.carleton.edu/NAGTWorkshops/intro/index.html.

Introductory Raman spectroscopy

CERN Document Server

Ferraro, John R

2012-01-01

Praise for Introductory Raman Spectroscopy Highlights basic theory, which is treated in an introductory fashion Presents state-of-the-art instrumentation Discusses new applications of Raman spectroscopy in industry and research.

Assessing Factors That Influence the Recruitment of Majors from Introductory Geology Classes at Northern Arizona University

Science.gov (United States)

Hoisch, Thomas D.; Bowie, James I.

2010-01-01

In order to guide the formulation of strategies for recruiting undergraduates into the geology program at Northern Arizona University, we surveyed 783 students in introductory geology classes and 23 geology majors in their junior and senior years. Our analysis shows that ~7% of students in the introductory classes are possible candidates for…

Helping Struggling Students in Introductory Biology: A Peer-Tutoring Approach That Improves Performance, Perception, and Retention

Science.gov (United States)

Batz, Zachary; Olsen, Brian J.; Dumont, Jonathan; Dastoor, Farahad; Smith, Michelle K.

2015-01-01

The high attrition rate among science, technology, engineering, and mathematics (STEM) majors has long been an area of concern for institutions and educational researchers. The transition from introductory to advanced courses has been identified as a particularly “leaky” point along the STEM pipeline, and students who struggle early in an introductory STEM course are predominantly at risk. Peer-tutoring programs offered to all students in a course have been widely found to help STEM students during this critical transition, but hiring a sufficient number of tutors may not be an option for some institutions. As an alternative, this study examines the viability of an optional peer-tutoring program offered to students who are struggling in a large-enrollment, introductory biology course. Struggling students who regularly attended peer tutoring increased exam performance, expert-like perceptions of biology, and course persistence relative to their struggling peers who were not attending the peer-tutoring sessions. The results of this study provide information to instructors who want to design targeted academic assistance for students who are struggling in introductory courses. PMID:25976652

Blended Learning Versus Traditional Lecture in Introductory Nursing Pathophysiology Courses.

Science.gov (United States)

Blissitt, Andrea Marie

2016-04-01

Currently, many undergraduate nursing courses use blended-learning course formats with success; however, little evidence exists that supports the use of blended formats in introductory pathophysiology courses. The purpose of this study was to compare the scores on pre- and posttests and course satisfaction between traditional and blended course formats in an introductory nursing pathophysiology course. This study used a quantitative, quasi-experimental, nonrandomized control group, pretest-posttest design. Analysis of covariance compared pre- and posttest scores, and a t test for independent samples compared students' reported course satisfaction of the traditional and blended course formats. Results indicated that the differences in posttest scores were not statistically significant between groups. Students in the traditional group reported statistically significantly higher satisfaction ratings than students in the blended group. The results of this study support the need for further research of using blended learning in introductory pathophysiology courses in undergraduate baccalaureate nursing programs. Further investigation into how satisfaction is affected by course formats is needed. Copyright 2016, SLACK Incorporated.

Addressing the Problem of Service Teaching Introductory Economics Subjects

Science.gov (United States)

Barrett, Steven

2005-01-01

Enrolments in undergraduate economics programs have been falling constantly since the early 1990s. This trend coincides with the increasing popularity of business and management degrees. Consequently, the major activity of many, if not most economics departments and schools in Australia is service teaching of introductory economics to first year…

The Impact of the Supplemental Instruction Leader on Student Performance in Introductory Accounting

Science.gov (United States)

Jones, Jefferson P.

2013-01-01

This study explores the association between a supplemental instruction (SI) program and student performance in an introductory accounting course. SI is a proactive academic support program that is aimed at improving student learning in traditionally "high-risk" college courses by integrating learning and critical thinking strategies with…

Two-Language, Two-Paradigm Introductory Computing Curriculum Model and its Implementation

OpenAIRE

Zanev, Vladimir; Radenski, Atanas

2011-01-01

This paper analyzes difficulties with the introduction of object-oriented concepts in introductory computing education and then proposes a two-language, two-paradigm curriculum model that alleviates such difficulties. Our two-language, two-paradigm curriculum model begins with teaching imperative programming using Python programming language, continues with teaching object-oriented computing using Java, and concludes with teaching object-oriented data structures with Java.

The Importance of Attendance in an Introductory Textile Science Course

Science.gov (United States)

Marcketti, Sara B.; Wang, Xinxin; Greder, Kate

2013-01-01

At Iowa State University, the introductory textile science course is a required 4-credit class for all undergraduate students enrolled in the Apparel, Merchandising, and Design Program. Frustrated by a perceived gap between students who easily comprehended course material and those who complained and struggled, the instructor implemented an…

X-29 vortex flow control tests

Science.gov (United States)

Hancock, Regis; Fullerton, Gordon

1992-01-01

A joint Air Force/NASA X-29 aircraft program to improve yaw control at high angle of attack using vortex flow control (VFC) is described. Directional VFC blowing proved to a be a powerful yaw moment generator and was very effective in overriding natural asymmetries, but was essentially ineffective in suppressing wing rock. Symmetric aft blowing also had little effect on suppressing wing rock.

Mathematical Rigor in Introductory Physics

Science.gov (United States)

Vandyke, Michael; Bassichis, William

2011-10-01

Calculus-based introductory physics courses intended for future engineers and physicists are often designed and taught in the same fashion as those intended for students of other disciplines. A more mathematically rigorous curriculum should be more appropriate and, ultimately, more beneficial for the student in his or her future coursework. This work investigates the effects of mathematical rigor on student understanding of introductory mechanics. Using a series of diagnostic tools in conjunction with individual student course performance, a statistical analysis will be performed to examine student learning of introductory mechanics and its relation to student understanding of the underlying calculus.

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC162 (Link to dictyBase) - - - Contig-U16455-1 VFC162P (Link... to Original site) VFC162F 367 VFC162Z 501 VFC162P 868 - - Show VFC162 Library VF (Link to library) Clone ID VFC162 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16455-1 Original site URL http://dict...elongation factor 1 alpha. 896 0.0 3 AF016242 |AF016242.1 Dictyostelium discoideu... vacuolar 4.0 %: mitochondrial 4.0 %: peroxisomal >> prediction for VFC162 is nuc 5' end seq. ID VFC162F 5'

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC255 (Link to dictyBase) - - - Contig-U16272-1 VFC255P (Link... to Original site) VFC255F 198 VFC255Z 525 VFC255P 723 - - Show VFC255 Library VF (Link to library) Clone ID VFC255 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict...oducing significant alignments: (bits) Value N L08391 |L08391.1 Dictyostelium discoideum ribosomal protein (...ic 32.0 %: nuclear 4.0 %: Golgi 4.0 %: mitochondrial >> prediction for VFC255 is cyt 5' end seq. ID VFC255F

Evolving Roles For Teaching Assistants In Introductory Courses

Science.gov (United States)

Dunbar, R. W.; Egger, A. E.; Schwartz, J. K.

2008-12-01

As we bring new research-based learning approaches, curricular innovations, and student engagement practices into the introductory science classroom, expectations of teaching assistants (TAs) should have, and have, changed. Similarly, the 21st century teaching assistant has different expectations of us. Maintaining relevance in this context means bringing TAs into an integrated teaching team that supports effective learning for students and provides structured professional development opportunities for TAs. A number of support efforts on our campus, with counterparts at many other universities, seek to optimize the instructional impact of faculty and teaching assistants, thus opening the door to enhanced student engagement (e.g. the quality of effort students put forth, their persistence in science and/or engineering courses, and their perception of scientific relevance in everyday life). Among these efforts, School of Earth Sciences course development TAs work 1:1 in advance of the term with introductory course faculty to design exercises and course materials that meet clearly articulated student learning goals or pedagogical challenges. Throughout the process, TAs are mentored by the faculty as well as science pedagogy experts. Initially funded by a major teaching award, the School is now moving to institutionalize this successful program which has broadened the definition of the TA role. Another area of optimization, reflecting Shulman's concept of pedagogical content knowledge, is our campus mandate that TA development take place within a departmental, as well as general, context. Both Chemistry and Physics expect introductory course TAs to lead interactive, guided-inquiry or tutorial-style sections. Integrating these sections with lecture and positively reinforcing course goals requires TA buy-in and a set of pedagogical facilitation skills cultivated through course-specific training and active mentoring while teaching. To better support the mentoring process

THE PROPOSED MODEL OF COLLABORATIVE VIRTUAL LEARNING ENVIRONMENT FOR INTRODUCTORY PROGRAMMING COURSE

Directory of Open Access Journals (Sweden)

Mahfudzah OTHMAN

2012-01-01

Full Text Available This paper discusses the proposed model of the collaborative virtual learning system for the introductory computer programming course which uses one of the collaborative learning techniques known as the “Think-Pair-Share”. The main objective of this study is to design a model for an online learning system that facilitates the collaborative learning activities in a virtual environment such as online communications and pair or small group discussions. In order to model the virtual learning environment, the RUP methodology has been used where it involves the data collection phase and the analysis and design phase. Fifty respondents have been randomly selected to participate in the data collection phase to investigate the students’ interest and learning styles as well as their learning preferences. The results have shown the needs for the development of online small group discussions that can be used as an alternative learning style for programming courses. The proposed design of the virtual learning system named as the Online Collaborative Learning System or OCLS is being depicted using the object-oriented models which are the use-case model and class diagram in order to show the concise processes of virtual “Think-Pair-Share” collaborative activities. The “Think-Pair-Share” collaborative learning technique that is being used in this model has been chosen because of its simplicity and relatively low-risk. This paper also presents the proposed model of the system’s architecture that will become the guidelines for the physical development of OCLS using the web-based applications.

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC234 (Link to dictyBase) - - - Contig-U16464-1 VFC234P (Link... to Original site) VFC234F 292 VFC234Z 462 VFC234P 754 - - Show VFC234 Library VF (Link to library) Clone ID VFC234 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16464-1 Original site URL http://dict...2 5e-06 6 AL844509 |AL844509.1 Plasmodium falciparum chromosome 13. 48 4e-04 4 AC117075 |AC117075.2 Dict...brane 4.0 %: Golgi 4.0 %: vesicles of secretory system >> prediction for VFC234 is nuc 5' end seq. ID VFC234

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC204 (Link to dictyBase) - - - - VFC204P (Link to Original s...ite) VFC204F 508 VFC204Z 681 VFC204P 1189 - - Show VFC204 Library VF (Link to library) Clone ID VFC204 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.t...|X55972.1 D. discoideum EF1-II gene for elongation factor 1 alpha. 1245 0.0 2 AF016242 |AF016242.1 Dict... 8.0 %: vacuolar 4.0 %: mitochondrial 4.0 %: peroxisomal >> prediction for VFC204 is cyt 5' end seq. ID VFC2

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC161 (Link to dictyBase) - - - Contig-U15456-1 VFC161P (Link... to Original site) VFC161F 564 VFC161Z 562 VFC161P 1126 - - Show VFC161 Library VF (Link to library) Clone ID VFC161 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15456-1 Original site URL http://dict...Value N Y16962 |Y16962.1 Dictyostelium discoideum mRNA for cathepsin D. 1025 0.0 5 AJ243946 |AJ243946.1 Dict...plasma membrane 4.0 %: vesicles of secretory system >> prediction for VFC161 is nuc 5' end seq. ID VFC161F 5

Understanding and Affecting Science Teacher Candidates' Scientific Reasoning in Introductory Astrophysics

Science.gov (United States)

Steinberg, Richard; Cormier, Sebastien

2013-01-01

This study reports on a content course for science immersion teacher candidates that emphasized authentic practice of science and thinking scientifically in the context of introductory astrophysics. We explore how 122 science teacher candidates spanning three cohorts did and did not reason scientifically and how this evolved in our program. Our…

Active and Collaborative Learning in an Introductory Electrical and Computer Engineering Course

Science.gov (United States)

Kotru, Sushma; Burkett, Susan L.; Jackson, David Jeff

2010-01-01

Active and collaborative learning instruments were introduced into an introductory electrical and computer engineering course. These instruments were designed to assess specific learning objectives and program outcomes. Results show that students developed an understanding comparable to that of more advanced students assessed later in the…

Introductory remarks

NARCIS (Netherlands)

Kiefer, Friedemann; Schulte-Merker, Stefan

2014-01-01

This introductory section briefly highlights the subsequent chapters in the context of recent findings and open questions in lymphatic vessel biology. It aims to provide a quick overview and orientation in the contents of this monograph collection.

Sigma-Delta Voltage to Frequency Converter With Phase Modulation Possibility

OpenAIRE

STORK, Milan

2014-01-01

Voltage to frequency converter (VFC) is an oscillator whose frequency is linearly proportional to control voltage. There are two common VFC architectures: the current steering multivibrator and the charge-balance VFC. For higher linearity, the charge-balancing method is preferred. The charge balanced VFC may be made in asynchronous or synchronous (clocked) forms. The synchronous charge balanced VFC or "sigma delta" (S-D) VFC is used when output pulses are synchroni...

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC102 (Link to dictyBase) - - - Contig-U16455-1 VFC102P (Link... to Original site) VFC102F 433 VFC102Z 582 VFC102P 1015 - - Show VFC102 Library VF (Link to library) Clone ID VFC102 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16455-1 Original site URL http://dict...lpha. 1100 0.0 2 X55972 |X55972.1 D. discoideum EF1-II gene for elongation factor 1 alpha. 1059 0.0 2 AF016242 |AF016242.1 Dict....0 %: vacuolar 4.0 %: mitochondrial 4.0 %: peroxisomal >> prediction for VFC102 i

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC171 (Link to dictyBase) - - - Contig-U16478-1 VFC171P (Link... to Original site) VFC171F 482 VFC171Z 633 VFC171P 1115 - - Show VFC171 Library VF (Link to library) Clone ID VFC171 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16478-1 Original site URL http://dict...ptttrlptt trlstttrlptttrlptttrlptttrlptttrlsttrlxtttrlstswctswctswictr ygswissrllcwynhs*l*t*c*sfkksnerywyk*i...ologous to C-terminal repeat sequence of rhodopsin and synaptophysin. 88 1e-15 3 X54062 |X54062.1 Dictyostel

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC231 (Link to dictyBase) - - - Contig-U16593-1 VFC231P (Link... to Original site) VFC231F 428 VFC231Z 202 VFC231P 630 - - Show VFC231 Library VF (Link to library) Clone ID VFC231 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16593-1 Original site URL http://dict...amoeba histolytica genomic, DNA sequence. 48 0.13 1 AC116984 |AC116984.2 Dictyostelium discoideum chromosome...mbrane 4.0 %: vesicles of secretory system 4.0 %: extracellular, including cell wall >> predict

A MOOC for Introductory Physics

Science.gov (United States)

Schatz, Michael

2014-03-01

We describe an effort to develop and to implement a college-level introductory physics (mechanics) MOOC that offers bona fide laboratory experiences. We also discuss efforts to use MOOC curricular materials to ``flip'' the classroom in a large lecture introductory physics course offered on-campus at Georgia Tech. Preliminary results of assessments and surveys from both MOOC and on-campus students will be presented.

News clippings for introductory astronomy

Science.gov (United States)

Bobrowsky, Matthew

1999-09-01

Most students entering our introductory astronomy course for nonscience majors arrive not merely lacking scientific facts-they also have misconceptions about the nature of science, and many have a handicapping ``science anxiety'' (in addition to math anxiety). So I have added a ``current science'' requirement to our introductory course. Each student must compile a file of five astronomy news articles taken from readily available sources.

Psychology Ethics in Introductory Psychology Textbooks

Science.gov (United States)

Zucchero, Renee' A.

2011-01-01

Previous research revealed that introductory psychology textbooks included limited information about psychology ethics. This study reviewed 48 current introductory psychology textbooks for research and other APA ethics content. These textbooks included slightly more total ethics content and were more thorough in their review of research ethics…

Introductory Guide to European Corporate Law

DEFF Research Database (Denmark)

Fomcenco, Alex

Introductory Guide to European Corporate Law presents in an easily comprehensible and accessible way the main features and principles that govern European corporate law.......Introductory Guide to European Corporate Law presents in an easily comprehensible and accessible way the main features and principles that govern European corporate law....

SIGKit: Software for Introductory Geophysics Toolkit

Science.gov (United States)

Kruse, S.; Bank, C. G.; Esmaeili, S.; Jazayeri, S.; Liu, S.; Stoikopoulos, N.

2017-12-01

The Software for Introductory Geophysics Toolkit (SIGKit) affords students the opportunity to create model data and perform simple processing of field data for various geophysical methods. SIGkit provides a graphical user interface built with the MATLAB programming language, but can run even without a MATLAB installation. At this time SIGkit allows students to pick first arrivals and match a two-layer model to seismic refraction data; grid total-field magnetic data, extract a profile, and compare this to a synthetic profile; and perform simple processing steps (subtraction of a mean trace, hyperbola fit) to ground-penetrating radar data. We also have preliminary tools for gravity, resistivity, and EM data representation and analysis. SIGkit is being built by students for students, and the intent of the toolkit is to provide an intuitive interface for simple data analysis and understanding of the methods, and act as an entrance to more sophisticated software. The toolkit has been used in introductory courses as well as field courses. First reactions from students are positive. Think-aloud observations of students using the toolkit have helped identify problems and helped shape it. We are planning to compare the learning outcomes of students who have used the toolkit in a field course to students in a previous course to test its effectiveness.

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC221 (Link to dictyBase) - - - Contig-U09438-1 VFC221Z (Link... to Original site) - - VFC221Z 496 - - - - Show VFC221 Library VF (Link to library) Clone ID VFC221 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U09438-1 Original site URL http://dict... mitochondrial 8.0 %: peroxisomal 4.0 %: cytoskeletal 4.0 %: Golgi >> prediction for VFC221 is cyt 5' end se

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC254 (Link to dictyBase) - - - Contig-U15456-1 VFC254P (Link... to Original site) VFC254F 509 VFC254Z 569 VFC254P 1078 - - Show VFC254 Library VF (Link to library) Clone ID VFC254 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15456-1 Original site URL http://dict...mology vs DNA Score E Sequences producing significant alignments: (bits) Value N Y16962 |Y16962.1 Dictyostel...ium discoideum mRNA for cathepsin D. 910 0.0 3 AJ243946 |AJ243946.1 Dictyostelium

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC187 (Link to dictyBase) - - - Contig-U12289-1 VFC187P (Link... to Original site) VFC187F 411 VFC187Z 678 VFC187P 1089 - - Show VFC187 Library VF (Link to library) Clone ID VFC187 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12289-1 Original site URL http://dict... N AC117176 |AC117176.2 Dictyostelium discoideum chromosome 2 map 5018074-5200947... strain AX4, complete sequence. 36 0.008 12 AC114263 |AC114263.2 Dictyostelium discoideum chromosome 2 map 2

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC212 (Link to dictyBase) - - - Contig-U16455-1 VFC212P (Link... to Original site) VFC212F 260 VFC212Z 343 VFC212P 603 - - Show VFC212 Library VF (Link to library) Clone ID VFC212 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16455-1 Original site URL http://dict...actor 1 alpha. 394 0.0 3 X55972 |X55972.1 D. discoideum EF1-II gene for elongation factor 1 alpha. 347 0.0 3...4.0 %: vesicles of secretory system 4.0 %: endoplasmic reticulum >> prediction fo

The Memorability of Introductory Psychology Revisited

Science.gov (United States)

Landrum, R. Eric; Gurung, Regan A. R.

2013-01-01

Almost 2 million students enroll in introductory psychology each year in the United States, making it the second most popular undergraduate course in the nation. Introductory psychology not only serves as a prerequisite for other courses in the discipline but for some students this course provides their only exposure to psychological science.…

Assessment of Factors that Influence the Recruitment of Majors from Introductory Geology Classes

Science.gov (United States)

Hoisch, T. D.; Bowie, J. I.

2009-12-01

In order to guide the formulation of strategies for recruiting undergraduates taking introductory geology courses into the geology program at Northern Arizona University, we surveyed 783 students in introductory geology classes and 23 geology majors in their junior and senior years. Our introductory courses (GLG100, Introduction to Geology; GLG101, Physical Geology; and GLG112, Geologic Disasters) typically enroll ~600 students each semester. The majority of students in these classes are non-majors who take them in order to satisfy a university general education requirement (called “Liberal Studies requirements” at NAU). A large proportion of these students are freshmen (51%) and sophomores (30%), and many have not yet decided on a major or are uncertain about the major they have chosen. Our analysis shows that ~7% of students in the introductory classes are possible candidates for recruitment. Although a small percentage, it represents a large number of individuals, in fact more than could be accommodated were they all to decide to major in geology. Influential factors that weigh in favor of majoring in geology include good employability, good salary potential, and opportunities for working outdoors, field work, observing nature, travel, and environmentally friendly employment. In addition, students view a career as a geologist as potentially the most fulfilling of the different science occupations (biologist, chemist, geologist, environmental scientist, physicist) and among the more environmentally friendly. However, students perceive geology to be the least difficult of the sciences, and geology occupations to be low-paying and low in prestige relative to the other sciences. These negative perceptions could be countered by providing data to introductory students showing the starting salaries of geologists in comparison to other science occupations, and by communicating the rigorous nature of the more advanced classes in the geology degree program. A

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC196 (Link to dictyBase) - - - Contig-U13856-1 VFC196P (Link... to Original site) VFC196F 487 VFC196Z 556 VFC196P 1043 - - Show VFC196 Library VF (Link to library) Clone ID VFC196 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13856-1 Original site URL http://dict...te 2004.12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N U72746 |U72746.1 Dict...13. 36 0.053 5 AC116984 |AC116984.2 Dictyostelium discoideum chromosome 2 map 2567470-3108875 strain AX4, co

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC241 (Link to dictyBase) - - - Contig-U16272-1 VFC241P (Link... to Original site) VFC241F 369 VFC241Z 514 VFC241P 883 - - Show VFC241 Library VF (Link to library) Clone ID VFC241 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict...ments: (bits) Value N L08391 |L08391.1 Dictyostelium discoideum ribosomal protein (L3) gene, complete cds. 6...0 m3a: 0.00 m3b: 0.00 m_ : 1.00 68.0 %: nuclear 20.0 %: cytoplasmic 8.0 %: mitochondrial 4.0 %: peroxisomal >> predict

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC138 (Link to dictyBase) - - - Contig-U15456-1 VFC138P (Link... to Original site) VFC138F 411 VFC138Z 440 VFC138P 851 - - Show VFC138 Library VF (Link to library) Clone ID VFC138 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15456-1 Original site URL http://dict...ducing significant alignments: (bits) Value N Y16962 |Y16962.1 Dictyostelium discoideum mRNA for cathepsin D.... 815 0.0 4 AJ243946 |AJ243946.1 Dictyostelium discoideum ctsD gene for cathepsin D, exons 1 to 2. 815 0.0 5

Helping struggling students in introductory biology: a peer-tutoring approach that improves performance, perception, and retention.

Science.gov (United States)

Batz, Zachary; Olsen, Brian J; Dumont, Jonathan; Dastoor, Farahad; Smith, Michelle K

2015-01-01

The high attrition rate among science, technology, engineering, and mathematics (STEM) majors has long been an area of concern for institutions and educational researchers. The transition from introductory to advanced courses has been identified as a particularly "leaky" point along the STEM pipeline, and students who struggle early in an introductory STEM course are predominantly at risk. Peer-tutoring programs offered to all students in a course have been widely found to help STEM students during this critical transition, but hiring a sufficient number of tutors may not be an option for some institutions. As an alternative, this study examines the viability of an optional peer-tutoring program offered to students who are struggling in a large-enrollment, introductory biology course. Struggling students who regularly attended peer tutoring increased exam performance, expert-like perceptions of biology, and course persistence relative to their struggling peers who were not attending the peer-tutoring sessions. The results of this study provide information to instructors who want to design targeted academic assistance for students who are struggling in introductory courses. © 2015 Z. Batz et al. CBE—Life Sciences Education © 2015 The American Society for Cell Biology. This article is distributed by The American Society for Cell Biology under license from the author(s). It is available to the public under an Attribution–Noncommercial–Share Alike 3.0 Unported Creative Commons License (http://creativecommons.org/licenses/by-nc-sa/3.0).

Crossword Puzzles as Learning Tools in Introductory Soil Science

Science.gov (United States)

Barbarick, K. A.

2010-01-01

Students in introductory courses generally respond favorably to novel approaches to learning. To this end, I developed and used three crossword puzzles in spring and fall 2009 semesters in Introductory Soil Science Laboratory at Colorado State University. The first hypothesis was that crossword puzzles would improve introductory soil science…

Evaluation of a Continuing Professional Development program for first year student pharmacists undergoing an Introductory Pharmacy Practice Experience

Directory of Open Access Journals (Sweden)

Toyin Tofade

2011-01-01

Full Text Available Objectives: The purpose of the study was to evaluate a live and online training program for first year pharmacy students in implementing Continuing Professional Development (CPD principles (Reflect, Plan, Act, and Evaluate, writing SMART learning objectives, and documenting learning activities prior to and during a hospital introductory professional practice experience. Design: Cohort Study. Setting: Introductory professional practice experience. Participants: First year (PY1 students at the University of North Carolina Eshelman School of Pharmacy. Intervention: Live training or online training to introduce the concept of Continuing Professional Development in practice. Main Outcomes: Implementation of CPD principles through 1 completed pre-rotation education action plans with specific, measurable, achievable, relevant and time-bound (SMART learning objectives; and 2 completed learning activity worksheets post-rotation indicating stimuli for learning, resources used and accomplished learning. objectives; and 3 documented suggestions and content feedback for future lectures and pharmaceutical care lab experiences. Results:Out of the whole cohort (N=154, 14 (87.5% live (in person trainees and 122 (88% online trainees submitted an education action plan. Objectives were scored using a rubric on a scale of 1-5. A rating of 5 means "satisfactory", 3 means "work in progress" and 1 means "unacceptable". There were significant differences between the mean live trainee scores and the mean online trainee scores for the following respective section comparisons: Specific 4.7 versus 3.29 (p Conclusion: Live trainees performed significantly better than online trainees in writing SMART learning objectives. With focused training, students are more capable of implementing principles of CPD.   Type: Original Research

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC278 (Link to dictyBase) - - - Contig-U13504-1 VFC278E (Link... Clone ID VFC278 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13504-1 Original site URL http://dict...0.0 %: mitochondrial 4.0 %: plasma membrane >> prediction for VFC278 is cyt 5' end seq. ID VFC278F 5' end se

The analysis of students' characteristics related to the achievement in the introduction course to programming

OpenAIRE

Habjan, Klaudija

2016-01-01

In this Master thesis we look into students' characteristics which impact their success at introductory programming course. We want to define characteristics which are connected to and positively correlate with success at introductory programming course. The majority of novice students studying Computing on the Two-subject teacher program at the Faculty of Education, University of Ljubljana experience programming for the first time in this introductory programming course. Every year, stude...

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC175 (Link to dictyBase) - - - Contig-U16358-1 VFC175F (Link... to Original site) VFC175F 507 - - - - - - Show VFC175 Library VF (Link to library) Clone ID VFC175 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16358-1 Original site URL http://dict...12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC117072 |AC117072.2 Dict...eletal 4.0 %: mitochondrial 4.0 %: vacuolar 4.0 %: vesicles of secretory system >> prediction for VFC175 is

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC242 (Link to dictyBase) - - - Contig-U16280-1 VFC242F (Link... to Original site) VFC242F 431 - - - - - - Show VFC242 Library VF (Link to library) Clone ID VFC242 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16280-1 Original site URL http://dict...3( S18663 ) coronin - slime mold (Dictyostelium discoideum) ... 270 1e-71 AY52578...asmic 4.0 %: cytoskeletal 4.0 %: vesicles of secretory system >> prediction for VFC242 is nuc 5' end seq. ID

Introductory Punjabi.

Science.gov (United States)

Bahri, Ujjal Singh; Walia, Paramjit Singh

This introductory text in Punjabi (also spelled Panjabi) is intended primarily for those whose mother tongue is not Punjabi but are native speakers of other Indian languages. Some familiarity with the Punjabi cultural items is presupposed. The non-Indian may, however, also be able to use this text with profit since the lessons are graded. The…

An Analysis of Economic Learning among Undergraduates in Introductory Economics Courses in Germany

Science.gov (United States)

Happ, Roland; Zlatkin-Troitschanskaia, Olga; Schmidt, Susanne

2016-01-01

In this article, the authors present the findings of a pretest-posttest measurement of the economic knowledge of students in introductory economics courses in undergraduate study programs in Germany. The responses of 403 students to 14 items selected from the "Test of Economic Literacy" (Soper and Walstad 1987) were analyzed to identify…

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC280 (Link to dictyBase) - - - Contig-U16349-1 VFC280Z (Link... to Original site) - - VFC280Z 627 - - - - Show VFC280 Library VF (Link to library) Clone ID VFC280 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dict...4. 4 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AJ315489 |AJ315489.1 Dict...: vacuolar 4.0 %: Golgi 4.0 %: nuclear 4.0 %: vesicles of secretory system >> prediction for VFC280 is end 5

Using Isomorphic Problems to Learn Introductory Physics

Science.gov (United States)

Lin, Shih-Yin; Singh, Chandralekha

2011-01-01

In this study, we examine introductory physics students' ability to perform analogical reasoning between two isomorphic problems which employ the same underlying physics principles but have different surface features. Three hundred sixty-two students from a calculus-based and an algebra-based introductory physics course were given a quiz in the…

A Readability Analysis of Selected Introductory Economics.

Science.gov (United States)

Gallagher, Daniel J.; Thompson, G. Rodney

1981-01-01

To aid secondary school and college level economics teachers as they select textbooks for introductory economics courses, this article recounts how teachers can use the Flesch Reading Ease Test to measure readability. Data are presented on application of the Flesch Reading Ease Test to 15 introductory economics textbooks. (Author/DB)

Mental Models and Programming Aptitude

DEFF Research Database (Denmark)

Caspersen, Michael Edelgaard; Bennedsen, Jens; Larsen, Kasper Dalgaard

2007-01-01

Predicting the success of students participating in introductory programming courses has been an active research area for more than 25 years. Until recently, no variables or tests have had any significant predictive power. However, Dehnadi and Bornat claim to have found a simple test for programm......Predicting the success of students participating in introductory programming courses has been an active research area for more than 25 years. Until recently, no variables or tests have had any significant predictive power. However, Dehnadi and Bornat claim to have found a simple test...... for programming aptitude to cleanly separate programming sheep from non-programming goats. We briefly present their theory and test instrument. We have repeated their test in our local context in order to verify and perhaps generalise their findings, but we could not show that the test predicts students' success...... in our introductory program-ming course. Based on this failure of the test instrument, we discuss various explanations for our differing results and suggest a research method from which it may be possible to generalise local results in this area. Furthermore, we discuss and criticize Dehnadi and Bornat...

Instructional Practices in Introductory Geoscience Courses: Results of a National Faculty Survey

Science.gov (United States)

MacDonald, R.; Manduca, C. A.; Mogk, D. W.; Tewksbury, B. J.

2004-12-01

The NAGT professional development program "On the Cutting Edge" recently surveyed 7000 geoscience faculty in the United States to develop a snapshot of current instructional practices in undergraduate geoscience courses, faculty strategies for learning new content and new teaching approaches, and faculty involvement in the geoscience education community. Over 2200 faculty responded to the survey which was conducted by the American Institute of Physics. Results for introductory courses (814 responses) indicate that lecture is the most common teaching strategy used in courses of all sizes. Many faculty incorporate some interactive activities in their courses. Most commonly, they use questioning, demonstrations, discussions, and in-class exercises. Less common, but not rare, are small group discussion or think-pair-share and classroom debates or role-playing. Activities involving problem solving, using quantitative skills, working with data and primarily literature, and structured collaboration are incorporated by many faculty in introductory courses, suggesting efforts to teach the process of science. Activities in which students address a problem of national or local interest, analyze their own data, or address problems of their own design are less common but not rare. Field experiences are common but not ubiquitous for students in introductory courses. A wide variety of assessment strategies are used in introductory courses of all sizes, including exams, quizzes, problem sets, papers, oral presentations, and portfolios. While papers are used for assessment more extensively in small classes, a significant number of faculty use papers in large classes (greater than 81 students). A majority of faculty use rubrics in grading. Faculty report that in the past two years, approximately one-third have made changes in the content of their introductory courses while just under half have changed the teaching methods they use. While faculty learn about both new content and

Beginning Introductory Physics with Two-Dimensional Motion

Science.gov (United States)

Huggins, Elisha

2009-01-01

During the session on "Introductory College Physics Textbooks" at the 2007 Summer Meeting of the AAPT, there was a brief discussion about whether introductory physics should begin with one-dimensional motion or two-dimensional motion. Here we present the case that by starting with two-dimensional motion, we are able to introduce a considerable…

Teaching Introductory Psychology: Tips from "ToP"

Science.gov (United States)

Griggs, Richard A., Ed.; Jackson, Sherri L., Ed.

2011-01-01

This book follows in the footsteps of the first three volumes in the "Handbook for Teaching Introductory Psychology" series. In the prefaces to these volumes, the various editors all stressed two major points relevant to the development of this series. These comments also apply to this book. First, introductory psychology is one of the most…

Introductory photoemission theory

International Nuclear Information System (INIS)

Arai, Hiroko; Fujikawa, Takashi

2010-01-01

An introductory review is presented on the basis of many-body scattering theory. Some fundamental aspects of photoemission theory are discussed in detail. A few applications are also discussed; photoelectron diffraction, depth distribution function and multi-atom resonant photoemission are also discussed briefly. (author)

The Client-Centered Approach as a Foundation for Teaching the Introductory Course in Public Relations.

Science.gov (United States)

Najor, Michele A.; Motschall, Melissa

2001-01-01

Describes how the authors use a broad-based, client-centered model to teach an introductory course in public relations, integrating writing assignments for "clients" into course topics, which include history, ethics, theory, research, program planning, publicity, crisis management, and evaluation methods. Discusses course objectives, and notes…

Modern introductory physics

CERN Document Server

Holbrow, Charles H; Amato, Joseph C; Galvez, Enrique; Parks, M. Elizabeth

2010-01-01

Modern Introductory Physics, 2nd Edition, by Charles H. Holbrow, James N. Lloyd, Joseph C. Amato, Enrique Galvez, and Beth Parks, is a successful innovative text for teaching introductory college and university physics. It is thematically organized to emphasize the physics that answers the fundamental question: Why do we believe in atoms and their properties?  The book provides a sound introduction to basic physical concepts with particular attention to the nineteenth- and twentieth-century physics underlying our modern ideas of atoms and their structure.  After a review of basic Newtonian mechanics, the book discusses early physical evidence that matter is made of atoms.  With a simple model of the atom Newtonian mechanics can explain the ideal gas laws, temperature, and viscosity.  Basic concepts of electricity and magnetism are introduced along with a more complicated model of the atom to account for the observed electrical properties of atoms. The physics of waves---particularly light and x-rays---an...

Attitudes and Motivation of Students in an Introductory Technical Graphics Course: A Meta-Analysis Study

Science.gov (United States)

Ernst, Jeremy V.; Clark, Aaron C.

2012-01-01

Students in introductory engineering graphics courses at North Carolina State University (NCSU) were asked to complete surveys to help educators and administrators understand their attitudes toward learning and their motivation to learn. Analyses of the completed surveys provided the Graphic Communications Program at NCSU with an understanding of…

Mathematization in introductory physics

Science.gov (United States)

Brahmia, Suzanne M.

Mathematization is central to STEM disciplines as a cornerstone of the quantitative reasoning that characterizes these fields. Introductory physics is required for most STEM majors in part so that students develop expert-like mathematization. This dissertation describes coordinated research and curriculum development for strengthening mathematization in introductory physics; it blends scholarship in physics and mathematics education in the form of three papers. The first paper explores mathematization in the context of physics, and makes an original contribution to the measurement of physics students' struggle to mathematize. Instructors naturally assume students have a conceptual mastery of algebra before embarking on a college physics course because these students are enrolled in math courses beyond algebra. This paper provides evidence that refutes the validity of this assumption and categorizes some of the barriers students commonly encounter with quantification and representing ideas symbolically. The second paper develops a model of instruction that can help students progress from their starting points to their instructor's desired endpoints. Instructors recognize that the introductory physics course introduces new ideas at an astonishing rate. More than most physicists realize, however, the way that mathematics is used in the course is foreign to a large portion of class. This paper puts forth an instructional model that can move all students toward better quantitative and physical reasoning, despite the substantial variability of those students' initial states. The third paper describes the design and testing of curricular materials that foster mathematical creativity to prepare students to better understand physics reasoning. Few students enter introductory physics with experience generating equations in response to specific challenges involving unfamiliar quantities and units, yet this generative use of mathematics is typical of the thinking involved in

Adding Resistances and Capacitances in Introductory Electricity

Science.gov (United States)

Efthimiou, C. J.; Llewellyn, R. A.

2005-09-01

All introductory physics textbooks, with or without calculus, cover the addition of both resistances and capacitances in series and in parallel as discrete summations. However, none includes problems that involve continuous versions of resistors in parallel or capacitors in series. This paper introduces a method for solving the continuous problems that is logical, straightforward, and within the mathematical preparation of students at the introductory level.

Teaching introductory game development with unreal engine: Challenges, strategies, and experiences

Science.gov (United States)

Head, Nicholas A.

From the days of Pong to 100 million dollar projects such as the Grand Theft Auto franchise, video games have evolved significantly over the years. This evolution has also changed the way game development is viewed as a career. Today, video games are one of the most profitable forms of entertainment, and game development courses are appearing at universities around the world. Even with this growth, a degree from a university has yet to be an important factor in finding a job in game development (Owen, 2013). This thesis examines a method of creating and implementing an introductory gaming course and recommends ways to improve the curriculum. The main focus of the course was to introduce game development to the students. Each week, they were given an exercise that covered a different topic. Students also took part in a team project in which they were tasked with creating a complete game. The goal of the team projects was to expand the student's basic knowledge given to them from the exercises. Data was gathered on the students' subjective experiences with the class. This data and the class's overall performance were compared with past iterations of the course. New to the course was the Unreal Engine. Students used the latest version of the engine, Unreal Engine 4, to complete exercises. Not all students chose to use this engine for the team project. Instructor and students experiences with the engine were also recorded. While there were some problems implementing the engine within our lab environment, we were still able to execute the overall lesson plan. Even with the engine issues, the course had overall good performance. CGT 241, Introduction to 3D Animation, was shown to help the students to complete the course while CGT 215, Computer Graphics Programming I, did not provide enough information on game programming. Exercises were found to be helpful but students wanted a better understanding of how these skills can be applied to game development. Team projects

Introductory real analysis

CERN Document Server

Kolmogorov, A N; Silverman, Richard A

1975-01-01

Self-contained and comprehensive, this elementary introduction to real and functional analysis is readily accessible to those with background in advanced calculus. It covers basic concepts and introductory principles in set theory, metric spaces, topological and linear spaces, linear functionals and linear operators, and much more. 350 problems. 1970 edition.

Teaching Electrostatics and Entropy in Introductory Physics

Science.gov (United States)

Reeves, Mark

Entropy changes underlie the physics that dominates biological interactions. Indeed, introductory biology courses often begin with an exploration of the qualities of water that are important to living systems. However, one idea that is not explicitly addressed in most introductory physics or biology courses is important contribution of the entropy in driving fundamental biological processes towards equilibrium. I will present material developed to teach electrostatic screening in solutions and the function of nerve cells where entropic effects act to counterbalance electrostatic attraction. These ideas are taught in an introductory, calculus-based physics course to biomedical engineers using SCALEUP pedagogy. Results of student mastering of complex problems that cross disciplinary boundaries between biology and physics, as well as the challenges that they face in learning this material will be presented.

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC154 (Link to dictyBase) - - - Contig-U16363-1 VFC154Z (Link... to Original site) - - VFC154Z 551 - - - - Show VFC154 Library VF (Link to library) Clone ID VFC154 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16363-1 Original site URL http://dict...s: (bits) Value N U82513 |U82513.1 Dictyostelium discoideum random slug cDNA25 protein (rsc25) mRNA, partial...producing significant alignments: (bits) Value U82513_1( U82513 |pid:none) Dictyostelium discoideum random s

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC129 (Link to dictyBase) - - - Contig-U16543-1 VFC129F (Link... to Original site) VFC129F 276 - - - - - - Show VFC129 Library VF (Link to library) Clone ID VFC129 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16543-1 Original site URL http://dict... vs DNA Score E Sequences producing significant alignments: (bits) Value N M91382 |M91382.1 Dictyostelium di...scoideum thioredoxin (TRX2) mRNA, 5' end. 281 2e-96 3 M91384 |M91384.1 Dictyostelium discoideum thioredoxin

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC191 (Link to dictyBase) - - - Contig-U16281-1 VFC191F (Link... to Original site) VFC191F 350 - - - - - - Show VFC191 Library VF (Link to library) Clone ID VFC191 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16281-1 Original site URL http://dict...ts) Value N AC116305 |AC116305.2 Dictyostelium discoideum chromosome 2 map 1005175-1418323 strain AX4, compl... 186 3e-46 AC116305_8( AC116305 |pid:none) Dictyostelium discoideum chromosom...

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC222 (Link to dictyBase) - - - Contig-U16046-1 VFC222Z (Link... to Original site) - - VFC222Z 339 - - - - Show VFC222 Library VF (Link to library) Clone ID VFC222 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16046-1 Original site URL http://dict...pdate 2002.12.15 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116989 |AC116989.2 Dict...etical LO... 88 8e-17 AC115592_28( AC115592 |pid:none) Dictyostelium discoideum c

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC124 (Link to dictyBase) - - - Contig-U12017-1 VFC124Z (Link... to Original site) - - VFC124Z 496 - - - - Show VFC124 Library VF (Link to library) Clone ID VFC124 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12017-1 Original site URL http://dict...e E Sequences producing significant alignments: (bits) Value N AC116957 |AC116957.2 Dictyostelium discoideum... chromosome 2 map 1685067-2090751 strain AX4, complete sequence. 835 0.0 2 U67089 |U67089.1 Dict

Assessing expertise in introductory physics using categorization task

Directory of Open Access Journals (Sweden)

Andrew Mason

2011-10-01

Full Text Available The ability to categorize problems based upon underlying principles, rather than surface features or contexts, is considered one of several proxy predictors of expertise in problem solving. With inspiration from the classic study by Chi, Feltovich, and Glaser, we assess the distribution of expertise among introductory physics students by asking three introductory physics classes, each with more than a hundred students, to categorize mechanics problems based upon similarity of solution. We compare their categorization with those of physics graduate students and faculty members. To evaluate the effect of problem context on students’ ability to categorize, two sets of problems were developed for categorization. Some problems in one set included those available from the prior study by Chi et al. We find a large overlap between calculus-based introductory students and graduate students with regard to their categorizations that were assessed as “good.” Our findings, which contrast with those of Chi et al., suggest that there is a wide distribution of expertise in mechanics among introductory and graduate students. Although the categorization task is conceptual, introductory students in the calculus-based course performed better than those in the algebra-based course. Qualitative trends in categorization of problems are similar between the non-Chi problems and problems available from the Chi study used in our study although the Chi problems used are more difficult on average.

Synthesis of Ibuprofen in the Introductory Organic Laboratory

Science.gov (United States)

Kjonaas, Richard A.; Williams, Peggy E.; Counce, David A.; Crawley, Lindsey R.

2011-01-01

A method for the synthesis of ibuprofen in introductory organic chemistry laboratory courses is reported. This experiment requires two 3-h lab sessions. All of the reactions and techniques are a standard part of any introductory organic chemistry course. In the first lab session, students reduce p-isobutylacetophenone to an alcohol and then…

Examining issues of underrepresented minority students in introductory physics

Science.gov (United States)

Watkins, Jessica Ellen

In this dissertation we examine several issues related to the retention of under-represented minority students in physics and science. In the first section, we show that in calculus-based introductory physics courses, the gender gap on the FCI is diminished through the use of interactive techniques, but in lower-level introductory courses, the gap persists, similar to reports published at other institutions. We find that under-represented racial minorities perform similar to their peers with comparable academic preparation on conceptual surveys, but their average exam grades and course grades are lower. We also examine student persistence in science majors; finding a significant relationship between pedagogy in an introductory physics course and persistence in science. In the second section, we look at student end-of-semester evaluations and find that female students rate interactive teaching methods a full point lower than their male peers. Looking more deeply at student interview data, we find that female students report more social issues related to the discussions in class and both male and female students cite feeling pressure to obtain the correct answer to clicker questions. Finally, we take a look an often-cited claim for gender differences in STEM participation: cognitive differences explain achievement differences in physics. We examine specifically the role of mental rotations in physics achievement and problem-solving, viewing mental rotations as a tool that students can use on physics problems. We first look at student survey results for lower-level introductory students, finding a low, but significant correlation between performance on a mental rotations test and performance in introductory physics courses. In contrast, we did not find a significant relationship for students in the upper-level introductory course. We also examine student problem-solving interviews to investigate the role of mental rotations on introductory problems.

A Survey of Introductory Statistics Courses at University Faculties of Pharmaceutical Sciences in Japan.

Science.gov (United States)

Matsumura, Mina; Nakayama, Takuto; Sozu, Takashi

2016-01-01

A survey of introductory statistics courses at Japanese medical schools was published as a report in 2014. To obtain a complete understanding of the way in which statistics is taught at the university level in Japan, it is important to extend this survey to related fields, including pharmacy, dentistry, and nursing. The current study investigates the introductory statistics courses offered by faculties of pharmaceutical sciences (six-year programs) at Japanese universities, comparing the features of these courses with those studied in the survey of medical schools. We collected relevant data from the online syllabi of statistics courses published on the websites of 71 universities. The survey items included basic course information (for example, the course names, the targeted student grades, the number of credits, and course classification), textbooks, handouts, the doctoral subject and employment status of each lecturer, and course contents. The period surveyed was July-September 2015. We found that these 71 universities offered a total of 128 statistics courses. There were 67 course names, the most common of which was "biostatistics (iryou toukeigaku)." About half of the courses were designed for first- or second-year students. Students earned fewer than two credits. There were 62 different types of textbooks. The lecturers held doctoral degrees in 18 different subjects, the most common being a doctorate in pharmacy or science. Some course content differed, reflecting the lecturers' academic specialties. The content of introductory statistics courses taught in pharmaceutical science programs also differed slightly from the equivalent content taught in medical schools.

Reflections on the Teaching of Programming

DEFF Research Database (Denmark)

-line tutorials, object-oriented programming and Java, the BlueJ environment to introduce programming, model-driven programming as opposed to the prevailing language-driven approach, teaching software engineering, testing, extreme programming, frameworks, feedback and assessment, active learning, technology.......  Part II consists of four chapters that specifically address issues related to  introductory courses on object-oriented programming ⎯the currently most prevailing  approach to introductory programming. The primary issues covered are transitioning  to object-oriented programming and Java, the use...... general challenge of  teaching software engineering. The primary issues covered in this part are testing,  extreme programming, and frameworks. These are all issues that are typically covered  in later courses.  Part IV, the last part of the book, consists of two chapters addressing innovative  approaches...

Introductory Education for Mechanical Engineering by Exercise in Mechanical Disassembly

Science.gov (United States)

Matsui, Yoshio; Asakawa, Naoki; Iwamori, Satoru

An introductory program “Exercise for engineers in mechanical disassembly” is an exercise that ten students of every team disassemble a motor scooter to the components and then assemble again to the initial form in 15 weeks. The purpose of this program is to introduce mechanical engineering by touching the real machine and learning how it is composed from various mechanical parts to the students at the early period after the entrance into the university. Additional short lectures by young teachers and a special lecture by a top engineer in the industry encourage the students to combine the actual machine and the mechanical engineering subjects. Furthermore, various educations such as group leader system, hazard prediction training, parts filing are included in this program. As a result, students recognize the importance of the mechanical engineering study and the way of group working.

Teaching Introductory Business Statistics Using the DCOVA Framework

Science.gov (United States)

Levine, David M.; Stephan, David F.

2011-01-01

Introductory business statistics students often receive little guidance on how to apply the methods they learn to further business objectives they may one day face. And those students may fail to see the continuity among the topics taught in an introductory course if they learn those methods outside a context that provides a unifying framework.…

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC101 (Link to dictyBase) - - - Contig-U16544-1 VFC101Z (Link... to Original site) - - VFC101Z 556 - - - - Show VFC101 Library VF (Link to library) Clone ID VFC101 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16544-1 Original site URL http://dict...t alignments: (bits) Value N AY164994 |AY164994.1 Dictyostelium discoideum RTNLC (RTNLC) mRNA, complete cds.... 969 0.0 2 AY164656 |AY164656.1 Dictyostelium discoideum RTNLC (RTNLC) gene, complete cds. 565 0.0 3 AL71386

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC265 (Link to dictyBase) - - - Contig-U16459-1 VFC265Z (Link... to Original site) - - VFC265Z 278 - - - - Show VFC265 Library VF (Link to library) Clone ID VFC265 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16459-1 Original site URL http://dict...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC123513 |AC123513.1 Dictyos...telium discoideum chromosome 2 map 2779865-2840915 strain AX4, *** SEQUENCING IN PROGRESS ***. 159 9e-77 4 AC117070 |AC117070.2 Dict

Notional Machines and Introductory Programming Education

Science.gov (United States)

Sorva, Juha

2013-01-01

This article brings together, summarizes, and comments on several threads of research that have contributed to our understanding of the challenges that novice programmers face when learning about the runtime dynamics of programs and the role of the computer in program execution. More specifically, the review covers the literature on programming…

Using a Common Experience to Teach Introductory Managerial Accounting

Science.gov (United States)

King, Gail Hoover; McConnell, Cheryl

2010-01-01

Teaching introductory accounting courses can be both challenging and rewarding. In introductory financial and managerial accounting, students struggle with the unfamiliar terminology and concepts. However, managerial accounting offers distinct challenges in that managerial accounting reports used for decision-making are not publically available,…

An Empirical Evaluation of Puzzle-Based Learning as an Interest Approach for Teaching Introductory Computer Science

Science.gov (United States)

Merrick, K. E.

2010-01-01

This correspondence describes an adaptation of puzzle-based learning to teaching an introductory computer programming course. Students from two offerings of the course--with and without the puzzle-based learning--were surveyed over a two-year period. Empirical results show that the synthesis of puzzle-based learning concepts with existing course…

Qualitative Research for Tobacco Control : A How-to Introductory ...

International Development Research Centre (IDRC) Digital Library (Canada)

Qualitative Research for Tobacco Control : A How-to Introductory Manual for Researchers and Development Practitioners. Couverture du livre Qualitative Research for Tobacco Control : A How-to Introductory Manual for. Auteur(s):. Alison Mathie et Anne Carnozzi. Maison(s) d'édition: CRDI. 15 janvier 2005. ISBN :.

Using isomorphic problems to learn introductory physics

Directory of Open Access Journals (Sweden)

Shih-Yin Lin

2011-08-01

Full Text Available In this study, we examine introductory physics students’ ability to perform analogical reasoning between two isomorphic problems which employ the same underlying physics principles but have different surface features. Three hundred sixty-two students from a calculus-based and an algebra-based introductory physics course were given a quiz in the recitation in which they had to first learn from a solved problem provided and take advantage of what they learned from it to solve another problem (which we call the quiz problem which was isomorphic. Previous research suggests that the multiple-concept quiz problem is challenging for introductory students. Students in different recitation classes received different interventions in order to help them discern and exploit the underlying similarities of the isomorphic solved and quiz problems. We also conducted think-aloud interviews with four introductory students in order to understand in depth the difficulties they had and explore strategies to provide better scaffolding. We found that most students were able to learn from the solved problem to some extent with the scaffolding provided and invoke the relevant principles in the quiz problem. However, they were not necessarily able to apply the principles correctly. Research suggests that more scaffolding is needed to help students in applying these principles appropriately. We outline a few possible strategies for future investigation.

Using isomorphic problems to learn introductory physics

Science.gov (United States)

Lin, Shih-Yin; Singh, Chandralekha

2011-12-01

In this study, we examine introductory physics students’ ability to perform analogical reasoning between two isomorphic problems which employ the same underlying physics principles but have different surface features. Three hundred sixty-two students from a calculus-based and an algebra-based introductory physics course were given a quiz in the recitation in which they had to first learn from a solved problem provided and take advantage of what they learned from it to solve another problem (which we call the quiz problem) which was isomorphic. Previous research suggests that the multiple-concept quiz problem is challenging for introductory students. Students in different recitation classes received different interventions in order to help them discern and exploit the underlying similarities of the isomorphic solved and quiz problems. We also conducted think-aloud interviews with four introductory students in order to understand in depth the difficulties they had and explore strategies to provide better scaffolding. We found that most students were able to learn from the solved problem to some extent with the scaffolding provided and invoke the relevant principles in the quiz problem. However, they were not necessarily able to apply the principles correctly. Research suggests that more scaffolding is needed to help students in applying these principles appropriately. We outline a few possible strategies for future investigation.

Helping Students Test Programs That Have Graphical User Interfaces

Directory of Open Access Journals (Sweden)

Matthew Thornton

2008-08-01

Full Text Available Within computer science education, many educators are incorporating software testing activities into regular programming assignments. Tools like JUnit and its relatives make software testing tasks much easier, bringing them into the realm of even introductory students. At the same time, many introductory programming courses are now including graphical interfaces as part of student assignments to improve student interest and engagement. Unfortunately, writing software tests for programs that have significant graphical user interfaces is beyond the skills of typical students (and many educators. This paper presents initial work at combining educationally oriented and open-source tools to create an infrastructure for writing tests for Java programs that have graphical user interfaces. Critically, these tools are intended to be appropriate for introductory (CS1/CS2 student use, and to dovetail with current teaching approaches that incorporate software testing in programming assignments. We also include in our findings our proposed approach to evaluating our techniques.

Lessons Learned from Teaching Scratch as an Introduction to Object-Oriented Programming in Delphi

Science.gov (United States)

van Zyl, Sukie; Mentz, Elsa; Havenga, Marietjie

2016-01-01

As part of curriculum changes in South Africa, an introductory programming language, Scratch, must first be taught before switching to the well-established teaching of Delphi. The nature of programming in Scratch is considerably different from that in Delphi. It was assumed that the teaching of Scratch as introductory programming language could…

Evaluating Effectiveness of Pair Programming as a Teaching Tool in Programming Courses

Science.gov (United States)

Faja, Silvana

2014-01-01

This study investigates the effectiveness of pair programming on student learning and satisfaction in introductory programming courses. Pair programming, used in the industry as a practice of an agile development method, can be adopted in classroom settings to encourage peer learning, increase students' social skills, and enhance student…

The Greening of Marketing: An Analysis of Introductory Textbooks

Science.gov (United States)

DeMoss, Michelle; Nicholson, Carolyn Y.

2005-01-01

In this study, the authors examined whether introductory marketing textbooks contain the information that is needed to educate future business leaders about the important role of environmentally sustainable practices. We content-analyzed the 21 current introductory marketing textbooks for coverage of these practices. The results showed limited,…

A Diagnostic Assessment for Introductory Molecular and Cell Biology

Science.gov (United States)

Shi, Jia; Wood, William B.; Martin, Jennifer M.; Guild, Nancy A.; Vicens, Quentin; Knight, Jennifer K.

2010-01-01

We have developed and validated a tool for assessing understanding of a selection of fundamental concepts and basic knowledge in undergraduate introductory molecular and cell biology, focusing on areas in which students often have misconceptions. This multiple-choice Introductory Molecular and Cell Biology Assessment (IMCA) instrument is designed…

The Development and Evolution of an Introductory Statistics Course for In-Service Middle-Level Mathematics Teachers

Science.gov (United States)

Schmind, Kendra K.; Blankenship, Erin E.; Kerby. April T.; Green, Jennifer L.; Smith, Wendy M.

2014-01-01

The statistical preparation of in-service teachers, particularly middle school teachers, has been an area of concern for several years. This paper discusses the creation and delivery of an introductory statistics course as part of a master's degree program for in-service mathematics teachers. The initial course development took place before the…

Introductory Textbooks and Plagiarism in Higher Education: A Case Study from Economics.

Science.gov (United States)

Richardson, Paul

2002-01-01

Textbooks are powerful technologies that are foundational to introductory level courses. In the research site of an introductory economic classroom, the textbook is positioned as having status similar to that of a canonical religious text. This study investigated how student reading and writing can be problematic when introductory level courses…

Sensors an introductory course

CERN Document Server

Kalantar-zadeh, Kourosh

2013-01-01

Sensors: An Introductory Course provides an essential reference on the fundamentals of sensors. The book is designed to help readers in developing skills and the understanding required in order to implement a wide range of sensors that are commonly used in our daily lives. This book covers the basic concepts in the sensors field, including definitions and terminologies. The physical sensing effects are described, and devices which utilize these effects are presented. The most frequently used organic and inorganic sensors are introduced and the techniques for implementing them are discussed. This book: Provides a comprehensive representation of the most common sensors and can be used as a reference in relevant fields Presents learning materials in a concise and easy to understand manner Includes examples of how sensors are incorporated in real life measurements Contains detailed figures and schematics to assist in understanding the sensor performance Sensors: An Introductory Course is ideal for university stu...

Mississippi Curriculum Framework for Welding and Cutting Programs (Program CIP: 48.0508--Welder/Welding Technologist). Postsecondary Programs.

Science.gov (United States)

Mississippi Research and Curriculum Unit for Vocational and Technical Education, State College.

This document, which is intended for use by community and junior colleges throughout Mississippi, contains curriculum frameworks for the course sequences in the welding and cutting programs cluster. Presented in the introductory section are a description of the program and suggested course sequence. Section I lists baseline competencies, and…

Computer Tutorial Programs in Physics.

Science.gov (United States)

Faughn, Jerry; Kuhn, Karl

1979-01-01

Describes a series of computer tutorial programs which are intended to help college students in introductory physics courses. Information about these programs, which are either calculus or algebra-trig based, is presented. (HM)

Billing third party payers for vaccines: state and local health department perspectives.

Science.gov (United States)

Quintanilla, Carlos; Duncan, Lorraine; Luther, Lydia

2009-01-01

The cost of adequately immunizing a child has risen steadily with recommendations of new, more expensive vaccines. The Vaccines for Children (VFC) program, a federal entitlement, has continued to fund all recommended vaccines for eligible children. The one other federal vaccine-funding source, Section 317 of the Public Health Service Act, has not kept pace with rising vaccine costs. For local health departments to immunize children not eligible for VFC, but whose families are underinsured or otherwise unable to pay for vaccines, state immunization programs have often relied on Section 317 funds. Recognizing this funding challenge and having learned that children covered by health insurance were being immunized in public clinics with publicly supplied vaccines, the Oregon Immunization Program (OIP) launched a project to expand billing of health plans by local health departments for vaccines administered to covered persons. This has resulted in significant savings of Section 317 funds, allowing the Oregon program to provide more vaccines for high-need persons.

Introductory Programming Subject in European Higher Education

Science.gov (United States)

Aleksic, Veljko; Ivanovic, Mirjana

2016-01-01

Programming is one of the basic subjects in most informatics, computer science mathematics and technical faculties' curricula. Integrated overview of the models for teaching programming, problems in teaching and suggested solutions were presented in this paper. Research covered current state of 1019 programming subjects in 715 study programmes at…

The Impact of Baby Swimming on Introductory and Elementary Swimming Training

OpenAIRE

Břízová, Gabriela

2007-01-01

THESIS ANNOTATION Title: The Impact of Baby Swimming on Introductory and Elementary Swimming Training Aim: To assess the impact of 'baby swimming' on the successfulness in introductory and partly in elementary swimming training, and to find out whether also other circumstances (for example the length of attendance at 'baby swimming') have some influence on introductory swimming training. Methods: We used a questionnaire method for the parents of children who had attended 'baby swimming' and f...

Incorporating hypertensive patient education on salt intake into an introductory pharmacy practice experience.

Science.gov (United States)

Garza, Kimberly B; Westrick, Salisa C; Teeter, Benjamin S; Stevenson, T Lynn

2013-11-12

To evaluate the impact of the Salt Education Program for hypertensive adults on student pharmacists' knowledge, behaviors, and attitudes regarding sodium consumption. As part of the introductory pharmacy practice experience program in community pharmacies, student pharmacists assessed patients' sodium intake knowledge and behaviors, taught them how to read nutrition labels, and obtained information about their hypertensive conditions. Students completed pre-and post-intervention questionnaires in April and August 2012, respectively. One hundred thirty student pharmacists (70% female, 78% white) completed pre- and post-intervention questionnaires. Students demonstrated significant improvements in knowledge scores (pshopping (p<0.001) and purchasing low-salt foods (p=0.004). Changes in students' knowledge, behaviors, and attitudes after participating in the Salt Education program suggested that the program was effective in improving student knowledge, behaviors, and attitudes.

A Web Support System for Submission and Handling of Programming Assignments

DEFF Research Database (Denmark)

Nørmark, Kurt

2011-01-01

Individual submission of programming assignments should be considered in all introductory programming courses. We describe a custom web support system for submission and management of programming assignments in an introductory C programming course. Experience from the first time use of the system...... is reported. In addition, we compare the pattern of use with the results of the final exam in order to reveal a possible impact of the programming assignments. We summarize the lessons learned in preparation for improving the system prior to the next round of use in the fall of 2011....

Redesigning a Large Introductory Course to Incorporate the GAISE Guidelines

Science.gov (United States)

Woodard, Roger; McGowan, Herle

2012-01-01

In 2005, the "Guidelines for Assessment and Instruction in Statistics Education" (GAISE) college report described several recommendations for teaching introductory statistics. This paper discusses how a large multi-section introductory course was redesigned in order to implement these recommendations. The experience described discusses…

A Citation Analysis of Who's Who in Introductory Textbooks

Science.gov (United States)

Griggs, Richard A.; Proctor, Derrick L.

2002-01-01

Given the many changes in the introductory psychology textbook market in the past 2 decades and the lack of a recent citation study of introductory texts, we conducted a citation analysis of a stratified random sample of current texts. To provide a more comprehensive picture of current citation emphases, we extended our analysis to the top 60…

Faraday's Principle and Air Travel in the Introductory Labs

Science.gov (United States)

Abdul-Razzaq, Wathiq; Thakur, Saikat Chakraborty

2017-01-01

We all know that we must improve the quality of teaching in science at all levels. Not only physicists but also many students from other areas of study take the introductory physics courses in college. Physics introductory laboratories (labs) can be one of the best tools to help these students understand applications of scientific principles that…

Introductory Biology Textbooks Under-Represent Scientific Process

Directory of Open Access Journals (Sweden)

Dara B. Duncan

2011-08-01

Full Text Available Attrition of undergraduates from Biology majors is a long-standing problem. Introductory courses that fail to engage students or spark their curiosity by emphasizing the open-ended and creative nature of biological investigation and discovery could contribute to student detachment from the field. Our hypothesis was that introductory biology books devote relatively few figures to illustration of the design and interpretation of experiments or field studies, thereby de-emphasizing the scientific process.To investigate this possibility, we examined figures in six Introductory Biology textbooks published in 2008. On average, multistep scientific investigations were presented in fewer than 5% of the hundreds of figures in each book. Devoting such a small percentage of figures to the processes by which discoveries are made discourages an emphasis on scientific thinking. We suggest that by increasing significantly the illustration of scientific investigations, textbooks could support undergraduates’ early interest in biology, stimulate the development of design and analytical skills, and inspire some students to participate in investigations of their own.

Computer Programming Education with Miranda

NARCIS (Netherlands)

Joosten, S.M.M.; van den Berg, Klaas

During the past four years, an experiment has been carried out with an introductory course in computer programming, based on functional programming. This article describes the background of this approach, the aim of the computer programming course, the outline and subject matter of the course parts

Class modality, student characteristics, and performance in a community college introductory STEM course

Science.gov (United States)

Fogle, Thomas Ty

Research on introductory STEM course performance has indicated that student characteristics (age, ethnicity and gender) and Grade Point Average (G.P.A.) can be predictive of student performance, and by implication, a correlation among these factors can help determine course design interventions to help certain types of students perform well in introductory STEM courses. The basis of this study was a community college Visual Basic programming course taught in both online and hybrid format. Beginning students in this course represented a diverse population residing in a large, mid-western, city and surrounding communities. Many of these students were defined as "at-Risk" or "non-traditional, which generally means any combination of socio-economic, cultural, family and employment factors that indicate a student is non-traditional. Research has shown these students struggle academically in technologically dense STEM courses, and may require student services and support to achieve their individual performance goals. The overall number in the study range was 392 distance students and 287 blended course students. The main question of this research was to determine to what extent student characteristics in a community college context, and previous success, as measured in overall G.P.A., were related to course performance in an introductory Visual Basic programming (STEM) course; and, whether or not a combination of these factors and course modality was predictive of success. The study employed a quantitative, quasi-experimental design to assess whether students' course performance was linked to course modality, student characteristics and overall G.P.A. The results indicated that the only predictor of student performance was overall G.P.A. Despite the research analyzed in Chapter 2, there was no statistically significant relationship to modality, age, ethnicity, or gender to performance in the course. Cognitive load is significant in a computer programming course and it

Introductory Statistics in the Garden

Science.gov (United States)

Wagaman, John C.

2017-01-01

This article describes four semesters of introductory statistics courses that incorporate service learning and gardening into the curriculum with applications of the binomial distribution, least squares regression and hypothesis testing. The activities span multiple semesters and are iterative in nature.

Coverage of the Stanford Prison Experiment in Introductory Psychology Courses

Science.gov (United States)

Bartels, Jared M.; Milovich, Marilyn M.; Moussier, Sabrina

2016-01-01

The present study examined the coverage of Stanford prison experiment (SPE), including criticisms of the study, in introductory psychology courses through an online survey of introductory psychology instructors (N = 117). Results largely paralleled those of the recently published textbook analyses with ethical issues garnering the most coverage,…

Analysis of Decadal Vegetation Dynamics Using Multi-Scale Satellite Images

Science.gov (United States)

Chiang, Y.; Chen, K.

2013-12-01

This study aims at quantifying vegetation fractional cover (VFC) by incorporating multi-resolution satellite images, including Formosat-2(RSI), SPOT(HRV/HRG), Landsat (MSS/TM) and Terra/Aqua(MODIS), to investigate long-term and seasonal vegetation dynamics in Taiwan. We used 40-year NDVI records for derivation of VFC, with field campaigns routinely conducted to calibrate the critical NDVI threshold. Given different sensor capabilities in terms of their spatial and spectral properties, translation and infusion of NDVIs was used to assure NDVI coherence and to determine the fraction of vegetation cover at different spatio-temporal scales. Based on the proposed method, a bimodal sequence of intra-annual VFC which corresponds to the dual-cropping agriculture pattern was observed. Compared to seasonal VFC variation (78~90%), decadal VFC reveals moderate oscillations (81~86%), which were strongly linked with landuse changes and several major disturbances. This time-series mapping of VFC can be used to examine vegetation dynamics and its response associated with short-term and long-term anthropogenic/natural events.

Chemical Equilibrium, Unit 2: Le Chatelier's Principle. A Computer-Enriched Module for Introductory Chemistry. Student's Guide and Teacher's Guide.

Science.gov (United States)

Jameson, A. Keith

Presented are the teacher's guide and student materials for one of a series of self-instructional, computer-based learning modules for an introductory, undergraduate chemistry course. The student manual for this unit on Le Chatelier's principle includes objectives, prerequisites, pretest, instructions for executing the computer program, and…

Plasma medicine: an introductory review

NARCIS (Netherlands)

Kong, M.G.; Kroesen, G.M.W.; Morfill, G.; Nosenko, T.; Shimizu, T.; Dijk, van J.; Zimmermann, J.L.

2009-01-01

This introductory review on plasma health care is intended to provide the interested reader with a summary of the current status of this emerging field, its scope, and its broad interdisciplinary approach, ranging from plasma physics, chemistry and technology, to microbiology, biochemistry,

Microcomputers in the Introductory Laboratory.

Science.gov (United States)

Bare, John K.

1982-01-01

A microcomputer was used successfully to replicate Sternberg's 1966 study of retrieval from short-term memory and Sperling's 1960 study on sensory or iconic memory. Computers with a capacity for measuring reaction time are useful in the laboratory for introductory psychology courses. (SR)

Student Misconceptions in Introductory Biology.

Science.gov (United States)

Fisher, Kathleen M.; Lipson, Joseph I.

Defining a "misconception" as an error of translation (transformation, correspondence, interpolation, interpretation) between two different kinds of information which causes students to have incorrect expectations, a Taxonomy of Errors has been developed to examine student misconceptions in an introductory biology course for science…

CAS Introductory Course in Italy

CERN Multimedia

2008-01-01

The CERN Accelerator School’s introductory course is a great success. This year the CERN Accelerator School held its "Introduction to Accelerator Physics" course in Frascati, Italy, from 2-14 November in collaboration with the University of Rome "La Sapienza" and the INFN Frascati National Laboratory. The Introductory level course is particularly important since, for the majority of participants, it is the first opportunity to discover the various aspects of accelerator physics. For this school the programme had been significantly revised in order to take into account the new trends currently being developed in the field, thus putting more emphasis on linacs, synchrotron light sources and free-electron lasers. The school was a resounding success with 115 participants of more than 23 nationalities. Feedback from the students praised the expertise of the lecturers, the high standard of the lectures as well as the excellent organizati...

Topical Coverage in Introductory Textbooks from the 1980s through the 2000s

Science.gov (United States)

Griggs, Richard A.

2014-01-01

To determine how topical coverage in introductory textbooks may have changed from the 1980s to the present, the author examined topic coverage in full-length and brief introductory textbooks from this time period. Because 98% of the teachers use textbooks for the introductory course and the majority do not assign reading beyond the textbook, the…

Engaging Students In Modeling Instruction for Introductory Physics

Science.gov (United States)

Brewe, Eric

2016-05-01

Teaching introductory physics is arguably one of the most important things that a physics department does. It is the primary way that students from other science disciplines engage with physics and it is the introduction to physics for majors. Modeling instruction is an active learning strategy for introductory physics built on the premise that science proceeds through the iterative process of model construction, development, deployment, and revision. We describe the role that participating in authentic modeling has in learning and then explore how students engage in this process in the classroom. In this presentation, we provide a theoretical background on models and modeling and describe how these theoretical elements are enacted in the introductory university physics classroom. We provide both quantitative and video data to link the development of a conceptual model to the design of the learning environment and to student outcomes. This work is supported in part by DUE #1140706.

Who's Who in Introductory Psychology Textbooks: A Citation Analysis Redux

Science.gov (United States)

Griggs, Richard A.; Christopher, Andrew N.

2016-01-01

It is important to assess periodically how introductory textbooks portray our discipline because introductory psychology is the most popular psychology course, almost all teachers use textbooks for it, and textbooks play a major role in defining the course for students. To do so, past studies have used textbook citation analyses. We analyzed…

Learning Programming Patterns Using Games

Science.gov (United States)

de Aquino Leal, Alexis Vinícius; Ferreira, Deller James

2016-01-01

There is still no pedagogy to teach programming that stands out significantly from others and no consensus on what is the best way for learning programming. There is still a need to develop new teaching methods for learning in introductory programming courses. This paper presents a pedagogic approach in support of creativity in programming and the…

Computer problem-solving coaches for introductory physics: Design and usability studies

Science.gov (United States)

Ryan, Qing X.; Frodermann, Evan; Heller, Kenneth; Hsu, Leonardo; Mason, Andrew

2016-06-01

The combination of modern computing power, the interactivity of web applications, and the flexibility of object-oriented programming may finally be sufficient to create computer coaches that can help students develop metacognitive problem-solving skills, an important competence in our rapidly changing technological society. However, no matter how effective such coaches might be, they will only be useful if they are attractive to students. We describe the design and testing of a set of web-based computer programs that act as personal coaches to students while they practice solving problems from introductory physics. The coaches are designed to supplement regular human instruction, giving students access to effective forms of practice outside class. We present results from large-scale usability tests of the computer coaches and discuss their implications for future versions of the coaches.

Concept Maps in Introductory Statistics

Science.gov (United States)

Witmer, Jeffrey A.

2016-01-01

Concept maps are tools for organizing thoughts on the main ideas in a course. I present an example of a concept map that was created through the work of students in an introductory class and discuss major topics in statistics and relationships among them.

Examining the Gender Gap in Introductory Physics

Science.gov (United States)

Kost, Lauren; Pollock, Steven; Finkelstein, Noah

2009-05-01

Our previous research[1] showed that despite the use of interactive engagement techniques in the introductory physics course, the gap in performance between males and females on a mechanics conceptual learning survey persisted from pre- to post-test, at our institution. Such findings were counter to previously published work[2]. Follow-up studies[3] identified correlations between student performance on the conceptual learning survey and students' prior physics and math knowledge and their incoming attitudes and beliefs about physics and learning physics. The results indicate that the gender gap at our institution is predominantly associated with differences in males' and females' previous physics and math knowledge, and attitudes and beliefs. Our current work extends these results in two ways: 1) we look at the gender gap in the second semester of the introductory sequence and find results similar to those in the first semester course and 2) we identify ways in which males and females differentially experience several aspects of the introductory course. [1] Pollock, et al, Phys Rev: ST: PER 3, 010107. [2] Lorenzo, et al, Am J Phys 74, 118. [3] Kost, et al, PERC Proceedings 2008.

Optimal Quadratic Programming Algorithms

CERN Document Server

Dostal, Zdenek

2009-01-01

Quadratic programming (QP) is one technique that allows for the optimization of a quadratic function in several variables in the presence of linear constraints. This title presents various algorithms for solving large QP problems. It is suitable as an introductory text on quadratic programming for graduate students and researchers

Introductory Linear Regression Programs in Undergraduate Chemistry.

Science.gov (United States)

Gale, Robert J.

1982-01-01

Presented are simple programs in BASIC and FORTRAN to apply the method of least squares. They calculate gradients and intercepts and express errors as standard deviations. An introduction of undergraduate students to such programs in a chemistry class is reviewed, and issues instructors should be aware of are noted. (MP)

IT0: Discrete Math and Programming Logic Topics as a Hybrid Alternative to CS0

Science.gov (United States)

Martin, Nancy L.

2015-01-01

This paper describes the development of a hybrid introductory course for students in their first or second year of an information systems technologies degree program at a large Midwestern university. The course combines topics from discrete mathematics and programming logic and design, a unique twist on most introductory courses. The objective of…

A Review of Generic Program Visualization Systems for Introductory Programming Education

Science.gov (United States)

Sorva, Juha; Karavirta, Ville; Malmi, Lauri

2013-01-01

This article is a survey of program visualization systems intended for teaching beginners about the runtime behavior of computer programs. Our focus is on generic systems that are capable of illustrating many kinds of programs and behaviors. We inclusively describe such systems from the last three decades and review findings from their empirical…

Toward Publicly Responsive Sociology Curricula: The Role of Introductory Sociology

Science.gov (United States)

Greenwood, Nancy A.

2013-01-01

Introductory sociology casts a wide net with regard to its audience and plays an important role in capturing the public eye as well as helping students to make more informed choices in their lives and communities. I ask six questions that help us as sociologists to think about how introductory sociology can better serve our discipline, our…

Introductory statistical inference

CERN Document Server

Mukhopadhyay, Nitis

2014-01-01

This gracefully organized text reveals the rigorous theory of probability and statistical inference in the style of a tutorial, using worked examples, exercises, figures, tables, and computer simulations to develop and illustrate concepts. Drills and boxed summaries emphasize and reinforce important ideas and special techniques.Beginning with a review of the basic concepts and methods in probability theory, moments, and moment generating functions, the author moves to more intricate topics. Introductory Statistical Inference studies multivariate random variables, exponential families of dist

Introductory graph theory

CERN Document Server

Chartrand, Gary

1984-01-01

Graph theory is used today in the physical sciences, social sciences, computer science, and other areas. Introductory Graph Theory presents a nontechnical introduction to this exciting field in a clear, lively, and informative style. Author Gary Chartrand covers the important elementary topics of graph theory and its applications. In addition, he presents a large variety of proofs designed to strengthen mathematical techniques and offers challenging opportunities to have fun with mathematics. Ten major topics - profusely illustrated - include: Mathematical Models, Elementary Concepts of Grap

Students' conceptions of evidence during a university introductory forensic science course

Science.gov (United States)

Yeshion, Theodore Elliot

Students' Conceptions of Science, Scientific Evidence, and Forensic Evidence during a University Introductory Forensic Science Course This study was designed to examine and understand what conceptions undergraduate students taking an introductory forensic science course had about scientific evidence. Because the relationships between the nature of science, the nature of evidence, and the nature of forensic evidence are not well understood in the science education literature, this study sought to understand how these concepts interact and affect students' understanding of scientific evidence. Four participants were purposefully selected for this study from among 89 students enrolled in two sections of an introductory forensic science course taught during the fall 2005 semester. Of the 89 students, 84 were criminal justice majors with minimal science background and five were chemistry majors with academic backgrounds in the natural and physical sciences. All 89 students completed a biographical data sheet and a pre-instruction Likert scale survey consisting of twenty questions relating to the nature of scientific evidence. An evaluation of these two documents resulted in a purposeful selection of four varied student participants, each of whom was interviewed three times throughout the semester about the nature of science, the nature of evidence, and the nature of forensic evidence. The same survey was administered to the participants again at the end of the semester-long course. This study examined students' assumptions, prior knowledge, their understanding of scientific inference, scientific theory, and methodology. Examination of the data found few differences with regard to how the criminal justice majors and the chemistry majors responded to interview questions about forensic evidence. There were qualitative differences, however, when the same participants answered interview questions relating to traditional scientific evidence. Furthermore, suggestions are

Strengthening introductory psychology: A new model for teaching the introductory course.

Science.gov (United States)

Gurung, Regan A R; Hackathorn, Jana; Enns, Carolyn; Frantz, Susan; Cacioppo, John T; Loop, Trudy; Freeman, James E

2016-01-01

Introductory psychology (Intro Psych) is one of the most popular and frequently taught courses on college campuses, yet educators in psychology have limited knowledge about what is covered in classes around the nation or the extent to which class content reflects the current scope of the discipline. There is no explicit model to guide course content selection for the intro course, which poses substantial challenges for instructors. This article proposes a new model for teaching the intro course that integrates (a) scientific foundations, (b) 5 major domains or pillars of knowledge (biological, cognitive, developmental, social and personality, and mental and physical health), and (c) cross-cutting themes relevant to all domains (cultural and social diversity, ethics, variations in human functioning, and applications; American Psychological Association, 2014). We advocate for national assessment of the course, a similar introductory course for majors and nonmajors, the inclusion of experiential or laboratory components, and additional training resources for instructors of the intro course. Given the exponential growth of psychological knowledge and applications during the past decades, we caution against attempting to provide exhaustive coverage of all topic areas of psychology in a one-semester course. We conclude by discussing the challenges that lie ahead for the discipline of psychology as it launches this new model for Intro Psych. (c) 2016 APA, all rights reserved).

Teaching abstraction in introductory courses

NARCIS (Netherlands)

Koppelman, Herman; van Dijk, Betsy

Abstraction is viewed as a key concept in computer science. It is not only an important concept but also one that is difficult to master. This paper focuses on the problems that novices experience when they first encounter this concept. Three assignments from introductory courses are analyzed, to

Future of the Introductory Psychology Textbook: A Survey of College Publishers.

Science.gov (United States)

Buskit, William; Cush, David T.

1997-01-01

Examines aspects of the introductory psychology textbook market through a publishing house survey. Aspects covered are the current and future number of introductory texts, fewer textbook publishers, custom publishing, changing content, and computer technologies. Discusses the results of the publishers' responses and provides statistical tables of…

Semantics in Teaching Introductory Physics.

Science.gov (United States)

Williams, H. Thomas

1999-01-01

Contends that the large vocabulary used for precise purposes in physics contains many words that have related but potentially confusing meanings in everyday usage. Analyzes the treatment of Newton's Laws of Motion in several well-known introductory textbooks for evidence of inconsistent language use. Makes teaching suggestions. (Contains 11…

Organic Chemistry in Action! Developing an Intervention Program for Introductory Organic Chemistry to Improve Learners' Understanding, Interest, and Attitudes

Science.gov (United States)

O'Dwyer, Anne; Childs, Peter

2014-01-01

The main areas of difficulty experienced by those teaching and learning organic chemistry at high school and introductory university level in Ireland have been identified, and the findings support previous studies in Ireland and globally. Using these findings and insights from chemistry education research (CER), the Organic Chemistry in Action!…

Computational Inquiry in Introductory Statistics

Science.gov (United States)

Toews, Carl

2017-01-01

Inquiry-based pedagogies have a strong presence in proof-based undergraduate mathematics courses, but can be difficult to implement in courses that are large, procedural, or highly computational. An introductory course in statistics would thus seem an unlikely candidate for an inquiry-based approach, as these courses typically steer well clear of…

MRI Experiments for Introductory Physics

Science.gov (United States)

Taghizadeh, Sanaz; Lincoln, James

2018-01-01

The introductory physics classroom has long educated students about the properties of the atom and the nucleus. But absent from these lessons has been an informed discussion of magnetic resonance imaging (MRI) and its parent science nuclear magnetic resonance (NMR). Physics teachers should not miss the opportunity to instruct upon this highly…

Biotechnology by Design: An Introductory Level, Project-Based, Synthetic Biology Laboratory Program for Undergraduate Students.

Science.gov (United States)

Beach, Dale L; Alvarez, Consuelo J

2015-12-01

Synthetic biology offers an ideal opportunity to promote undergraduate laboratory courses with research-style projects, immersing students in an inquiry-based program that enhances the experience of the scientific process. We designed a semester-long, project-based laboratory curriculum using synthetic biology principles to develop a novel sensory device. Students develop subject matter knowledge of molecular genetics and practical skills relevant to molecular biology, recombinant DNA techniques, and information literacy. During the spring semesters of 2014 and 2015, the Synthetic Biology Laboratory Project was delivered to sophomore genetics courses. Using a cloning strategy based on standardized BioBrick genetic "parts," students construct a "reporter plasmid" expressing a reporter gene (GFP) controlled by a hybrid promoter regulated by the lac-repressor protein (lacI). In combination with a "sensor plasmid," the production of the reporter phenotype is inhibited in the presence of a target environmental agent, arabinose. When arabinose is absent, constitutive GFP expression makes cells glow green. But the presence of arabinose activates a second promoter (pBAD) to produce a lac-repressor protein that will inhibit GFP production. Student learning was assessed relative to five learning objectives, using a student survey administered at the beginning (pre-survey) and end (post-survey) of the course, and an additional 15 open-ended questions from five graded Progress Report assignments collected throughout the course. Students demonstrated significant learning gains (p Biology Laboratory Project enhanced their understanding of molecular genetics. The laboratory project is highly adaptable for both introductory and advanced courses.

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC148 (Link to dictyBase) - G00403 DDB0215559 Contig-U08747-1...rary) Clone ID VFC148 (Link to dictyBase) Atlas ID - NBRP ID G00403 dictyBase ID DDB0215559 Link to Contig C...ontig-U08747-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFC1-B...STEITHLAIPSNSNIK IIEGGAYIPANVKHCLLLDGFNQPLEPGFLAPTITHLHICTIKTPLLVGSIPNGVTDLFL HDGFSEPISQDIIPPSVQNLYLCDIKLPFK...it--- ---LMKSXFIIHSKSINXAKKPKRVQFGDKVFTYYNKDENNGIISTEITHLAIPSNSNIK IIEGGAYIPANVKHCLLLDGFNQPLEPGFLAPTITHLHICT

78 FR 19468 - Applications for New Awards; Minority Science and Engineering Improvement Program

Science.gov (United States)

2013-04-01

... the introductory years of science and engineering programs. We invite applications for projects that... research courses into the introductory STEM curricula. Expand the use of scientific research and... strong statistical controls for selection bias and for discerning the influence of internal factors...

Voltage-to-frequency converters CMOS design and implementation

CERN Document Server

Azcona Murillo, Cristina; Pueyo, Santiago Celma

2013-01-01

This book develops voltage-to-frequency converter (VFC) solutions integrated in standard CMOS technology to be used as a part of a microcontroller-based, multisensor interface in the environment of portable applications, particularly within a WSN node.  Coverage includes the total design flow of monolithic VFCs, according to the target application, as well as the analysis, design and implementation of the main VFC blocks, revealing the main challenges and solutions encountered during the design of such high performance cells. Four complete VFCs, each temperature compensated, are fully designed and evaluated: a programmable VFC that includes an offset frequency and a sleep/mode enable terminal; a low power rail-to-rail VFC; and two rail-to-rail differential VFCs.

Utilization of the voltage frequency converter or digital representation and documentation of transient reactor operation

International Nuclear Information System (INIS)

Doane, Harry J.

1986-01-01

The ease and speed of handling transient data is enhanced by the use of a voltage to frequency converter (VFC). This analogue to digital semiconductor device provides an inexpensive and portable alternative to electro-mechanical recorders and hand entry of data into computer codes. The VFC used at The University of Arizona is a Teledyne Philbrick 4705/01. A zero to positive ten volt input signal provides a zero to one megahertz output signal which is TTL/DTL compatible. VFC is used at the University of Arizona to collect data for super prompt critical TRIGA excursions. The VFC provides a low cost, convenient method of transient data storage and retrieval for experimentation and laboratory demonstration

Teaching Programming to Liberal Arts Students

DEFF Research Database (Denmark)

Andersen, Peter Bøgh; Bennedsen, Jens; Brandorff, Steffen

2003-01-01

In this paper we present a new learning environment to be used in an introductory programming course for studentsthat are non-majors in computer science, more precisely formultimedia students with a liberal arts background. Media-oriented programming adds new requirements to thecraft of programmi...

29 CFR 1977.1 - Introductory statement.

Science.gov (United States)

2010-07-01

... AND HEALTH ACT OF 1970 General § 1977.1 Introductory statement. (a) The Occupational Safety and Health... Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR... general application designed to regulate employment conditions relating to occupational safety and health...

Factors associated with the success of first-time African American freshmen taking introductory science lecture courses at a private HBCU

Science.gov (United States)

Smith, Kendra Leigh

This study had four purposes: (1) to investigate the relationship between performance in introductory biology or introductory chemistry lecture courses and their accompanying laboratory courses, (2) to investigate the relationship between performance in introductory biology or introductory chemistry lecture courses and a student's gender, (3) to investigate the relationship between performance in introductory biology or introductory chemistry lecture courses and a student's major, and (4) to investigate the relationship between performance in introductory biology or introductory chemistry lecture courses and a student's ACT scores. The sample consisted of 195 first--time freshmen who enrolled in and completed an introductory biology or an introductory chemistry lecture and laboratory courses during the fall semesters of 2007-2012. Of the 195 students, 61 were enrolled in introductory chemistry and 134 were enrolled in introductory biology courses. Logistic regression, via the Statistical Package for the Social Sciences (SPSS), was utilized to analyze several variables as they related to success in the lecture courses. Data were extracted from the university's student information system (BANNER), and analyses were conducted on biology and chemistry separately. The dependent variable for this study was a dichotomous variable for success and nonsuccess in introductory biology or introductory chemistry lecture course. The independent variables analyzed were student's gender, major, final grade in an accompanying biology or chemistry laboratory course, and ACT test scores (composite, mathematics, and science). Results indicate that concurrent enrollment in a biology laboratory course increased the likelihood of success by 15.64 times in the lecture course. Gender was found to not be a significant predictor of success for either introductory biology or introductory chemistry lecture courses. STEM majors were 9.6 times more likely to be successful than non-STEM majors in

Developing and validating a conceptual survey to assess introductory physics students’ understanding of magnetism

Science.gov (United States)

Li, Jing; Singh, Chandralekha

2017-03-01

Development of validated physics surveys on various topics is important for investigating the extent to which students master those concepts after traditional instruction and for assessing innovative curricula and pedagogies that can improve student understanding significantly. Here, we discuss the development and validation of a conceptual multiple-choice survey related to magnetism suitable for introductory physics courses. The survey was developed taking into account common students’ difficulties with magnetism concepts covered in introductory physics courses found in our investigation and the incorrect choices to the multiple-choice questions were designed based upon those common student difficulties. After the development and validation of the survey, it was administered to introductory physics students in various classes in paper-pencil format before and after traditional lecture-based instruction in relevant concepts. We compared the performance of students on the survey in the algebra-based and calculus-based introductory physics courses before and after traditional lecture-based instruction in relevant magnetism concepts. We discuss the common difficulties of introductory physics students with magnetism concepts we found via the survey. We also administered the survey to upper-level undergraduates majoring in physics and PhD students to benchmark the survey and compared their performance with those of traditionally taught introductory physics students for whom the survey is intended. A comparison with the base line data on the validated magnetism survey from traditionally taught introductory physics courses and upper-level undergraduate and PhD students discussed in this paper can help instructors assess the effectiveness of curricula and pedagogies which is especially designed to help students integrate conceptual and quantitative understanding and develop a good grasp of the concepts. In particular, if introductory physics students’ average

Developing and validating a conceptual survey to assess introductory physics students’ understanding of magnetism

International Nuclear Information System (INIS)

Li, Jing; Singh, Chandralekha

2017-01-01

Development of validated physics surveys on various topics is important for investigating the extent to which students master those concepts after traditional instruction and for assessing innovative curricula and pedagogies that can improve student understanding significantly. Here, we discuss the development and validation of a conceptual multiple-choice survey related to magnetism suitable for introductory physics courses. The survey was developed taking into account common students’ difficulties with magnetism concepts covered in introductory physics courses found in our investigation and the incorrect choices to the multiple-choice questions were designed based upon those common student difficulties. After the development and validation of the survey, it was administered to introductory physics students in various classes in paper–pencil format before and after traditional lecture-based instruction in relevant concepts. We compared the performance of students on the survey in the algebra-based and calculus-based introductory physics courses before and after traditional lecture-based instruction in relevant magnetism concepts. We discuss the common difficulties of introductory physics students with magnetism concepts we found via the survey. We also administered the survey to upper-level undergraduates majoring in physics and PhD students to benchmark the survey and compared their performance with those of traditionally taught introductory physics students for whom the survey is intended. A comparison with the base line data on the validated magnetism survey from traditionally taught introductory physics courses and upper-level undergraduate and PhD students discussed in this paper can help instructors assess the effectiveness of curricula and pedagogies which is especially designed to help students integrate conceptual and quantitative understanding and develop a good grasp of the concepts. In particular, if introductory physics students’ average

Does Living near Classmates Help Introductory Economics Students Get Better Grades?

Science.gov (United States)

Parker, Jeffrey

2012-01-01

This article examines whether first-year students in introductory economics courses get better grades if they have other students in their on-campus residential unit who either are taking the same course or have taken the course in the past. The study uses nine years of data for the introductory economics course at Reed College. The author finds…

16 CFR 502.101 - Introductory offers.

Science.gov (United States)

2010-01-01

... Commercial Practices FEDERAL TRADE COMMISSION RULES, REGULATIONS, STATEMENT OF GENERAL POLICY OR... FAIR PACKAGING AND LABELING ACT Retail Sale Price Representations § 502.101 Introductory offers. (a... retail sale at a price lower than the anticipated ordinary and customary retail sale price. (b) The...

Collaborative Workshops and Student Academic Performance in Introductory College Mathematics Courses: A Study of a Treisman Model Math Excel Program.

Science.gov (United States)

Duncan, Hollis; Dick, Thomas

2000-01-01

Describes the Treisman model which involves supplemental workshops in which college students solve problems in collaborative learning groups. Reports on the effectiveness of Math Excel, an implementation of the Treisman model for introductory mathematics courses at Oregon State University over five academic terms. Reveals a significant effect on…

Exploring Poetry through Interactive Computer Programs.

Science.gov (United States)

Nimchinsky, Howard; Camp, Jocelyn

The goal of a project was to design, test, and evaluate several computer programs that allow students in introductory literature and poetry courses to explore a poem in detail and, through a dialogue with the program, to develop their own interpretation of it. Computer programs were completed on poems by Robert Frost and W.H. Auden. Both programs…

An Analysis of Learning Objectives and Content Coverage in Introductory Psychology Syllabi

Science.gov (United States)

Homa, Natalie; Hackathorn, Jana; Brown, Carrie M.; Garczynski, Amy; Solomon, Erin D.; Tennial, Rachel; Sanborn, Ursula A.; Gurung, Regan A. R.

2013-01-01

Introductory psychology is one of the most popular undergraduate courses and often serves as the gateway to choosing psychology as an academic major. However, little research has examined the typical structure of introductory psychology courses. The current study examined student learning objectives (SLOs) and course content in introductory…

Agricultural In-Service Needs of Introductory Level Career and Technical Education Teachers

Science.gov (United States)

Christensen, Jolene; Warnick, Brian K.; Spielmaker, Debra; Tarpley, Rudy S.; Straquadine, Gary S.

2009-01-01

This study identified and prioritized the agricultural in-service needs of introductory level career and technical education teachers in Utah. The Utah State Board of Education requires that all seventh grade students complete an introductory career and technical education course as their first formal career exploration experience. One component…

Emotion Instruction in Journalism Courses: An Analysis of Introductory News Writing Textbooks

Science.gov (United States)

Hopper, K. Megan; Huxford, John

2017-01-01

This study explores how introductory news writing textbooks address issues surrounding emotional labor and its consequences, both for journalists and for those they interview. Eighteen of the highest-selling introductory news-writing textbooks were selected for qualitative analysis. Results showed the term and concept of emotional labor--the…

Research and Teaching: Reenvisioning the Introductory Science Course as a Cognitive Apprenticeship

Science.gov (United States)

Thompson, Meredith M.; Pastorino, Lucia; Lee, Star; Lipton, Paul

2016-01-01

Introductory science courses play a critical role in the recruitment and retention of undergraduate science majors. In particular, first-year courses are opportunities to engage students in scientific practices and motivate them to consider scientific careers. We developed an introductory course using a semester-long series of established…

New Approach to Analyzing Physics Problems: A Taxonomy of Introductory Physics Problems

Science.gov (United States)

Teodorescu, Raluca E.; Bennhold, Cornelius; Feldman, Gerald; Medsker, Larry

2013-01-01

This paper describes research on a classification of physics problems in the context of introductory physics courses. This classification, called the Taxonomy of Introductory Physics Problems (TIPP), relates physics problems to the cognitive processes required to solve them. TIPP was created in order to design educational objectives, to develop…

Introductory Comments

Directory of Open Access Journals (Sweden)

Jolanta Sujecka

2016-12-01

Full Text Available Introductory Comments The fifth yearly volume of the Colloquia Humanistica comprises a thematic section on Nation, Natsiya, Ethnie. The subject it discusses has thus far received little attention as a research problem in the Slavia Orthodoxa, the Slavia Romana, the Balkans but also in Central and Eastern Europe.   Uwagi wstępne Piąty numer rocznika "Colloquia Humanistica" przedstawia dział tematyczny, poświęcony kategoriom narodu, nacji i etni. Temat ten, w takiej perspektywie, którą proponujemy, nie spotkał się dotąd z należytym namysłem badawczym w sferze Slavia Otrhodoxa, Slavia Romana i na Bałkanach, jak też w Europie Środkowo-Wschodniej.

The Effect of Problem-Solving Instruction on the Programming Self-efficacy and Achievement of Introductory Computer Science Students

Science.gov (United States)

Maddrey, Elizabeth

Research in academia and industry continues to identify a decline in enrollment in computer science. One major component of this decline in enrollment is a shortage of female students. The primary reasons for the gender gap presented in the research include lack of computer experience prior to their first year in college, misconceptions about the field, negative cultural stereotypes, lack of female mentors and role models, subtle discriminations in the classroom, and lack of self-confidence (Pollock, McCoy, Carberry, Hundigopal, & You, 2004). Male students are also leaving the field due to misconceptions about the field, negative cultural stereotypes, and a lack of self-confidence. Analysis of first year attrition revealed that one of the major challenges faced by students of both genders is a lack of problem-solving skills (Beaubouef, Lucas & Howatt, 2001; Olsen, 2005; Paxton & Mumey, 2001). The purpose of this study was to investigate whether specific, non-mathematical problem-solving instruction as part of introductory programming courses significantly increased computer programming self-efficacy and achievement of students. The results of this study showed that students in the experimental group had significantly higher achievement than students in the control group. While this shows statistical significance, due to the effect size and disordinal nature of the data between groups, care has to be taken in its interpretation. The study did not show significantly higher programming self-efficacy among the experimental students. There was not enough data collected to statistically analyze the effect of the treatment on self-efficacy and achievement by gender. However, differences in means were observed between the gender groups, with females in the experimental group demonstrating a higher than average degree of self-efficacy when compared with males in the experimental group and both genders in the control group. These results suggest that the treatment from this

Gender differences in introductory university physics performance: The influence of high school physics preparation and affect

Science.gov (United States)

Hazari, Zahra Sana

The attrition of females studying physics after high school is a concern to the science education community. Most undergraduate science programs require introductory physics coursework. Thus, success in introductory physics is necessary for students to progress to higher levels of science study. Success also influences attitudes; if females are well-prepared, feel confident, and do well in introductory physics, they may be inclined to study physics further. This quantitative study using multilevel modeling focused on determining factors from high school physics preparation (content, pedagogy, and assessment) and the affective domain that influenced female and male performance in introductory university physics. The study controlled for some university/course level characteristics as well as student demographic and academic background characteristics. The data consisted of 1973 surveys from 54 introductory physics courses within 35 universities across the US. The results highlight high school physics and affective experiences that differentially influenced female and male performance. These experiences include: learning requirements, computer graphing/analysis, long written problems, everyday world examples, community projects, cumulative tests/quizzes, father's encouragement, family's belief that science leads to a better career, and the length of time students believed that high school physics would help in university physics. There were also experiences that had a similar influence on female and male performance. Positively related to performance were: covering fewer topics for longer periods of time, the history of physics as a recurring topic, physics-related videos, and test/quiz questions that involved calculations and/or were drawn from standardized tests. Negatively related to performance were: student-designed projects, reading/discussing labs the day before performing them, microcomputer based laboratories, discussion after demonstrations, and family

Introductory Astronomy Course at the University of Cape Town: Probing Student Perspectives

Science.gov (United States)

Rajpaul, Vinesh; Allie, Saalih; Blyth, Sarah-Louise

2014-01-01

We report on research carried out to improve teaching and student engagement in the introductory astronomy course at the University of Cape Town. This course is taken by a diverse range of students, including many from educationally disadvantaged backgrounds. We describe the development of an instrument, the Introductory Astronomy Questionnaire…

Revealing the programming process

DEFF Research Database (Denmark)

Bennedsen, Jens; Caspersen, Michael Edelgaard

2005-01-01

One of the most important goals of an introductory programming course is that the students learn a systematic approach to the development of computer programs. Revealing the programming process is an important part of this; however, textbooks do not address the issue -- probably because...... the textbook medium is static and therefore ill-suited to expose the process of programming. We have found that process recordings in the form of captured narrated programming sessions are a simple, cheap, and efficient way of providing the revelation.We identify seven different elements of the programming...

Mississippi Curriculum Framework for Veterinary Technology (Program CIP: 51.0808--Veterinarian Asst./Animal Health). Postsecondary Programs.

Science.gov (United States)

Mississippi Research and Curriculum Unit for Vocational and Technical Education, State College.

This document, which is intended for use by community and junior colleges throughout Mississippi, contains curriculum frameworks for the course sequences in the veterinary technology program. Presented in the introductory section are a of the program and suggested course sequence. Section I lists baseline competencies, and section II consists of…

A voltage to frequency converter for astronomical photometry

Science.gov (United States)

Dunham, E.; Elliot, J. L.

1978-01-01

A voltage to frequency converter (VFC) for general use with photomultipliers is described. For high light levels, when the dead-time corrections for a photon counter would be excessive, the VFC maintains a linear response and allows the recording of data at high time resolution. Results of laboratory tests are given for the signal-to-noise characteristics, linearity, stability, and transient response of the VFC when used in conjunction with EMI 9658 and RCA C31034 photomultipliers.

Item Analysis in Introductory Economics Testing.

Science.gov (United States)

Tinari, Frank D.

1979-01-01

Computerized analysis of multiple choice test items is explained. Examples of item analysis applications in the introductory economics course are discussed with respect to three objectives: to evaluate learning; to improve test items; and to help improve classroom instruction. Problems, costs and benefits of the procedures are identified. (JMD)

The Nature of Introductory Economics Courses

Science.gov (United States)

Koscielniak, James

1975-01-01

A questionnaire was developed to determine the content, mode of instruction, approach, and textbook selection of instructors of introductory economics courses. The survey was distributed in 1974 to 143 economics instructors at two- and four-year colleges in Illinois. Results are presented here, and recommendations are made. (Author/NHM)

Programming in Context

DEFF Research Database (Denmark)

Bennedsen, J.; Caspersen, M.E.

2004-01-01

The recommendations of the Joint Task Force on Computing Curricula 2001 encompass suggestions for an object-first introductory programming course. We have identified conceptual modeling as a lacking perspective in the suggestions for CS1. Conceptual modeling is the defining characteristic of object...... approach to programming; both of these are a big help to newcomers. The approach has a very positive impact on the number of students passing the course....

Quantifying the Level of Inquiry in a Reformed Introductory Geology Lab Course

Science.gov (United States)

Moss, Elizabeth; Cervato, Cinzia

2016-01-01

As part of a campus-wide effort to transform introductory science courses to be more engaging and more accurately convey the excitement of discovery in science, the curriculum of an introductory physical geology lab course was redesigned. What had been a series of ''cookbook'' lab activities was transformed into a sequence of activities based on…

An Introductory Calculus-Based Mechanics Investigation

Science.gov (United States)

Allen, Bradley

2017-01-01

One challenge for the introductory physics teacher is incorporating calculus techniques into the laboratory setting. It can be difficult to strike a balance between presenting an experimental task for which calculus is essential and making the mathematics accessible to learners who may be apprehensive about applying it. One-dimensional kinematics…

Macromod: Computer Simulation For Introductory Economics

Science.gov (United States)

Ross, Thomas

1977-01-01

The Macroeconomic model (Macromod) is a computer assisted instruction simulation model designed for introductory economics courses. An evaluation of its utilization at a community college indicates that it yielded a 10 percent to 13 percent greater economic comprehension than lecture classes and that it met with high student approval. (DC)

29 CFR 782.0 - Introductory statement.

Science.gov (United States)

2010-07-01

... one place general interpretations of the Administrator which will provide “a practical guide to... CERTAIN EMPLOYEES OF MOTOR CARRIERS § 782.0 Introductory statement. (a) Since the enactment of the Fair... seek to apply it.” (Skidmore v. Swift & Co., 323 U.S. 134) (b) The interpretations contained in this...

29 CFR 531.25 - Introductory statement.

Science.gov (United States)

2010-07-01

... such interpretations of this Act “provide a practical guide to employers and employees as to how the... PAYMENTS UNDER THE FAIR LABOR STANDARDS ACT OF 1938 Interpretations § 531.25 Introductory statement. (a... responsibilities of administration and enforcement (Skidmore v. Swift, 323 U.S. 134). In order that these positions...

The Development of a Set of Core Communication Competencies for Introductory Communication Courses

Science.gov (United States)

Engleberg, Isa N.; Ward, Susan M.; Disbrow, Lynn M.; Katt, James A.; Myers, Scott A.; O'Keefe, Patricia

2017-01-01

In most academic disciplines, there is "one" introductory course that presents an overview of the discipline and introduces fundamental, discipline-specific principles and competencies. However, in Communication Studies, the discipline recognizes and offers multiple course options that may serve as the introductory course. This project…

Vaccines provided by family physicians.

Science.gov (United States)

Campos-Outcalt, Doug; Jeffcott-Pera, Michelle; Carter-Smith, Pamela; Schoof, Bellinda K; Young, Herbert F

2010-01-01

This study was conducted to document current immunization practices by family physicians. In 2008 the American Academy of Family Physicians (AAFP) conducted a survey among a random sample of 2,000 of its members who reported spending 80% or more of their time in direct patient care. The survey consisted of questions regarding the demographics of the practice, vaccines that are provided at the physicians' clinical site, whether the practice refers patients elsewhere for vaccines, and participation in the Vaccines for Children (VFC) program. The response rate was 38.5%, 31.8% after non-office-based respondents were deleted. A high proportion of respondents (80% or more) reported providing most routinely recommended child, adolescent, and adult vaccines at their practice sites. The exceptions were rotavirus vaccine for children and herpes zoster vaccine for adults., A significant proportion, however, reported referring elsewhere for some vaccines (44.1% for children and adolescent vaccines and 53.5% for adult vaccines), with the most frequent referral location being a public health department. A higher proportion of solo and 2-physician practices than larger practices reported referring patients. A lack of adequate payment was listed as the reason for referring patients elsewhere for vaccines by one-half of those who refer patients. One-half of responders do not participate in the VFC program. Provision of recommended vaccines by most family physicians remains an important service. Smaller practices have more difficulty offering a full array of vaccine products, and lack of adequate payment contributes to referring patients outside the medical home. The reasons behind the lack of participation in the VFC program deserve further study.

An Analysis of Introductory Programming Courses at UK Universities

OpenAIRE

Murphy, Ellen; Crick, Tom; Davenport, James H.

2016-01-01

Context: In the context of exploring the art, science and engineering of programming, the question of which programming languages should be taught first has been fiercely debated since computer science teaching started in universities. Failure to grasp programming readily almost certainly implies failure to progress in computer science. Inquiry: What first programming languages are being taught? There have been regular national-scale surveys in Australia and New Zealand, with the only US surv...

Inference and the Introductory Statistics Course

Science.gov (United States)

Pfannkuch, Maxine; Regan, Matt; Wild, Chris; Budgett, Stephanie; Forbes, Sharleen; Harraway, John; Parsonage, Ross

2011-01-01

This article sets out some of the rationale and arguments for making major changes to the teaching and learning of statistical inference in introductory courses at our universities by changing from a norm-based, mathematical approach to more conceptually accessible computer-based approaches. The core problem of the inferential argument with its…

"World Religions" in Introductory Sociology Textbooks

Science.gov (United States)

Carroll, Michael P.

2017-01-01

A section on "world religions" (WRs) is now routinely included in the religion chapters of introductory sociology textbooks. Looking carefully at these WR sections, however, two things seem puzzling. The first is that the criteria for defining a WR varies considerably from textbook to textbook; the second is that these WRs sections…

Making Introductory Quantum Physics Understandable and Interesting

Indian Academy of Sciences (India)

Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 1. Making Introductory Quantum Physics Understandable and Interesting. Ranjana Y Abhang. Classroom Volume 10 Issue 1 January 2005 pp 63-73. Fulltext. Click here to view fulltext PDF. Permanent link:

Analysis of the Impact of Introductory Physics on Engineering Students at Texas A&M University

Science.gov (United States)

Perry, Jonathan; Bassichis, William

Introductory physics forms a major part of the foundational knowledge of engineering majors, independent of discipline and institution. While the content of introductory physics courses is consistent from institution to institution, the manner in which it is taught can vary greatly due to professor, textbook, instructional method, and overall course design. This work attempts to examine variations in student success, as measured by overall academic performance in an engineering major, and matriculation rates, based on the type of introductory physics a student took while enrolled in an engineering degree at Texas A&M University. Specific options for introductory physics at Texas A&M University include two calculus based physics courses, one traditional (UP), and one more mathematically rigorous (DP), transfer credit, and high school (AP or dual) credit. In order to examine the impact of introductory physics on a student's degree progression, data mining analyses are performed on a data set of relatively comprehensive academic records for all students enrolled as an engineering major for a minimum of one academic term. Student data has been collected for years of entering freshman beginning in 1990 and ending in 2010. Correlations will be examined between freshman level courses, including introductory physics, and follow on engineering courses, matriculation rates, and time to graduation.

Transversality of Electromagnetic Waves in the Calculus--Based Introductory Physics Course

Science.gov (United States)

Burko, Lior M.

2009-05-01

Introductory calculus--based physics textbooks state that electromagnetic waves are transverse and list many of their properties, but most such textbooks do not bring forth arguments why this is so. Both physical and theoretical arguments are at a level appropriate for students of courses based on such books, and could be readily used by instructors of such courses. Here, we discuss two physical arguments (based on polarization experiments and on lack of monopole electromagnetic radiation), and the full argument for the transversality of (plane) electromagnetic waves based on the integral Maxwell equations. We also show, at a level appropriate for the introductory course, why the electric and magnetic fields in a wave are in phase and the relation of their magnitudes. We have successfully integrated this approach in the calculus--based introductory physics course at the University of Alabama in Huntsville.

Enhancing the Teaching of Introductory Economics with a Team-Based, Multi-Section Competition

Science.gov (United States)

Beaudin, Laura; Berdiev, Aziz N.; Kaminaga, Allison Shwachman; Mirmirani, Sam; Tebaldi, Edinaldo

2017-01-01

The authors describe a unique approach to enhancing student learning at the introductory economics level that utilizes a multi-section, team-based competition. The competition is structured to supplement learning throughout the entire introductory course. Student teams are presented with current economic issues, trends, or events, and use economic…

Introducing Object-Oriented Programming

DEFF Research Database (Denmark)

Caspersen, Michael Edelgaard

2008-01-01

The practice of teaching programming at universities, colleges and high schools went through a major change roughly in the mid 1990s: The teaching of objectorientation in introductory courses slowly became mainstream. Fairly soon, the Object First or Objects Early school of thought was formulated...

Exploring Urban America: An Introductory Reader.

Science.gov (United States)

Caves, Roger W.

This introductory text presents a collection of articles from urban-studies journals to introduce undergraduate students to the interdisciplinary field of urban studies. The book is divided into 9 parts as follows: Part 1: Cities and Urbanism; part 2: Urban History; part 3: Urban Policy; part 4: Economic Development; part 5: Community Services and…

Using Short Videos in an Introductory Programming Course

DEFF Research Database (Denmark)

Nørmark, Kurt

2014-01-01

Video resources are gradually being introduced in a first year programming course. The course is about imperative programming in C. After each of the first two years with video lectures the students have been asked about their assessments and opinions. The main parts of the paper are based on evi...... experience we also carry out a discussion of future plans for using video resources in the course....

Teaching Quantum Mechanics on an Introductory Level.

Science.gov (United States)

Muller, Rainer; Wiesner, Hartmut

2002-01-01

Presents a new research-based course on quantum mechanics in which the conceptual issues of quantum mechanics are taught at an introductory level. Involves students in the discovery of how quantum phenomena deviate from classical everyday experiences. (Contains 31 references.) (Author/YDS)

Mississippi Curriculum Framework for Fashion Marketing Technology (Program CIP: 08.0101--Apparel and Accessories Mkt. Op., Gen.). Postsecondary Programs.

Science.gov (United States)

Mississippi Research and Curriculum Unit for Vocational and Technical Education, State College.

This document, which is intended for use by community and junior colleges throughout Mississippi, contains curriculum frameworks for the course sequences in the fashion marketing technology programs cluster. Presented in the introductory section are a description of the program and suggested course sequence. Section I lists baseline competencies,…

Peer Learning as a Tool to Strengthen Math Skills in Introductory Chemistry Laboratories

Science.gov (United States)

Srougi, Melissa C.; Miller, Heather B.

2018-01-01

Math skills vary greatly among students enrolled in introductory chemistry courses. Students with weak math skills (algebra and below) tend to perform poorly in introductory chemistry courses, which is correlated with increased attrition rates. Previous research has shown that retention of main ideas in a peer learning environment is greater when…

Practical C programming

CERN Document Server

Oualline, Steve

1997-01-01

There are lots of introductory C books, but this is the first one that has the no-nonsense, practical approach that has made Nutshell Handbooks® famous. C programming is more than just getting the syntax right. Style and debugging also play a tremendous part in creating programs that run well and are easy to maintain. This book teaches you not only the mechanics of programming, but also describes how to create programs that are easy to read, debug, and update. Practical rules are stressed. For example, there are fifteen precedence rules in C (&& comes before || comes before ?:). The practi

Multimedia programming with pure data

CERN Document Server

Chung, Bryan

2013-01-01

A quick and comprehensive tutorial book for media designers to jump-start interactive multimedia production with computer graphics, digital audio, digital video, and interactivity, using the Pure Data graphical programming environment.An introductory book on multimedia programming for media artists/designers who like to work on interactivity in their projects, digital art/design students who like to learn the first multimedia programming technique, and audio-visual performers who like to customize their performance sets

Behaviorism, latent learning, and cognitive maps: needed revisions in introductory psychology textbooks.

Science.gov (United States)

Jensen, Robert

2006-01-01

This paper critically assesses the scholarship in introductory psychology textbooks in relation to the topic of latent learning. A review of the treatment of latent learning in 48 introductory psychology textbooks published between 1948 and 2004, with 21 of these texts published since 1999, reveals that the scholarship on the topic of latent learning demonstrated in introductory textbooks warrants improvement. Errors that persist in textbooks include the assertion that the latent learning experiments demonstrate unequivocally that reinforcement was not necessary for learning to occur, that behavioral theories could not account for the results of the latent learning experiments, that B. F. Skinner was an S-R association behaviorist who argued that reinforcement is necessary for learning to occur, and that because behavioral theories (including that of B. F. Skinner) were unable explain the results of the latent learning experiments the cognitive map invoked by Edward Tolman is the only explanation for latent learning. Finally, the validity of the cognitive map is typically accepted without question. Implications of the presence of these errors for students and the discipline are considered. Lastly, remedies are offered to improve the scholarship found in introductory psychology textbooks.

Systematic Literature Review Protocol: Teaching Novices Programming Using Robots

Science.gov (United States)

Major, Louis

2010-01-01

Teaching computer programming to novices is a difficult task due to the complex nature of the subject, as negative stereotypes are associated with programming and because introductory programming courses often fail to encourage student understanding. This Protocol outlines the plan that is to be followed in order to investigate the effectiveness…

Integrated Circuits in the Introductory Electronics Laboratory

Science.gov (United States)

English, Thomas C.; Lind, David A.

1973-01-01

Discusses the use of an integrated circuit operational amplifier in an introductory electronics laboratory course for undergraduate science majors. The advantages of this approach and the implications for scientific instrumentation are identified. Describes a number of experiments suitable for the undergraduate laboratory. (Author/DF)

Barriers to Teaching Introductory Physical Geography Online

Science.gov (United States)

Ritter, Michael E.

2012-01-01

Learning geography online is becoming an option for more students but not without controversy. Issues of faculty resources, logistics, professional recognition, and pedagogical concerns are cited as barriers to teaching online. Offering introductory physical geography online presents special challenges. As a general education course, an…

A 21st century perspective as a primer to introductory physics

Energy Technology Data Exchange (ETDEWEB)

Curtis, Lorenzo J, E-mail: ljc@physics.utoledo.edu [Department of Physics and Astronomy, University of Toledo, Toledo, OH 43606 (United States)

2011-09-15

Much effort over many years has been devoted to the reform of the teaching of physics. This has led to many new and imaginative approaches in the content and delivery of material. Great strides have been made in the delivery, and the content has been continually supplemented. However, attempts to modernize the basic structure of the presentation have faced resistance, and the majority of introductory physics textbooks in wide adoption today have a general structure that has changed little in over 60 years. Thus, in comparison to biology, chemistry, geology, etc, physics is unique in that its introductory course is not a survey of the current status of the field. In an attempt to circumvent this problem in a tractable way, we have developed a qualitative front-end course designed to create a 21st century perspective that can be embedded into the beginning of a standard introductory physics sequence.

A 21st century perspective as a primer to introductory physics

International Nuclear Information System (INIS)

Curtis, Lorenzo J

2011-01-01

Much effort over many years has been devoted to the reform of the teaching of physics. This has led to many new and imaginative approaches in the content and delivery of material. Great strides have been made in the delivery, and the content has been continually supplemented. However, attempts to modernize the basic structure of the presentation have faced resistance, and the majority of introductory physics textbooks in wide adoption today have a general structure that has changed little in over 60 years. Thus, in comparison to biology, chemistry, geology, etc, physics is unique in that its introductory course is not a survey of the current status of the field. In an attempt to circumvent this problem in a tractable way, we have developed a qualitative front-end course designed to create a 21st century perspective that can be embedded into the beginning of a standard introductory physics sequence.

Variabilidad de la frecuencia cardíaca y perfiles psicofisiológicos en deportes de equipo de alto rendimiento

Directory of Open Access Journals (Sweden)

Jordi Moreno S\\u00E1nchez

2013-01-01

Full Text Available En el presente trabajo se plantean dos objetivos, llevados a cabo en dos estudios diferentes. En primer lugar, se pretende analizar la utilidad del análisis de la Variabilidad de la Frecuencia Cardíaca (VFC dentro del contexto de los deportes de equipo de alto rendimiento. Por otra parte, se pretende analizar la VFC en base a los perfiles de estado de ánimo evaluados con el POMS. Para el primer estudio se seleccionaron 53 deportistas de 3 deportes de equipo de élite diferentes: baloncesto, hockey hierba y fútbol. Para el segundo estudio la muestra la formaron 18 futbolistas de élite, divididos en dos grupos: perfil iceberg y estado de ánimo alterado. Los resultados muestran que los futbolistas presentan un perfil de VFC diferente a los jugadores de baloncesto o hockey hierba, que muestran un perfil de VFC bastante parecido. En los futbolistas con perfil iceberg, el factor de Vigor correlaciona negativamente con los parámetros LF/HF y %LF, y positivamente con el parámetro HF%. En los futbolistas con estado de ánimo alterado, el factor de Fatiga correlaciona negativamente con los parámetros pNN50 y HF. Los resultados permiten profundizar en el estudio de la VFC en deportes de equipo para adaptar mejor los seguimientos, así como obtener indicadores de estado de ánimo relacionados con la VFC.

Just the Facts? Introductory Undergraduate Biology Courses Focus on Low-Level Cognitive Skills

Science.gov (United States)

Momsen, Jennifer L.; Long, Tammy M.; Wyse, Sara A.; Ebert-May, Diane

2010-01-01

Introductory biology courses are widely criticized for overemphasizing details and rote memorization of facts. Data to support such claims, however, are surprisingly scarce. We sought to determine whether this claim was evidence-based. To do so we quantified the cognitive level of learning targeted by faculty in introductory-level biology courses.…

Stimulating Situational Interest and Student Questioning through Three Types of Historical Introductory Texts

Science.gov (United States)

Logtenberg, Albert; van Boxtel, Carla; van Hout-Wolters, Bernadette

2011-01-01

This study investigates questions students ask related to an introductory text about a new topic in the history classroom. The effects of a narrative, problematizing, and expository introductory text on the situational interest of students and the number and type of student-generated questions, are compared. Participants are 174 students in higher…

Comparative Assessment of Two Vegetation Fractional Cover Estimating Methods and Their Impacts on Modeling Urban Latent Heat Flux Using Landsat Imagery

Directory of Open Access Journals (Sweden)

Kai Liu

2017-05-01

Full Text Available Quantifying vegetation fractional cover (VFC and assessing its role in heat fluxes modeling using medium resolution remotely sensed data has received less attention than it deserves in heterogeneous urban regions. This study examined two approaches (Normalized Difference Vegetation Index (NDVI-derived and Multiple Endmember Spectral Mixture Analysis (MESMA-derived methods that are commonly used to map VFC based on Landsat imagery, in modeling surface heat fluxes in urban landscape. For this purpose, two different heat flux models, Two-source energy balance (TSEB model and Pixel Component Arranging and Comparing Algorithm (PCACA model, were adopted for model evaluation and analysis. A comparative analysis of the NDVI-derived and MESMA-derived VFCs showed that the latter achieved more accurate estimates in complex urban regions. When the two sources of VFCs were used as inputs to both TSEB and PCACA models, MESMA-derived urban VFC produced more accurate urban heat fluxes (Bowen ratio and latent heat flux relative to NDVI-derived urban VFC. Moreover, our study demonstrated that Landsat imagery-retrieved VFC exhibited greater uncertainty in obtaining urban heat fluxes for the TSEB model than for the PCACA model.

Análisis de los componentes espectrales de la variabilidad cardíaca en hombres jóvenes entrenados: comparación del entrenamiento aeróbico y anaeróbico

OpenAIRE

Urbina, Adriana; Ortiz Guzmán, Johan Enrique; Mendoza Romero, Dario; Calderón, Carlos Alberto

2012-01-01

Introducción La variabilidad de la frecuencia cardíaca (VFC) permite estudiar de forma no invasiva la modulación autonómica de la función cardiovascular. Según el principio de especificidad del entrenamiento, cada tipo de ejercicio produce adaptaciones específicas. Sin embargo, no se ha establecido si este concepto también es aplicable a la VFC. El presente estudio tiene como objetivo comparar los componentes espectrales de la VFC en hombres jóvenes entrenados aeróbicamente y anaeróbicam...

Evaluating OO example programs for CS1

DEFF Research Database (Denmark)

Börstler, Jürgen; Christensen, Henrik Bærbak; Bennedsen, Jens

2008-01-01

Example programs play an important role in learning to program. They work as templates, guidelines, and inspiration for learners when developing their own programs. It is therefore important to provide learners with high quality examples. In this paper, we discuss properties of example programs...... that might affect the teaching and learning of object-oriented programming. Furthermore, we present an evaluation instrument for example programs and report on initial experiences of its application to a selection of examples from popular introductory programming textbooks....

An Introductory Interprofessional Exercise for Healthcare Students

Science.gov (United States)

Rege, Saumitra V.; Misto, Kara; Dollase, Richard; George, Paul

2012-01-01

Objective. To evaluate healthcare students’ perceptions of an introductory interprofessional exercise and their team dynamics. Design. A workshop was developed, combining second-year medical students, fourth-year nursing students, and third-year pharmacy students to work as an interdisciplinary team. The teams alternated between working together on patient cases focusing on chronic obstructive pulmonary disease and asthma, and on the evaluation of standardized pneumonia patients. Teams were given the patients' health information and no other instructions. A faculty member and the standardized patient evaluated the students using a teamwork global rating scale. Assessment. Student survey results showed a positive response to interprofessional teamwork. The faculty members and standardized patients reported that the students worked as a cohesive unit and demonstrated good team communication. Conclusions. This introductory interprofessional experience had a positive impact on the students’ understanding of collaboration and teamwork. This type of experience will help students foster future collaborations as healthcare providers. PMID:23129853

Progress in motion estimation for video format conversion

NARCIS (Netherlands)

Haan, de G.

2000-01-01

There are now two generations of ICs for motion-compensated video format conversion (MC-VFC). Real-time DSP software for MC-VFC has previously been demonstrated, with the breakthroughs enabling this progress coming from motion estimation. The paper gives an overview.

Teaching Health Care in Introductory Economics

Science.gov (United States)

Cutler, David M.

2017-01-01

Health care is one of the economy's biggest industries, so it is natural that the health care industry should play some role in the teaching of introductory economics. There are many ways that health care can appear in such a context: in the teaching of microeconomics, as a macroeconomic issue, to learn about social welfare, and even to learn how…

Personality types and student performance in an introductory physics course

Science.gov (United States)

Harlow, Jason J. B.; Harrison, David M.; Justason, Michael; Meyertholen, Andrew; Wilson, Brian

2017-12-01

We measured the personality type of the students in a large introductory physics course of mostly life science students using the True Colors instrument. We found large correlations of personality type with performance on the precourse Force Concept Inventory (FCI), both term tests, the postcourse FCI, and the final examination. We also saw correlations with the normalized gain on the FCI. The personality profile of the students in this course is very different from the profile of the physics faculty and graduate students, and also very different from the profile of students taking the introductory physics course intended for physics majors and specialists.

Improving Introductory Astronomy Education in American Colleges and Universities: A Review of Recent Progress

Science.gov (United States)

Waller, William H.; Slater, Timothy F.

2011-01-01

Over the past 15 years, professional astronomers, their societies, and associated funding agencies have collaborated to improve astronomy teaching and learning at the introductory undergraduate level. Many nonscience majors and preservice teachers enroll in these introductory astronomy courses, thus meriting the focused attention. In this review…

The Lasting Effects of Introductory Economics Courses.

Science.gov (United States)

Sanders, Philip

1980-01-01

Reports research which tests the Stigler Hypothesis. The hypothesis suggests that students who have taken introductory economics courses and those who have not show little difference in test performance five years after completing college. Results of the author's research illustrate that economics students do retain some knowledge of economics…

Beat the Instructor: An Introductory Forecasting Game

Science.gov (United States)

Snider, Brent R.; Eliasson, Janice B.

2013-01-01

This teaching brief describes a 30-minute game where student groups compete in-class in an introductory time-series forecasting exercise. The students are challenged to "beat the instructor" who competes using forecasting techniques that will be subsequently taught. All forecasts are graphed prior to revealing the randomly generated…

Holography and Introductory Science at Hampshire College.

Science.gov (United States)

Wirth, Frederick H.

1991-01-01

An introductory Natural Science course with a focus on the laboratory is described. The main function of the course is getting students prepared for required individual projects in science. A copy of the syllabus, a description of laboratory experiments, and the context of the course are included. (KR)

Teaching assistants’ performance at identifying common introductory student difficulties in mechanics revealed by the Force Concept Inventory

Directory of Open Access Journals (Sweden)

Alexandru Maries

2016-05-01

Full Text Available The Force Concept Inventory (FCI has been widely used to assess student understanding of introductory mechanics concepts by a variety of educators and physics education researchers. One reason for this extensive use is that many of the items on the FCI have strong distractor choices which correspond to students’ alternate conceptions in mechanics. Instruction is unlikely to be effective if instructors do not know the common alternate conceptions of introductory physics students and explicitly take into account students’ initial knowledge states in their instructional design. Here, we discuss research involving the FCI to evaluate one aspect of the pedagogical content knowledge of teaching assistants (TAs: knowledge of introductory student alternate conceptions in mechanics as revealed by the FCI. For each item on the FCI, the TAs were asked to identify the most common incorrect answer choice of introductory physics students. This exercise was followed by a class discussion with the TAs related to this task, including the importance of knowing student difficulties in teaching and learning. Then, we used FCI pretest and post-test data from a large population (∼900 of introductory physics students to assess the extent to which TAs were able to identify alternate conceptions of introductory students related to force and motion. In addition, we carried out think-aloud interviews with graduate students who had more than two semesters of teaching experience in recitations to examine how they reason about the task. We find that while the TAs, on average, performed better than random guessing at identifying introductory students’ difficulties with FCI content, they did not identify many common difficulties that introductory physics students have after traditional instruction. We discuss specific alternate conceptions, the extent to which TAs are able to identify them, and results from the think-aloud interviews that provided valuable information

Comparing Student Success and Understanding in Introductory Statistics under Consensus and Simulation-Based Curricula

Science.gov (United States)

Hldreth, Laura A.; Robison-Cox, Jim; Schmidt, Jade

2018-01-01

This study examines the transferability of results from previous studies of simulation-based curriculum in introductory statistics using data from 3,500 students enrolled in an introductory statistics course at Montana State University from fall 2013 through spring 2016. During this time, four different curricula, a traditional curriculum and…

Generating a Gender Balance: making introductory information systems courses a positive experience

Directory of Open Access Journals (Sweden)

Rosemary Stockdale

2007-12-01

Full Text Available There is a growing shortfall of graduates entering the IT profession. The situation is exacerbated by the continuing decline in the number of women undertaking IT related degrees. However, there are an increasing number of students taking business degrees that have a small information systems component, although few students choose to major in IS. Using a qualitative reflective approach we identify the perceptions and experiences of female undergraduates taking introductory IS courses in two universities, one in Australia and one in New Zealand. We discuss ways of improving the delivery of introductory IS courses in order to make information systems more interesting to women undergraduates, thus enhancing their learning experiences and encouraging further uptake of IS majors. The paper concludes with some reflections on other influences that impact on the ability of IS departments to deliver appropriate introductory courses.

The Case for Infusing Quantitative Literacy into Introductory Geoscience Courses

Directory of Open Access Journals (Sweden)

Jennifer M. Wenner

2009-01-01

Full Text Available We present the case for introductory geoscience courses as model venues for increasing the quantitative literacy (QL of large numbers of the college-educated population. The geosciences provide meaningful context for a number of fundamental mathematical concepts that are revisited several times in a single course. Using some best practices from the mathematics education community surrounding problem solving, calculus reform, pre-college mathematics and five geoscience/math workshops, geoscience and mathematics faculty have identified five pedagogical ideas to increase the QL of the students who populate introductory geoscience courses. These five ideas include techniques such as: place mathematical concepts in context, use multiple representations, use technology appropriately, work in groups, and do multiple-day, in-depth problems that place quantitative skills in multiple contexts. We discuss the pedagogical underpinnings of these five ideas and illustrate some ways that the geosciences represent ideal places to use these techniques. However, the inclusion of QL in introductory courses is often met with resistance at all levels. Faculty who wish to include quantitative content must use creative means to break down barriers of public perception of geoscience as qualitative, administrative worry that enrollments will drop and faculty resistance to change. Novel ways to infuse QL into geoscience classrooms include use of web-based resources, shadow courses, setting clear expectations, and promoting quantitative geoscience to the general public. In order to help faculty increase the QL of geoscience students, a community-built faculty-centered web resource (Teaching Quantitative Skills in the Geosciences houses multiple examples that implement the five best practices of QL throughout the geoscience curriculum. We direct faculty to three portions of the web resource: Teaching Quantitative Literacy, QL activities, and the 2006 workshop website

The Introductory College Business Course: A New Dimension

Science.gov (United States)

Podell, Joel; And Others

1977-01-01

Describes various methodologies used at the Queensboro Community College, New York, to enrich some of the topics traditionally included in the introductory course such as union management relations, social responsibility and business ethics, internal organization structure, and small business management. (TA)

Teaching Introductory Programming to IS Students: Java Problems and Pitfalls

Science.gov (United States)

Pendergast, Mark O.

2006-01-01

This paper examines the impact the use of the Java programming language has had on the way our students learn to program and the success they achieve. The importance of a properly constructed first course in programming cannot be overstated. A course well experienced will leave students with good programming habits, the ability to learn on their…

Pre-Service Physics Teachers' Opinions about the Difficulties in Understanding Introductory Quantum Physics Topics

Science.gov (United States)

Kizilcik, Hasan Sahin; Yavas, Pervin Ünlü

2017-01-01

The aim of this study is to identify the opinions of pre-service physics teachers about the difficulties in introductory quantum physics topics. In this study conducted with twenty-five pre-service physics teachers, the case study method was used. The participants were interviewed about introductory quantum physics topics. The interviews were…

Variabilidad de la frecuencia cardíaca como indicador de salud en el deporte: validación con un cuestionario de calidad de vida (SF-12)

OpenAIRE

Capdevila Ortís, Lluís; Rodas Font, Gil; Ocaña Mariné, Marta; Parrado Romero, Eva; Pintanel Bassets, Mónica; Valero Herreros, Montserrat

2008-01-01

Introducción y objetivo: El análisis de la variabilidad de la frecuencia cardíaca (VFC) se utiliza cada vez más en el ámbito de la medicina del deporte para evaluar la adaptación al entrenamiento de los deportistas. Nuestro objetivo es validar el análisis de la VFC como indicador de salud, comparando los parámetros de VFC con las puntuaciones del SF-12 en una muestra de personas sanas. Método: Estudio experimental con 32 sujetos sanos, 18 varones y 14 mujeres (26,19 años de promedio). Se util...

Black Holes and Pulsars in the Introductory Physics Course

Science.gov (United States)

Orear, Jay; Salpeter, E. E.

1973-01-01

Discusses the phenomenon of formation of white dwarfs, neutron stars, and black holes from dying stars for the purpose of providing college teachers with materials usable in the introductory physics course. (CC)

Cultural Diversity in Introductory Psychology Textbook Selection: The Case for Historically Black Colleges/Universities (HBCUs)

Science.gov (United States)

Whaley, Arthur L.; Clay, William A. L.; Broussard, Dominique

2017-01-01

The present study describes a culturally relevant approach to introductory psychology textbook selection for students attending a historically Black college/university (HBCU). The following multistage procedure was used: (1) a survey of HBCU psychology departments was conducted to ascertain how they selected their introductory psychology…

Effects of Team Teaching on Students Performance in Introductory ...

African Journals Online (AJOL)

FIRST LADY

Students taught. Introductory Technology through team teaching approach performed ... Vocational education differs in both concept and status in different nations of ... completion of the course, can carry out simple daily maintenance of motor.

77 FR 68834 - Proposed Exemptions From Certain Prohibited Transaction Restrictions

Science.gov (United States)

2012-11-16

..., Studley, Inc. Section 401(k) Plan Profit Sharing Plan (the Plan); and D-11724, EquiLend Holdings LLC (Equi..., 2011, UBS AG had invested assets of 2,167 billion CHF. 2. From January 4, 2002, to December 9, 2005... the ``Restoration of Profits,'' as described in Section 5(b) of the VFC Program, provided, that, an...

Rural and Urban Youth Programs.

Science.gov (United States)

Backman, Kenneth; And Others

This publication provides a variety of information on prevention and intervention programs for rural and urban children and adolescents. Drawing from a rural sociological perspective, the introductory paper defines "rural," discusses rural-urban economic and social differences, and lists indicators of risk for rural youth. It discusses the extent…

The Effect of "Clickers" on Attendance in an Introductory Statistics Course: An Action Research Study

Science.gov (United States)

Amstelveen, Raoul H.

2013-01-01

The purpose of this study was to design and implement a Classroom Response System, also known as a "clicker," to increase attendance in introductory statistics courses at an undergraduate university. Since 2010, non-attendance had been prevalent in introductory statistics courses. Moreover, non-attendance created undesirable classrooms…

Active Learning by Design: An Undergraduate Introductory Public Health Course

Directory of Open Access Journals (Sweden)

Karin eYeatts

2014-12-01

Full Text Available Principles of active learning were used to design and implement an introductory public health course. Students were introduced to the breadth and practice of public health through team and individual-based activities. Team assignments covered topics in epidemiology, biostatistics, health behavior, nutrition, maternal and child health, environment, and health policy. Students developed an appreciation of the population perspective through an experience trip and related intervention project in a public health area of their choice. Students experienced several key critical component elements of a public health undergraduate major; they cover key public health domains, experience public health practice, and integrated concepts with their assignments. In this paper, course assignments, lessons learned, and student successes are described. Given the increased growth in the undergraduate public health major, these active learning assignments may be of interest to undergraduate public health programs at both liberal arts colleges and research universities.

An Infiltration Exercise for Introductory Soil Science

Science.gov (United States)

Barbarick, K. A.; Ippolito, J. A.; Butters, G.; Sorge, G. M.

2005-01-01

One of the largest challenges in teaching introductory soil science is explaining the dynamics of soil infiltration. To aid students in understanding the concept and to further engage them in active learning in the soils laboratory course, we developed an exercise using Decagon Mini-Disk Infiltrometers with a tension head (h[subscript o]) of 2 cm.…

A Case-Based Curriculum for Introductory Geology

Science.gov (United States)

Goldsmith, David W.

2011-01-01

For the past 5 years I have been teaching my introductory geology class using a case-based method that promotes student engagement and inquiry. This article presents an explanation of how a case-based curriculum differs from a more traditional approach to the material. It also presents a statistical analysis of several years' worth of student…

Introductory statistics and random phenomena uncertainty, complexity and chaotic behavior in engineering and science

CERN Document Server

Denker, Manfred

2017-01-01

Introductory Statistics and Random Phenomena integrates traditional statistical data analysis with new computational experimentation capabilities and concepts of algorithmic complexity and chaotic behavior in nonlinear dynamic systems.  This was the first advanced text/reference to bring together such a comprehensive variety of tools for the study of random phenomena occurring in engineering and the natural, life, and social sciences. The crucial computer experiments are conducted using the readily available computer program Mathematica® Uncertain Virtual Worlds™ software packages which optimize and facilitate the simulation environment.  Brief tutorials are included that explain how to use theMathematica® programs for effective simulation and computer experiments.  Large and original real-life data sets are introduced and analyzed as a model for independent study. This is an excellent classroom tool and self-study guide.  The material is presented in a clear and accessible style providing numerous...

Contrasting Grading Approaches in Introductory Physics and Quantum Mechanics: The Case of Graduate Teaching Assistants

Science.gov (United States)

Marshman, Emily; Sayer, Ryan; Henderson, Charles; Singh, Chandralekha

2017-01-01

At large research universities, physics graduate teaching assistants (TAs) are often responsible for grading in courses at all levels. However, few studies have focused on TAs' grading practices in introductory and advanced physics courses. This study was designed to investigate whether physics graduate TAs grade students in introductory physics…

Research and Teaching: From Gatekeeper to Gateway: Improving Student Success in an Introductory Biology Course

Science.gov (United States)

Scott, Amy N.; McNair, Delores E.; Lucas, Jonathan C.; Land, Kirkwood M.

2017-01-01

Introductory science, math, and engineering courses often have problems related to student engagement, achievement, and course completion. To begin examining these issues in greater depth, this pilot study compared student engagement, achievement, and course completion in a small and large section of an introductory biology class. Results based on…

Simulator program as a form of implementation of electronic teaching tools for self-study of foreign students at the stage of pre-university training

Directory of Open Access Journals (Sweden)

Andriy O. Savel'ev

2015-06-01

Full Text Available Questions of empowerment the organization of classroom and extracurricular self-study of foreign students at the stage of pre-university training through the implementation of electronic teaching tools as a component of computer training facilities in educational process are considered. Classification of modern electronic teaching tools as a component of computer hardware training, developed on the basis of modern information and communication technologies is offered. Version of program-simulator "Introductory course" is offered. The program is created by means of WEB-programming and uses training material of introductory course. Introductory course is one of the most important elements of teaching of scientific style of speech within the language training for the foreign students at the preparatory faculty.

Introductory Life Science Mathematics and Quantitative Neuroscience Courses

Science.gov (United States)

Duffus, Dwight; Olifer, Andrei

2010-01-01

We describe two sets of courses designed to enhance the mathematical, statistical, and computational training of life science undergraduates at Emory College. The first course is an introductory sequence in differential and integral calculus, modeling with differential equations, probability, and inferential statistics. The second is an…

Does the Choice of Introductory Microeconomics Textbook Matter?

Science.gov (United States)

Pyne, Derek

2007-01-01

The author examines the effects of different introductory microeconomics textbooks on student performance in subsequent economics courses (specifically, Intermediate Microeconomics I and Money and Banking). In some cases, the effects are significant and sizeable. There is also evidence of other variables affecting student performance in later…

Introductory Statistics Education and the National Science Foundation

Science.gov (United States)

Hall, Megan R.; Rowell, Ginger Holmes

2008-01-01

This paper describes 27 National Science Foundation supported grant projects that have innovations designed to improve teaching and learning in introductory statistics courses. The characteristics of these projects are compared with the six recommendations given in the "Guidelines for Assessment and Instruction in Statistics Education (GAISE)…

Evaluation of a flipped classroom approach to learning introductory epidemiology.

Science.gov (United States)

Shiau, Stephanie; Kahn, Linda G; Platt, Jonathan; Li, Chihua; Guzman, Jason T; Kornhauser, Zachary G; Keyes, Katherine M; Martins, Silvia S

2018-04-02

Although the flipped classroom model has been widely adopted in medical education, reports on its use in graduate-level public health programs are limited. This study describes the design, implementation, and evaluation of a flipped classroom redesign of an introductory epidemiology course and compares it to a traditional model. One hundred fifty Masters-level students enrolled in an introductory epidemiology course with a traditional format (in-person lecture and discussion section, at-home assignment; 2015, N = 72) and a flipped classroom format (at-home lecture, in-person discussion section and assignment; 2016, N = 78). Using mixed methods, we compared student characteristics, examination scores, and end-of-course evaluations of the 2016 flipped classroom format and the 2015 traditional format. Data on the flipped classroom format, including pre- and post-course surveys, open-ended questions, self-reports of section leader teaching practices, and classroom observations, were evaluated. There were no statistically significant differences in examination scores or students' assessment of the course between 2015 (traditional) and 2016 (flipped). In 2016, 57.1% (36) of respondents to the end-of-course evaluation found watching video lectures at home to have a positive impact on their time management. Open-ended survey responses indicated a number of strengths of the flipped classroom approach, including the freedom to watch pre-recorded lectures at any time and the ability of section leaders to clarify targeted concepts. Suggestions for improvement focused on ways to increase regular interaction with lecturers. There was no significant difference in students' performance on quantitative assessments comparing the traditional format to the flipped classroom format. The flipped format did allow for greater flexibility and applied learning opportunities at home and during discussion sections.

From Procedural to Object-Oriented Programming (OOP- Performance in OOP: An empirical study

Directory of Open Access Journals (Sweden)

Irene Govender

2011-02-01

Full Text Available This exploratory study of introductory pre- and in-service teachers’ performance in object-oriented programming (OOP assessments reveals important issues with regard to learning and teaching OOP, using java. The study is set against the backdrop of the country’s transition of its national IT curriculum from a procedural to an object-oriented programming language. The effect of prior programming experience and performances in different types of questions are examined. A combination of quantitative and qualitative methods is used to analyse the data. The effect of prior programming experience of a procedural kind and the type of assessments given is shown to have a marked influence on the performance in programming assessments and teaching of OOP. Many introductory OOP courses are in effect taught procedurally as courses in the small. Therefore educating teachers how to teach programming is a significant educational challenge. Some implications for teaching are therefore suggested

Incentive Matters!--The Benefit of Reminding Students about Their Academic Standing in Introductory Economics Courses

Science.gov (United States)

Chen, Qihui; Okediji, Tade O.

2014-01-01

In this article, the authors illustrate how incentives can improve student performance in introductory economics courses. They implemented a policy experiment in a large introductory economics class in which they reminded students who scored below an announced cutoff score on the midterm exam about the risk of failing the course. The authors…

Student Understanding of Gravity in Introductory College Astronomy

Science.gov (United States)

Williamson, Kathryn E.; Willoughby, Shannon

2012-01-01

Twenty-four free-response questions were developed to explore introductory college astronomy students' understanding of gravity in a variety of contexts, including in and around Earth, throughout the solar system, and in hypothetical situations. Questions were separated into three questionnaires, each of which was given to a section of…

The European Public Prosecutor's Office (EPPO): Introductory Remarks

NARCIS (Netherlands)

Vervaele, J.A.E.

2018-01-01

These introductory remarks deal with the reasons why the EPPO is perceived by some as a controversial body. These reasons are mirrored with the problem identification and the causes thereof. The size of EU fraud and related corruption and money laundering, both at the income and expenditure side, is

Introductory Level Problems Illustrating Concepts in Pharmaceutical Engineering

Science.gov (United States)

McIver, Keith; Whitaker, Kathryn; De Delva, Vladimir; Farrell, Stephanie; Savelski, Mariano J.; Slater, C. Stewart

2012-01-01

Textbook style problems including detailed solutions introducing pharmaceutical topics at the level of an introductory chemical engineering course have been created. The problems illustrate and teach subjects which students would learn if they were to pursue a career in pharmaceutical engineering, including the unique terminology of the field,…

Implementation and Results of a Learning Assistant Program

Science.gov (United States)

Bogue, Thomas B.; Seeley, L.; Vokos, S.

2006-12-01

The Physics Department at Seattle Pacific University has recently completed a three-year CCLI grant to integrate Tutorials in Introductory Physics , Activity Based Physics , and Real Time Physics into our one-year introductory curriculum. One of the difficulties encountered in doing this at a small undergraduate university was the need for additional instructors. This need is met through the use of undergraduate learning assistants. The development of recruitment and implementation methods will be discussed, along with the advantages to physics education, and the challenges encountered. We will also discuss several strategies we have identified as critical to a successful learning assistant program.

P3T+: A Performance Estimator for Distributed and Parallel Programs

Directory of Open Access Journals (Sweden)

T. Fahringer

2000-01-01

Full Text Available Developing distributed and parallel programs on today's multiprocessor architectures is still a challenging task. Particular distressing is the lack of effective performance tools that support the programmer in evaluating changes in code, problem and machine sizes, and target architectures. In this paper we introduce P3T+ which is a performance estimator for mostly regular HPF (High Performance Fortran programs but partially covers also message passing programs (MPI. P3T+ is unique by modeling programs, compiler code transformations, and parallel and distributed architectures. It computes at compile-time a variety of performance parameters including work distribution, number of transfers, amount of data transferred, transfer times, computation times, and number of cache misses. Several novel technologies are employed to compute these parameters: loop iteration spaces, array access patterns, and data distributions are modeled by employing highly effective symbolic analysis. Communication is estimated by simulating the behavior of a communication library used by the underlying compiler. Computation times are predicted through pre-measured kernels on every target architecture of interest. We carefully model most critical architecture specific factors such as cache lines sizes, number of cache lines available, startup times, message transfer time per byte, etc. P3T+ has been implemented and is closely integrated with the Vienna High Performance Compiler (VFC to support programmers develop parallel and distributed applications. Experimental results for realistic kernel codes taken from real-world applications are presented to demonstrate both accuracy and usefulness of P3T+.

First order error corrections in common introductory physics experiments

Science.gov (United States)

Beckey, Jacob; Baker, Andrew; Aravind, Vasudeva; Clarion Team

As a part of introductory physics courses, students perform different standard lab experiments. Almost all of these experiments are prone to errors owing to factors like friction, misalignment of equipment, air drag, etc. Usually these types of errors are ignored by students and not much thought is paid to the source of these errors. However, paying attention to these factors that give rise to errors help students make better physics models and understand physical phenomena behind experiments in more detail. In this work, we explore common causes of errors in introductory physics experiment and suggest changes that will mitigate the errors, or suggest models that take the sources of these errors into consideration. This work helps students build better and refined physical models and understand physics concepts in greater detail. We thank Clarion University undergraduate student grant for financial support involving this project.

Evolution of Student Knowledge in a Traditional Introductory Classroom

Science.gov (United States)

Sayre, Eleanor C.; Heckler, Andrew F.

2008-10-01

In the physics education research community, a common format for evaluation is pre- and post-tests. In this study, we collect student test data many times throughout a course, allowing for the measurement of the changes of student knowledge with a time resolution on the order of a few days. The data cover the first two quarters (mechanics, E&M) of a calculus-based introductory sequence populated primarily by first- and second-year engineering majors. To avoid the possibility of test-retest effects, separate and quasi-random subpopulations of students are evaluated every week of the quarter on a variety of tasks. Unsurprisingly for a traditional introductory course, there is little change on many conceptual questions. However, the data suggest that some student ideas peak and decay rapidly during a quarter, a pattern consistent with memory research yet unmeasurable by pre-/post-testing.

Toward equity through participation in Modeling Instruction in introductory university physics

Science.gov (United States)

Brewe, Eric; Sawtelle, Vashti; Kramer, Laird H.; O'Brien, George E.; Rodriguez, Idaykis; Pamelá, Priscilla

2010-06-01

We report the results of a five year evaluation of the reform of introductory calculus-based physics by implementation of Modeling Instruction (MI) at Florida International University (FIU), a Hispanic-serving institution. MI is described in the context of FIU’s overall effort to enhance student participation in physics and science broadly. Our analysis of MI from a “participationist” perspective on learning identifies aspects of MI including conceptually based instruction, culturally sensitive instruction, and cooperative group learning, which are consistent with research on supporting equitable learning and participation by students historically under-represented in physics (i.e., Black, Hispanic, women). This study uses markers of conceptual understanding as measured by the Force Concept Inventory (FCI) and odds of success as measured by the ratio of students completing introductory physics and earning a passing grade (i.e., C- or better) by students historically under-represented in physics to reflect equity and participation in introductory physics. FCI pre and post scores for students in MI are compared with lecture-format taught students. Modeling Instruction students outperform students taught in lecture-format classes on post instruction FCI (61.9% vs 47.9%, p<0.001 ), where these benefits are seen across both ethnic and gender comparisons. In addition, we report that the odds of success in MI are 6.73 times greater than in lecture instruction. Both odds of success and FCI scores within Modeling Instruction are further disaggregated by ethnicity and by gender to address the question of equity within the treatment. The results of this disaggregation indicate that although ethnically under-represented students enter with lower overall conceptual understanding scores, the gap is not widened during introductory physics but instead is maintained, and the odds of success for under-represented students is not different from majority students. Women

Toward equity through participation in Modeling Instruction in introductory university physics

Directory of Open Access Journals (Sweden)

Eric Brewe

2010-05-01

Full Text Available We report the results of a five year evaluation of the reform of introductory calculus-based physics by implementation of Modeling Instruction (MI at Florida International University (FIU, a Hispanic-serving institution. MI is described in the context of FIU’s overall effort to enhance student participation in physics and science broadly. Our analysis of MI from a “participationist” perspective on learning identifies aspects of MI including conceptually based instruction, culturally sensitive instruction, and cooperative group learning, which are consistent with research on supporting equitable learning and participation by students historically under-represented in physics (i.e., Black, Hispanic, women. This study uses markers of conceptual understanding as measured by the Force Concept Inventory (FCI and odds of success as measured by the ratio of students completing introductory physics and earning a passing grade (i.e., C− or better by students historically under-represented in physics to reflect equity and participation in introductory physics. FCI pre and post scores for students in MI are compared with lecture-format taught students. Modeling Instruction students outperform students taught in lecture-format classes on post instruction FCI (61.9% vs 47.9%, p<0.001, where these benefits are seen across both ethnic and gender comparisons. In addition, we report that the odds of success in MI are 6.73 times greater than in lecture instruction. Both odds of success and FCI scores within Modeling Instruction are further disaggregated by ethnicity and by gender to address the question of equity within the treatment. The results of this disaggregation indicate that although ethnically under-represented students enter with lower overall conceptual understanding scores, the gap is not widened during introductory physics but instead is maintained, and the odds of success for under-represented students is not different from majority students

Mediating relationship of differential products in understanding integration in introductory physics

Science.gov (United States)

Amos, Nathaniel; Heckler, Andrew F.

2018-01-01

In the context of introductory physics, we study student conceptual understanding of differentials, differential products, and integrals and possible pathways to understanding these quantities. We developed a multiple choice conceptual assessment employing a variety of physical contexts probing physical understanding of these three quantities and administered the instrument to over 1000 students in first and second semester introductory physics courses. Using a regression-based mediation analysis with conceptual understanding of integration as the dependent variable, we found evidence consistent with a simple mediation model: the relationship between differentials scores and integral scores may be mediated by the understanding of differential products. The indirect effect (a quantifiable metric of mediation) was estimated as a b =0.29 , 95% CI [0.25, 0.33] for N =1102 Physics 1 students, and a b =0.27 , 95% CI [0.14, 0.48] for N =65 Physics 2 students. We also find evidence that the physical context of the questions can be an important factor. These results imply that for introductory physics courses, instructional emphasis first on differentials then on differential products in a variety of contexts may in turn promote better integral understanding.

Measuring the impact of an instructional laboratory on the learning of introductory physics

OpenAIRE

Wieman, Carl; Holmes, N. G.

2015-01-01

We have analyzed the impact of taking an associated lab course on the scores on final exam questions in two large introductory physics courses. Approximately a third of the students who completed each course also took an accompanying instructional lab course. The lab courses were fairly conventional, although they focused on supporting the mastery of a subset of the introductory physics topics covered in the associated course. Performance between students who did and did not take the lab cour...

Excerpts from the introductory statement. IAEA Board of Governors. Vienna, 18 March 2002

International Nuclear Information System (INIS)

ElBaradei, M.

2002-01-01

Excerpts are given from the Introductory Statement to the Board of Governors by the IAEA Director General Dr. Mohamed ElBaradei. Major topics covered in his introductory remarks include: protection against terrorism, nuclear technology, water resource management, application of sterile insect technique, human health, nuclear power, radioactive waste management, management of nuclear knowledge, nuclear safety, safety of radioactive sources, safeguards agreements and additional protocols, conceptual framework for integrated safeguards, Democratic People's Republic of Korea, and Iraq

Just the facts? Introductory undergraduate biology courses focus on low-level cognitive skills.

Science.gov (United States)

Momsen, Jennifer L; Long, Tammy M; Wyse, Sara A; Ebert-May, Diane

2010-01-01

Introductory biology courses are widely criticized for overemphasizing details and rote memorization of facts. Data to support such claims, however, are surprisingly scarce. We sought to determine whether this claim was evidence-based. To do so we quantified the cognitive level of learning targeted by faculty in introductory-level biology courses. We used Bloom's Taxonomy of Educational Objectives to assign cognitive learning levels to course goals as articulated on syllabi and individual items on high-stakes assessments (i.e., exams and quizzes). Our investigation revealed the following: 1) assessment items overwhelmingly targeted lower cognitive levels, 2) the cognitive level of articulated course goals was not predictive of the cognitive level of assessment items, and 3) there was no influence of course size or institution type on the cognitive levels of assessments. These results support the claim that introductory biology courses emphasize facts more than higher-order thinking.

The role of applied physics in American introductory physics courses

Science.gov (United States)

Poduska, Ervin L.; Lunetta, Vincent N.

1984-09-01

To what extent should technology and applied physics be included in introductory physics courses? What is the proper balance between pure and applied physics? Should physics teachers devote precious time to socially relevant issues like nuclear power and alternative sources of energy? How much time should be spent, if any, on applications that are more relevant to the student's world like cars, music, television and refrigeration? Does including applications reduce or enhance student understanding of important classical topics? A response to these questions must be based on goals for physics teaching, on knowledge of how students learn and on the nature of the physics discipline. Since there is not enough time to teach everything in an introductory course, priorities must be determined.

Teaching Introductory Weather and Climate Using Popular Movies

Science.gov (United States)

Yow, Donald M.

2014-01-01

Addressing the need for an introductory atmospheric science course for nonscience majors, a course was developed that provides a general understanding of atmospheric processes by examining how meteorological events are portrayed in movies. The course also uses films to study the causes of, impacts associated with, and potential adaptations to…

Rhetorical Analysis as Introductory Speech: Jumpstarting Student Engagement

Science.gov (United States)

Malone, Marc P.

2012-01-01

When students enter the basic public speaking classroom,When students enter the basic public speaking classroom, they are asked to develop an introductory speech. This assignment typically focuses on a speech of self-introduction for which there are several pedagogical underpinnings: it provides an immediate and relatively stress-free speaking…

The Effect of Vocabulary on Introductory Microbiology Instruction

Science.gov (United States)

Richter, Emily

2011-01-01

This study examines the effect of the translation of traditional scientific vocabulary into plain English, a process referred to as Anglicization, on student learning in the context of introductory microbiology instruction. Data from Anglicized and Classical-vocabulary lab sections were collected. Data included exam scores as well as pre and…

Assessing Expertise in Introductory Physics Using Categorization Task

Science.gov (United States)

Mason, Andrew; Singh, Chandralekha

2011-01-01

The ability to categorize problems based upon underlying principles, rather than surface features or contexts, is considered one of several proxy predictors of expertise in problem solving. With inspiration from the classic study by Chi, Feltovich, and Glaser, we assess the distribution of expertise among introductory physics students by asking…

Learning Styles and Student Performance in Introductory Economics

Science.gov (United States)

Brunton, Bruce

2015-01-01

Data from nine introductory microeconomics classes was used to test the effect of student learning style on academic performance. The Kolb Learning Style Inventory was used to assess individual student learning styles. The results indicate that student learning style has no significant effect on performance, undermining the claims of those who…

Computer Self-Efficacy: A Practical Indicator of Student Computer Competency in Introductory IS Courses

Directory of Open Access Journals (Sweden)

Rex Karsten

1998-01-01

Full Text Available Students often receive their first college-level computer training in introductory information systems courses. Students and faculty frequently expect this training to develop a level of student computer competence that will support computer use in future courses. In this study, we applied measures of computer self-efficacy to students in a typical introductory IS course. The measures provided useful evidence that student perceptions of their ability to use computers effectively in the future significantly improved as a result of their training experience. The computer self-efficacy measures also provided enhanced insight into course-related factors of practical concern to IS educators. Study results also suggest computer self-efficacy measures may be a practical and informative means of assessing computer-training outcomes in the introductory IS course context

Computer-Tailored Student Support in Introductory Physics

Science.gov (United States)

Huberth, Madeline; Chen, Patricia; Tritz, Jared; McKay, Timothy A.

2015-01-01

Large introductory courses are at a disadvantage in providing personalized guidance and advice for students during the semester. We introduce E2Coach (an Expert Electronic Coaching system), which allows instructors to personalize their communication with thousands of students. We describe the E2Coach system, the nature of the personalized support it provides, and the features of the students who did (and did not) opt-in to using it during the first three terms of its use in four introductory physics courses at the University of Michigan. Defining a ‘better-than-expected’ measure of performance, we compare outcomes for students who used E2Coach to those who did not. We found that moderate and high E2Coach usage was associated with improved performance. This performance boost was prominent among high users, who improved by 0.18 letter grades on average when compared to nonusers with similar incoming GPAs. This improvement in performance was comparable across both genders. E2Coach represents one way to use technology to personalize education at scale, contributing to the move towards individualized learning that is becoming more attainable in the 21st century. PMID:26352403

Computer-Tailored Student Support in Introductory Physics.

Science.gov (United States)

Huberth, Madeline; Chen, Patricia; Tritz, Jared; McKay, Timothy A

2015-01-01

Large introductory courses are at a disadvantage in providing personalized guidance and advice for students during the semester. We introduce E2Coach (an Expert Electronic Coaching system), which allows instructors to personalize their communication with thousands of students. We describe the E2Coach system, the nature of the personalized support it provides, and the features of the students who did (and did not) opt-in to using it during the first three terms of its use in four introductory physics courses at the University of Michigan. Defining a 'better-than-expected' measure of performance, we compare outcomes for students who used E2Coach to those who did not. We found that moderate and high E2Coach usage was associated with improved performance. This performance boost was prominent among high users, who improved by 0.18 letter grades on average when compared to nonusers with similar incoming GPAs. This improvement in performance was comparable across both genders. E2Coach represents one way to use technology to personalize education at scale, contributing to the move towards individualized learning that is becoming more attainable in the 21st century.

Lecturers' Perspectives on How Introductory Economic Courses Address Sustainability

Science.gov (United States)

Green, Tom L.

2015-01-01

Purpose: The purpose of this article is to explore sustainability commitments' potential implications for the curriculum of introductory economics courses. Universities have signed the Talloires Declaration, committing themselves to promoting students' environmental literacy and ecological citizenship, thereby creating pressure to integrate…

Impact of a visual programming experience on the attitude toward programming of introductory undergraduate students

Science.gov (United States)

Godbole, Saurabh

Traditionally, textual tools have been utilized to teach basic programming languages and paradigms. Research has shown that students tend to be visual learners. Using flowcharts, students can quickly understand the logic of their programs and visualize the flow of commands in the algorithm. Moreover, applying programming to physical systems through the use of a microcontroller to facilitate this type of learning can spark an interest in students to advance their programming knowledge to create novel applications. This study examined if freshmen college students' attitudes towards programming changed after completing a graphical programming lesson. Various attributes about students' attitudes were examined including confidence, interest, stereotypes, and their belief in the usefulness of acquiring programming skills. The study found that there were no statistically significant differences in attitudes either immediately following the session or after a period of four weeks.

Peer Tutoring in Programming: Lessons Learned

Science.gov (United States)

Gerhardt, Jill; Olan, Michael

2010-01-01

This article describes our experience with peer tutoring in introductory programming courses. This tutoring concept was one of the integral support services out of five student services, which were part of a National Science Foundation Grant, designed to improve education, increase retention, improve professional development and employability, and…

The Development of Curricular Guidelines for Introductory Microbiology that Focus on Understanding

Directory of Open Access Journals (Sweden)

Susan Merkel

2012-02-01

Full Text Available The number of students who leave majors in science, technology, engineering, and mathematics (STEM due to a perception that courses are poorly taught is evidence that education reform in STEM is overdue. Despite decades of research that argues for student-centered teaching approaches, most introductory STEM courses are still taught in the large lecture format, focusing on rote memorization. While individual efforts in STEM educational reform are important, solutions will most certainly need to include institutional and cultural change. In biology, numerous national reports have called for educational reform to better prepare future scientists. We describe here a new, concept-based curriculum for Introductory Microbiology courses, designed to promote deep understanding of core concepts. Supported by the American Society for Microbiology (ASM and based on the overarching concepts and competencies presented in the AAAS/NSF report Vision and Change in Undergraduate Biology Education: A Call to Action, we hope it will empower instructors to adapt student-centered approaches so that students in Introductory Microbiology courses can leave the course with a core set of enduring understandings of microbiology.

The Development of Curricular Guidelines for Introductory Microbiology that Focus on Understanding.

Science.gov (United States)

Merkel, Susan

2012-01-01

The number of students who leave majors in science, technology, engineering, and mathematics (STEM) due to a perception that courses are poorly taught is evidence that education reform in STEM is overdue. Despite decades of research that argues for student-centered teaching approaches, most introductory STEM courses are still taught in the large lecture format, focusing on rote memorization. While individual efforts in STEM educational reform are important, solutions will most certainly need to include institutional and cultural change. In biology, numerous national reports have called for educational reform to better prepare future scientists. We describe here a new, concept-based curriculum for Introductory Microbiology courses, designed to promote deep understanding of core concepts. Supported by the American Society for Microbiology (ASM) and based on the overarching concepts and competencies presented in the AAAS/NSF report Vision and Change in Undergraduate Biology Education: A Call to Action, we hope it will empower instructors to adapt student-centered approaches so that students in Introductory Microbiology courses can leave the course with a core set of enduring understandings of microbiology.

Fundamentals of Aerospace Engineering: An introductory course to aeronautical engineering

OpenAIRE

Soler, Manuel

2014-01-01

Fundamentals of Aerospace Engineering is a text book that provides an introductory, thorough overview of aeronautical engineering, and it is aimed at serving as reference for an undergraduate course on aerospace engineering.

Introductory Psychology Textbooks: An Objective Analysis and Update.

Science.gov (United States)

Griggs, Richard A.; Jackson, Sherri L.; Christopher, Andrew N.; Marek, Pam

1999-01-01

Explores changes in the introductory psychology textbook market through an analysis of edition, author, length, and content coverage of the volumes that comprise the current market. Finds a higher edition average, a decrease in the number of authors, an increase in text pages, and a focus on developmental psychology and sensation/perception. (CMK)

[Economics] Introductory Lesson (Begin Day One). Lesson Plan.

Science.gov (United States)

Lewin, Roland

This introductory lesson on teaching economics concepts contains sections on the following: purpose; objectives; time; materials needed; and step-by-step classroom procedures. The focus is on the economic problem of scarcity and opportunity costs. Attached is an original skit, "There's no such thing as a free lunch," and a chart that…

Introducing the Cloud in an Introductory IT Course

Science.gov (United States)

Woods, David M.

2018-01-01

Cloud computing is a rapidly emerging topic, but should it be included in an introductory IT course? The magnitude of cloud computing use, especially cloud infrastructure, along with students' limited knowledge of the topic support adding cloud content to the IT curriculum. There are several arguments that support including cloud computing in an…

Using R for introductory statistics

CERN Document Server

Verzani, John

2014-01-01

The second edition of a bestselling textbook, Using R for Introductory Statistics guides students through the basics of R, helping them overcome the sometimes steep learning curve. The author does this by breaking the material down into small, task-oriented steps. The second edition maintains the features that made the first edition so popular, while updating data, examples, and changes to R in line with the current version.See What's New in the Second Edition:Increased emphasis on more idiomatic R provides a grounding in the functionality of base R.Discussions of the use of RStudio helps new

Whatever Happened to Richard Reid's List of First Programming Languages?

Science.gov (United States)

Siegfried, Robert M.; Greco, Daniel M.; Miceli, Nicholas G.; Siegfried, Jason P.

2012-01-01

Throughout the 1990s, Richard Reid of Michigan State University maintained a list showing the first programming language used in introductory programming courses taken by computer science and information systems majors; it was updated for several years afterwards by Frances Van Scoy of West Virginia University. However, it has been 5 years since…

Introductory Physics Gender Gaps: Pre- and Post-Studio Transition

Science.gov (United States)

Kohl, Patrick B.; Kuo, H. Vincent

2009-11-01

Prior work has characterized the gender gaps present in college-level introductory physics courses. Such work has also shown that research-based interactive engagement techniques can reduce or eliminate these gender gaps. In this paper, we study the gender gaps (and lack thereof) in the introductory calculus-based electricity and magnetism course at the Colorado School of Mines. We present eight semesters' worth of data, totaling 2577 students, with four semesters preceding a transition to Studio physics, and four following. We examine gender gaps in course grades, DFW (D grade, fail, or withdrawal) rates, and normalized gains on the Conceptual Survey of Electricity and Magnetism (CSEM), and consider factors such as student ACT scores and grades in prior math classes. We find little or no gap in male/female course grades and DFW rates, but substantial gaps in CSEM gains that are reduced somewhat by the transition to Studio physics.

FPGA and Software Design for the Qualification and Automated tests for the production of CERN Digital Acquisition Boards

CERN Document Server

Laroussi, H; Lefevre, T; Degeest, A; Garcia, S; Tichon, J

The VFC-HPC is an FPGA-based multipurpose board designed to be the new standard back-end for the Beam Instrumentation (BI) Group. This contribution is aimed to give a presentation of the test and qualification system designed to be used to verify the compliance of the VFC-HPC to the specifications. We will begin by presenting the CERN, the company, its main purpose and its brief history. Afterward, we will present the VFC-HPC, the purpose of this board and its mains characteristics. We will then focus on the work done to allow the test and qualification of the VFC-HPC. This project was focused on the test and qualification of the connectivity of the board, consisting of the FMC Connector and the SFPs. This work involved making several market surveys to choose the proper test components to be used (as FMC Mezzanines), setting up a test bench, implementing optical communications through SFPs, writing Verilog firmwares, writing software test routines in Python and measuring Bit Error Rates (BER) and eye diagrams...

Promoting Success in the Physical Sciences: The University of Wisconsin's Physics Learning Program

Science.gov (United States)

Nossal, S. M.; Jacob, A. T.

2002-05-01

The Physics Learning Program at the University of Wisconsin-Madison provides small group, academic and mentoring support for students enrolled in algebra-based introductory physics courses. Those students accepted into our program are potentially at-risk academically in their physics course or for feeling isolated at the University. They include, among others, students who have not taken high school physics, returning adults, minority students, students with disabilities, and students with English as a second language. A core component of the program is the peer-lead teaching and mentoring groups that match upper level undergraduate physics majors with students potentially at-risk in introductory physics. The tutors receive ongoing training and supervision throughout the year. The program has expanded over the years to include staff tutors, the majority of whom are scientists who seek additional teaching experience. The Physics Peer Mentor Tutor Program is run in collaboration with a similar chemistry program at the University of Wisconsin's Chemistry Learning Center. We will describe our Physics Learning Programs and discuss some of the challenges, successes, and strategies used to work with our tutors and students.

Implementing New Reform Guidelines in Teaching Introductory College Statistics Courses

Science.gov (United States)

Everson, Michelle; Zieffler, Andrew; Garfield, Joan

2008-01-01

This article introduces the recently adopted Guidelines for the Assessment and Instruction in Statistics Education (GAISE) and provides two examples of introductory statistics courses that have been redesigned to better align with these guidelines.

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC115 (Link to dictyBase) - - - Contig-U16382-1 VFC115E (Link...) Clone ID VFC115 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Ori...ant alignments: (bits) Value N X03281 |X03281.1 Dictyostelium discoideum gene for actin A8. 954 0.0 7 AC116957 |AC116957.2 Dict...X4, complete sequence. 906 0.0 9 M14146 |M14146.1 D.discoideum actin 15 gene, complete cds. 890 0.0 7 AC115579 |AC115579.2 Dict...0.0 7 U25660 |U25660.1 Dictyostelium discoideum actin gene, partial cds. 866 0.0

Unpacking Gender Differences in Students' Perceived Experiences in Introductory Physics

Science.gov (United States)

Kost, Lauren E.; Pollock, Steven J.; Finkelstein, Noah D.

2009-11-01

Prior research has shown, at our institution: 1) males outperform females on conceptual assessments (a gender gap), 2) the gender gap persists despite the use of research-based reforms, and 3) the gender gap is correlated with students' physics and mathematics background and prior attitudes and beliefs [Kost, et al. PRST-PER, 5, 010101]. Our follow-up work begins to explore how males and females experience the introductory course differently and how these differences relate to the gender gap. We gave a survey to students in the introductory course in which we investigated students' physics identity and self-efficacy. We find there are significant gender differences in each of these three areas, and further find that these measures are weakly correlated with student conceptual performance, and moderately correlated with course grade.

Learning to Program with Personal Robots: Influences on Student Motivation

Science.gov (United States)

McGill, Monica M.

2012-01-01

One of the goals of using robots in introductory programming courses is to increase motivation among learners. There have been several types of robots that have been used extensively in the classroom to teach a variety of computer science concepts. A more recently introduced robot designed to teach programming to novice students is the Institute…

Feasibility of Python in teaching programming

Directory of Open Access Journals (Sweden)

Rafael Martínez Estévez

2014-03-01

Full Text Available Given the diversity of the objectives of the programming courses in the Cuban educational system and the training of teachers, it is not easy to decide the language to be used in each case. The intention of this article is to bring to debate to our context a trend that has been growing in the last decade: Python as a first programming language. The aim of this study is to compile some inter national experiences in the use of Python in introductory programming courses, also analyzing their advantages and disadvantages.

The Write Stuff: Teaching the Introductory Public Relations Writing Course.

Science.gov (United States)

King, Cynthia M.

2001-01-01

Outlines an introductory public relations writing course. Presents course topics and objectives, and assignments designed to meet them. Provides a sample grading rubric and evaluates major public relations writing textbooks. Discusses learning and assessment strategies. (SR)

Women and Minorities in Introductory Economics Textbooks: 1974 to 1984.

Science.gov (United States)

Feiner, Susan F.; Morgan, Barbara A.

1987-01-01

Reviews widely-used introductory economics textbooks, examining how issues relating to race and gender are treated. Suggests how stereotypical roles could be avoided in the future. Includes a table summarizing data from 21 textbooks. (Author/DH)

Topic Order in Introductory Physics and its Impact on the STEM Curricular Ladder

Directory of Open Access Journals (Sweden)

Teresa L Larkin

2017-02-01

Full Text Available Introductory physics courses are an important rung on the curricular ladder in STEM. These courses help to strengthen students critical thinking and problem solving skills while simultaneously introducing them to many topics they will explore in more detail in later courses in physics and engineering. For these reasons, introductory physics is a required element on the curricular ladder. Most often, introductory physics is offered as a two-semester sequence with basic mechanics being taught in the first semester and electricity and magnetism in the second. In fact, this curricular sequence has not been altered in decades. Is there a reason for this? There are many other enduring questions that arise pertaining to these foundation courses in physics. These questions include: Does taking the introductory course sequence “out of order” have an impact on student learning in physics? What topics should be taught? When should these topics be taught? What topics could be left out? The list of questions is essentially endless. This paper will address some of these questions in part, through a brief discussion on student learning in a second-semester algebra-based physics course. Connections will also be made to the broader curricular ladder in STEM. To this end, an illustration that makes connections to an engineering statics course will be presented. This discussion will conclude by presenting some broader implications for the larger STEM communities.

Teaching Introductory Psychology in the Community College Classroom: Enhancing Student Understanding and Retention of Essential Information

Science.gov (United States)

Debb, Scott M.; Debb, Sharon M.

2012-01-01

Enrolling in an introductory course in psychology is a staple of many community college students' core curriculum. For those students who plan to pursue social science and humanities-related majors in particular, introductory psychology helps provide a solid base upon which future coursework at all academic levels will be built. The goal of any…

Humor to the Rescue: How to Make Introductory Economics an Appealing Social Science for Non-Majors

Science.gov (United States)

Jones, George H.

2014-01-01

Despite efforts made over the past few years to improve upon the way introductory economics is taught, these efforts have unfortunately done very little to change student perception of economics as a dry, difficult and boring subject. Since the introductory economics course for many nonmajors may be their only economics course in college, it is…

Introductory analysis of Benard-Marangoni convection

International Nuclear Information System (INIS)

Maroto, J A; Perez-Munuzuri, V; Romero-Cano, M S

2007-01-01

We describe experiments on Benard-Marangoni convection which permit a useful understanding of the main concepts involved in this phenomenon such as, for example, Benard cells, aspect ratio, Rayleigh and Marangoni numbers, Crispation number and critical conditions. In spite of the complexity of convection theory, we carry out a simple and introductory analysis which has the additional advantage of providing very suggestive experiments. As a consequence, we recommend our device for use as a laboratory experiment for undergraduate students of the thermodynamics of nonlinear and fluid physics

Introductory analysis of Benard-Marangoni convection

Energy Technology Data Exchange (ETDEWEB)

Maroto, J A [Group of Physics and Chemistry of Linares, Escuela Politecnica Superior, St Alfonso X El Sabio, 28, University of Jaen, E-23700 Linares, Jaen (Spain); Perez-Munuzuri, V [Group of Nonlinear Physics, University of Santiago de Compostela, E-15782 Santiago de Compostela (Spain); Romero-Cano, M S [Group of Complex Fluids Physics, Department of Applied Physics, University of Almeria, E-04120 Almeria (Spain)

2007-03-15

We describe experiments on Benard-Marangoni convection which permit a useful understanding of the main concepts involved in this phenomenon such as, for example, Benard cells, aspect ratio, Rayleigh and Marangoni numbers, Crispation number and critical conditions. In spite of the complexity of convection theory, we carry out a simple and introductory analysis which has the additional advantage of providing very suggestive experiments. As a consequence, we recommend our device for use as a laboratory experiment for undergraduate students of the thermodynamics of nonlinear and fluid physics.

Introductory statistics for the behavioral sciences

CERN Document Server

Welkowitz, Joan; Cohen, Jacob

1971-01-01

Introductory Statistics for the Behavioral Sciences provides an introduction to statistical concepts and principles. This book emphasizes the robustness of parametric procedures wherein such significant tests as t and F yield accurate results even if such assumptions as equal population variances and normal population distributions are not well met.Organized into three parts encompassing 16 chapters, this book begins with an overview of the rationale upon which much of behavioral science research is based, namely, drawing inferences about a population based on data obtained from a samp

Academic Performance in Introductory Accounting: Do Learning Styles Matter?

Science.gov (United States)

Tan, Lin Mei; Laswad, Fawzi

2015-01-01

This study examines the impact of learning styles on academic performance using major assessment methods (examinations and assignments including multiple-choice and constructed response questions (CRQs)) in an introductory accounting course. Students' learning styles were assessed using Kolb's Learning Style Inventory Version 3.1. The results…

Characterizing Teaching in Introductory Geology Courses: Measuring Classroom Practices

Science.gov (United States)

Budd, D. A.; van der Hoeven Kraft, K. J.; McConnell, D. A.; Vislova, T.

2013-01-01

Most research about reformed teaching practices in the college science classroom is based on instructor self-report. This research describes what is happening in some introductory geology courses at multiple institutions across the country using external observers. These observations are quantified using the Reformed Teaching Observation Protocol…

Race, Sex, and Their Influences on Introductory Statistics Education

Science.gov (United States)

van Es, Cindy; Weaver, Michelle M.

2018-01-01

The Survey of Attitudes Toward Statistics or SATS was administered for three consecutive years to students in an Introductory Statistics course at Cornell University. Questions requesting demographic information and expected final course grade were added. Responses were analyzed to investigate possible differences between sexes and racial/ethnic…

The Impact of Student-Directed Projects in Introductory Statistics

Science.gov (United States)

Spence, Dianna J.; Bailey, Brad; Sharp, Julia L.

2017-01-01

A multi-year study investigated the impact of incorporating student-directed discovery projects into introductory statistics courses. Pilot instructors at institutions across the United States taught statistics implementing student-directed projects with the help of a common set of instructional materials designed to facilitate such projects.…

Introductory Anatomy and Physiology in an Undergraduate Nursing Curriculum

Science.gov (United States)

Brown, S. J.; White, S.; Power, N.

2017-01-01

Using an educational data mining approach, first-year academic achievement of undergraduate nursing students, which included two compulsory courses in introductory human anatomy and physiology, was compared with achievement in a final semester course that transitioned students into the workplace. We hypothesized that students could be grouped…

Using News Media Databases (LexisNexis) To Identify Relevant Topics For Introductory Earth Science Classes

Science.gov (United States)

Cervato, C.; Jach, J. Y.; Ridky, R.

2003-12-01

Introductory Earth science courses are undergoing pedagogical changes in universities across the country and are focusing more than ever on the non-science majors. Increasing enrollment of non-science majors in these introductory Earth science courses demands a new look at what is being taught and how the content can be objectively chosen. Assessing the content and effectiveness of these courses requires a quantitative investigation of introductory Earth science topics and their relevance to current issues and concerns. Relevance of Earth science topics can be linked to improved students' attitude toward science and a deeper understanding of concepts. We have used the Internet based national news search-engine LexisNexis Academic Universe (http://www.lexisnexis.org/) to select the occurrence of Earth science terms over the last 12 months, five and ten years both regionally and nationally. This database of term occurrences is being used to examine how Earth sciences have evolved in the news through the last 10 years and is also compared with textbook contents and course syllabi from randomly selected introductory earth science courses across the nation. These data constitute the quantitative foundation for this study and are being used to evaluate the relevance of introductory earth science course content. The relevance of introductory course content and current real-world issues to student attitudes is a crucial factor when considering changes in course curricula and pedagogy. We have examined students' conception of the nature of science and attitudes towards science and learning science using a Likert-scale assessment instrument in the fall 2002 Geology 100 classes at Iowa State University. A pre-test and post-test were administered to see if the students' attitudes changed during the semester using as reference a control group comprised of geoscience undergraduate and graduate students, and faculty. The results of the attitude survey have been analyzed in terms

Intuitive introductory statistics

CERN Document Server

Wolfe, Douglas A

2017-01-01

This textbook is designed to give an engaging introduction to statistics and the art of data analysis. The unique scope includes, but also goes beyond, classical methodology associated with the normal distribution. What if the normal model is not valid for a particular data set? This cutting-edge approach provides the alternatives. It is an introduction to the world and possibilities of statistics that uses exercises, computer analyses, and simulations throughout the core lessons. These elementary statistical methods are intuitive. Counting and ranking features prominently in the text. Nonparametric methods, for instance, are often based on counts and ranks and are very easy to integrate into an introductory course. The ease of computation with advanced calculators and statistical software, both of which factor into this text, allows important techniques to be introduced earlier in the study of statistics. This book's novel scope also includes measuring symmetry with Walsh averages, finding a nonp...

Introductory Biology Labs... They Just Aren't Sexy Enough!

Science.gov (United States)

Cotner, Sehoya; Gallup, Gordon G., Jr.

2011-01-01

The typical introductory biology curriculum includes the nature of science, evolution and genetics. Laboratory activities are designed to engage students in typical subject areas ranging from cell biology and physiology, to ecology and evolution. There are few, if any, laboratory classes exploring the biology and evolution of human sexual…

Transversality of electromagnetic waves in the calculus-based introductory physics course

International Nuclear Information System (INIS)

Burko, Lior M

2008-01-01

Introductory calculus-based physics textbooks state that electromagnetic waves are transverse and list many of their properties, but most such textbooks do not bring forth arguments why this is so. Both physical and theoretical arguments are at a level appropriate for students of courses based on such books, and could be readily used by instructors of such courses. Here, we discuss two physical arguments (based on polarization experiments and on lack of monopole electromagnetic radiation) and the full argument for the transversality of (plane) electromagnetic waves based on the integral Maxwell equations. We also show, at a level appropriate for the introductory course, why the electric and magnetic fields in a wave are in phase and the relation of their magnitudes

Transversality of electromagnetic waves in the calculus-based introductory physics course

Science.gov (United States)

Burko, Lior M.

2008-11-01

Introductory calculus-based physics textbooks state that electromagnetic waves are transverse and list many of their properties, but most such textbooks do not bring forth arguments why this is so. Both physical and theoretical arguments are at a level appropriate for students of courses based on such books, and could be readily used by instructors of such courses. Here, we discuss two physical arguments (based on polarization experiments and on lack of monopole electromagnetic radiation) and the full argument for the transversality of (plane) electromagnetic waves based on the integral Maxwell equations. We also show, at a level appropriate for the introductory course, why the electric and magnetic fields in a wave are in phase and the relation of their magnitudes.

Introductory modern algebra a historical approach

CERN Document Server

Stahl, Saul

2013-01-01

Praise for the First Edition ""Stahl offers the solvability of equations from the historical point of view...one of the best books available to support a one-semester introduction to abstract algebra.""-CHOICE Introductory Modern Algebra: A Historical Approach, Second Edition presents the evolution of algebra and provides readers with the opportunity to view modern algebra as a consistent movement from concrete problems to abstract principles. With a few pertinent excerpts from the writings of some of the greatest mathematicians, the Second Edition uniquely facilitates the understanding of pi

Introductory Statistics for the Behavioral Sciences

CERN Document Server

Cohen, Barry H; Lea, R Brooke

2012-01-01

A comprehensive and user-friendly introduction to statistics for behavioral science students-revised and updated Refined over seven editions by master teachers, this book gives instructors and students alike clear examples and carefully crafted exercises to support the teaching and learning of statistics for both manipulating and consuming data. One of the most popular and respected statistics texts in the behavioral sciences, the Seventh Edition of Introductory Statistics for the Behavioral Sciences has been fully revised. The new edition presents all the topics students in the behavioral s

A Retrospective Self-Assessment of the SURFO Summer Internship Program in Oceanography

Science.gov (United States)

Pockalny, R. A.; Donohue, K. A.; Fliegler, J.

2009-12-01

The Summer Undergraduate Research Fellowships in Oceanography (SURFO) program at the Graduate School of Oceanography/University of Rhode Island is an NSF-funded Research Experience for Undergraduates site program with a programmatic research niche focused on quantitative aspects of Oceanography. Each summer-cohort includes 9-12 participants (rising seniors) who are paired with a primary research advisor and often with a graduate student mentor. The primary components of the 10-week program include a 4-week introductory phase and a 6-week core research phase. A retrospective self-assessment instrument gauged the confidence, attitude and comfort level of participants with; 1) core math and science subjects, 2) oceanography-related subjects, 3) research skills, and 4) SURFO and GSO staff. SURFO participants evaluated themselves at the start of the program, after the introductory phase, and at the end of the program. Participants were also asked to reassess their initial evaluations and provide an updated score. The pre-assessment results indicate that the program recruits students from the target group (e.g., strong physics and math backgrounds, but with limited exposure to oceanography). The results also indicate that the students are initially comfortable with their advising team, but not so comfortable with their research topic and research skills. The post-introductory phase results indicate large increases in comfort level with the advising team and the local research community yet little or no change is indicated for research skills. The final assessments show large changes in oceanography-content knowledge, research topic, and research skills. The retrospective reassessment indicates an initial overconfidence in most categories. Overall, the largest changes occurred during the core research portion of the program. These results reinforce the importance/effectiveness of authentic, hands-on, inquiry-based research for higher learning and training the next

The Structure of the Introductory Economics Course in United States Colleges.

Science.gov (United States)

Sweeney, M. Jane Barr; And Others

1983-01-01

This survey examined class size, teaching methods, and the one-semester/two-semester organization of the introductory economics course. Student satisfaction with respect to their institution was also studied. (Author/RM)

Active Learning Outside the Classroom: Implementation and Outcomes of Peer-Led Team-Learning Workshops in Introductory Biology.

Science.gov (United States)

Kudish, Philip; Shores, Robin; McClung, Alex; Smulyan, Lisa; Vallen, Elizabeth A; Siwicki, Kathleen K

2016-01-01

Study group meetings (SGMs) are voluntary-attendance peer-led team-learning workshops that supplement introductory biology lectures at a selective liberal arts college. While supporting all students' engagement with lecture material, specific aims are to improve the success of underrepresented minority (URM) students and those with weaker backgrounds in biology. Peer leaders with experience in biology courses and training in science pedagogy facilitate work on faculty-generated challenge problems. During the eight semesters assessed in this study, URM students and those with less preparation attended SGMs with equal or greater frequency than their counterparts. Most agreed that SGMs enhanced their comprehension of biology and ability to articulate solutions. The historical grade gap between URM and non-URM students narrowed slightly in Biology 2, but not in other biology and science, technology, engineering, and mathematics courses. Nonetheless, URM students taking introductory biology after program implementation have graduated with biology majors or minors at the same rates as non-URM students, and have enrolled in postcollege degree programs at equal or greater rates. These results suggest that improved performance as measured by science grade point average may not be necessary to improve the persistence of students from underrepresented groups as life sciences majors. © 2016 P. Kudish et al. CBE—Life Sciences Education © 2016 The American Society for Cell Biology. This article is distributed by The American Society for Cell Biology under license from the author(s). It is available to the public under an Attribution–Noncommercial–Share Alike 3.0 Unported Creative Commons License (http://creativecommons.org/licenses/by-nc-sa/3.0).

Polymerization Simulator for Introductory Polymer and Material Science Courses

Science.gov (United States)

Chirdon, William M.

2010-01-01

This work describes how molecular simulation of polymerization reactions can be used to enrich introductory polymer or material science courses to give students a deeper understanding of free-radical chain and stepwise growth polymerization reactions. These simulations have proven to be effective media for instruction that do not require material…

Ecology Content in Introductory Biology Courses: A Comparative Analysis

Science.gov (United States)

Pool, Richard F.; Turner, Gregory D.; Böttger, S. Anne

2013-01-01

In recent years the need for ecological literacy and problem solving has increased, but there is no evidence that this need is reflected by increased ecology coverage at institutions of higher education (IHE) across the United States. Because introductory biology courses may serve to direct student interest toward particular biological categories…

Using Data from Climate Science to Teach Introductory Statistics

Science.gov (United States)

Witt, Gary

2013-01-01

This paper shows how the application of simple statistical methods can reveal to students important insights from climate data. While the popular press is filled with contradictory opinions about climate science, teachers can encourage students to use introductory-level statistics to analyze data for themselves on this important issue in public…

Students' Spirituality and "Big Questions" in Introductory Religion Courses

Science.gov (United States)

Walvoord, Barbara E.

2008-01-01

A study of sixty-six highly effective teachers of introductory theology and religion courses in various types of institutions reveals very complex challenges for instructors. The majority of students have as a goal their own religious and spiritual development. Faculty members' most frequent goal is critical thinking. Students much less frequently…

Integrating Symmetry in Stereochemical Analysis in Introductory Organic Chemistry

Science.gov (United States)

Taagepera, Mare; Arasasingham, Ramesh D.; King, Susan; Potter, Frank; Martorell, Ingrid; Ford, David; Wu, Jason; Kearney, Aaron M.

2011-01-01

We report a comparative study using "knowledge space theory" (KAT) to assess the impact of a hands-on laboratory exercise that used molecular model kits to emphasize the connections between a plane of symmetry, Charity, and isomerism in an introductory organic chemistry course. The experimental design compared three groups of…

Public School Finance Programs, 1978-79.

Science.gov (United States)

Tron, Esther O., Comp.

This compendium describes the programs of state financial aid to school districts that were in effect in the 1978-79 school year. The introductory section of the report is an analysis of the situation and contains summary tables. The report for each state consists of two parts. The first part reports features of the state and local systems of…

Statistical and Machine Learning Models to Predict Programming Performance

OpenAIRE

Bergin, Susan

2006-01-01

This thesis details a longitudinal study on factors that influence introductory programming success and on the development of machine learning models to predict incoming student performance. Although numerous studies have developed models to predict programming success, the models struggled to achieve high accuracy in predicting the likely performance of incoming students. Our approach overcomes this by providing a machine learning technique, using a set of three significant...

Characterizing, modeling, and addressing gender disparities in introductory college physics

Science.gov (United States)

Kost-Smith, Lauren Elizabeth

2011-12-01

The underrepresentation and underperformance of females in physics has been well documented and has long concerned policy-makers, educators, and the physics community. In this thesis, we focus on gender disparities in the first- and second-semester introductory, calculus-based physics courses at the University of Colorado. Success in these courses is critical for future study and careers in physics (and other sciences). Using data gathered from roughly 10,000 undergraduate students, we identify and model gender differences in the introductory physics courses in three areas: student performance, retention, and psychological factors. We observe gender differences on several measures in the introductory physics courses: females are less likely to take a high school physics course than males and have lower standardized mathematics test scores; males outscore females on both pre- and post-course conceptual physics surveys and in-class exams; and males have more expert-like attitudes and beliefs about physics than females. These background differences of males and females account for 60% to 70% of the gender gap that we observe on a post-course survey of conceptual physics understanding. In analyzing underlying psychological factors of learning, we find that female students report lower self-confidence related to succeeding in the introductory courses (self-efficacy) and are less likely to report seeing themselves as a "physics person". Students' self-efficacy beliefs are significant predictors of their performance, even when measures of physics and mathematics background are controlled, and account for an additional 10% of the gender gap. Informed by results from these studies, we implemented and tested a psychological, self-affirmation intervention aimed at enhancing female students' performance in Physics 1. Self-affirmation reduced the gender gap in performance on both in-class exams and the post-course conceptual physics survey. Further, the benefit of the self

Readers of the Round Table: The 1998 Joint Kentucky - Arizona Reading Program.

Science.gov (United States)

Kentucky State Dept. for Libraries and Archives, Frankfort.

Intended to encourage children of all ages to read over the summer, this manual presents library-based programs, crafts, displays, and events with a medieval theme. The chapters of the manual are: (1) Introductory Materials; (2) Goals, Objectives and Evaluation; (3) Getting Started; (4) Common Program Structures; (5) Planning Timeline; (6)…

Improving student learning and views of physics in a large enrollment introductory physics class

Science.gov (United States)

Salehzadeh Einabad, Omid

Introductory physics courses often serve as gatekeepers for many scientific and engineering programs and, increasingly, colleges are relying on large, lecture formats for these courses. Many students, however, leave having learned very little physics and with poor views of the subject. In interactive engagement (IE), classroom activities encourage students to engage with each other and with physics concepts and to be actively involved in their own learning. These methods have been shown to be effective in introductory physics classes with small group recitations. This study examined student learning and views of physics in a large enrollment course that included IE methods with no separate, small-group recitations. In this study, a large, lecture-based course included activities that had students explaining their reasoning both verbally and in writing, revise their ideas about physics concepts, and apply their reasoning to various problems. The questions addressed were: (a) What do students learn about physics concepts and how does student learning in this course compare to that reported in the literature for students in a traditional course?, (b) Do students' views of physics change and how do students' views of physics compare to that reported in the literature for students in a traditional course?, and (c) Which of the instructional strategies contribute to student learning in this course? Data included: pre-post administration of the Force Concept Inventory (FCI), classroom exams during the term, pre-post administration of the Colorado Learning Attitudes About Science Survey (CLASS), and student work, interviews, and open-ended surveys. The average normalized gain (=0.32) on the FCI falls within the medium-gain range as reported in the physics education literature, even though the average pre-test score was very low (30%) and this was the instructor's first implementation of IE methods. Students' views of physics remained relatively unchanged by instruction

Catholic/Jesuit Values in an Introductory Religious Studies Course

Science.gov (United States)

Lynch, Patrick; S. J.; Mizak, Pat

2012-01-01

A growing interest in the communication to students of the mission and identity of a higher education institution prompted this study about the presence of Catholic, Jesuit values in the introductory religious studies course at a faith-based university. To conduct this study a survey instrument was developed, piloted, further refined, and then…

Student and Professor Gender Effects in Introductory Business Statistics

Science.gov (United States)

Haley, M. Ryan; Johnson, Marianne F.; Kuennen, Eric W.

2007-01-01

Studies have yielded highly mixed results as to differences in male and female student performance in statistics courses; the role that professors play in these differences is even less clear. In this paper, we consider the impact of professor and student gender on student performance in an introductory business statistics course taught by…

The Distribution of Macromolecular Principles throughout Introductory Organic Chemistry

Science.gov (United States)

Shulman, Joel I.

2017-01-01

Many of the principles of organic polymer chemistry are direct extensions of the information contained in the standard introductory organic chemistry course. Often, however, the discussion of macromolecules is relegated to a chapter at the end of the organic chemistry text and is covered briefly, if at all. Connecting the organic-chemical…

A Longitudinal Analysis of the Reid List of First Programming Languages

Science.gov (United States)

Siegfried, Robert M.; Siegfried, Jason P.; Alexandro, Gina

2016-01-01

Throughout the 1990s, Richard Reid of Michigan State University maintained a list showing the first programming language used in introductory programming courses taken by computer science and information systems majors; it was updated for several years afterwards with the most recent update done in 2011. This is a follow-up to that last update of…

A Voltage and Frequency Control Strategy for Stand-Alone Full Converter Wind Energy Conversion Systems

Directory of Open Access Journals (Sweden)

Andrés Peña Asensio

2018-02-01

Full Text Available This paper addresses the design and analysis of a voltage and frequency control (VFC strategy for full converter (FC-based wind energy conversion systems (WECSs and its applicability for the supply of an isolated load. When supplying an isolated load, the role of the back-to-back converters in the FC must change with respect to a grid-connected application. Voltage and frequency are established by the FC line side converter (LSC, while the generator side converter (GSC is responsible for maintaining constant voltage in the DC link. Thus, the roles of the converters in the WECS are inverted. Under such control strategies, the LSC will automatically supply the load power and hence, in order to maintain a stable operation of the WECS, the wind turbine (WT power must also be controlled in a load-following strategy. The proposed VFC is fully modelled and a stability analysis is performed. Then, the operation of the WECS under the proposed VFC is simulated and tested on a real-time test bench, demonstrating the performance of the VFC for the isolated operation of the WECS.

Development and Validation of a Teaching Practice Scale (TISS) for Instructors of Introductory Statistics at the College Level

Science.gov (United States)

Hassad, Rossi A.

2009-01-01

This study examined the teaching practices of 227 college instructors of introductory statistics (from the health and behavioral sciences). Using primarily multidimensional scaling (MDS) techniques, a two-dimensional, 10-item teaching practice scale, TISS (Teaching of Introductory Statistics Scale), was developed and validated. The two dimensions…

MRI experiments for introductory physics

Science.gov (United States)

Taghizadeh, Sanaz; Lincoln, James

2018-04-01

The introductory physics classroom has long educated students about the properties of the atom and the nucleus. But absent from these lessons has been an informed discussion of magnetic resonance imaging (MRI) and its parent science nuclear magnetic resonance (NMR). Physics teachers should not miss the opportunity to instruct upon this highly relevant application of modern physics, especially with so many of our students planning to pursue a career in medicine. This article provides an overview of the physics of MRI and gives advice on how physics teachers can introduce this topic. Also included are some demonstration activities and a discussion of a desktop MRI apparatus that may be used by students in the lab or as a demo.

Mississippi Curriculum Framework for Medical Radiologic Technology (Radiography) (CIP: 51.0907--Medical Radiologic Technology). Postsecondary Programs.

Science.gov (United States)

Mississippi Research and Curriculum Unit for Vocational and Technical Education, State College.

This document, which is intended for use by community and junior colleges throughout Mississippi, contains curriculum frameworks for the course sequences in the radiologic technology program. Presented in the introductory section are a description of the program and suggested course sequence. Section I lists baseline competencies for the program,…

Sustained knowledge acquisition among Rwandan physicians participating in six-month ultrasound training program

Directory of Open Access Journals (Sweden)

P.C. Henwood*

2013-12-01

Conclusions: Trainees demonstrated significant knowledge improvement after an intensive introductory ultrasound course, which increased through the training program. Mean OSCE scores remained above 80% throughout the course. Participants in an ultrasound training program with an initial training phase and periodic skill reinforcement can acquire and retain ultrasound knowledge and scanning skills.

Special Relativity and Magnetism in an Introductory Physics Course

Science.gov (United States)

Piccioni, R. G.

2007-01-01

Too often, students in introductory courses are left with the impression that Einstein's special theory of relativity comes into play only when the relative speed of two objects is an appreciable fraction of the speed of light ("c"). In fact, relativistic length contraction, along with Coulomb's law, accounts quantitatively for the force on a…

Incorporating Code-Based Software in an Introductory Statistics Course

Science.gov (United States)

Doehler, Kirsten; Taylor, Laura

2015-01-01

This article is based on the experiences of two statistics professors who have taught students to write and effectively utilize code-based software in a college-level introductory statistics course. Advantages of using software and code-based software in this context are discussed. Suggestions are made on how to ease students into using code with…

Student Interpretations of Phylogenetic Trees in an Introductory Biology Course

Science.gov (United States)

Dees, Jonathan; Momsen, Jennifer L.; Niemi, Jarad; Montplaisir, Lisa

2014-01-01

Phylogenetic trees are widely used visual representations in the biological sciences and the most important visual representations in evolutionary biology. Therefore, phylogenetic trees have also become an important component of biology education. We sought to characterize reasoning used by introductory biology students in interpreting taxa…

Using Astrology to Teach Research Methods to Introductory Psychology Students.

Science.gov (United States)

Ward, Roger A.; Grasha, Anthony F.

1986-01-01

Provides a classroom demonstration designed to test an astrological hypothesis and help teach introductory psychology students about research design and data interpretation. Illustrates differences between science and nonscience, the role of theory in developing and testing hypotheses, making comparisons among groups, probability and statistical…

BlueJ Visual Debugger for Learning the Execution of Object-Oriented Programs?

Science.gov (United States)

Bennedsen, Jens; Schulte, Carsten

2010-01-01

This article reports on an experiment undertaken in order to evaluate the effect of a program visualization tool for helping students to better understand the dynamics of object-oriented programs. The concrete tool used was BlueJ's debugger and object inspector. The study was done as a control-group experiment in an introductory programming…

Java Programming Language

Science.gov (United States)

Shaykhian, Gholam Ali

2007-01-01

The Java seminar covers the fundamentals of Java programming language. No prior programming experience is required for participation in the seminar. The first part of the seminar covers introductory concepts in Java programming including data types (integer, character, ..), operators, functions and constants, casts, input, output, control flow, scope, conditional statements, and arrays. Furthermore, introduction to Object-Oriented programming in Java, relationships between classes, using packages, constructors, private data and methods, final instance fields, static fields and methods, and overloading are explained. The second part of the seminar covers extending classes, inheritance hierarchies, polymorphism, dynamic binding, abstract classes, protected access. The seminar conclude by introducing interfaces, properties of interfaces, interfaces and abstract classes, interfaces and cailbacks, basics of event handling, user interface components with swing, applet basics, converting applications to applets, the applet HTML tags and attributes, exceptions and debugging.

Introductory statistics and analytics a resampling perspective

CERN Document Server

Bruce, Peter C

2014-01-01

Concise, thoroughly class-tested primer that features basic statistical concepts in the concepts in the context of analytics, resampling, and the bootstrapA uniquely developed presentation of key statistical topics, Introductory Statistics and Analytics: A Resampling Perspective provides an accessible approach to statistical analytics, resampling, and the bootstrap for readers with various levels of exposure to basic probability and statistics. Originally class-tested at one of the first online learning companies in the discipline, www.statistics.com, the book primarily focuses on application

An introductory course in philosophy of medicine.

Science.gov (United States)

Rudnick, A

2004-06-01

Philosophy of medicine, narrowly defined as ontology and epistemology of medicine, is a well developed research field, yet education in this field is less well developed. The aim of this paper is to present an educational development in philosophy of medicine-an introductory course in philosophy of medicine. Central features of the course are described. Participants (medical undergraduate students) scored high on average. The conclusion is that further such educational ventures in philosophy of medicine should be developed and implemented.

Ancient Indian Astronomy in Introductory Texts

Science.gov (United States)

Narahari Achar, B. N.

1997-10-01

It is customary in introductory survey courses in astronomy to devote some time to the history of astronomy. In the available text books only the Greek contribution receives any attention. Apart from Stonehenge and Chichenitza pictures, contributions from Babylon and China are some times mentioned. Hardly any account is given of ancient Indian astronomy. Even when something is mentioned it is incomplete or incorrect or both. Examples are given from several text books currently available. An attempt is made to correct this situation by sketching the contributions from the earliest astronomy of India, namely Vedaanga Jyotisha.

The UKAEA mechanical test programs in air

International Nuclear Information System (INIS)

Wood, D.S.

1977-01-01

The design of CDFR will be based on the mechanical behaviour of materials in air, although at a later date account may need to be taken of sodium effects. The need for this Information is outlined in the introductory paper. The extent of the air programs and preliminary findings are described in this paper

The UKAEA mechanical test programs in air

Energy Technology Data Exchange (ETDEWEB)

Wood, D S [UKAEA, RNPDL, Risley (United Kingdom)

1977-07-01

The design of CDFR will be based on the mechanical behaviour of materials in air, although at a later date account may need to be taken of sodium effects. The need for this Information is outlined in the introductory paper. The extent of the air programs and preliminary findings are described in this paper.

Prenatal Foundations: Fetal Programming of Health and Development

Science.gov (United States)

Davis, Elysia Poggi; Thompson, Ross A.

2014-01-01

The fetal programming and developmental origins of disease models suggest that experiences that occur before birth can have consequences for physical and mental health that persist across the lifespan. Development is more rapid during the prenatal period as compared to any other stage of life. This introductory article considers evidence that…

Cognitive Transfer Outcomes for a Simulation-Based Introductory Statistics Curriculum

Science.gov (United States)

Backman, Matthew D.; Delmas, Robert C.; Garfield, Joan

2017-01-01

Cognitive transfer is the ability to apply learned skills and knowledge to new applications and contexts. This investigation evaluates cognitive transfer outcomes for a tertiary-level introductory statistics course using the CATALST curriculum, which exclusively used simulation-based methods to develop foundations of statistical inference. A…

Introductory Graduate Research Courses: An Examination of the Knowledge Base.

Science.gov (United States)

Mundfrom, Daniel J.; Shaw, Dale G.; Thomas, Ann; Young, Suzanne; Moore, Alan D.

This study addresses the question, "What should graduate students know about research and statistics after completing an initial course?" Individuals who teach such courses at various Carnegie classifications of institutions were surveyed about the specific characteristics of an introductory graduate research course at their own institutions to…

A Program for the Preparation and Certification of School Administrators. Program E--Learning Resource Specialist. In Compliance with Guidelines and Standards for the Development and Approval of Programs of Preparation Leading to Certification [of] School Professional Personnel.

Science.gov (United States)

Canzler, Lillian

The initial and continuing competencies needed by a district-level administrator in educational media or learning resources are outlined. An introductory discussion covers internship program procedures, supervision and evaluation, record keeping and reports, and competencies and skills. Competencies are then defined, the use of the format is…

Use of AECC Directives and Cooperative Learning Theory in Introductory Accounting Classes.

Science.gov (United States)

Holt, Doris L.; Swanson, Janice Goodnow

1995-01-01

Explores how colleges and universities are responding to the directives of the Accounting Education Change Commission for introductory accounting classes and whether these classrooms use cooperative learning techniques. (Author/JOW)

A comparative study of traditional lecture methods and interactive lecture methods in introductory geology courses for non-science majors at the college level

Science.gov (United States)

Hundley, Stacey A.

In recent years there has been a national call for reform in undergraduate science education. The goal of this reform movement in science education is to develop ways to improve undergraduate student learning with an emphasis on developing more effective teaching practices. Introductory science courses at the college level are generally taught using a traditional lecture format. Recent studies have shown incorporating active learning strategies within the traditional lecture classroom has positive effects on student outcomes. This study focuses on incorporating interactive teaching methods into the traditional lecture classroom to enhance student learning for non-science majors enrolled in introductory geology courses at a private university. Students' experience and instructional preferences regarding introductory geology courses were identified from survey data analysis. The information gained from responses to the questionnaire was utilized to develop an interactive lecture introductory geology course for non-science majors. Student outcomes were examined in introductory geology courses based on two teaching methods: interactive lecture and traditional lecture. There were no significant statistical differences between the groups based on the student outcomes and teaching methods. Incorporating interactive lecture methods did not statistically improve student outcomes when compared to traditional lecture teaching methods. However, the responses to the survey revealed students have a preference for introductory geology courses taught with lecture and instructor-led discussions and students prefer to work independently or in small groups. The results of this study are useful to individuals who teach introductory geology courses and individuals who teach introductory science courses for non-science majors at the college level.

Connecting Symbolic Integrals to Physical Meaning in Introductory Physics

Science.gov (United States)

Amos, Nathaniel R.

This dissertation presents a series of studies pertaining to introductory physics students' abilities to derive physical meaning from symbolic integrals (e.g., the integral of vdt) and their components, namely differentials and differential products (e.g., dt and vdt, respectively). Our studies focus on physical meaning in the form of interpretations (e.g., "the total displacement of an object") and units (e.g., "meters"). Our first pair of studies independently attempted to identify introductory-level mechanics students' common conceptual difficulties with and unproductive interpretations of physics integrals and their components, as well as to estimate the frequencies of these difficulties. Our results confirmed some previously-observed incorrect interpretations, such as the notion that differentials are physically meaningless; however, we also uncovered two new conceptualizations of differentials, the "rate" (differentials are "rates" or "derivatives") and "instantaneous value" (differentials are values of physical variables "at an instant") interpretations, which were exhibited by more than half of our participants at least once. Our next study used linear regression analysis to estimate the strengths of the inter-connections between the abilities to derive physical meaning from each of differentials, differential products, and integrals in both first- and second-semester, calculus-based introductory physics. As part of this study, we also developed a highly reliable, multiple choice assessment designed to measure students' abilities to connect symbolic differentials, differential products, and integrals with their physical interpretations and units. Findings from this study were consistent with statistical mediation via differential products. In particular, students' abilities to extract physical meaning from differentials were seen to be strongly related to their abilities to derive physical meaning from differential products, and similarly differential

Curriculum renewal: Alignment of introductory pharmacy practice experiences with didactic course content.

Science.gov (United States)

Nuffer, Wesley; Botts, Sheila; Franson, Kari; Gilliam, Eric; Knutsen, Randy; Nuffer, Monika; O'Brien, Elizabeth; Saseen, Joseph; Thompson, Megan; Vande Griend, Joseph; Willis, Robert

2017-11-01

The University of Colorado Skaggs School of Pharmacy and Pharmaceutical Sciences (SSPPS) used the opportunity of curriculum renewal to integrate knowledge and skills learned from didactic courses into the introductory pharmacy practice experiences (IPPEs) occurring simultaneously. This paper describes and evaluates the meaningful application of course content into IPPEs, and evaluates the success using qualitative feedback. Students entering the renewed curriculum starting in fall 2012 were provided a list of pharmacy skills and activities from didactic course directors that reinforced course content for that semester. The skills and activities were to be completed during the students' IPPE visits in the community or health systems settings, depending on the program year and semester. Students successfully completed course assignments during their IPPE course program. Not all activities could be completed as designed, and many required modification, including simulated experiences. Feedback from faculty and preceptor members of the school's experiential education committee demonstrated that these activities were valuable and improved learning of course material, but were challenging to implement. A renewed curriculum that mapped course assignments for completion in experiential settings was successfully established, after some modifications. The program was modified at regular intervals to improve the ability of preceptors to complete these activities in their individual practice environment. A balance between the school providing guidance on what activities students should perform and allowing unstructured independent learning with the preceptor is needed for an optimal experience. Copyright © 2017 Elsevier Inc. All rights reserved.

Deep-Elaborative Learning of Introductory Management Accounting for Business Students

Science.gov (United States)

Choo, Freddie; Tan, Kim B.

2005-01-01

Research by Choo and Tan (1990; 1995) suggests that accounting students, who engage in deep-elaborative learning, have a better understanding of the course materials. The purposes of this paper are: (1) to describe a deep-elaborative instructional approach (hereafter DEIA) that promotes deep-elaborative learning of introductory management…

An Open-Ended Investigative Microbial Ecology Laboratory for Introductory Biology

Science.gov (United States)

Jones-Held, Susan; Paoletti, Robert; Glick, David; Held, Michael E.

2010-01-01

In this article we describe a multi-week investigative laboratory in microbial ecology/diversity and nitrogen cycling that we have used in our introductory biology course. This module encourages active student involvement in experimental design, using the scientific literature and quantitative analysis of large data sets. Students analyze soil…

Public Speaking versus Hybrid Introductory Communication Courses: Exploring Four Outcomes

Science.gov (United States)

Broeckelman-Post, Melissa A.; Pyle, Andrew S.

2017-01-01

The purpose of this study was to compare student growth in public speaking and hybrid introductory communication skills courses on four outcomes: public speaking anxiety, self-perceived communication competence, intercultural effectiveness, and connected classroom climate. This study also sought to find out whether there were differences in the…

Using Facebook Data to Turn Introductory Statistics Students into Consultants

Science.gov (United States)

Childers, Adam F.

2017-01-01

Facebook provides businesses and organizations with copious data that describe how users are interacting with their page. This data affords an excellent opportunity to turn introductory statistics students into consultants to analyze the Facebook data using descriptive and inferential statistics. This paper details a semester-long project that…

A Pilot Study Teaching Metrology in an Introductory Statistics Course

Science.gov (United States)

Casleton, Emily; Beyler, Amy; Genschel, Ulrike; Wilson, Alyson

2014-01-01

Undergraduate students who have just completed an introductory statistics course often lack deep understanding of variability and enthusiasm for the field of statistics. This paper argues that by introducing the commonly underemphasized concept of measurement error, students will have a better chance of attaining both. We further present lecture…

Using Chinua Achebe's "Things Fall Apart" in Introductory Geography Courses.

Science.gov (United States)

Hathaway, James

1993-01-01

Describes use of Nigerian author, Chinua Achebe's novel, "Things Fall Apart," in an introductory geography course at the secondary school or college level. Provides a summary of the book's story, which deals with the impact of colonialism and Christianity on the culture of eastern Nigeria. Includes recommended instructional strategies…

Equity investigation of attitudinal shifts in introductory physics

Directory of Open Access Journals (Sweden)

Adrienne Traxler

2015-11-01

Full Text Available We report on seven years of attitudinal data using the Colorado Learning Attitudes about Science Survey from University Modeling Instruction (UMI sections of introductory physics at Florida International University. University Modeling Instruction is a curricular and pedagogical transformation of introductory university physics that engages students in building and testing conceptual models in an integrated lab and lecture learning environment. This work expands upon previous studies that reported consistently positive attitude shifts in UMI courses; here, we disaggregate the data by gender and ethnicity to look for any disparities in the pattern of favorable shifts. We find that women and students from statistically underrepresented ethnic groups have gains that are comparable to those of men and students from well-represented ethnic groups on this attitudinal measure, and that this result holds even when interaction effects of gender and ethnicity are included. We conclude with suggestions for future work in UMI courses and for attitudinal equity investigations generally. We encourage researchers to expand their scope beyond simple performance gaps when considering equity concerns, and to avoid relying on a single measure to evaluate student success. Finally, we conjecture that students’ social and academic networks are one means by which attitudinal and efficacy beliefs about the course are propagated.

Equity investigation of attitudinal shifts in introductory physics

Science.gov (United States)

Traxler, Adrienne; Brewe, Eric

2015-12-01

We report on seven years of attitudinal data using the Colorado Learning Attitudes about Science Survey from University Modeling Instruction (UMI) sections of introductory physics at Florida International University. University Modeling Instruction is a curricular and pedagogical transformation of introductory university physics that engages students in building and testing conceptual models in an integrated lab and lecture learning environment. This work expands upon previous studies that reported consistently positive attitude shifts in UMI courses; here, we disaggregate the data by gender and ethnicity to look for any disparities in the pattern of favorable shifts. We find that women and students from statistically underrepresented ethnic groups have gains that are comparable to those of men and students from well-represented ethnic groups on this attitudinal measure, and that this result holds even when interaction effects of gender and ethnicity are included. We conclude with suggestions for future work in UMI courses and for attitudinal equity investigations generally. We encourage researchers to expand their scope beyond simple performance gaps when considering equity concerns, and to avoid relying on a single measure to evaluate student success. Finally, we conjecture that students' social and academic networks are one means by which attitudinal and efficacy beliefs about the course are propagated.

Mississippi Curriculum Framework for Dental Hygiene Technology (Program CIP: 51.0602--Dental Hygienist). Postsecondary Education.

Science.gov (United States)

Mississippi Research and Curriculum Unit for Vocational and Technical Education, State College.

This document, which is intended for use by community and junior colleges throughout Mississippi, contains curriculum frameworks for the course sequences in the dental hygiene technology program. Presented in the introductory section are a description of the program and suggested course sequence. Section I lists baseline competencies. Section II…

Themes of nanoscience for the introductory physics course

International Nuclear Information System (INIS)

Planinsic, Gorazd; Lindell, Anssi; Remskar, Maja

2009-01-01

We present three experimental themes and one discussion theme that proved to be suitable for introducing nanoscience through topics that can be integrated into the existing introductory physics or teacher training courses. The experimental themes include two teaching models of an atomic force microscope (AFM) and an experiment with an elastic optical grating. They are all based on simple experiments that give also quantitative results and can be explained using basic physics theory.

Themes of nanoscience for the introductory physics course

Energy Technology Data Exchange (ETDEWEB)

Planinsic, Gorazd [Faculty for Mathematics and Physics, University of Ljubljana (Slovenia); Lindell, Anssi [Department of Teacher Education, University of Jyvaskyla (Finland); Remskar, Maja [Josef Stefan Institute, Ljubljana (Slovenia)

2009-07-15

We present three experimental themes and one discussion theme that proved to be suitable for introducing nanoscience through topics that can be integrated into the existing introductory physics or teacher training courses. The experimental themes include two teaching models of an atomic force microscope (AFM) and an experiment with an elastic optical grating. They are all based on simple experiments that give also quantitative results and can be explained using basic physics theory.

Perceived Relevance of an Introductory Information Systems Course to Prospective Business Students

Directory of Open Access Journals (Sweden)

Irene Govender

2013-12-01

Full Text Available The study is designed to examine students’ perceptions of the introductory Information Systems (IS course. It was an exploratory study in which 67 students participated. A quantitative approach was followed making use of questionnaires for the collection of data. Using the theory of reasoned action as a framework, the study explores the factors that influence non-IS major students’ perceived relevance of the IS introductory course. The analysis of collected data included descriptive and inferential statistics. Using multiple regression analysis, the results suggest that overall, the independent variables, relevance of the content, previous IT knowledge, relevance for professional practice, IT preference in courses and peers’ influence may account for 72% of the explanatory power for the dependent variable, perceived relevance of the IS course. In addition, the results have shown some strong predictors (IT preference and peers’ influence that influence students’ perceived relevance of the IS course. Practical work was found to be a strong mediating variable toward positive perceptions of IS. The results of this study suggest that students do indeed perceive the introductory IS course to be relevant and match their professional needs, but more practical work would enhance their learning. Implications for theory and practice are discussed as a result of the behavioural intention to perceive the IS course to be relevant and eventually to recruit more IS students.

First-Day Strategies for Millennial Students in Introductory Accounting Courses: It's All Fun and Games until Something Gets Learned

Science.gov (United States)

Mastilak, Christian

2012-01-01

Millennial students often possess characteristics at odds with typical lecture-based approaches to introductory accounting courses. The author introduces an approach for reaching millennial students early in introductory accounting courses in ways that fit millennials' characteristics. This article describes the use of the board game Monopoly[R]…

The Role of the Introductory Matter in Bilingual Dictionaries of ...

African Journals Online (AJOL)

rbr

learner's dictionaries and bilingual English–Arabic dictionaries, and to determine to what ... Here, one has to differentiate between an introduction in a book and one in a .... study will analyze, compare and criticize the introductory matter in a set of .... designed for native speakers of English, especially for comprehension and.

Class Size and Academic Achievement in Introductory Political Science Courses

Science.gov (United States)

Towner, Terri L.

2016-01-01

Research on the influence of class size on student academic achievement is important for university instructors, administrators, and students. The article examines the influence of class size--a small section versus a large section--in introductory political science courses on student grades in two comparable semesters. It is expected that…

A Proposal for More Sophisticated Normative Principles in Introductory Economics

Science.gov (United States)

Schmidt, Stephen

2017-01-01

Introductory textbooks teach a simple normative story about the importance of maximizing economic surplus that supports common policy claims. There is little defense of the claim that maximizing surplus is normatively important, which is not obvious to non-economists. Difficulties with the claim that society should maximize surplus are generally…

A One-Year Introductory Robotics Curriculum for Computer Science Upperclassmen

Science.gov (United States)

Correll, N.; Wing, R.; Coleman, D.

2013-01-01

This paper describes a one-year introductory robotics course sequence focusing on computational aspects of robotics for third- and fourth-year students. The key challenges this curriculum addresses are "scalability," i.e., how to teach a robotics class with a limited amount of hardware to a large audience, "student assessment,"…

A Critical Understanding and Transformation of an Introductory Statistics Course

Science.gov (United States)

Magalhães, Marcos Nascimento; Magalhães, Maria Cecilia Camargo

2014-01-01

In this paper, we report on the impact of four activities and two interviews on the organization of an introductory statistics course attended by future mathematics teachers at the University of Sao Paulo, Brazil. The activities were designed to enhance students' learning and collaborative knowledge construction, based on Vygotsky's…

Exploring Foundation Concepts in Introductory Statistics Using Dynamic Data Points

Science.gov (United States)

Ekol, George

2015-01-01

This paper analyses introductory statistics students' verbal and gestural expressions as they interacted with a dynamic sketch (DS) designed using "Sketchpad" software. The DS involved numeric data points built on the number line whose values changed as the points were dragged along the number line. The study is framed on aggregate…

A Simulation Game for an Introductory Course in International Business

Science.gov (United States)

McGuinness, Michael J.

2004-01-01

An international business simulation game designed for an introductory International Business course. The simulation game allows for student decision making and allows for the ready introduction of many topics which are covered in an International Business course. The simulation game has continued to be improved with student suggestions and has…

Pedagogic discourse in introductory classes: Multi-dimensional analysis of textbooks and lectures in biology and macroeconomics

Science.gov (United States)

Carkin, Susan

The broad goal of this study is to represent the linguistic variation of textbooks and lectures, the primary input for student learning---and sometimes the sole input in the large introductory classes which characterize General Education at many state universities. Computer techniques are used to analyze a corpus of textbooks and lectures from first-year university classes in macroeconomics and biology. These spoken and written variants are compared to each other as well as to benchmark texts from other multi-dimensional studies in order to examine their patterns, relations, and functions. A corpus consisting of 147,000 words was created from macroeconomics and biology lectures at a medium-large state university and from a set of nationally "best-selling" textbooks used in these same introductory survey courses. The corpus was analyzed using multi-dimensional methodology (Biber, 1988). The analysis consists of both empirical and qualitative phases. Quantitative analyses are undertaken on the linguistic features, their patterns of co-occurrence, and on the contextual elements of classrooms and textbooks. The contextual analysis is used to functionally interpret the statistical patterns of co-occurrence along five dimensions of textual variation, demonstrating patterns of difference and similarity with reference to text excerpts. Results of the analysis suggest that academic discourse is far from monolithic. Pedagogic discourse in introductory classes varies by modality and discipline, but not always in the directions expected. In the present study the most abstract texts were biology lectures---more abstract than written genres of academic prose and more abstract than introductory textbooks. Academic lectures in both disciplines, monologues which carry a heavy informational load, were extremely interactive, more like conversation than academic prose. A third finding suggests that introductory survey textbooks differ from those used in upper division classes by being

Design guidelines for adapting scientific research articles: An example from an introductory level, interdisciplinary program on soft matter

Science.gov (United States)

Langbeheim, Elon; Safran, Samuel A.; Yerushalmi, Edit

2013-01-01

We present design guidelines for using Adapted Primary Literature (APL) as part of current interdisciplinary topics to introductory physics students. APL is a text genre that allows students to comprehend a scientific article, while maintaining the core features of the communication among scientists, thus representing an authentic scientific discourse. We describe the adaptation of a research paper by Nobel Laureate Paul Flory on phase equilibrium in polymer-solvent mixtures that was presented to high school students in a project-based unit on soft matter. The adaptation followed two design strategies: a) Making explicit the interplay between the theory and experiment. b) Re-structuring the text to map the theory onto the students' prior knowledge. Specifically, we map the theory of polymer-solvent systems onto a model for binary mixtures of small molecules of equal size that was already studied in class.

TA Mentorship in Lecture significantly enhances students' learning in mechanics in large introductory physics classes

Science.gov (United States)

Cheng, K.; Caglar, Mehmet

2011-10-01

Lab is an important component of students' learning in a traditional lecture-lab setting of introductory physics courses. Using standard mechanics concepts and baseline surveys as well as independent classroom observations, the effects of TA mentorship in Lecture on students' learning of physics concepts and problem-solving skills among different student subgroups taught by other TAs and lecturers using different level of student interactive engagement in classes have been analyzed. Our data indicate that in lecture training of TA promotes lecture/lab synergism in improvement students' learning of mechanics in large introductory physics classes.

Cognitive development in introductory physics: A research-based approach to curriculum reform

Science.gov (United States)

Teodorescu, Raluca Elena

This project describes the research on a classification of physics problems in the context of introductory physics courses. This classification, called the Taxonomy of Introductory Physics Problems (TIPP), relates physics problems to the cognitive processes required to solve them. TIPP was created for designing and clarifying educational objectives, for developing assessments that can evaluate individual component processes of the problem-solving process, and for guiding curriculum design in introductory physics courses, specifically within the context of a "thinking-skills" curriculum. TIPP relies on the following resources: (1) cognitive research findings adopted by physics education research, (2) expert-novice research discoveries acknowledged by physics education research, (3) an educational psychology taxonomy for educational objectives, and (4) various collections of physics problems created by physics education researchers or developed by textbook authors. TIPP was used in the years 2006--2008 to reform the first semester of the introductory algebra-based physics course (called Phys 11) at The George Washington University. The reform sought to transform our curriculum into a "thinking-skills" curriculum that trades "breadth for depth" by focusing on fewer topics while targeting the students' cognitive development. We employed existing research on the physics problem-solving expert-novice behavior, cognitive science and behavioral science findings, and educational psychology recommendations. Our pedagogy relies on didactic constructs such as the GW-ACCESS problem-solving protocol, learning progressions and concept maps that we have developed and implemented in our introductory physics course. These tools were designed based on TIPP. Their purpose is: (1) to help students build local and global coherent knowledge structures, (2) to develop more context-independent problem-solving abilities, (3) to gain confidence in problem solving, and (4) to establish

An Administrator's Manual for Planning, Developing, and Implementing Mainstream, Self-Contained, or Co-op Programs for the Disadvantaged.

Science.gov (United States)

Pennsylvania State Univ., University Park. Div. of Occupational and Vocational Studies.

This administrator's manual contains guidelines for planning, developing, and implementing mainstream, self-contained, or cooperative work experience programs for the disadvantaged. Outlined in the introductory section are the philosophy underlying programs for the disadvantaged, procedures to determine student eligibility, signals indicating the…

The Introductory Psychology Textbook Market: Perceptions of Authors and Editors.

Science.gov (United States)

Griggs, Richard A.; Jackson, Sherri L.

1989-01-01

Surveys psychology textbook authors and editors on their perceptions of the introductory psychology textbook market. Finds that the textbook market is divided into three levels according to quality, and that authors and editors are not familiar with most textbooks. Notes that the growth of used book companies has adversely affected the market.…

An Engineering-Oriented Approach to the Introductory Differential Equations Course

Science.gov (United States)

Pennell, S.; Avitabile, P.; White, J.

2009-01-01

The introductory differential equations course can be made more relevant to engineering students by including more of the engineering viewpoint, in which differential equations are regarded as systems with inputs and outputs. This can be done without sacrificing any of the usual topical coverage. This point of view is conducive to student…

Core References in Introductory Social Psychology and Developmental Psychology Textbooks

Science.gov (United States)

Whitehead, George I., III; Smith, Stephanie H.; Losonczy-Marshall, Marta

2017-01-01

The purpose of the present study was to identify the core references in introductory textbooks in two sub-disciplines of psychology: social psychology and developmental psychology. One research question was the extent to which the common references in these textbooks present the trends in contemporary research in each sub-discipline. An analysis…

Challenges in Understanding Photosynthesis in a University Introductory Biosciences Class

Science.gov (United States)

Södervik, Ilona; Virtanen, Viivi; Mikkilä-Erdmann, Mirjamaija

2015-01-01

University students' understanding of photosynthesis was examined in a large introductory biosciences class. The focus of this study was to first examine the conceptions of photosynthesis among students in class and then to investigate how a certain type of text could enhance students' understanding of photosynthesis. The study was based on pre-…

Eating Competence of College Students in an Introductory Nutrition Course

Science.gov (United States)

Brown, Lora Beth; Larsen, Katrina J.; Nyland, Nora K.; Eggett, Dennis L.

2013-01-01

Objective: Describe eating competence, a positive and flexible way of conceptualizing eating attitudes and behaviors, in students enrolled in an introductory nutrition course. Methods: Online completion of the Satter Eating Competence Inventory (ecSI) and self-assessment of eating disorder status by 557 students (343 ages 18-20 years and 180 ages…

Multiple-Choice Exams: An Obstacle for Higher-Level Thinking in Introductory Science Classes

Science.gov (United States)

Stanger-Hall, Kathrin F.

2012-01-01

Learning science requires higher-level (critical) thinking skills that need to be practiced in science classes. This study tested the effect of exam format on critical-thinking skills. Multiple-choice (MC) testing is common in introductory science courses, and students in these classes tend to associate memorization with MC questions and may not see the need to modify their study strategies for critical thinking, because the MC exam format has not changed. To test the effect of exam format, I used two sections of an introductory biology class. One section was assessed with exams in the traditional MC format, the other section was assessed with both MC and constructed-response (CR) questions. The mixed exam format was correlated with significantly more cognitively active study behaviors and a significantly better performance on the cumulative final exam (after accounting for grade point average and gender). There was also less gender-bias in the CR answers. This suggests that the MC-only exam format indeed hinders critical thinking in introductory science classes. Introducing CR questions encouraged students to learn more and to be better critical thinkers and reduced gender bias. However, student resistance increased as students adjusted their perceptions of their own critical-thinking abilities. PMID:22949426

Establishment of nuclear knowledge-information base; development of courseware on introductory nuclear engineering and establishment of digital education platform

Energy Technology Data Exchange (ETDEWEB)

Song, Jong Soon; Na, Mang Yun; Lee, Goung Jin; Yang, Won Sik [Chosun University, Gwangju (Korea)

2002-01-01

In this research, there are two major tasks. The first one is a development of digital course-ware program for introductory nuclear engineering. For this task, a development of lecture note is followed by lecture Slide files in html file format, which is based on web. For this purpose, following activities were performed; collection of related materials. planning of overall courseware, writing of lecture note and exercise plan, and securing the computer programs and codes needed. The second task of this research is to plan and install several hardwares in a multimedia class room as a digital education platform. The platform includes smart board with touch screen functionality, network server and personal computers. The digital education platform was established as a multimedia class room in the 2nd College of Engineering building, room 16210 by using the Server-Client environment and smart board, personal computer, and internet was connected by a TCP/IP way. For the courseware, hypertext was supported to be web-based, and photo, picture, data and related web links including text were developed in a close relation, it is possible for students to study big amounts of information in a systemized way and to maximize the learning efficiency. The whole range of introductory nuclear engineering course was divided into nuclear fuel cycle, reactor theory, heat transport, and reactor control, and digital contents were developed by each experts, but the final format of the courseware was maintained consistently for easy understanding . Also, the reactor experiment courseware developed by Kyunghee University can be utilized on this platform. 5 refs., 36 figs., 4 tabs. (Author)

Introductory comments on the USGS geographic applications program

Science.gov (United States)

Gerlach, A. C.

1970-01-01

The third phase of remote sensing technologies and potentials applied to the operations of the U.S. Geological Survey is introduced. Remote sensing data with multidisciplinary spatial data from traditional sources is combined with geographic theory and techniques of environmental modeling. These combined imputs are subject to four sequential activities that involve: (1) thermatic mapping of land use and environmental factors; (2) the dynamics of change detection; (3) environmental surveillance to identify sudden changes and general trends; and (4) preparation of statistical model and analytical reports. Geography program functions, products, clients, and goals are presented in graphical form, along with aircraft photo missions, geography test sites, and FY-70.

Using Robotics to Improve Retention and Increase Comprehension in Introductory Programming Courses

Science.gov (United States)

Pullan, Marie

2013-01-01

Several college majors, outside of computer science, require students to learn computer programming. Many students have difficulty getting through the programming sequence and ultimately change majors or drop out of college. To deal with this problem, active learning techniques were developed and implemented in a freshman programming logic and…

Mississippi Curriculum Framework for Diesel Equipment Technology (CIP: 47.0605--Diesel Engine Mechanic & Repairer). Postsecondary Programs.

Science.gov (United States)

Mississippi Research and Curriculum Unit for Vocational and Technical Education, State College.

This document, which is intended for use by community and junior colleges throughout Mississippi, contains curriculum frameworks for the course sequences in the diesel equipment technology programs cluster. Presented in the introductory section are a description of the program and suggested course sequence. Section I lists baseline competencies,…

Introductory life science mathematics and quantitative neuroscience courses.

Science.gov (United States)

Duffus, Dwight; Olifer, Andrei

2010-01-01

We describe two sets of courses designed to enhance the mathematical, statistical, and computational training of life science undergraduates at Emory College. The first course is an introductory sequence in differential and integral calculus, modeling with differential equations, probability, and inferential statistics. The second is an upper-division course in computational neuroscience. We provide a description of each course, detailed syllabi, examples of content, and a brief discussion of the main issues encountered in developing and offering the courses.

Mediating Relationship of Differential Products in Understanding Integration in Introductory Physics

Science.gov (United States)

Amos, Nathaniel; Heckler, Andrew F.

2018-01-01

In the context of introductory physics, we study student conceptual understanding of differentials, differential products, and integrals and possible pathways to understanding these quantities. We developed a multiple choice conceptual assessment employing a variety of physical contexts probing physical understanding of these three quantities and…

Beyond Euler's Method: Implicit Finite Differences in an Introductory ODE Course

Science.gov (United States)

Kull, Trent C.

2011-01-01

A typical introductory course in ordinary differential equations (ODEs) exposes students to exact solution methods. However, many differential equations must be approximated with numerical methods. Textbooks commonly include explicit methods such as Euler's and Improved Euler's. Implicit methods are typically introduced in more advanced courses…

Ups and downs of using ``kitchen sink'' experiments in an introductory fluid mechanics class

Science.gov (United States)

Kaye, Nigel

2015-11-01

Both positive and negative experiences from two semesters of using take home ``kitchen sink'' experiments in an introductory civil engineering fluid mechanics class are reported. Four different experimental assignments were given each semester to groups of four students. The students were tasked with using common household equipment to measure various properties of fluids or fluid flows. These included the density of cooking oil, the exit velocity from a garden hose, and the mass flux of air from a compressed air can. Students were given minimal guidance on how to do the measurements and each measurement had to be done in at least two different ways. The labs were used to relate their course work to everyday situations and was also used as a platform for discussing experimental uncertainty and error propagation in calculations. In general the students successfully completed each task using at least one method. Finding a second method sometimes proved problematic. The presentation will discuss the logistics of running the program and the positive and negative aspects from the instructor viewpoint. A summary of student feedback on the labs will also be presented. Links to resources for those interested in implementing such a program will be provided.

Quantitative Activities for Introductory Astronomy

Science.gov (United States)

Keohane, Jonathan W.; Bartlett, J. L.; Foy, J. P.

2010-01-01

We present a collection of short lecture-tutorial (or homework) activities, designed to be both quantitative and accessible to the introductory astronomy student. Each of these involves interpreting some real data, solving a problem using ratios and proportionalities, and making a conclusion based on the calculation. Selected titles include: "The Mass of Neptune” "The Temperature on Titan” "Rocks in the Early Solar System” "Comets Hitting Planets” "Ages of Meteorites” "How Flat are Saturn's Rings?” "Tides of the Sun and Moon on the Earth” "The Gliese 581 Solar System"; "Buckets in the Rain” "How Hot, Bright and Big is Betelgeuse?” "Bombs and the Sun” "What Forms Stars?” "Lifetimes of Cars and Stars” "The Mass of the Milky” "How Old is the Universe?” "Is The Universe Speeding up or Slowing Down?"

The Effects of Different Teaching Approaches in Introductory Financial Accounting

Science.gov (United States)

Chiang, Bea; Nouri, Hossein; Samanta, Subarna

2014-01-01

The purpose of the research is to examine the effect of the two different teaching approaches in the first accounting course on student performance in a subsequent finance course. The study compares 128 accounting and finance students who took introductory financial accounting by either a user approach or a traditional preparer approach to examine…

Basic Math Skills and Performance in an Introductory Economics Class

Science.gov (United States)

Ballard, Charles L.; Johnson, Marianne F.

2004-01-01

The authors measure math skills with a broader set of explanatory variables than have been used in previous studies. To identify what math skills are important for student success in introductory microeconomics, they examine (1) the student's score on the mathematics portion of the ACT Assessment Test, (2) whether the student has taken calculus,…

OkCupid Data for Introductory Statistics and Data Science Courses

Science.gov (United States)

Kim, Albert Y.; Escobedo-Land, Adriana

2015-01-01

We present a data set consisting of user profile data for 59,946 San Francisco OkCupid users (a free online dating website) from June 2012. The data set includes typical user information, lifestyle variables, and text responses to 10 essay questions. We present four example analyses suitable for use in undergraduate introductory probability and…

Teaching Introductory GIS Programming to Geographers Using an Open Source Python Approach

Science.gov (United States)

Etherington, Thomas R.

2016-01-01

Computer programming is not commonly taught to geographers as a part of geographic information system (GIS) courses, but the advent of NeoGeography, big data and open GIS means that programming skills are becoming more important. To encourage the teaching of programming to geographers, this paper outlines a course based around a series of…

75 FR 44067 - Conservation Reserve Program

Science.gov (United States)

2010-07-28

... using Prices Paid by Farmer Index as compiled by the USDA National Agricultural Statistics Service), and...) introductory text, (a)(2)(i)(B), (a)(2)(i)(C), (a)(2)(ii) introductory text, (a)(2)(ii))B), (a)(3), (b)(1) introductory text, (b)(2)(iii), (b)(6), (b)(7), (b)(11), (b)(12), (c) introductory text and (c)(3), remove the...

A Tutorial Design Process Applied to an Introductory Materials Engineering Course

Science.gov (United States)

Rosenblatt, Rebecca; Heckler, Andrew F.; Flores, Katharine

2013-01-01

We apply a "tutorial design process", which has proven to be successful for a number of physics topics, to design curricular materials or "tutorials" aimed at improving student understanding of important concepts in a university-level introductory materials science and engineering course. The process involves the identification…

Accounting History in Undergraduate Introductory Financial Accounting Courses: An Exploratory Study.

Science.gov (United States)

Williams, Satina V.; Schwartz, Bill N.

2002-01-01

Accounting faculty surveyed (n=45) did not overwhelmingly support incorporating accounting history into introductory courses, despite Accounting Education Change Commission recommendations. They did not support a separate course or believe history would attract more students. Attitudes of those already including history did not differ greatly from…

How We Teach Introductory Bible Courses: A Comparative and Historical Sampling

Science.gov (United States)

Cornell, Collin; LeMon, Joel M.

2016-01-01

This study identifies the dominant modes of biblical interpretation being taught in introductory Bible courses through a qualitative analysis of course syllabi from three institutional contexts: evangelical Christian colleges, private colleges, and public universities. Despite a proliferation of methods and scholarly approaches to the Bible, this…

Preliminary Investigation of Instructor Effects on Gender Gap in Introductory Physics

Science.gov (United States)

Kreutzer, Kimberley; Boudreaux, Andrew

2012-01-01

Gender differences in student learning in the introductory, calculus-based electricity and magnetism course were assessed by administering the Conceptual Survey of Electricity and Magnetism pre- and postcourse. As expected, male students outgained females in traditionally taught sections as well as sections that incorporated interactive engagement…

Clinical Application Projects (CAPs) for Health Science Students in Introductory Microbiology.

Science.gov (United States)

Halyard, Rebecca A.

Clinical Application Projects (CAPs) have been developed that allow dental hygiene and nursing students to apply introductory microbiology principles and skills learned in lecture and laboratory to a problem in an appropriate clinical situation. CAPs therefore substitute for the traditional study of "unknowns". Principles and processes emphasized…

Activating Theory in the Introductory Classroom: Erving Goffman Visits Wisteria Lane

Science.gov (United States)

Melander, Lisa A.; Wortmann, Susan L.

2011-01-01

Instructors of large, general education lecture courses face a number of student engagement and learning challenges. In this article, we develop and assess an interactive lecture that introduces a theoretical perspective and three related concepts to two introductory sociology general education classrooms (n = 433). This interactive lecture…

The Stanford Prison Experiment in Introductory Psychology Textbooks: A Content Analysis

Science.gov (United States)

Bartels, Jared M.

2015-01-01

The present content analysis examines the coverage of theoretical and methodological problems with the Stanford prison experiment (SPE) in a sample of introductory psychology textbooks. Categories included the interpretation and replication of the study, variance in guard behavior, participant selection bias, the presence of demand characteristics…

Effectively Using Discussion Boards to Engage Students in Introductory Leadership Courses

Science.gov (United States)

Smith, Deborah N.

2015-01-01

This article discusses the use of online asynchronous discussion boards as a valuable tool for connecting students to leadership concepts, theories, and models in introductory leadership survey courses. Recommendations are given for designing effective discussion boards that engage students and enhance their learning. Student outcomes include…

Influence of Course Delivery Method and Proctoring on Performance in Introductory Economics

OpenAIRE

Wachenheim, Cheryl J.

2011-01-01

This work was published in the Review of Agricultural Economics. See Wachenheim, C.J. 2009. Final Exam Scores in Introductory Economics Courses: Effect of Course Delivery Method and Proctoring. Review of Agricultural Economics 31(3), pp. 640-652.

The Approaches to Studying of Portuguese Students of Introductory Accounting

Science.gov (United States)

Teixeira, Cláudia; Gomes, Delfina; Borges, Janete

2013-01-01

The focus of this paper is an investigation into the approaches to studying of Portuguese students of introductory accounting using the short version of the ASSIST instrument. In doing so, it also examined the impact upon the strategy adopted of the discipline area of students and gender. The results validate the use of the inventory with students…

Lin's theory of flux and nuclear reactions

International Nuclear Information System (INIS)

Ping-Wha Lin

2002-01-01

Mathematical development of Lin's theory of flux is presented. Based on the Theory, when a chemical reaction system is subjected to a high time rate of temperature change, it changes from equilibrium to non-equilibrium conditions. It is proved mathematically that, when a gas system is subjected to a high time rate of temperature increase, the activities of particles (molecules, atoms or nuclei, and electrons) are increased: the particles are accelerated; frequencies and amplitudes of electron and atomic vibrations in a molecule increased; average kinetic energy of the particles increased; atomic bonds are ruptured; electrons are caused to leave their orbits. If most or all of the electrons leave their orbits, the gas fluid becomes plasma, which is very active chemically. The acceleration of nuclei in the dynamic condition can lead to nuclear reactions. In the pilot plant studies conducted at Research Triangle, NC, USA, for SO 2 conversion to SO 3 by rapid heating, a 10-ft high vertically fired combustor (VFC) was used. Air containing 0.5% SO 2 is forced continuously through the VFC, where it is heated by burners for conversion of SO 2 to SO 3 . During the idle period of operation, no external heat is added to the system by turning off the burners. It is observed that, as the air passing through the VFC during the idle period of sixteen hours, the temperature of the flowing air consistently rises up rapidly from ambient temperature (90 deg F) at inlet of the VFC to an average temperature as high as 582 deg F (in the range of 840 deg F to 455 deg F) at one section of the VFC, an increase of about 500 deg F. The air flow temperature increase of such large magnitude and long duration clearly indicates that nuclear reactions are present in VFC. It is also found that the water vapour in the air stream has completely disappeared in the VFC, for no sulphuric acid formation resulting from the reaction of water and SO 3 is detected there. Presumably, the water vapour in the

GeoWall use in an Introductory Geology laboratory: Impacts in Student Understanding of Field Mapping Concepts

Science.gov (United States)

Ross, L. E.; Kelly, M.; Springer, A. E.

2003-12-01

In the Fall semester of 2003, Northern Arizona University will introduce the GeoWall to its introductory geology courses. This presents an opportunity to assess the impact of this new technology on students' understanding of basic topographic concepts and the spatial relationships between geology, topography, and hydrology on a field trip. Introductory Geology fulfills the Lab Science component of the Liberal Studies Program at Northern Arizona University. The class is open to all Northern Arizona University students, and is most commonly taken by non-science majors. In this class students learn to: locate their position using maps, identify common minerals and rocks, recognize the relationship between geology and geomorphology, visualize how rocks exposed at the surface continue into the subsurface, and to draw conclusions about possible geologic hazards in different settings. In this study we will report how a GeoWall 3D visualization technology was used in a field study of a graben south of Flagstaff. The goal of the field exercise is to improve students' ability to synthesize data collected at field stops into a conceptual model of the graben, linking geology, geomorphology and hydrology. We plan to present a quantitative assessment of the GeoWall learning objectives from data collected from a paired test and control group of students. Teaching assistants (TAs) with two or more lab classes have been identified; these TAs will participate in both GeoWall and non-GeoWall lab exercises. The GeoWall use will occur outside of normal lab hours to avoid disrupting the lab schedule during the eighth week of lab. This field preparation exercise includes a 3D visualization of the Lake Mary graben rendered with the ROMA software. The following week, all students attend the graben field trip; immediately following the trip, students will interviewed about their gain in understanding of the geologic features illustrated during the field trip. The results of the post

The Effect of Stereotype Threat on Undergraduates in AN Introductory Astronomy Class

Science.gov (United States)

Hufnagel, Beth; Deming, Grace L.; Landato, Janet M.; Hodari, Apriel K.

This quantitative study tests the hypothesis that undergraduates taking an introductory astronomy class for nonscience majors are susceptible to stereotype threat (ST). The Astronomy Diagnostic Test (ADT), a conceptual survey designed for introductory astronomy classes, was administered pre- and postcourse to two pairs (control and threatened) of the same class taught by the same professors, one pair at a public, suburban community college and the other pair at a large, state research university. One class of each pair was threatened postcourse by telling the students that their gender mattered on the ADT. The results showed no ST effect on the women in the university class. The college women underperformed and the men overperformed at a low statistical significance. The authors infer that Steele's requirement for domain identification as a condition is also required to strongly invoke ST for this sample of nonscience students.

Using Arduino to Teach Programming to First-Year Computer Science Students

Science.gov (United States)

Tan, Wee Lum; Venema, Sven; Gonzalez, Ruben

2017-01-01

Transitioning to university is recognised as a challenging endeavour for commencing students. For commencing Computer Science students specifically, evidence suggests a link between poor performance in introductory technical courses, such as programming, and high attrition rates. Building resilience in students, particularly at the start of their…

Introductory lectures on Chern-Simons theories

Science.gov (United States)

Zanelli, Jorge

2012-02-01

The Chern-Simons (CS) form evolved from an obstruction in mathematics into an important object in theoretical physics. In fact, the presence of CS terms in physics is more common than one may think. They are found in the studies of anomalies in quantum field theories and as Lagrangians for gauge fields, including gravity and supergravity. They seem to play an important role in high Tc superconductivity and in recently discovered topological insulators. CS forms are also the natural generalization of the minimal coupling between the electromagnetic field and a point charge when the source is not point-like but an extended fundamental object, a membrane. A cursory review of these ideas is presented at an introductory level.

Using an Isomorphic Problem Pair to Learn Introductory Physics: Transferring from a Two-Step Problem to a Three-Step Problem

Science.gov (United States)

Lin, Shih-Yin; Singh, Chandralekha

2013-01-01

In this study, we examine introductory physics students' ability to perform analogical reasoning between two isomorphic problems which employ the same underlying physics principles but have different surface features. 382 students from a calculus-based and an algebra-based introductory physics course were administered a quiz in the recitation…

The Socratic Method in the Introductory PR Course: An Alternative Pedagogy.

Science.gov (United States)

Parkinson, Michael G.; Ekachai, Daradirek

2002-01-01

Presents the results of a study comparing student reactions to and perceptions of learning in introductory public relations courses using a traditional lecture format and a Socratic approach. Finds significant differences in the two groups showing that students who received the Socratic instruction reported more opportunities in practicing their…

An Alternative to the Problematic Macro-Micro Structure of Introductory Economics.

Science.gov (United States)

Tinari, Frank D.

The paper explains an alternative structure to teaching micro and macroeconomic theory and describes the characteristics that make it an effective framework for introductory and principles courses. The teaching of economics principles typically proceeds by separating macroeconomic theory and microeconomic theory. But the use of the macro-micro…

Explaining Electromagnetic Plane Waves in a Vacuum at the Introductory Level

Science.gov (United States)

Allred, Clark L.; Della-Rose, Devin J.; Flusche, Brian M.; Kiziah, Rex R.; Lee, David J.

2010-01-01

A typical introduction to electromagnetic waves in vacuum is illustrated by the following quote from an introductory physics text: "Maxwell's equations predict that an electromagnetic wave consists of oscillating electric and magnetic fields. The changing fields induce each other, which maintains the propagation of the wave; a changing electric…

"Big Questions" in the Introductory Religion Classroom: Expanding the Integrative Approach

Science.gov (United States)

Deffenbaugh, Daniel G.

2011-01-01

Recent research by Barbara Walvoord suggests a perceived disparity between faculty learning objectives and students' desire to engage "big questions" in the introductory religion classroom. Faculty opinions of such questions are varied, ranging from a refusal to employ any approach that diverts attention away from critical thinking, to a…

Teaching Critical Thinking: An Investigation of a Task in Introductory Macroeconomics

Science.gov (United States)

Jones, Anna

2004-01-01

This paper is an investigation of understandings of critical thinking from two teaching perspectives: academic staff and tutors. It explores critical thinking as situated within an assessment task in introductory macroeconomics. This study found that while the two academic staff conceptualized critical thinking as a set of concrete cognitive…

Instructional strategies for online introductory college physics based on learning styles

Science.gov (United States)

Ekwue, Eleazer U.

The practical nature of physics and its reliance on mathematical presentations and problem solving pose a challenge toward presentation of the course in an online environment for effective learning experience. Most first-time introductory college physics students fail to grasp the basic concepts of the course and the problem solving skills if the instructional strategy used to deliver the course is not compatible with the learners' preferred learning styles. This study investigates the effect of four instructional strategies based on four learning styles (listening, reading, iconic, and direct-experience) to improve learning for introductory college physics in an online environment. Learning styles of 146 participants were determined with Canfield Learning Style inventory. Of the 85 learners who completed the study, research results showed a statistically significant increase in learning performance following the online instruction in all four learning style groups. No statistically significant differences in learning were found among the four groups. However, greater significant academic improvement was found among learners with iconic and direct-experience modes of learning. Learners in all four groups expressed that the design of the unit presentation to match their individual learning styles contributed most to their learning experience. They were satisfied with learning a new physics concept online that, in their opinion, is either comparable or better than an instructor-led classroom experience. Findings from this study suggest that learners' performance and satisfaction in an online introductory physics course could be improved by using instructional designs that are tailored to learners' preferred ways of learning. It could contribute toward the challenge of providing viable online physics instruction in colleges and universities.

Understanding the elementary considerations in a network warfare environment: an introductory framework

CSIR Research Space (South Africa)

Veerasamy, N

2008-07-01

Full Text Available . It seeks to offer a better introductory understanding to the field of network warfare. This paper addresses the requirements for a network warfare capability and will look at the high-level approach, constraints, focus areas, levels, techniques...

Help Increase the Peace, A Youth-Focused Program in Peace Education

Science.gov (United States)

Morrison, Mary Lee; Austad, Carol Shaw; Cota, Kate

2011-01-01

This study investigated specific attitudes and beliefs, related to the concepts of peace education, of participants in an "Introductory, basic help increase the peace program" (HIPP) workshop. Pre- and post-workshop ratings showed significant differences on two important attitudinal variables: first, the importance of being familiar with the…

Microworlds for Learning Object-Oriented Programming: Considerations from Research to Practice

Science.gov (United States)

Djelil, Fahima; Albouy-Kissi, Adelaide; Albouy-Kissi, Benjamin; Sanchez, Eric; Lavest, Jean-Marc

2016-01-01

Object-Oriented paradigm is a common paradigm for introductory programming courses. However, many teachers find that transitioning to teaching this paradigm is a difficult task. To overcome this complexity, many experienced teachers use microworlds to give beginner students an intuitive and rapid understanding of fundamental abstract concepts of…

The Application of VARK Learning Styles in Introductory Level Economics Units

Science.gov (United States)

Wright, Sarah; Stokes, Anthony

2015-01-01

The issues of developing strategies and approaches to teaching introductory level economics courses at university have been long standing. With the development of economics learning standards in Australia, this is a time to consider teaching and learning approaches to engage students and develop skills in economics. This paper considers that to…

Analyzing Conceptual Gains in Introductory Calculus with Interactively-Engaged Teaching Styles

Science.gov (United States)

Thomas, Matthew

2013-01-01

This dissertation examines the relationship between an instructional style called Interactive-Engagement (IE) and gains on a measure of conceptual knowledge called the Calculus Concept Inventory (CCI). The data comes from two semesters of introductory calculus courses (Fall 2010 and Spring 2011), consisting of a total of 482 students from the…

Exploring the Relationship between Self-Efficacy and Retention in Introductory Physics

Science.gov (United States)

Sawtelle, Vashti; Brewe, Eric; Kramer, Laird H.

2012-01-01

The quantitative results of Sources of Self-Efficacy in Science Courses-Physics (SOSESC-P) are presented as a logistic regression predicting the passing of students in introductory Physics with Calculus I, overall as well as disaggregated by gender. Self-efficacy as a theory to explain human behavior change [Bandura [1977] "Psychological…

Development and Assessment of a Preliminary Randomization-Based Introductory Statistics Curriculum

Science.gov (United States)

Tintle, Nathan; VanderStoep, Jill; Holmes, Vicki-Lynn; Quisenberry, Brooke; Swanson, Todd

2011-01-01

The algebra-based introductory statistics course is the most popular undergraduate course in statistics. While there is a general consensus for the content of the curriculum, the recent Guidelines for Assessment and Instruction in Statistics Education (GAISE) have challenged the pedagogy of this course. Additionally, some arguments have been made…

Effect of Task Presentation on Students' Performances in Introductory Statistics Courses

Science.gov (United States)

Tomasetto, Carlo; Matteucci, Maria Cristina; Carugati, Felice; Selleri, Patrizia

2009-01-01

Research on academic learning indicates that many students experience major difficulties with introductory statistics and methodology courses. We hypothesized that students' difficulties may depend in part on the fact that statistics tasks are commonly viewed as related to the threatening domain of math. In two field experiments which we carried…

Effects of a Case-Based Reasoning System on Student Performance in a Java Programming Course

Science.gov (United States)

Schmidt, Cecil

2007-01-01

The purpose of this study was to determine if a case-based reasoning tool would improve a student's understanding of the complex concepts in a Java programming course. Subjects for the study were randomly assigned from two sections of an introductory Java programming course. Posttests were used to measure the effects of the case-based reasoning…

The physical basis of electronics an introductory course

CERN Document Server

Harris, D J; Hammond, P

1975-01-01

The Physical Basis of Electronics: An Introductory Course, Second Edition is an 11-chapter text that discusses the physical concepts of electronic devices. This edition deals with the considerable advances in electronic techniques, from the introduction of field effect transistors to the development of integrated circuits. The opening chapters discuss the fundamentals of vacuum electronics and solid-state electronics. The subsequent chapters deal with the other components of electronic devices and their functions, including semiconductor diode and transistor as an amplifier and a switch. The d

Using Visual Analogies To Teach Introductory Statistical Concepts

Directory of Open Access Journals (Sweden)

Jessica S. Ancker

2017-07-01

Full Text Available Introductory statistical concepts are some of the most challenging to convey in quantitative literacy courses. Analogies supplemented by visual illustrations can be highly effective teaching tools. This literature review shows that to exploit the power of analogies, teachers must select analogies familiar to the audience, explicitly link the analog with the target concept, and avert misconceptions by explaining where the analogy fails. We provide guidance for instructors and a series of visual analogies for use in teaching medical and health statistics.

Geology in the Movies: Using Hollywood Films as a Teaching Tool in Introductory Geosciences Courses

Science.gov (United States)

Lawrence, K. T.; Malinconico, L. L.

2008-12-01

A common challenge in introductory Geoscience courses is engaging students who often do not have a long- standing interest in science. In recent years Hollywood has produced a number of geoscience-themed films (Dante's Peak, Deep Impact, Day After Tomorrow, Inconvenient Truth), most of which contain kernels of scientific truth as well as gross misrepresentations of scientific reality. In our introductory courses (Geological Disasters: Agents of Chaos and Earth's Climate: Past Present and Future) we have had great success using these films as a way of both engaging students and accomplishing many of our course goals. Even though most of the students in these courses will not become geoscience majors, it is important for them to realize that they can make informed judgments about concepts portrayed in the popular media. We have incorporated short written movie critiques into our suite of introductory course laboratory exercises. Through these movie-critique labs, students have an opportunity to apply their new geoscience expertise to examining the validity of the scientific concepts presented in the film. Along the way, students start to see the relevance of course materials to their everyday lives, think more critically about how science is portrayed by non-scientists, synthesize what they have learned by applying their knowledge to a new problem, and improve their ability to communicate what they have learned. Despite the fact that these movie-critique labs require significantly more out-of-lab effort that our other introductory lab assignments, in our course evaluations many students rate the movie critiques as not only one of the most interesting lab exercises of the semester, but also the lab exercise containing the most educational value.

A Modified Approach to the Introductory Economics Course in a School of Business

Science.gov (United States)

Crockett, G. V.

1977-01-01

Describes course format, materials development, and evaluation of an introductory economics course which stressed problem solving techniques and conceptual skills instead of rote memorization of factual content. For journal availability, see SO 506 029. (AV)

Food Preparation and Service. An Introductory Course for Food Services Careers.

Science.gov (United States)

Douma, Elaine L.

Intended for use in a comprehensive senior high school, this curriculum guide for an introductory laboratory course focuses on the development of abilities, attitudes, and personal qualities which would lead to job success at the entry level in the food service industry, including in the areas of cooking, waitressing, supermarkets, and similar…

Instructional Strategies for Online Introductory College Physics Based on Learning Styles

Science.gov (United States)

Ekwue, Eleazer U.

2013-01-01

The practical nature of physics and its reliance on mathematical presentations and problem solving pose a challenge toward presentation of the course in an online environment for effective learning experience. Most first-time introductory college physics students fail to grasp the basic concepts of the course and the problem solving skills if the…

Success in Introductory College Physics: The Role of High School Preparation.

Science.gov (United States)

Sadler, Philip M.; Tai, Robert H.

2001-01-01

Examines the extent to which a high school physics course prepares students for college physics success. In this study of 1,933 introductory college physics students, demographic and schooling factors account for a large fraction of the variation in college physics grades at 18 colleges and universities from around the nation. (Author/SAH)

Content Analysis of Introductory Interior Design College Textbooks: A Study Revisited

Science.gov (United States)

Temple, Julie A.; Potthoff, Joy K.

2013-01-01

Introductory interior design texts adopted by design educators present information relevant to both historical and contemporary issues in interior design. According to one author, they provide a "survey of the field of interior design as it now exists" (Pile, 2007). A comparison of the content of contemporary texts with those of more…

Do Introductory Statistics Courses in the United States Improve Students' Attitudes?

Science.gov (United States)

Schau, Candace; Emmioglu, Esma

2012-01-01

We examined the attitudes of about 2200 students enrolled in 101 sections of post-secondary introductory statistics service courses located across the United States. Using the "Survey of Attitudes Toward Statistics-36," we assessed students' attitudes when they entered and left their courses, as well as changes in attitudes across their courses.…

The joy of stats a short guide to introductory statistics in the social sciences

CERN Document Server

Garner, Roberta

2010-01-01

"This is a great book for social science students. Clearly written, with many examples, Garner certainly makes learning and teaching introductory statistics a joy!" - Nikolaos Liodakis, Wilfrid Laurier University.

Use of a Laboratory Field Project in an Introductory Crop Science Course.

Science.gov (United States)

Lane, Robert A.

1986-01-01

Assesses the benefits resulting from a laboratory field project and report for agricultural students in an introductory crop science course. Student responses to evaluation statements indicated that the project helped them identify crops, understand cultural and management practices, and recognize environmental influences that affect crop…

A Cost-Effective Two-Part Experiment for Teaching Introductory Organic Chemistry Techniques

Science.gov (United States)

Sadek, Christopher M.; Brown, Brenna A.; Wan, Hayley

2011-01-01

This two-part laboratory experiment is designed to be a cost-effective method for teaching basic organic laboratory techniques (recrystallization, thin-layer chromatography, column chromatography, vacuum filtration, and melting point determination) to large classes of introductory organic chemistry students. Students are exposed to different…

Measuring the Impact of App Inventor for Android and Studio-Based Learning in an Introductory Computer Science Course for Non-Majors

Science.gov (United States)

Ahmad, Khuloud Nasser

2012-01-01

A reexamination of the traditional instruction of introductory computer science (CS) courses is becoming a necessity. Introductory CS courses tend to have high attrition rates and low success rates. In many universities, the CS department suffered from low enrollment for several years compared to other majors. Multiple studies have linked these…

Student Selection of the Textbook for an Introductory Physics Course

Science.gov (United States)

Dake, L. S.

2007-01-01

Several years ago I had to select a new textbook for my calculus-based introductory physics class. I subscribe to Just-in-Time Teaching methods,1 which require students to read the book before the material is covered in class. Thus, the readability of the text by the students is critical. However, I did not feel that I was the best judge of this…

The Importance of Mathematics as a Prerequisite to Introductory Financial Accounting

Science.gov (United States)

McCarron, Karen B.; Burstein, Alan N.

2017-01-01

Mathematics has long served as a prerequisite to introductory financial accounting in the 4-year college business curriculum. However, 2-year colleges have been slower to adopt math as a prerequisite. Its usefulness in relation to achieving successful completion of accounting has not been demonstrated at either a 2-year or 4-year college. Using…

The Kitty Genovese Story in Introductory Psychology Textbooks: Fifty Years Later

Science.gov (United States)

Griggs, Richard A.

2015-01-01

Given the many inaccuracies in the original "New York Times" 38-witnesses version of the Kitty Genovese story, this study examined the accuracy of this story in current introductory psychology textbooks, 50 years later. Recent studies have shown that there is no evidence for the following three key features of the original story: (1)…

Transversality of Electromagnetic Waves in the Calculus-Based Introductory Physics Course

Science.gov (United States)

Burko, Lior M.

2008-01-01

Introductory calculus-based physics textbooks state that electromagnetic waves are transverse and list many of their properties, but most such textbooks do not bring forth arguments why this is so. Both physical and theoretical arguments are at a level appropriate for students of courses based on such books, and could be readily used by…

Course Format Effects on Learning Outcomes in an Introductory Statistics Course

Science.gov (United States)

Sami, Fary

2011-01-01

The purpose of this study was to determine if course format significantly impacted student learning and course completion rates in an introductory statistics course taught at Harford Community College. In addition to the traditional lecture format, the College offers an online, and a hybrid (blend of traditional and online) version of this class.…

A Reactive Blended Learning Proposal for an Introductory Control Engineering Course

Science.gov (United States)

Mendez, Juan A.; Gonzalez, Evelio J.

2010-01-01

As it happens in other fields of engineering, blended learning is widely used to teach process control topics. In this paper, the inclusion of a reactive element--a Fuzzy Logic based controller--is proposed for a blended learning approach in an introductory control engineering course. This controller has been designed in order to regulate the…

Exact renormalization group equations: an introductory review

Science.gov (United States)

Bagnuls, C.; Bervillier, C.

2001-07-01

We critically review the use of the exact renormalization group equations (ERGE) in the framework of the scalar theory. We lay emphasis on the existence of different versions of the ERGE and on an approximation method to solve it: the derivative expansion. The leading order of this expansion appears as an excellent textbook example to underline the nonperturbative features of the Wilson renormalization group theory. We limit ourselves to the consideration of the scalar field (this is why it is an introductory review) but the reader will find (at the end of the review) a set of references to existing studies on more complex systems.

Introductory course on differential equations

CERN Document Server

Gorain, Ganesh C

2014-01-01

Introductory Course on DIFFERENTIAL EQUATIONS provides an excellent exposition of the fundamentals of ordinary and partial differential equations and is ideally suited for a first course of undergraduate students of mathematics, physics and engineering. The aim of this book is to present the elementary theories of differential equations in the forms suitable for use of those students whose main interest in the subject are based on simple mathematical ideas. KEY FEATURES: Discusses the subject in a systematic manner without sacrificing mathematical rigour. A variety of exercises drill the students in problem solving in view of the mathematical theories explained in the book. Worked out examples illustrated according to the theories developed in the book with possible alternatives. Exhaustive collection of problems and the simplicity of presentation differentiate this book from several others. Material contained will help teachers as well as aspiring students of different competitive examinations.

High School Pedagogy: The Influence of High School In-class Activities and Events On Introductory College Physics Success

OpenAIRE

Carter, Brooke

2014-01-01

This study explores how students’ grades in introductory college physics are influenced by the pedagogy used in their high school physics classes. The success of college science professors is often judged on the basis of the success of their students. This disregards the 18+ years of experiences with which students come into their physics classroom. This study aims to answer the question of what pedagogy best prepares students for introductory college physics. This quantitative study analyzes...

Evaluating multiple-choice exams in large introductory physics courses

OpenAIRE

Gary Gladding; Tim Stelzer; Michael Scott

2006-01-01

The reliability and validity of professionally written multiple-choice exams have been extensively studied for exams such as the SAT, graduate record examination, and the force concept inventory. Much of the success of these multiple-choice exams is attributed to the careful construction of each question, as well as each response. In this study, the reliability and validity of scores from multiple-choice exams written for and administered in the large introductory physics courses at the Unive...

Particle in a Box: Software for computer-assisted learning in introductory quantum mechanics courses

International Nuclear Information System (INIS)

Magalhaes, A L; Vasconcelos, V P S

2006-01-01

Particle in a Box is a non-commercial program which was devised to help students to become familiar with typical quantum phenomena when they are introduced for the first time in a physical-chemistry course. Its name comes from the simple and well-known theoretical model on which it is based. The user can select three distinct potential wells, namely the one dimensional with two infinite walls, the one dimensional with one finite barrier and the two-dimensional infinite potential square box. In order to set the system conditions, the user may enter the values for different physical parameters, including the quantum level, mass of the particle, dimensions of the box and height of the finite potential barrier. Through a clear and attractive output, one can visualize and compare the wavefunctions and their squares for the chosen quantum levels, the corresponding energy diagrams and probabilities of tunnelling. The program was tested as a pedagogical tool in tutorials of an introductory course in atomic and molecular structure. The use of this software in the classroom increased the receptivity of the students to non-intuitive topics such as, for instance, quantization, nodes and tunnelling, which helped to improve their success in the course

Investigating and improving introductory physics students’ understanding of symmetry and Gauss’s law

Science.gov (United States)

Li, Jing; Singh, Chandralekha

2018-01-01

We discuss an investigation of student difficulties with symmetry and Gauss’s law and how the research on students’ difficulties was used as a guide to develop a tutorial related to these topics to help students in the calculus-based introductory physics courses learn these concepts. During the development of the tutorial, we interviewed students individually at various stages of development and administered written tests in the free-response and multiple-choice formats on these concepts to learn about common student difficulties. We also obtained feedback from physics instructors who teach introductory physics courses regularly in which these concepts were covered. The students in several ‘equivalent’ sections worked on the tutorial after traditional lecture-based instruction. We discuss the performance of students on the written pre-test (administered after lecture-based instruction in relevant concepts) and post-test given after students worked on the tutorial. We find that on the pre-test, all sections of the course performed comparably regardless of the instructor. Also, on average, student performance on the post-test after working on the tutorial is significantly better than on the pre-test after lecture-based instruction. We also compare the post-test performance of introductory students in sections of the course in which the tutorial was used versus not used and find that sections in which students engaged with the tutorial outperformed those in which students did not engage with it.

An Integrative Approach to Improving an Introductory Weather & Climate Course and Developing an Allied NASA Earth & Space Science Certificate Program for Pre-service Secondary Teachers (Invited)

Science.gov (United States)

Morrow, C. A.; Martin-Hansen, L.; Diem, J.; Elliott, W.

2009-12-01

An Atlanta-based partnership made up of leaders in science, education, and Georgia’s state-wide STEM Education Initiative are creating an enduring legacy of climate science education for pre-service and in-service teachers in Georgia as well as for underrepresented high school students who participate in an "Early College" program with Georgia State University (GSU). The core elements of our NASA-funded program are to infuse NASA global climate change resources and best pedagogical practice into a popular 4-credit lecture/lab course called “Introduction to Weather & Climate” (GEOG 1112) at GSU, and to establish a sustainable academic program for pre-service teachers in the College of Education called the NASA Earth & Space Science (ESS) Teacher Certificate. The NASA ESS Certificate will require candidates to accomplish the following as part of (or in addition to) standard degree and licensure requirements: 1. successfully complete a graduate section of “Introduction to Weather and Climate” (GEOG 7112), which requires lesson planning related to course content and engagement with GSU's new CO2 monitoring station whose research-quality data will provide unique hands-on opportunities for Metro Atlanta students and teachers; 2) complete an additional advanced course in climate change (GEOG 6784) plus elective hours in physical science disciplines (e.g. astronomy and physics); 3) serve as a lab teaching assistant for GEOG 1112 and a coach for a cadre of Carver Early College students who are taking the course; 4) make at least one of two teaching practica at a Georgia-based NASA Explorer School; and 5) participate or co-present in a week-long, residential, field-based, Summer Institute in Earth & Space Science intended to increase the interest, knowledge, and ability of in-service secondary science educators to fulfill climate-related standards in Earth Science and Earth Systems Science. We will evaluate, document, and disseminate (to the University System of

Curriculum Currency: Integrating Direct and Interactive Marketing Content in Introductory Marketing Courses

Science.gov (United States)

Spiller, Lisa D.; Scovotti, Carol

2008-01-01

This study investigates the extent to which educators address direct and interactive marketing concepts in undergraduate introductory marketing courses. As practitioners seek more accountability from their marketing efforts, so too must academia respond with more relevant content. Results from textbook content analysis suggest that direct and…

Introductory Comments

Directory of Open Access Journals (Sweden)

Jolanta Sujecka

2017-11-01

Full Text Available Introductory Comments The sixth issue (not just in the Thematic Section is devoted to the borders of civilization in our memory, in culture, in art, in literature, in the arrangement of political objectives. Both their demarcation and their crossing is a matter of the objectives we can and want to set ourselves in the context of the order that exists and into which we try to fit, transforming it or levelling. The value of this survey of  “images of borders” is its setting in such varied material, owing to which the theoretical speculations gain a representative illustration and, at the same time, a guarantee of being rooted, even if it is only a “contact zone”.   Wprowadzenie Szósty numer (nie tylko sekcja tematyczna jest poświęcony kwestii granic cywilizacji w naszej pamięci, kulturze, sztuce, literaturze, w definiowaniu celów politycznych. Zarówno ich wyznaczanie, jak i przekraczanie, jest kwestią celów, jakie możemy i chcemy postawić sobie w kontekście istniejącego ładu, w który staramy się wpisać, przekształcając go lub dostosowując się do niego. Wartością niniejszego przeglądu "obrazów granic" jest przedstawienie ich poprzez tak zróżnicowany materiał, dzięki czemu rozważania teoretyczne zyskują reprezentatywną ilustrację, a zarazem gwarancję zakorzenienia, nawet jeśli będzie to tylko "sfera kontaktu".

Impacts of curricular change: Implications from 8 years of data in introductory physics

Science.gov (United States)

Pollock, Steven J.; Finkelstein, Noah

2013-01-01

Introductory calculus-based physics classes at the University of Colorado Boulder were significantly transformed beginning in 2004. They now regularly include: interactive engagement using clickers in large lecture settings, Tutorials in Introductory Physics with use of undergraduate Learning Assistants in recitation sections, and a staffed help-room setting where students work on personalized CAPA homework. We compile and summarize conceptual (FMCE and BEMA) pre- and post-data from over 9,000 unique students after 16 semesters of both Physics 1 and 2. Within a single institution with stable pre-test scores, we reproduce results of Hake's 1998 study that demonstrate the positive impacts of interactive engagement on student performance. We link the degree of faculty's use of interactive engagement techniques and their experience levels on student outcomes, and argue for the role of such systematic data collection in sustained course and institutional transformations.

Introductory astronomy course at the University of Cape Town: Probing student perspectives

Directory of Open Access Journals (Sweden)

Vinesh Rajpaul

2014-11-01

Full Text Available We report on research carried out to improve teaching and student engagement in the introductory astronomy course at the University of Cape Town. This course is taken by a diverse range of students, including many from educationally disadvantaged backgrounds. We describe the development of an instrument, the Introductory Astronomy Questionnaire (IAQ, which we administered as pre- and posttests to students enrolled in the course. The instrument comprised a small number of questions which probed three areas of interest: student motivation and expectations, astronomy content, and worldview. Amongst our findings were that learning gains were made in several conceptual areas, and that students appeared to develop a more nuanced view of the nature of astronomy. There was some evidence that the course had a positive impact on students’ worldviews, particularly their attitudes towards science. We also identified a promising predictor of course success that could in the future be used to identify students requiring special teaching intervention.

Teaching and Program Variations in International Business: Past, Present and Future.

Science.gov (United States)

Kaynak, Erdener; Schermerhorn, John R., Jr.

1999-01-01

This introductory article in a theme issue identifies common themes in the included papers, such as the need for more "active learning" and "project-based learning," the use of computer technology to facilitate "virtual teamwork," the importance of support services for these initiatives, and reliance on need-oriented programs and courses in…

Textbook Readability and Student Performance in Online Introductory Corporate Finance Classes

Science.gov (United States)

Peng, Chien-Chih

2015-01-01

This paper examines whether the choice of a more readable textbook can improve student performance in online introductory corporate finance classes. The ordinary least squares regression model is employed to analyze a sample of 206 students during the period from 2008 to 2012. The results of this study show that the student's age, student's major,…

Using a Movie as a Capstone Activity for the Introductory Course

Science.gov (United States)

Blessing, Stephen B.; Blessing, Jennifer S.

2015-01-01

A capstone experience serves as a culminating exercise for students to assimilate the information learned in a course and to realize how to use the material and skills in different contexts. Both majors and nonmajors benefit from having the material in the introductory course consolidated in such a way, for later study in the field and to more…

Introductory physics in biological context: An approach to improve introductory physics for life science students

Science.gov (United States)

Crouch, Catherine H.; Heller, Kenneth

2014-05-01

We describe restructuring the introductory physics for life science students (IPLS) course to better support these students in using physics to understand their chosen fields. Our courses teach physics using biologically rich contexts. Specifically, we use examples in which fundamental physics contributes significantly to understanding a biological system to make explicit the value of physics to the life sciences. This requires selecting the course content to reflect the topics most relevant to biology while maintaining the fundamental disciplinary structure of physics. In addition to stressing the importance of the fundamental principles of physics, an important goal is developing students' quantitative and problem solving skills. Our guiding pedagogical framework is the cognitive apprenticeship model, in which learning occurs most effectively when students can articulate why what they are learning matters to them. In this article, we describe our courses, summarize initial assessment data, and identify needs for future research.

Heuristic Methods of Integer Programming and Its Applications in Economics

Directory of Open Access Journals (Sweden)

Dominika Crnjac Milić

2010-12-01

Full Text Available A short overview of the results related to integer programming is described in the introductory part of this paper. Furthermore, there is a list of literature related to this field. The main part of the paper analyses the Heuristic method which yields a very fast result without the use of significant mathematical tools.

Tale of Two Curricula: The Performance of 2000 Students in Introductory Electromagnetism

Science.gov (United States)

Kohlmyer, Matthew A.; Caballero, Marcos D.; Catrambone, Richard; Chabay, Ruth W.; Ding, Lin; Haugan, Mark P.; Marr, M. Jackson; Sherwood, Bruce A.; Schatz, Michael F.

2009-01-01

The performance of over 2000 students in introductory calculus-based electromagnetism (E&M) courses at four large research universities was measured using the Brief Electricity and Magnetism Assessment (BEMA). Two different curricula were used at these universities: a traditional E&M curriculum and the Matter & Interactions (M&I)…

Ditching the Script: Moving beyond "Automatic Thinking" in Introductory Political Science Courses

Science.gov (United States)

Glover, Robert W.; Tagliarina, Daniel

2011-01-01

Political science is a challenging field, particularly when it comes to undergraduate teaching. If we are to engage in something more than uncritical ideological instruction, it demands from the student a willingness to approach alien political ideas with intellectual generosity. Yet, students within introductory classes often harbor inherited…

"Economics with Training Wheels": Using Blogs in Teaching and Assessing Introductory Economics

Science.gov (United States)

Cameron, Michael P.

2012-01-01

Blogs provide a dynamic interactive medium for online discussion, consistent with communal constructivist pedagogy. The author of this article describes and evaluates a blog assignment used in the teaching and assessment of a small (40-60 students) introductory economics course. Using qualitative and quantitative data collected across four…

Student Performance in an Introductory Business Statistics Course: Does Delivery Mode Matter?

Science.gov (United States)

Haughton, Jonathan; Kelly, Alison

2015-01-01

Approximately 600 undergraduates completed an introductory business statistics course in 2013 in one of two learning environments at Suffolk University, a mid-sized private university in Boston, Massachusetts. The comparison group completed the course in a traditional classroom-based environment, whereas the treatment group completed the course in…

Using R in Introductory Statistics Courses with the pmg Graphical User Interface

Science.gov (United States)

Verzani, John

2008-01-01

The pmg add-on package for the open source statistics software R is described. This package provides a simple to use graphical user interface (GUI) that allows introductory statistics students, without advanced computing skills, to quickly create the graphical and numeric summaries expected of them. (Contains 9 figures.)

Computer-Automated Approach for Scoring Short Essays in an Introductory Statistics Course

Science.gov (United States)

Zimmerman, Whitney Alicia; Kang, Hyun Bin; Kim, Kyung; Gao, Mengzhao; Johnson, Glenn; Clariana, Roy; Zhang, Fan

2018-01-01

Over two semesters short essay prompts were developed for use with the Graphical Interface for Knowledge Structure (GIKS), an automated essay scoring system. Participants were students in an undergraduate-level online introductory statistics course. The GIKS compares students' writing samples with an expert's to produce keyword occurrence and…

BlueJ Visual Debugger for Learning the Execution of Object-Oriented Programs?

DEFF Research Database (Denmark)

Bennedsen, Jens B.; Schulte, Carsten

2010-01-01

-group experiment in an introductory programming course.The results of the experiment show that the students who used BlueJ?s debugger did not perform statistically significantly better than the students not using it; both groups profited about the same amount from the exercises given in the experiment. We discuss...

Particle in a Box: An Experiential Environment for Learning Introductory Quantum Mechanics

Science.gov (United States)

Anupam, Aditya; Gupta, Ridhima; Naeemi, Azad; JafariNaimi, Nassim

2018-01-01

Quantum mechanics (QMs) is a foundational subject in many science and engineering fields. It is difficult to teach, however, as it requires a fundamental revision of the assumptions and laws of classical physics and probability. Furthermore, introductory QM courses and texts predominantly focus on the mathematical formulations of the subject and…

Operant Conditioning Concepts in Introductory Psychology Textbooks and Their Companion Web Sites

Science.gov (United States)

Sheldon, Jane P.

2002-01-01

Psychology instructors and textbook authors rate operant conditioning as one of the most essential concepts for students to learn, yet textbook writers, as well as students, can fall prey to misconceptions. This study is a content analysis of the presentation of operant conditioning in introductory psychology textbooks and their companion Web…

Retention of Statistical Concepts in a Preliminary Randomization-Based Introductory Statistics Curriculum

Science.gov (United States)

Tintle, Nathan; Topliff, Kylie; VanderStoep, Jill; Holmes, Vicki-Lynn; Swanson, Todd

2012-01-01

Previous research suggests that a randomization-based introductory statistics course may improve student learning compared to the consensus curriculum. However, it is unclear whether these gains are retained by students post-course. We compared the conceptual understanding of a cohort of students who took a randomization-based curriculum (n = 76)…

Portrayals of Wundt and Titchener in Introductory Psychology Texts: A Content Analysis.

Science.gov (United States)

Zehr, David

2000-01-01

Examines the content of introductory psychology books by performing a content analysis on texts from the 1970s and 1990s to determine whether the books incorporated recent historical scholarship in discussions of Wilhelm Wundt and Edward Titchener. Finds that some texts still misrepresent the relation between Wundt and Titchener. (CMK)

Introductory Psychology: How Student Experiences Relate to Their Understanding of Psychological Science

Science.gov (United States)

Toomey, Thomas; Richardson, Deborah; Hammock, Georgina

2017-01-01

Many students who declare a psychology major are unaware that they are studying a scientific discipline, precipitating a need for exercises and experiences that help students understand the scientific nature of the discipline. The present study explores aspects of an introductory psychology class that may contribute to students' understanding of…

Sprego Programming

Directory of Open Access Journals (Sweden)

Maria Csernoch

2015-02-01

Full Text Available Spreadsheet management is a border-land between office applications and programming, however, it is rather communicated that spreadsheet is nothing more than an easily handled fun piece. Consequently, the complexity of spreadsheet handling, the unprepared end-users, their problem solving abilities and approaches do not match. To overcome these problems we have developed and introduced Sprego (Spreadsheet Lego. Sprego is a simplified functional programming language in spreadsheet environment, and such as can be used both as introductory language and the language of end-user programmers. The essence of Sprego is that we use as few and simple functions as possible and based on these functions build multilevel formulas. With this approach, similar to high level programming, we are able solve advanced problems, developing algorithmic skills, computational thinking. The advantage of Sprego is the simplicity of the language, when the emphasis is not on the coding but on the problem. Beyond that spreadsheets would provide real life problems with authentic data and tables which students are more interested in than the artificial environment and semi-authentic problems of high level programming languages.

A Model for the Development an Upper-Division Marketing Certificate Program: Professional Sales.

Science.gov (United States)

Grahn, Joyce L.

The sequential components of a model for the development of an upper-division marketing certificate program in professional sales are described in this report as they were implemented at the University of Minnesota's General College during Fall 1980. After introductory material examining the responsibilities of the professional sales…

Earthquake effects on groundwater systems: an introductory review

International Nuclear Information System (INIS)

1988-09-01

This report presents an introductory review of the potential effects of earthquakes on groundwater systems with respect to the performance of underground repositories for radioactive waste in Britain. An approach to modelling these effects within the scope of general environmental simulation codes is presented. The relevant literature is reviewed and it is concluded that, although pertinent information exists, no clear relationship between seismic intensity and the degree of fracturing has been established. Recommendations are made for further work on fracture development to complement existing research into the effects of long-term changes on the integrity of radioactive waste disposal facilities. (author)

Implementing Recommendations for Introductory Biology by Writing a New Textbook

Science.gov (United States)

Barsoum, Mark J.; Sellers, Patrick J.; Campbell, A. Malcolm; Heyer, Laurie J.; Paradise, Christopher J.

2013-01-01

We redesigned the undergraduate introductory biology course by writing a new textbook (Integrating Concepts in Biology [ICB]) that follows first principles of learning. Our approach emphasizes primary data interpretation and the utility of mathematics in biology, while de-emphasizing memorization. This redesign divides biology into five big ideas (information, evolution, cells, emergent properties, homeostasis), addressing each at five levels of organization (molecules, cells, organisms, populations, ecological systems). We compared our course outcomes with two sections that used a traditional textbook and were taught by different instructors. On data interpretation assessments administered periodically during the semester, our students performed better than students in the traditional sections (p = 0.046) and exhibited greater improvement over the course of the semester (p = 0.015). On factual content assessments, our students performed similarly to students in the other sections (p = 0.737). Pre- and postsemester assessment of disciplinary perceptions and self-appraisal indicate that our students acquired a more accurate perception of biology as a discipline and may have developed a more realistic evaluation of their scientific abilities than did the control students (p < 0.05). We conclude that ICB improves critical thinking, metacognition, and disciplinary perceptions without compromising content knowledge in introductory biology. PMID:23463233

Introductory statement to the administrative and budgetary committee, 4 May 1998

International Nuclear Information System (INIS)

ElBaradei, M.

1998-01-01

The document represents the Introductory Statement made by the Director General of the IAEA on 4 May 1998 to the Administrative and Budgetary Committee of the IAEA who met at the Agency's Headquarters in Vienna. The Director General comments on the Agency's programme and budget proposals for 1999 and 2000, the framework for further reform, staffing of the Secretariat, and current resource situation

Lessons learned: A case study of an integrated way of teaching introductory physics to at-risk students at Rutgers University

Science.gov (United States)

Etkina, E.; Gibbons, K.; Holton, B. L.; Horton, G. K.

1999-09-01

In order to provide a physics instructional environment in which at-risk students (particularly women and minorities) can successfully learn and enjoy introductory physics, we have introduced Extended General Physics as an option for science, science teaching, and pre-health professions majors at Rutgers University. We have taught the course for the last five years. In this new course, we have used many elements that have been proven to be successful in physics instruction. We have added a new component, the minilab, stressing qualitative experiments performed by the students. By integrating all the elements, and structuring the time the students invest in the course, we have created a successful program for students-at-risk, indeed for all students. Our aim was not only to foster successful mastery of the traditional physics syllabus by the students, but to create a sense of community through the cooperation of students with each other and their instructors. We present a template for implementation of our program elsewhere.

Connecting biology and organic chemistry introductory laboratory courses through a collaborative research project.

Science.gov (United States)

Boltax, Ariana L; Armanious, Stephanie; Kosinski-Collins, Melissa S; Pontrello, Jason K

2015-01-01

Modern research often requires collaboration of experts in fields, such as math, chemistry, biology, physics, and computer science to develop unique solutions to common problems. Traditional introductory undergraduate laboratory curricula in the sciences often do not emphasize connections possible between the various disciplines. We designed an interdisciplinary, medically relevant, project intended to help students see connections between chemistry and biology. Second term organic chemistry laboratory students designed and synthesized potential polymer inhibitors or inducers of polyglutamine protein aggregation. The use of novel target compounds added the uncertainty of scientific research to the project. Biology laboratory students then tested the novel potential pharmaceuticals in Huntington's disease model assays, using in vitro polyglutamine peptide aggregation and in vivo lethality studies in Drosophila. Students read articles from the primary literature describing the system from both chemical and biological perspectives. Assessment revealed that students emerged from both courses with a deeper understanding of the interdisciplinary nature of biology and chemistry and a heightened interest in basic research. The design of this collaborative project for introductory biology and organic chemistry labs demonstrated how the local interests and expertise at a university can be drawn from to create an effective way to integrate these introductory courses. Rather than simply presenting a series of experiments to be replicated, we hope that our efforts will inspire other scientists to think about how some aspect of authentic work can be brought into their own courses, and we also welcome additional collaborations to extend the scope of the scientific exploration. © 2015 The International Union of Biochemistry and Molecular Biology.