WorldWideScience

Sample records for vfa pool size

  1. Lin28a regulates germ cell pool size and fertility

    Science.gov (United States)

    Shinoda, Gen; de Soysa, T. Yvanka; Seligson, Marc T.; Yabuuchi, Akiko; Fujiwara, Yuko; Huang, Pei Yi; Hagan, John P.; Gregory, Richard I.; Moss, Eric G.; Daley, George Q.

    2013-01-01

    Overexpression of LIN28A is associated with human germ cell tumors and promotes primordial germ cell (PGC) development from embryonic stem cells in vitro and in chimeric mice. Knockdown of Lin28a inhibits PGC development in vitro, but how constitutional Lin28a deficiency affects the mammalian reproductive system in vivo remains unknown. Here, we generated Lin28a knockout (KO) mice and found that Lin28a deficiency compromises the size of the germ cell pool in both males and females by affecting PGC proliferation during embryogenesis. Interestingly however, in Lin28a KO males the germ cell pool partially recovers during postnatal expansion, while fertility remains impaired in both males and females mated to wild type mice. Embryonic overexpression of let-7, a microRNA negatively regulated by Lin28a, reduces the germ cell pool, corroborating the role of the Lin28a/let-7 axis in regulating the germ lineage. PMID:23378032

  2. Gravity and Heater Size Effects on Pool Boiling Heat Transfer

    Science.gov (United States)

    Kim, Jungho; Raj, Rishi

    2014-01-01

    The current work is based on observations of boiling heat transfer over a continuous range of gravity levels between 0g to 1.8g and varying heater sizes with a fluorinert as the test liquid (FC-72/n-perfluorohexane). Variable gravity pool boiling heat transfer measurements over a wide range of gravity levels were made during parabolic flight campaigns as well as onboard the International Space Station. For large heaters and-or higher gravity conditions, buoyancy dominated boiling and heat transfer results were heater size independent. The power law coefficient for gravity in the heat transfer equation was found to be a function of wall temperature under these conditions. Under low gravity conditions and-or for smaller heaters, surface tension forces dominated and heat transfer results were heater size dependent. A pool boiling regime map differentiating buoyancy and surface tension dominated regimes was developed along with a unified framework that allowed for scaling of pool boiling over a wide range of gravity levels and heater sizes. The scaling laws developed in this study are expected to allow performance quantification of phase change based technologies under variable gravity environments eventually leading to their implementation in space based applications.

  3. Optimization of the LENS process for steady molten pool size

    Energy Technology Data Exchange (ETDEWEB)

    Wang, L. [Center for Advanced Vehicular Systems, Mississippi State University, Mississippi State, MS 39762 (United States); Felicelli, S. [Mechanical Engineering Department, Mississippi State University, Mississippi State, MS 39762 (United States)], E-mail: felicelli@me.msstate.edu; Gooroochurn, Y. [ESI Group, Bloomfield Hills, MI 48304 (United States); Wang, P.T.; Horstemeyer, M.F. [Center for Advanced Vehicular Systems, Mississippi State University, Mississippi State, MS 39762 (United States)

    2008-02-15

    A three-dimensional finite element model was developed and applied to analyze the temperature and phase evolution in deposited stainless steel 410 (SS410) during the Laser Engineered Net Shaping (LENS) rapid fabrication process. The effect of solid phase transformations is taken into account by using temperature and phase dependent material properties and the continuous cooling transformation (CCT) diagram. The laser beam is modeled as a Gaussian distribution of heat flux from a moving heat source with conical shape. The laser power and translational speed during deposition of a single-wall plate are optimized in order to maintain a steady molten pool size. It is found that, after an initial transient due to the cold substrate, the dependency of laser power with layer number is approximately linear for all travel speeds analyzed. The temperature distribution and cooling rate surrounding the molten pool are predicted and compared with experiments. Based upon the predicted thermal cycles and cooling rate, the phase transformations and their effects on the hardness of the part are discussed.

  4. Project size and common pool size: An empirical test using Danish municipal mergers

    DEFF Research Database (Denmark)

    Hansen, Sune Welling

    The paper examines the proposition that project size tends to increase with common pool size from the law of 1 over n (Weingast et al, 1981). This remains under-investigated and a recent study conducted by Primo & Snyder (2008) argues, and empirically substantiates, a reverse law of 1 over n...... across two research designs, two outcome variables, two subsamples, and several model specifications The implications of the findings, combined with the limited potential for empirically testing Primo & Snyder’s alternative model, suggest a re-appreciation of the law of 1 over n as it was originally...

  5. Evaluation of Decontamination Factor of Aerosol in Pool Scrubber according to Bubble Shape and Size

    Energy Technology Data Exchange (ETDEWEB)

    Jo, Hyun Joung; Ha, Kwang Soon; Jang, Dong Soon [KAERI, Daejeon (Korea, Republic of)

    2016-05-15

    The scrubbing pool could play an important role in the wet type FCVS because a large amount of aerosol is captured in the water pool. The pool scrubbing phenomena have been modelled and embedded in several computer codes, such as SPARC (Suppression Pool Aerosol Removal Code), BUSCA (BUbble Scrubbing Algorithm) and SUPRA (Suppression Pool Retention Analysis). These codes aim at simulating the pool scrubbing process and estimating the decontamination factors (DFs) of the radioactive aerosol and iodine gas in the water pool, which is defined as the ratio of initial mass of the specific radioactive material to final massy after passing through the water pool. The pool scrubbing models were reviewed and an aerosol scrubbing code has been prepared to calculate decontamination factor through the pool. The developed code has been verified using the experimental results and parametric studies the decontamination factor according to bubble shape and size. To evaluate the decontamination factor more accurate whole pool scrubber phenomena, the code was improved to consider the variety shape and size of bubbles. The decontamination factor were largely evaluated in ellipsoid bubble rather than in sphere bubble. The pool scrubbing models will be enhanced to apply more various model such as aerosol condensation of hygroscopic. And, it is need to experiment to measure to bubble shape and size distribution in pool to improve bubble model.

  6. Controls on the size and occurrence of pools in coarse-grained forest rivers

    Science.gov (United States)

    John M. Buffington; Thomas E. Lisle; Richard D. Woodsmith; Sue Hilton

    2002-01-01

    Controls on pool formation are examined in gravel- and cobble-bed rivers in forest mountain drainage basins of northern California, southern Oregon, and southeastern Alaska. We demonstrate that the majority of pools at our study sites are formed by flow obstructions and that pool geometry and frequency largely depend on obstruction characteristics (size, type, and...

  7. Relative estimates of TCA cycle pool size from 14CO2 production profiles

    International Nuclear Information System (INIS)

    Kelleher, J.K.; Cesta, M.L.; Holleran, A.L.

    1986-01-01

    In metabolic and isotopic steady state, the rate of 14 CO 2 production by TCA cycle intermediates labeled at different positions is linear. However, before the system reaches isotopic steady state, the rate of 14 CO 2 production is non-linear. The x-intercept extrapolated from the linear phase indicates the turnover rate of all metabolic pools the tracer must pass through. By exposing identical systems to 14 C succinate labeled in different positions, the contribution of TCA cycle pools to the non-linear phase may be considered. Specifically, the extrapolated x-intercept for [2,3 14 C] succinate will be greater than the x-intercept for [1,4 14 C] succinate if the TCA cycle pools are a contributing factor to the non-linear phase. The authors have used this method to analyze pyruvate oxidation in AS 30D hepatoma cells. They found that the extrapolated x-intercepts for the two tracers were identical. This indicates that the non-linear phase resulted from equilibration of the tracer with pools prior to entering the TCA cycle, i.e. lactate. Using this technique, it may be possible to estimate the variations in TCA cycle pool sizes in vivo

  8. Physical-chemical model for cellular uptake of fatty acids: prediction of intracellular pool sizes

    International Nuclear Information System (INIS)

    Cooper, R.; Noy, N.; Zakim, D.

    1987-01-01

    If the uptake of fatty acids by liver is a physical, not a biological, process, then the size and location of the intrahepatic pool of fatty acids can be predicted from uptake rates and thermodynamic data. The purpose of the experiments in this paper was to test the accuracy of this idea. Rat livers were perfused with [ 3 H] palmitate bound to [ 14 C] albumin, and the total amounts of palmitate removed from the perfusate were measured at 3-s intervals. The intrahepatic pools of palmitate calculated from these data were 13.8 and 23.0 nmol/g of liver at ratios of palmitate/albumin (mol/mol) (afferent side) of 2/1 and 4/1, respectively, in the steady state. The intrahepatic pools of palmitate calculated from the distributions of palmitate between membranes, H 2 O, albumin, and fatty acid binding protein and the measured first-order rate constants for acyl-CoA ligases in mitochondria and microsomes were 12.1 and 34.6 nmol/g for perfusate ratios of palmitate/albumin of 2/1 and 4/1, in the steady state. Intrahepatic pools of palmitate measured after establishment of a steady-state rate of uptake were 15.0 and 31.8 nmol/g for these ratios of palmitate/albumin of 2/1 and 4/1

  9. Analysis of small sample size studies using nonparametric bootstrap test with pooled resampling method.

    Science.gov (United States)

    Dwivedi, Alok Kumar; Mallawaarachchi, Indika; Alvarado, Luis A

    2017-06-30

    Experimental studies in biomedical research frequently pose analytical problems related to small sample size. In such studies, there are conflicting findings regarding the choice of parametric and nonparametric analysis, especially with non-normal data. In such instances, some methodologists questioned the validity of parametric tests and suggested nonparametric tests. In contrast, other methodologists found nonparametric tests to be too conservative and less powerful and thus preferred using parametric tests. Some researchers have recommended using a bootstrap test; however, this method also has small sample size limitation. We used a pooled method in nonparametric bootstrap test that may overcome the problem related with small samples in hypothesis testing. The present study compared nonparametric bootstrap test with pooled resampling method corresponding to parametric, nonparametric, and permutation tests through extensive simulations under various conditions and using real data examples. The nonparametric pooled bootstrap t-test provided equal or greater power for comparing two means as compared with unpaired t-test, Welch t-test, Wilcoxon rank sum test, and permutation test while maintaining type I error probability for any conditions except for Cauchy and extreme variable lognormal distributions. In such cases, we suggest using an exact Wilcoxon rank sum test. Nonparametric bootstrap paired t-test also provided better performance than other alternatives. Nonparametric bootstrap test provided benefit over exact Kruskal-Wallis test. We suggest using nonparametric bootstrap test with pooled resampling method for comparing paired or unpaired means and for validating the one way analysis of variance test results for non-normal data in small sample size studies. Copyright © 2017 John Wiley & Sons, Ltd. Copyright © 2017 John Wiley & Sons, Ltd.

  10. Radiation inactivation target size of rat adipocyte glucose transporters in the plasma membrane and intracellular pools

    International Nuclear Information System (INIS)

    Jacobs, D.B.; Berenski, C.J.; Spangler, R.A.; Jung, C.Y.

    1987-01-01

    The in situ assembly states of the glucose transport carrier protein in the plasma membrane and in the intracellular (microsomal) storage pool of rat adipocytes were assessed by studying radiation-induced inactivation of the D-glucose-sensitive cytochalasin B binding activities. High energy radiation inactivated the glucose-sensitive cytochalasin B binding of each of these membrane preparations by reducing the total number of the binding sites without affecting the dissociation constant. The reduction in total number of binding sites was analyzed as a function of radiation dose based on target theory, from which a radiation-sensitive mass (target size) was calculated. When the plasma membranes of insulin-treated adipocytes were used, a target size of approximately 58,000 daltons was obtained. For adipocyte microsomal membranes, we obtained target sizes of approximately 112,000 and 109,000 daltons prior to and after insulin treatment, respectively. In the case of microsomal membranes, however, inactivation data showed anomalously low radiation sensitivities at low radiation doses, which may be interpreted as indicating the presence of a radiation-sensitive inhibitor. These results suggest that the adipocyte glucose transporter occurs as a monomer in the plasma membrane while existing in the intracellular reserve pool either as a homodimer or as a stoichiometric complex with a protein of an approximately equal size

  11. A new VFA sensor technique for anaerobic reactor systems

    DEFF Research Database (Denmark)

    Pind, Peter Frode; Angelidaki, Irini; Ahring, Birgitte Kiær

    2003-01-01

    , propionate, iso-/n-butyrate and iso-/n-valerate ranging from 0.1 to 50 mM (6-3000 mg). The measuring range could readily be expanded to more components and both lower and higher concentrations if desired. In addition to the new VFA sensor system, test results from development and testing of the in situ...

  12. Melt-Pool Temperature and Size Measurement During Direct Laser Sintering

    Energy Technology Data Exchange (ETDEWEB)

    List, III, Frederick Alyious [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Dinwiddie, Ralph Barton [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Carver, Keith [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Gockel, Joy E. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-08-01

    Additive manufacturing has demonstrated the ability to fabricate complex geometries and components not possible with conventional casting and machining. In many cases, industry has demonstrated the ability to fabricate complex geometries with improved efficiency and performance. However, qualification and certification of processes is challenging, leaving companies to focus on certification of material though design allowable based approaches. This significantly reduces the business case for additive manufacturing. Therefore, real time monitoring of the melt pool can be used to detect the development of flaws, such as porosity or un-sintered powder and aid in the certification process. Characteristics of the melt pool in the Direct Laser Sintering (DLS) process is also of great interest to modelers who are developing simulation models needed to improve and perfect the DLS process. Such models could provide a means to rapidly develop the optimum processing parameters for new alloy powders and optimize processing parameters for specific part geometries. Stratonics’ ThermaViz system will be integrated with the Renishaw DLS system in order to demonstrate its ability to measure melt pool size, shape and temperature. These results will be compared with data from an existing IR camera to determine the best approach for the determination of these critical parameters.

  13. Determination of an unrelated donor pool size for human leukocyte antigen-matched platelets in Brazil

    Directory of Open Access Journals (Sweden)

    Carolina Bonet Bub

    2016-02-01

    Full Text Available ABSTRACT Background: Successful transfusion of platelet refractory patients is a challenge. Many potential donors are needed to sustain human leukocyte antigen matched-platelet transfusion programs because of the different types of antigens and the constant needs of these patients. For a highly mixed population such as the Brazilian population, the pool size required to provide adequate platelet support is unknown. Methods: A mathematical model was created to estimate the appropriate size of an unrelated donor pool to provide human leukocyte antigen-compatible platelet support for a Brazilian population. A group of 154 hematologic human leukocyte antigen-typed patients was used as the potential patient population and a database of 65,500 human leukocyte antigen-typed bone marrow registered donors was used as the donor population. Platelet compatibility was based on the grading system of Duquesnoy. Results: Using the mathematical model, a pool containing 31,940, 1710 and 321 donors would be necessary to match more than 80% of the patients with at least five completely compatible (no cross-reactive group, partial compatible (one cross-reactive group or less compatible (two cross-reactive group donors, respectively. Conclusion: The phenotypic diversity of the Brazilian population has probably made it more difficulty to find completely compatible donors. However, this heterogeneity seems to have facilitated finding donors when cross-reactive groups are accepted as proposed by the grading system of Duquesnoy. The results of this study may help to establish unrelated human leukocyte antigen-compatible platelet transfusions, a procedure not routinely performed in most Brazilian transfusion services.

  14. Effect of pH and VFA on hydrolysis of organic solid waste

    NARCIS (Netherlands)

    Veeken, A.H.M.; Kalyuzhnyi, S.; Scharff, H.; Hamelers, H.V.M.

    2000-01-01

    The anaerobic hydrolysis rate of organic solid waste was studied at fixed volatile fatty acid (VFA) concentrations ranging from 3 to 30 g COD/L and fixed pH values between 5 and 7. For separate control of both VFA and pH, a special completely mixed reactor was designed. In this way, it was possible

  15. Pool size measurements facilitate the determination of fluxes at branching points in nonstationary metabolic flux analysis: The case of Arabidopsis thaliana

    Directory of Open Access Journals (Sweden)

    Robert eHeise

    2015-06-01

    Full Text Available Pool size measurements are important for the estimation of absolute intracellular fluxes in particular scenarios based on data from heavy carbon isotope experiments. Recently, steady-state fluxes estimates were obtained for central carbon metabolism in an intact illuminated rosette of Arabidopsis thaliana grown photoautotrophically (Szecowka et al., 2013; Heise et al., 2014. Fluxes were estimated therein by integrating mass-spectrometric data of the dynamics of the unlabeled metabolic fraction, data on metabolic pool sizes, partitioning of metabolic pools between cellular compartments and estimates of photosynthetically inactive pools, with a simplified model of plant central carbon metabolism. However, the fluxes were determined by treating the pool sizes as fixed parameters. Here we investigated whether and, if so, to what extent the treatment of pool sizes as parameters to be optimized in three scenarios may affect the flux estimates. The results are discussed in terms of benchmark values for canonical pathways and reactions, including starch and sucrose synthesis as well as the ribulose-1,5-bisphosphate carboxylation and oxygenation reactions. In addition, we discuss pathways emerging from a divergent branch point for which pool sizes are required for flux estimation, irrespective of the computational approach used for the simulation of the observable labelling pattern. Therefore, our findings indicate the necessity for development of techniques for accurate pool size measurements to improve the quality of flux estimates from nonstationary flux estimates in intact plant cells in the absence of alternative flux measurements.

  16. Optimal Sizing and Sitting of Smart Microgrid Units under Pool Electricity Market

    DEFF Research Database (Denmark)

    Hakimi, Seyed Mehdi; Hajizadeh, Amin

    2017-01-01

    , reliability cost, power loss cost and selling and buying electricity cost. The new idea of this paper is the investigation of pool electricity market aspects in optimization of smart microgrid. On the other hand, cost minimization of smart microgrid is related to their bidding strategies. Therefore two...... different optimization tools are considered. First, a game-theoretical (GT) model has been used for bidding strategy of smart microgrid as a price-maker, in a long-term electricity market. Secondly, a particle swarm optimization (PSO) algorithm is employed to obtain the best cost value of smart microgrids...... construction. This study was performed for the Ekbatan residential complex in Tehran, Iran. It has three smart microgrids consist of renewable energy resources. They participate in a long-term electricity market as a price maker. The results show that the proposed method is more effective and has lower cost...

  17. Diets high in resistent starch and arabinoxylan modulate digestion processes and SCFA pool size in the large intestine and faecal microbial composition in pigs

    DEFF Research Database (Denmark)

    Nielsen, Tina Skau; Lærke, Helle Nygaard; Theil, Peter Kappel

    2014-01-01

    The effects of a high level of dietary fibre (DF) either as arabinoxylan (AX) or resistant starch (RS) on digestion processes, SCFA concentration and pool size in various intestinal segments and on the microbial composition in the faeces were studied in a model experiment with pigs. A total...... resulted in a 3- to 5-fold higher pool size of butyrate compared with WSD feeding, with the RSD being intermediate (P microbial composition towards butyrogenic...

  18. Microbial communities in litter and soil - particles size fractionation, C- and N-pools and soil enzymes

    International Nuclear Information System (INIS)

    Stemmer, M.; Gerzabek, M.H.; Pichlmayer, F.; Kandeler, E.

    1995-08-01

    In this study we try to correlate C and N pool investigations to enzyme activities in particle size fractions of soils. Soil incubations in the lab (for one year) simulate two different conventional tillage treatments : (i) soil mixed with maize straw (GSF-mixed) and (ii) soil with maize straw lying on the top (home-mixed). The control soil is incubated without any amendment. The separation of the particle size fractions (2000 - 200 μm, 200 - 63 μm, 63 - 2 μm, 2 - 0.1 μm and 0.1 - 0 μm) is realized by a combination of wet-sieving and centrifugation. To disrupt aggregates we use a defined low-energy ultrasonication, which partly preserves microaggregates. The decomposition of organic C during the incubation can be observed clearly, the small amount of N in the added maize straw complicates the analysis. The isotopic measurements of δ13C and δ15N provide valuable additional informations in this context. Both enzymes, saccharase and xylanase, seem to react in a more sensitive way on the incorporation of the maize litter, than the chemical analysis of the pools. The saccharase activity, which seems to be a sensitive indicator for microbial biomass, shows different behaviour between the mix- and top-treatment. The xylanase activity is mainly located in the coarse sand fraction, this extracellular enzyme might be adsorbed by the particulate organic matter. The transfer of adhering coatings and small particles of the added maize to small sized particles during the fractionation procedure and the 'passive role' of the silt fraction, which could be due to the used method, are nonexpected results. (author)

  19. Comparison of VFA titration procedures used for monitoring the biogas process.

    Science.gov (United States)

    Lützhøft, Hans-Christian Holten; Boe, Kanokwan; Fang, Cheng; Angelidaki, Irini

    2014-05-01

    Titrimetric determination of volatile fatty acids (VFAs) contents is a common way to monitor a biogas process. However, digested manure from co-digestion biogas plants has a complex matrix with high concentrations of interfering components, resulting in varying results when using different titration procedures. Currently, no standardized procedure is used and it is therefore difficult to compare the performance among plants. The aim of this study was to evaluate four titration procedures (for determination of VFA-levels of digested manure samples) and compare results with gas chromatographic (GC) analysis. Two of the procedures are commonly used in biogas plants and two are discussed in literature. The results showed that the optimal titration results were obtained when 40 mL of four times diluted digested manure was gently stirred (200 rpm). Results from samples with different VFA concentrations (1-11 g/L) showed linear correlation between titration results and GC measurements. However, determination of VFA by titration generally overestimated the VFA contents compared with GC measurements when samples had low VFA concentrations, i.e. around 1 g/L. The accuracy of titration increased when samples had high VFA concentrations, i.e. around 5 g/L. It was further found that the studied ionisable interfering components had lowest effect on titration when the sample had high VFA concentration. In contrast, bicarbonate, phosphate and lactate had significant effect on titration accuracy at low VFA concentration. An extended 5-point titration procedure with pH correction was best to handle interferences from bicarbonate, phosphate and lactate at low VFA concentrations. Contrary, the simplest titration procedure with only two pH end-points showed the highest accuracy among all titration procedures at high VFA concentrations. All in all, if the composition of the digested manure sample is not known, the procedure with only two pH end-points should be the procedure of

  20. Ephemeroptera, Plecoptera, and Trichoptera on Isle Royale National Park, USA, compared to mainland species pool and size distribution.

    Science.gov (United States)

    DeWalt, R Edward; South, Eric J

    2015-01-01

    Extensive sampling for aquatic insects was conducted in the orders Ephemeroptera (mayflies), Plecoptera (stoneflies), and Trichoptera (caddisflies) (EPT) of Isle Royale National Park (ISRO), Michigan, United States of America, during summer 2013. The island was ice covered until 8,000 to 10,000 years ago and is isolated by 22-70 km distance from the mainland. Two hypotheses were examined: that ISRO EPT richness would be much reduced from the mainland, and that the species colonizing ISRO would be of smaller size than mainland, adults presumably using updrafts to bridge the distance from mainland sources. Data sets were developed for known mainland EPT species and size for those species. The first hypothesis was confirmed with the mainland species pool consisting of 417 EPT, while ISRO is known to support 73 species. Richness of EPT is directly related to the number of specimens examined. Small streams supported five EPT species, while 15-25 species were found in larger streams. Lakeshores had intermediate diversity. The second hypothesis was substantiated for stoneflies, but not for mayflies or caddisflies. Stoneflies apparently are poorer fliers than either of the other two orders.

  1. Effect of Molten Pool Size on Microstructure and Tensile Properties of Wire Arc Additive Manufacturing of Ti-6Al-4V Alloy.

    Science.gov (United States)

    Wu, Qianru; Lu, Jiping; Liu, Changmeng; Fan, Hongli; Shi, Xuezhi; Fu, Jie; Ma, Shuyuan

    2017-07-04

    Wire arc additive manufacturing (WAAM) technique is a cost-competitive and efficient technology to produce large structure components in industry domains. Mechanical properties are mainly dominated by the microstructure of the components, which is deeply affected by the molten pool size. In this work, to investigate the effect of the molten pool size on microstructure and mechanical properties of the components, a series of Ti-6Al-4V alloy blocks with different width of molten pool (WMP) ranging from 7 mm to 22 mm were deposited by adjusting the wire feed speed (WFS) from 100 cm/min to 500 cm/min. It is interesting to find that the macrostructure changes from columnar grains to equiaxial grains, and then returns to large columnar grains with the increase of WMP, which is mainly caused by the different cooling rates and thermal gradients. Nonetheless, the tensile properties of the components have a tendency to decline with the increase of WMP.

  2. Monitoring and control of the biogas process based on propionate concentration using online VFA measurement

    DEFF Research Database (Denmark)

    Boe, Kanokwan; Steyer, J.P.; Angelidaki, Irini

    2008-01-01

    Simple logic control algorithms were tested for automatic control of a lab-scale CSTR manure digester. Using an online VFA monitoring system, propionate concentration in the reactor was used as parameter for control of the biogas process. The propionate concentration was kept below a threshold...

  3. An unusual correlation between ppGpp pool size and rate of ribosome synthesis during partial pyrimidine starvation of Escherichia coli

    DEFF Research Database (Denmark)

    Vogel, Ulla; Pedersen, Steen; Jensen, Kaj Frank

    1991-01-01

    Escherichia coli was exposed to partial pyrimidine starvation by feeding a pyrBI strain orotate as the only pyrimidine source. Subsequently, differential rates of synthesis of rRNA and of a few ribosome-associated proteins as well as the pool sizes of nucleoside triphosphates and ppGpp were measu...

  4. The Visiting Forces Agreement (VFA in the Philippines: Insights on Issues of Sovereignty, Security and Foreign Policy

    Directory of Open Access Journals (Sweden)

    Mark Anthony M. Velasco

    2015-11-01

    Full Text Available The study intends to compare the Visiting Forces Agreement (VFA between the Philippines and the United States of America and the VFA between the Philippines and Australia. The research piece is arranged in the following flow of ideas. The first and the second part provides the foundations by highlighting issues on definition, historical background, provisions of the agreement and concerns faced by the agreement of the Visiting Forces Agreement (VFA between the Republic of the Philippines and the United States of America and the Status of the Visiting Forces Agreement (SOVFA between the Republic of the Philippines and Australia. The third part is an analysis of the VFA and the SOVFA under the tutelage of the framework on the non-intervention principle. As a result, the provisions of SOVFA were in consonance with the legal arrangement in the Philippines than the VFA with the United States of America.

  5. Monitoring and control of the biogas process based on propionate concentration using online VFA measurement.

    Science.gov (United States)

    Boe, Kanokwan; Steyer, Jean-Philippe; Angelidaki, Irini

    2008-01-01

    Simple logic control algorithms were tested for automatic control of a lab-scale CSTR manure digester. Using an online VFA monitoring system, propionate concentration in the reactor was used as parameter for control of the biogas process. The propionate concentration was kept below a threshold of 10 mM by manipulating the feed flow. Other online parameters such as pH, biogas production, total VFA, and other individual VFA were also measured to examine process performance. The experimental results showed that a simple logic control can successfully prevent the reactor from overload, but with fluctuations of the propionate level due to the nature of control approach. The fluctuation of propionate concentration could be reduced, by adding a lower feed flow limit into the control algorithm to prevent undershooting of propionate response. It was found that use of the biogas production as a main control parameter, rather than propionate can give a more stable process, since propionate was very persistent and only responded very slowly to the decrease of the feed flow which lead to high fluctuation of biogas production. Propionate, however, was still an excellent parameter to indicate process stress under gradual overload and thus recommended as an alarm in the control algorithm. Copyright IWA Publishing 2008.

  6. Empowerment with VFA as an alternative to improve a seed of raw activated sludge for the starting of UASB reactors

    International Nuclear Information System (INIS)

    Wills, Beatriz; Cuellar Winston

    2002-01-01

    In this research the technique for the improvement of a seed coming from the aerobic digestion process of domestic wastewaters, was determined. It was done in UASB (up flow anaerobic sludge blanket) reactor, by adding volatile fatty acids (VFA), during fifty days. The seed was anaerobically acclimated for ninety days, prior to the improving process. Results show that the VFA addition improves the behavior regarding control variables and yielding, and increase in the bacterial population involved in the anaerobic digestion process. It was observed that, for upward speeds greater than 0.30 m/h, there are mass losses in the reactor with VFA

  7. Protein Restriction with Amino Acid-Balanced Diets Shrinks Circulating Pool Size of Amino Acid by Decreasing Expression of Specific Transporters in the Small Intestine.

    Directory of Open Access Journals (Sweden)

    Kai Qiu

    Full Text Available Dietary protein restriction is not only beneficial to health and longevity in humans, but also protects against air pollution and minimizes feeding cost in livestock production. However, its impact on amino acid (AA absorption and metabolism is not quite understood. Therefore, the study aimed to explore the effect of protein restriction on nitrogen balance, circulating AA pool size, and AA absorption using a pig model. In Exp.1, 72 gilts weighting 29.9 ± 1.5 kg were allocated to 1 of the 3 diets containing 14, 16, or 18% CP for a 28-d trial. Growth (n = 24, nitrogen balance (n = 6, and the expression of small intestinal AA and peptide transporters (n = 6 were evaluated. In Exp.2, 12 barrows weighting 22.7 ± 1.3 kg were surgically fitted with catheters in the portal and jejunal veins as well as the carotid artery and assigned to a diet containing 14 or 18% CP. A series of blood samples were collected before and after feeding for determining the pool size of circulating AA and AA absorption in the portal vein, respectively. Protein restriction did not sacrifice body weight gain and protein retention, since nitrogen digestibility was increased as dietary protein content reduced. However, the pool size of circulating AA except for lysine and threonine, and most AA flux through the portal vein were reduced in pigs fed the low protein diet. Meanwhile, the expression of peptide transporter 1 (PepT-1 was stimulated, but the expression of the neutral and cationic AA transporter systems was depressed. These results evidenced that protein restriction with essential AA-balanced diets, decreased AA absorption and reduced circulating AA pool size. Increased expression of small intestinal peptide transporter PepT-1 could not compensate for the depressed expression of jejunal AA transporters for AA absorption.

  8. Amino acid synthesis in photosynthesizing spinach cells: effects of ammonia on pool sizes and rates of labeling from 14CO2

    International Nuclear Information System (INIS)

    Larsen, P.O.; Cornwell, K.L.; Gee, S.L.; Bassham, J.A.

    1981-01-01

    Isolated cells from leaves of Spinacia oleracea have been maintained in a state capable of high rates of photosynthetic CO 2 fixation for more than 60 hours. The incorporation of 14 CO 2 under saturating CO 2 conditions into carbohydrates, carboxylic acids, and amino acids, and the effect of ammonia on this incorporation have been studied. Total incorporation, specific radioactivity, and pool size have been determined as a function of time for most of the protein amino acids and for γ-aminobutyric acid. The measurements of specific radio-activities and of the approaches to 14 C saturation of some amino acids indicate the presence and relative sizes of metabolically active and passive pools of these amino acids. Added ammonia decreased carbon fixation into carbohydrates and increased fixation into carboxylic acids and amino acids. The results indicate that added ammonia stimulates the reactions mediated by pyruvate kinase and phosphenoenolpyruvate carboxylase, as seen with other plant systems. The data on the effects of added ammonia on total labeling, pool sizes, and specific radioactivities of several amino acids provides a number of indications about the intracellular sites of principal synthesis from carbon skeletons of these amino acids and the selective nature of effects of increased intracellular ammonia concentration on-such synthesis

  9. Effect of Molten Pool Size on Microstructure and Tensile Properties of Wire Arc Additive Manufacturing of Ti-6Al-4V Alloy

    Directory of Open Access Journals (Sweden)

    Qianru Wu

    2017-07-01

    Full Text Available Wire arc additive manufacturing (WAAM technique is a cost-competitive and efficient technology to produce large structure components in industry domains. Mechanical properties are mainly dominated by the microstructure of the components, which is deeply affected by the molten pool size. In this work, to investigate the effect of the molten pool size on microstructure and mechanical properties of the components, a series of Ti-6Al-4V alloy blocks with different width of molten pool (WMP ranging from 7 mm to 22 mm were deposited by adjusting the wire feed speed (WFS from 100 cm/min to 500 cm/min. It is interesting to find that the macrostructure changes from columnar grains to equiaxial grains, and then returns to large columnar grains with the increase of WMP, which is mainly caused by the different cooling rates and thermal gradients. Nonetheless, the tensile properties of the components have a tendency to decline with the increase of WMP.

  10. A nine-point pH titration method to determine low-concentration VFA in municipal wastewater.

    Science.gov (United States)

    Ai, Hainan; Zhang, Daijun; Lu, Peili; He, Qiang

    2011-01-01

    Characterization of volatile fatty acid (VFA) in wastewater is significant for understanding the wastewater nature and the wastewater treatment process optimization based on the usage of Activated Sludge Models (ASMs). In this study, a nine-point pH titration method was developed for the determination of low-concentration VFA in municipal wastewater. The method was evaluated using synthetic wastewater containing VFA with the concentration of 10-50 mg/l and the possible interfering buffer systems of carbonate, phosphate and ammonium similar to those in real municipal wastewater. In addition, the further evaluation was conducted through the assay of real wastewater using chromatography as reference. The results showed that the recovery of VFA in the synthetic wastewater was 92%-102 and the coefficient of variance (CV) of reduplicate measurements 1.68%-4.72%. The changing content of the buffering substances had little effect on the accuracy of the method. Moreover, the titration method was agreed with chromatography in the determination of VFA in real municipal wastewater with R(2)= 0.9987 and CV =1.3-1.7. The nine-point pH titration method is capable of satisfied determination of low-concentration VFA in municipal wastewater.

  11. A novel in-situ sampling and VFA sensor technique for anaerobic systems

    DEFF Research Database (Denmark)

    Pind, Peter Frode; Angelidaki, Irini; Ahring, Birgitte Kiær

    2002-01-01

    A key information for understanding and controlling the anaerobic biogas process is the concentration of Volatile Fatty Acids (VFA). However, access to this information has so far been limited to off-line measurements by manual time and labour consuming methods. We have developed a new technique ...... than 1000 samples on both a fullscale biogas plant and lab-scale reactors. The measuring range covers specific measurements of acetate, propionate, iso-/n-butyrate and iso-/n-valerate from 0.1 to 50 mM (6–3,000 mg)....

  12. Comparison of VFA titration procedures used for monitoring the biogas process

    DEFF Research Database (Denmark)

    Lützhøft, Hans-Christian Holten; Boe, Kanokwan; Fang, Cheng

    2014-01-01

    (GC) analysis. Two of the procedures are commonly used in biogas plants and two are discussed in literature. The results showed that the optimal titration results were obtained when 40mL of four times diluted digested manure was gently stirred (200rpm). Results from samples with different VFA......Titrimetric determination of volatile fatty acids (VFAs) contents is a common way to monitor a biogas process. However, digested manure from co-digestion biogas plants has a complex matrix with high concentrations of interfering components, resulting in varying results when using different...

  13. Experimental study on size effect of siphon-breaking hole in the real-scaled reactor pool

    International Nuclear Information System (INIS)

    Kang, Soon Ho; Ahn, Ho Seon; Kim, Ji Min; Kim, Moo Hwan; Lee, Kwon Yeong; Seo, Kyoung Woo; Chi, Dae Young

    2012-01-01

    A rupture in the primary piping of a cooling system with a heat source or in a research reactor could lead to a loss-of-coolant accident (LOCA). However, if the water level of the reactor pool could be sustained and a reactor scram follows, the heat source could be cooled by natural convection, and significant accidents could be avoided. When a piping-system rupture accident occurs, the coolant starts to siphon out of the reactor pool until the pressure head between the inlet and outlet is removed or the siphon flow is interrupted. Therefore, a siphon-breaker mechanism can be adopted as a passive safety device to maintain the reactor water level. The gas entrainment is used to block the continuous loss of coolant by interrupting the siphon flow. Siphon breaking is complicated due to the transient, turbulent, two-phase flow mode, so suitable models or correlations that describe this phenomenon do not exist, and no general analysis been developed. Previous researchers have conducted experiments and numerical simulations to design a siphon breaker to meet their needs. Previous research on siphon breaking has not been conducted systemically, and no literature exists, even though the topic is greatly concerned with hydraulic safety. In this study, siphon-breaking holes were used as siphon breakers, and their performance was evaluated by the residual water quantity. Flow visualization was conducted to interpret the siphon-breaking phenomenon

  14. Diets high in resistant starch and arabinoxylan modulate digestion processes and SCFA pool size in the large intestine and faecal microbial composition in pigs.

    Science.gov (United States)

    Nielsen, Tina S; Lærke, Helle N; Theil, Peter K; Sørensen, Jens F; Saarinen, Markku; Forssten, Sofia; Knudsen, Knud E Bach

    2014-12-14

    The effects of a high level of dietary fibre (DF) either as arabinoxylan (AX) or resistant starch (RS) on digestion processes, SCFA concentration and pool size in various intestinal segments and on the microbial composition in the faeces were studied in a model experiment with pigs. A total of thirty female pigs (body weight 63.1 (sem 4.4) kg) were fed a low-DF, high-fat Western-style control diet (WSD), an AX-rich diet (AXD) or a RS-rich diet (RSD) for 3 weeks. Diet significantly affected the digestibility of DM, protein, fat, NSP and NSP components, and the arabinose:xylose ratio, as well as the disappearance of NSP and AX in the large intestine. RS was mainly digested in the caecum. AX was digested at a slower rate than RS. The digesta from AXD-fed pigs passed from the ileum to the distal colon more than twice as fast as those from WSD-fed pigs, with those from RSD-fed pigs being intermediate (PEubacterium rectale, Bifidobacterium spp. and Lactobacillus spp. in the faeces sampled at week 3 of the experimental period (P< 0.05). In the caecum, proximal and mid colon, AXD feeding resulted in a 3- to 5-fold higher pool size of butyrate compared with WSD feeding, with the RSD being intermediate (P <0.001). In conclusion, the RSD and AXD differently affected digestion processes compared with the WSD, and the AXD most efficiently shifted the microbial composition towards butyrogenic species in the faeces and increased the large-intestinal butyrate pool size.

  15. Toasting of cereal grains: effects on in vitro rumen gas production and VFA yield

    Directory of Open Access Journals (Sweden)

    Seerp Tamminga

    2010-01-01

    Full Text Available The fermentation properties of the following feeds: pelleted barley (PB, toasted and pelleted barley (TPB, pelleted maize (PM and toasted and pelleted maize (TPM were studied using an in vitro gas production (GP technique. Each feed sample (0.5g was incubated (3 replications, with rumen fluid collected from 3 grazing lactating dairy cows. The kinetics of GP were automatically recorded for 72h. The amounts of DM disappeared (DMd and the volatile fatty acid yields (VFA were measured. On barley, compared to simple pelleting, toasting significantly (P<0.05 reduced DMd (87.5 vs. 86.2%, the asymptotic GP (A, 388 vs. 367ml/g DMd and slightly increased the time of maximum GP rate (TRmax, 2.89 vs. 3.15h. On maize toasting did not affect DMd and A, but significantly reduced T1/2 (9.71 vs. 8.57; P<0.05 and TRmax (5.04 vs. 4.49, P<0.05. Toasting significantly reduced the VFA yields both of barley and maize. These results, in agreement with previous in sacco and in vivo observations, suggest that toasting might reduce the amount of potential fermentable substrate of barley, whereas it might increase the rate of fermentation of maize.

  16. Cash pooling

    OpenAIRE

    Lozovaya, Karina

    2009-01-01

    This work makes a mention of cash management. At next chapter describes two most known theoretical models of cash management -- Baumol Model and Miller-Orr Model. Principal part of work is about cash pooling, types of cash pooling, cash pooling at Czech Republic and influence of cash pooling over accounting and taxes.

  17. CONTROL PARAMETERS FOR UNDERSTANDING AND PREVENTING PROCESS IMBALANCES IN BIOGAS PLANTS. EMPHAS IS ON VFA DYNAMICS

    DEFF Research Database (Denmark)

    Bangsø Nielsen, Henrik

    environmental changes differ widely between the different groups. As a consequence of this, an unrestrained reactor operation can lead to disturbances in the balance between the different microbial groups, which might lead to reactor failure. Therefore, reliable parameters and tools for efficient process...... control and understanding are necessary. The work of present study was directed towards this challenge. Initially, the response of the anaerobic digestion process to various types of process imbalances was investigated with special focus on volatile fatty acid dynamics (VFA), methane production and pH...... of process imbalances in biogas plants. At Danish full-scale biogas plants the biogas production is normally the only continuously measured parameter. In order to examine the usability of propionate as control parameter a reactor experiment was constructed in which the reactor operation either was carried...

  18. Pilot-scale application of an online VFA sensor for monitoring and control of a manure digester

    DEFF Research Database (Denmark)

    Boe, Kanokwan; Angelidaki, Irini

    2012-01-01

    A volatile fatty acids (VFA) sensor based on headspace chromatography was tested for online monitoring and control of a pilot-scale manure digester. The sensor showed satisfying results in terms of sensitivity and reliability for monitoring of the digester. The online VFA and biogas production data...... parameter for optimization, it could not distinguish between the decreases of biogas production from inhibition and from lower organic content in the substrate, which resulted in undesired decreasing of the control gas setpoint when the substrate was diluted. It was necessary to adjust the yield parameter...

  19. Pool size ratio of the substantia nigra in Parkinson's disease derived from two different quantitative magnetization transfer approaches

    Energy Technology Data Exchange (ETDEWEB)

    Trujillo, Paula [Department of Neuroradiology, Fondazione IRCCS Ca' Granda - Ospedale Maggiore Policlinico, Milan, MI (Italy); Vanderbilt University Medical Center, Department of Neurology, Nashville, TN (United States); Summers, Paul E.; Costa, Antonella [Department of Neuroradiology, Fondazione IRCCS Ca' Granda - Ospedale Maggiore Policlinico, Milan, MI (Italy); Smith, Alex K. [University of Oxford, Centre for Functional Magnetic Resonance Imaging of the Brain (FMRIB), Nuffield Department of Clinical Neuroscience, Oxford (United Kingdom); Smith, Seth A. [Vanderbilt University Institute of Imaging Science, Nashville, TN (United States); Vanderbilt University, Department of Biomedical Engineering, Nashville, TN (United States); Mainardi, Luca T.; Cerutti, Sergio [Department of Electronics, Information and Bioengineering, Politecnico di Milano, Milan, MI (Italy); Claassen, Daniel O. [Vanderbilt University Medical Center, Department of Neurology, Nashville, TN (United States)

    2017-12-15

    We sought to measure quantitative magnetization transfer (qMT) properties of the substantia nigra pars compacta (SNc) in patients with Parkinson's disease (PD) and healthy controls (HCs) using a full qMT analysis and determine whether a rapid single-point measurement yields equivalent results for pool size ratio (PSR). Sixteen different MT-prepared MRI scans were obtained at 3 T from 16 PD patients and eight HCs, along with B1, B0, and relaxation time maps. Maps of PSR, free and macromolecular pool transverse relaxation times (T{sub 2}{sup f}, T{sub 2}{sup m}) and rate of MT exchange between pools (k{sub mf}) were generated using a full qMT model. PSR maps were also generated using a single-point qMT model requiring just two MT-prepared images. qMT parameter values of the SNc, red nucleus, cerebral crus, and gray matter were compared between groups and methods. PSR of the SNc was the only qMT parameter to differ significantly between groups (p < 0.05). PSR measured via single-point analysis was less variable than with the full MT model, provided slightly better differentiation of PD patients from HCs (area under curve 0.77 vs. 0.75) with sensitivity of 0.75 and specificity of 0.87, and was better than transverse relaxation time in distinguishing PD patients from HCs (area under curve 0.71, sensitivity 0.87, and specificity 0.50). The increased PSR observed in the SNc of PD patients may provide a novel biomarker of PD, possibly associated with an increased macromolecular content. Single-point PSR mapping with reduced variability and shorter scan times relative to the full qMT model appears clinically feasible. (orig.)

  20. Exciting Pools

    Science.gov (United States)

    Wright, Bradford L.

    1975-01-01

    Advocates the creation of swimming pool oscillations as part of a general investigation of mechanical oscillations. Presents the equations, procedure for deriving the slosh modes, and methods of period estimation for exciting swimming pool oscillations. (GS)

  1. Swimming Pool Safety

    Science.gov (United States)

    ... Spread the Word Shop AAP Find a Pediatrician Safety & Prevention Immunizations All Around At Home At Play ... Español Text Size Email Print Share Swimming Pool Safety Page Content ​What is the best way to ...

  2. Relationships between sulphate reduction and COD/VFA utilisation using grass cellulose as carbon and energy sources

    CSIR Research Space (South Africa)

    Mulopo, J

    2010-07-01

    Full Text Available /fermentation products of grass cellulose, volatile fatty acids (VFA), function as the electron donors and SO2/4 as the electron acceptor. The aim of the study presented here was to elucidate the interactions between the cellulose degradation rate, the chemical oxygen...

  3. Relationship between rumen protozoal growth, intake of DM, TDN, N, DOM and VFA production rate in buffalo calves

    International Nuclear Information System (INIS)

    Verma, D.N.; Singh, U.B.

    1981-01-01

    Relationships between in vivo rumen protozoal growth and intakes of dry matter (DM), nitrogen, digestible organic matter (DOM), total digestible nutrients (TDN) and volatile fatty acid (VFA) production have been studied. Isotope dilution technique and 14 C-labelled rumen protozoa were used in the studies. (author)

  4. Vfa1 Binds to the N-terminal Microtubule-interacting and Trafficking (MIT) Domain of Vps4 and Stimulates Its ATPase Activity*

    Science.gov (United States)

    Vild, Cody J.; Xu, Zhaohui

    2014-01-01

    The endosomal sorting complexes required for transport (ESCRT) are responsible for multivesicular body biogenesis, membrane abscission during cytokinesis, and retroviral budding. They function as transiently assembled molecular complexes on the membrane, and their disassembly requires the action of the AAA-ATPase Vps4. Vps4 is regulated by a multitude of ESCRT and ESCRT-related proteins. Binding of these proteins to Vps4 is often mediated via the microtubule-interacting and trafficking (MIT) domain of Vps4. Recently, a new Vps4-binding protein Vfa1 was identified in a yeast genetic screen, where overexpression of Vfa1 caused defects in vacuolar morphology. However, the function of Vfa1 and its role in vacuolar biology were largely unknown. Here, we provide the first detailed biochemical and biophysical study of Vps4-Vfa1 interaction. The MIT domain of Vps4 binds to the C-terminal 17 residues of Vfa1. This interaction is of high affinity and greatly stimulates the ATPase activity of Vps4. The crystal structure of the Vps4-Vfa1 complex shows that Vfa1 adopts a canonical MIT-interacting motif 2 structure that has been observed previously in other Vps4-ESCRT interactions. These findings suggest that Vfa1 is a novel positive regulator of Vps4 function. PMID:24567329

  5. Vfa1 binds to the N-terminal microtubule-interacting and trafficking (MIT) domain of Vps4 and stimulates its ATPase activity.

    Science.gov (United States)

    Vild, Cody J; Xu, Zhaohui

    2014-04-11

    The endosomal sorting complexes required for transport (ESCRT) are responsible for multivesicular body biogenesis, membrane abscission during cytokinesis, and retroviral budding. They function as transiently assembled molecular complexes on the membrane, and their disassembly requires the action of the AAA-ATPase Vps4. Vps4 is regulated by a multitude of ESCRT and ESCRT-related proteins. Binding of these proteins to Vps4 is often mediated via the microtubule-interacting and trafficking (MIT) domain of Vps4. Recently, a new Vps4-binding protein Vfa1 was identified in a yeast genetic screen, where overexpression of Vfa1 caused defects in vacuolar morphology. However, the function of Vfa1 and its role in vacuolar biology were largely unknown. Here, we provide the first detailed biochemical and biophysical study of Vps4-Vfa1 interaction. The MIT domain of Vps4 binds to the C-terminal 17 residues of Vfa1. This interaction is of high affinity and greatly stimulates the ATPase activity of Vps4. The crystal structure of the Vps4-Vfa1 complex shows that Vfa1 adopts a canonical MIT-interacting motif 2 structure that has been observed previously in other Vps4-ESCRT interactions. These findings suggest that Vfa1 is a novel positive regulator of Vps4 function.

  6. A model based on Rock-Eval thermal analysis to quantify the size of the centennially persistent organic carbon pool in temperate soils

    Science.gov (United States)

    Cécillon, Lauric; Baudin, François; Chenu, Claire; Houot, Sabine; Jolivet, Romain; Kätterer, Thomas; Lutfalla, Suzanne; Macdonald, Andy; van Oort, Folkert; Plante, Alain F.; Savignac, Florence; Soucémarianadin, Laure N.; Barré, Pierre

    2018-05-01

    Changes in global soil carbon stocks have considerable potential to influence the course of future climate change. However, a portion of soil organic carbon (SOC) has a very long residence time ( > 100 years) and may not contribute significantly to terrestrial greenhouse gas emissions during the next century. The size of this persistent SOC reservoir is presumed to be large. Consequently, it is a key parameter required for the initialization of SOC dynamics in ecosystem and Earth system models, but there is considerable uncertainty in the methods used to quantify it. Thermal analysis methods provide cost-effective information on SOC thermal stability that has been shown to be qualitatively related to SOC biogeochemical stability. The objective of this work was to build the first quantitative model of the size of the centennially persistent SOC pool based on thermal analysis. We used a unique set of 118 archived soil samples from four agronomic experiments in northwestern Europe with long-term bare fallow and non-bare fallow treatments (e.g., manure amendment, cropland and grassland) as a sample set for which estimating the size of the centennially persistent SOC pool is relatively straightforward. At each experimental site, we estimated the average concentration of centennially persistent SOC and its uncertainty by applying a Bayesian curve-fitting method to the observed declining SOC concentration over the duration of the long-term bare fallow treatment. Overall, the estimated concentrations of centennially persistent SOC ranged from 5 to 11 g C kg-1 of soil (lowest and highest boundaries of four 95 % confidence intervals). Then, by dividing the site-specific concentrations of persistent SOC by the total SOC concentration, we could estimate the proportion of centennially persistent SOC in the 118 archived soil samples and the associated uncertainty. The proportion of centennially persistent SOC ranged from 0.14 (standard deviation of 0.01) to 1 (standard deviation

  7. Mineralization of LCFA associated with anaerobic sludge: Kinetics, enhancement of methanogenic activity, and effect of VFA.

    Science.gov (United States)

    Pereira, M A; Sousa, D Z; Mota, M; Alves, M M

    2004-11-20

    Long-chain fatty acids (LCFA) associated with anaerobic sludge by mechanisms of precipitation, adsorption, or entrapment can be biodegraded to methane. The mineralization kinetics of biomass-associated LCFA were established according to an inhibition model based on Haldane's enzymatic inhibition kinetics. A value around 1,000 mg COD-LCFA..g VSS(-1) was obtained for the optimal specific LCFA content that allowed the maximal mineralization rate. For sludge with specific LCFA contents of 2,838 +/- 63 and 4,571 +/- 257 mg COD-LCFA..g VSS(-1), the specific methanogenic activities in the presence of acetate, butyrate, and H(2)/CO(2) were significantly enhanced after the mineralization of the biomass-associated LCFA. For sludge with a specific LCFA content near the optimal value defined by the kinetic model, the effect of adding VFA to the medium was studied during the mineralization of the biomass-associated LCFA. Different patterns were obtained for each individual substrate. Acetate and butyrate were preferentially consumed by the consortium, but in the case of propionate no evidence of a sequential consumption pattern could be withdrawn. It was concluded that LCFA do not exert a bactericidal neither a permanent toxic effect toward the anaerobic consortia. A discussion is addressed to the relative roles of a reversible inhibitory effect and a transport limitation effect imposed by the LCFA surrounding the cells. (c) 2004 Wiley Periodicals, Inc

  8. Cholecystectomy in patients with normal gallbladder function did not alter characteristics in duodenal motility which was not correlated to size of bile acid pool

    DEFF Research Database (Denmark)

    Andersen, P V; Mortensen, J; Oster-Jørgensen, E

    1999-01-01

    was obtained from 5 PM to 8 AM with a sampling frequency of 4 Hz. At 6 PM, the patients received a 1400-kJ standard meal. The size of the bile acid pool after cholecystectomy was measured according to the dilution principle using [C14]cholic acid as the marker. Preoperatively the migrating motor complex (MMC......) cycle was 0.48/hr (quartiles 0.42-0.68) compared to 0.68/hr (0.43-0.77) postoperatively. This difference was not significant. An increase in the MMC cycle frequency was observed postoperatively in three patients, and a decrease was seen in four patients. The migration velocity was 5.61 cm/min (4.......26-8.01) preoperatively and 7.16 cm/min (4.79-9.71) postoperatively, a difference that was not significant. The time period from meal ingestion to appearance of phase III was 297 min (218-431) at the preoperative examination and 443 min (192-494) at the postoperative examination. This difference was not significant...

  9. Anaerobic digestion of swine manure under natural zeolite addition: VFA evolution, cation variation, and related microbial diversity.

    Science.gov (United States)

    Lin, Lin; Wan, Chunli; Liu, Xiang; Lei, Zhongfang; Lee, Duu-Jong; Zhang, Yi; Tay, Joo Hwa; Zhang, Zhenya

    2013-12-01

    Batch experiments were carried out on anaerobic digestion of swine manure under 10 % of total solids and 60 g/L of zeolite addition at 35 °C. Four distinctive volatile fatty acid (VFAs) evolution stages were observed during the anaerobic process, i.e., VFA accumulation, acetic acid (HAc) and butyric acid (HBu) utilization, propionic acid (HPr) and valeric acid (HVa) degradation, and VFA depletion. Large decreases in HAc/HBu and HPr/HVa occurred respectively at the first and second biogas peaks. Biogas yield increased by 20 % after zeolite addition, about 356 mL/g VSadded with accelerated soluble chemical oxygen demand degradation and VFA (especially HPr and HBu) consumption in addition to a shortened lag phase between the two biogas peaks. Compared with Ca(2+) and Mg(2+) (100-300 mg/L) released from zeolite, simultaneous K(+) and NH4 (+) (580-600 mg/L) adsorptions onto zeolite particles contributed more to the enhanced biogasification, resulting in alleviated inhibition effects of ammonium on acidogenesis and methanogenesis, respectively. All the identified anaerobes could be grouped into Bacteroidetes and Firmicutes, and zeolite addition had no significant influence on the microbial biodiversity in this study.

  10. A model based on Rock-Eval thermal analysis to quantify the size of the centennially persistent organic carbon pool in temperate soils

    Directory of Open Access Journals (Sweden)

    L. Cécillon

    2018-05-01

    Full Text Available Changes in global soil carbon stocks have considerable potential to influence the course of future climate change. However, a portion of soil organic carbon (SOC has a very long residence time ( >  100 years and may not contribute significantly to terrestrial greenhouse gas emissions during the next century. The size of this persistent SOC reservoir is presumed to be large. Consequently, it is a key parameter required for the initialization of SOC dynamics in ecosystem and Earth system models, but there is considerable uncertainty in the methods used to quantify it. Thermal analysis methods provide cost-effective information on SOC thermal stability that has been shown to be qualitatively related to SOC biogeochemical stability. The objective of this work was to build the first quantitative model of the size of the centennially persistent SOC pool based on thermal analysis. We used a unique set of 118 archived soil samples from four agronomic experiments in northwestern Europe with long-term bare fallow and non-bare fallow treatments (e.g., manure amendment, cropland and grassland as a sample set for which estimating the size of the centennially persistent SOC pool is relatively straightforward. At each experimental site, we estimated the average concentration of centennially persistent SOC and its uncertainty by applying a Bayesian curve-fitting method to the observed declining SOC concentration over the duration of the long-term bare fallow treatment. Overall, the estimated concentrations of centennially persistent SOC ranged from 5 to 11 g C kg−1 of soil (lowest and highest boundaries of four 95 % confidence intervals. Then, by dividing the site-specific concentrations of persistent SOC by the total SOC concentration, we could estimate the proportion of centennially persistent SOC in the 118 archived soil samples and the associated uncertainty. The proportion of centennially persistent SOC ranged from 0.14 (standard deviation

  11. Dietary marker effects on fecal microbial ecology, fecal VFA, nutrient digestibility coefficients, and growth performance in finishing pigs.

    Science.gov (United States)

    Kerr, B J; Weber, T E; Ziemer, C J

    2015-05-01

    Use of indigestible markers such as Cr2O3, Fe2O3, and TiO2 are commonly used in animal studies to evaluate digesta rate of passage and nutrient digestibility. Yet, the potential impact of indigestible markers on fecal microbial ecology and subsequent VFA generation is not known. Two experiments utilizing a total of 72 individually fed finishing pigs were conducted to describe the impact of dietary markers on fecal microbial ecology, fecal ammonia and VFA concentrations, nutrient digestibility, and pig performance. All pigs were fed a common diet with no marker or with 0.5% Cr2O3, Fe2O3, or TiO2. In Exp. 1, after 33 d of feeding, fresh fecal samples were collected for evaluation of microbial ecology, fecal ammonia and VFA concentrations, and nutrient digestibility, along with measures of animal performance. No differences were noted in total microbes or bacterial counts in pig feces obtained from pigs fed the different dietary markers while Archaea counts were decreased (P = 0.07) in feces obtained from pigs fed the diet containing Fe2O 3compared to pigs fed the control diet. Feeding Cr2O3, Fe2O3, or TiO2 increased fecal bacterial richness (P = 0.03, 0.01, and 0.10; respectively) when compared to pigs fed diets containing no marker, but no dietary marker effects were noted on fecal microbial evenness or the Shannon-Wiener index. Analysis of denaturing gradient gel electrophoresis gels did not reveal band pattern alterations due to inclusion of dietary markers in pig diets. There was no effect of dietary marker on fecal DM, ammonia, or VFA concentrations. Pigs fed diets containing Cr2O3 had greater Ca, Cu, Fe, and P (P ≤ 0.02), but lower Ti ( P= 0.08) digestibility compared to pigs fed the control diet. Pigs fed diets containing Fe2O3 had greater Ca (P = 0.08) but lower Ti (P = 0.01) digestibility compared to pigs fed the control diet. Pigs fed diets containing TiO2 had greater Fe and Zn (P ≤ 0.09), but lower Ti ( P= 0.01) digestibility compared to pigs fed the

  12. Absorbed zinc and exchangeable zinc pool size are significantly greater in Pakistani infants receiving traditional complementary foods with zinc fortified micronutrient powder

    International Nuclear Information System (INIS)

    Ariff, Shabina; Soofi, Sajid; Bhutta, Zulfiqar; Krebs, Nancy; Westcott, Jamie

    2014-01-01

    Full text: Adequacy of zinc intake from breast milk alone becomes marginal in relation to infant requirements by around six months of age. Simple and cost effective strategies are needed at population level to ensure adequate intakes of zinc in infants and toddlers in populations at risk of zinc deficiency. We determined the amount of absorbed zinc (AZ) from a micronutrient powder (MNP) without and with 10 mg of zinc (MNP, MNP+Zn, respectively) added to local complementary foods used in Pakistan, and the impact on the exchangeable zinc pool (EZP) size. As a nested study within a large prospective cluster randomized trial, 6 month old infants were randomized to receive MNP or MNP+Zn. Stable isotope methodology was applied after ~ 3 and 9 months of use to measure AZ from MNP-fortified test meals of rice-lentils (khitchri) and EZP. Nineteen infants per group completed the first metabolic studies; 14 and 17 infants in MNP and MNP+Zn groups, completed the follow-up studies. Mean (±SD) AZs were 0.1± 0.1 and 1.2±0.5 mg at the first point for the MNP and MNP+Zn groups, respectively (p <0.001); results were nearly identical at the follow-up measurement. EZP did not differ between groups at the first measurement but was less in the MNP group (3.7±0.6 mg/kg) than in the MNP+Zn group (4.5±1.0 mg/kg) at the second measurement (P = 0.01). These data confirm that the MNP+Zn in khitchri were well absorbed, and after a year of home fortification, zinc status assessed by EZP was significantly better for the MNP+Zn group. Additional field studies may be necessary to ascertain the adequacy of this dose for infants at high risk of deficiency. (author)

  13. PDA: Pooled DNA analyzer

    Directory of Open Access Journals (Sweden)

    Lin Chin-Yu

    2006-04-01

    Full Text Available Abstract Background Association mapping using abundant single nucleotide polymorphisms is a powerful tool for identifying disease susceptibility genes for complex traits and exploring possible genetic diversity. Genotyping large numbers of SNPs individually is performed routinely but is cost prohibitive for large-scale genetic studies. DNA pooling is a reliable and cost-saving alternative genotyping method. However, no software has been developed for complete pooled-DNA analyses, including data standardization, allele frequency estimation, and single/multipoint DNA pooling association tests. This motivated the development of the software, 'PDA' (Pooled DNA Analyzer, to analyze pooled DNA data. Results We develop the software, PDA, for the analysis of pooled-DNA data. PDA is originally implemented with the MATLAB® language, but it can also be executed on a Windows system without installing the MATLAB®. PDA provides estimates of the coefficient of preferential amplification and allele frequency. PDA considers an extended single-point association test, which can compare allele frequencies between two DNA pools constructed under different experimental conditions. Moreover, PDA also provides novel chromosome-wide multipoint association tests based on p-value combinations and a sliding-window concept. This new multipoint testing procedure overcomes a computational bottleneck of conventional haplotype-oriented multipoint methods in DNA pooling analyses and can handle data sets having a large pool size and/or large numbers of polymorphic markers. All of the PDA functions are illustrated in the four bona fide examples. Conclusion PDA is simple to operate and does not require that users have a strong statistical background. The software is available at http://www.ibms.sinica.edu.tw/%7Ecsjfann/first%20flow/pda.htm.

  14. Strength training increases the size of the satellite cell pool in type I and II fibres of chronically painful trapezius muscle in females

    DEFF Research Database (Denmark)

    Mackey, Abigail; Andersen, Lars L; Frandsen, Ulrik

    2011-01-01

    ) and general fitness training (GFT, n = 16) to augment the satellite cell (SC) and macrophage pools in the trapezius muscles of women diagnosed with trapezius myalgia. A group receiving general health information (REF, n = 8) served as a control. Muscle biopsies were collected from the trapezius muscles...

  15. Pool scrubbing

    International Nuclear Information System (INIS)

    Lopez-Jimenez, J.; Herranz, J.; Escudero, M.J.; Espigares, M.M.; Peyres, V.; Polo, J.; Kortz, Ch.; Koch, M.K.; Brockmeier, U.; Unger, H.; Dutton, L.M.C.; Smedley, Ch.; Trow, W.; Jones, A.V.; Bonanni, E.; Calvo, M.; Alonso, A.

    1996-12-01

    The Source Term Project in the Third Frame Work Programme of the European Union Was conducted under and important joined effort on pool scrubbing research. CIEMAT was the Task Manager of the project and several other organizations participated in it: JRC-Ispra, NNC Limited, RUB-NES and UPM. The project was divided into several tasks. A peer review of the models in the pool scrubbing codes SPARC90 and BUSCA-AUG92 was made, considering the different aspects in the hydrodynamic phenomenology, particle retention and fission product vapor abortions. Several dominant risk accident sequences were analyzed with MAAP, SPARC90 and BUSCA-AUG92 codes, and the predictions were compared. A churn-turbulent model was developed for the hydrodynamic behaviour of the pool. Finally, an experimental programme in the PECA facility of CIEMAT was conducted in order to study the decontamination factor under jet injection regime, and the experimental observations were compared with the SPARC and BUSCA codes. (Author)

  16. A comparative study on the production rates of VFA and bacteria in the rumen of buffalo and goat estimated by isotope dilution technique

    International Nuclear Information System (INIS)

    Verma, D.N.; Mehra, U.R.; Singh, U.B.; Ranjhan, S.K.

    1977-01-01

    Digestibility trials were conducted on Murrah buffaloes and Barbari goats with rumen cannulae in the rumen to determine the digestibility of the feed constituents and the production rates of bacteria and total VFA were estimated in the rumen by isotope dilution technique. The bacterial cells growth in the rumen was more in goats than buffaloes when fed ad libitum and calculated on equal feed intake, where as, in buffaloes fed on restricted diet equal to the goats the production of bacteria and VFA were higher. Goats converted 54.04 percent of their dietary nitrogen into microbial nitrogen which was more than twice of buffaloes. (author)

  17. Study of the hovering period and bubble size in fully developed pool nucleate boiling of saturated liquid with a time-dependent heat source

    International Nuclear Information System (INIS)

    Pasamehmetoglu, K.O.; Nelson, R.A.

    1987-01-01

    In this paper, the bubble behavior in saturated pool boiling with a time-dependent heat source is analyzed. The study is restricted to the period from fully developed nucleate boiling until critical heat flux occurs. The hovering period and the departure volume of the bubble are selected as the characteristic parameters for bubble behavior. These parameters are quantified by solving the equation of motion for an idealized bubble. This equation is solved for cases in which the surface heat flux changes linearly and exponentially as a function of time. After nondimensionalization, the results are compared directly with the results of the steady-state problem. The comparison shows that the transient heat input has practically no effect on the hovering period. However, the transient heat flux causes a decreased volume at bubble departure. The volume decrease is dependent on the severity of the transient. These results are in qualitative agreement with the experimental observation quoted in the literature

  18. A Genetic Cascade of let-7-ncl-1-fib-1 Modulates Nucleolar Size and rRNA Pool in Caenorhabditis elegans.

    Directory of Open Access Journals (Sweden)

    Yung-Hsiang Yi

    2015-10-01

    Full Text Available Ribosome biogenesis takes place in the nucleolus, the size of which is often coordinated with cell growth and development. However, how metazoans control nucleolar size remains largely unknown. Caenorhabditis elegans provides a good model to address this question owing to distinct tissue distribution of nucleolar sizes and a mutant, ncl-1, which exhibits larger nucleoli than wild-type worms. Here, through a series of loss-of-function analyses, we report that the nucleolar size is regulated by a circuitry composed of microRNA let-7, translation repressor NCL-1, and a major nucleolar pre-rRNA processing protein FIB-1/fibrillarin. In cooperation with RNA binding proteins PUF and NOS, NCL-1 suppressed the translation of FIB-1/fibrillarin, while let-7 targeted the 3'UTR of ncl-1 and inhibited its expression. Consequently, the abundance of FIB-1 is tightly controlled and correlated with the nucleolar size. Together, our findings highlight a novel genetic cascade by which post-transcriptional regulators interplay in developmental control of nucleolar size and function.

  19. PENGARUH TEPUNG DAUN GAMAL DAN DAUN KELOR DALAM UREA CASSAVA BLOK (UCB TERHADAP KECERNAAN, KADAR VFA, DAN NH3 IN-VITRO

    Directory of Open Access Journals (Sweden)

    N M. WITARIADI

    2012-09-01

    Full Text Available ABSTRAK Penelitian telah dilakukan dengan tujuan untuk mendapatkan informasi tentang pengaruh tepung daun gamal dan daun kelor sebagai sumber protein dalam urea cassava blok (UCB terhadap kecernaan bahan kering, bahan organik, kadar VFA, dan NH3 cairan rumen pakan jerami padi secara invitro. Penelitian dilaksanakan dengan mempergunakan rancangan acak lengkap (RAL dengan 3 perlakuan dan 5 ulangan. Sehingga secara keseluruhan terdapat 15 unit penelitian. Adapun ketiga perlakuan tersebut adalah: Perlakuan A (jerami padi + UCB yang ditambah tepung daun kelor; B (jerami padi + UCB yang ditambah tepung daun gamal, dan C (jerami padi + UCB yang ditambah tepung daun kelor dan daun gamal. Varibel yang diamati adalah kecernaan bahan kering (KCBK , kecernaan bahan organik (KCBO in-vitro, produksi vollatile fatty acid (VFA, produksi NH3, dan pH supernatan. Hasil penelitian mendapatkan bahwa KCBK, KCBO invitro, VFA, NH3, dan pH supernatan pada ketiga perlakuan berbeda nyata (P<0,05. Penggunaan daun gamal sebagai sumber protein pada UCB menghasilkan KCBK, KCBO, VFA, NH3, tertinggi dibandingkan dengan daun kelor maupun kombinasi antara daun gamal dan daun kelor. EFFECT OF USING GLIRICIDIA (Gliricidia sepium AND MORINGA (Moringa oleifera LEAVES MEALS IN UREA CASSAVA BLOCK (UCB ON DIGESTIBILITY, VOLLATILE FATTY ACID, AND NH3 IN-VITRO. ABSTRACT The experiment has been conducted in order to now the effect of Gliricidia sepium and Moringa oleifera leaves meal a source of protein in urea cassava block (UCB to the digestibility dray matter and organic matter , VFA and ammonia concentration with rice straw diet. The experiment set in completely randomized design using three treatment. The treatment are: A (rise straw + UCB with Moringa; B (rise straw + UCB with Gliricidia sepium, and C (rise straw + UCB with Moringa and Gliricidia sepium. The observed variable are: dry matter, organic matter digestibility, volatile fatty acid, ammonia concentration, and pH rumen juice

  20. Hawaii ESI: POOLS (Anchialine Pool Points)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set contains sensitive biological resource data for anchialine pools in Hawaii. Anchialine pools are small, relatively shallow coastal ponds that occur...

  1. Relative size of gills of Cloeodes jaragua Salles & Lugo-Ortiz, 2003 (Ephemeroptera, Baetidae) on pool and riffle areas of streams at the Atlantic Rainforest

    OpenAIRE

    Gonçalves, Inês Corrêa; Cid, Bruno; Mortati, Amanda Frederico; Quesado, Letícia Barbosa; Nessimian, Jorge Luiz

    2011-01-01

    Physical environment of streams present many challenging factors to the organisms living under its influence. Water speed, one of the most important factors affecting such environments, has local influence on substrata, temperature, and oxygen levels. It acts determining species distributions and morphological and behavioral adaptations of organisms. The aim of this study was to assess the relative size of gills of Cloeodes jaragua on two mesohabitats: lentic environment (river dam) and lotic...

  2. An Lmx1b-miR135a2 regulatory circuit modulates Wnt1/Wnt signaling and determines the size of the midbrain dopaminergic progenitor pool.

    Directory of Open Access Journals (Sweden)

    Angela Anderegg

    Full Text Available MicroRNAs regulate gene expression in diverse physiological scenarios. Their role in the control of morphogen related signaling pathways has been less studied, particularly in the context of embryonic Central Nervous System (CNS development. Here, we uncover a role for microRNAs in limiting the spatiotemporal range of morphogen expression and function. Wnt1 is a key morphogen in the embryonic midbrain, and directs proliferation, survival, patterning and neurogenesis. We reveal an autoregulatory negative feedback loop between the transcription factor Lmx1b and a newly characterized microRNA, miR135a2, which modulates the extent of Wnt1/Wnt signaling and the size of the dopamine progenitor domain. Conditional gain of function studies reveal that Lmx1b promotes Wnt1/Wnt signaling, and thereby increases midbrain size and dopamine progenitor allocation. Conditional removal of Lmx1b has the opposite effect, in that expansion of the dopamine progenitor domain is severely compromised. Next, we provide evidence that microRNAs are involved in restricting dopamine progenitor allocation. Conditional loss of Dicer1 in embryonic stem cells (ESCs results in expanded Lmx1a/b+ progenitors. In contrast, forced elevation of miR135a2 during an early window in vivo phenocopies the Lmx1b conditional knockout. When En1::Cre, but not Shh::Cre or Nes::Cre, is used for recombination, the expansion of Lmx1a/b+ progenitors is selectively reduced. Bioinformatics and luciferase assay data suggests that miR135a2 targets Lmx1b and many genes in the Wnt signaling pathway, including Ccnd1, Gsk3b, and Tcf7l2. Consistent with this, we demonstrate that this mutant displays reductions in the size of the Lmx1b/Wnt1 domain and range of canonical Wnt signaling. We posit that microRNA modulation of the Lmx1b/Wnt axis in the early midbrain/isthmus could determine midbrain size and allocation of dopamine progenitors. Since canonical Wnt activity has recently been recognized as a key

  3. Heat transfer from internally heated hemispherical pools

    International Nuclear Information System (INIS)

    Gabor, J.D.; Ellsion, P.G.; Cassulo, J.C.

    1980-01-01

    Experiments were conducted on heat transfer from internally heated ZnSO 4 -H 2 O pools to the walls of hemispherical containers. This experimental technique provides data for a heat transfer system that has to date been only theoretically treated. Three different sizes of copper hemispherical containers were used: 240, 280, 320 mm in diameter. The pool container served both as a heat transfer surface and as an electrode. The opposing electrode was a copper disk, 50 mm in diameter located at the top of the pool in the center. The top surface of the pool was open to the atmosphere

  4. Swimming pool cleaner poisoning

    Science.gov (United States)

    Swimming pool cleaner poisoning occurs when someone swallows this type of cleaner, touches it, or breathes in ... The harmful substances in swimming pool cleaner are: Bromine ... copper Chlorine Soda ash Sodium bicarbonate Various mild acids

  5. Swimming pool granuloma

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/article/001357.htm Swimming pool granuloma To use the sharing features on this page, please enable JavaScript. A swimming pool granuloma is a long-term (chronic) skin ...

  6. Solar swimming pool

    Energy Technology Data Exchange (ETDEWEB)

    1985-01-01

    This report examines the feasibility of using solar collectors to heat the water in a previously unheated outdoor swimming pool. The solar system is used in conjunction with a pool blanket, to conserve heat when the pool is not in use. Energy losses through evaporation can be reduced by as much as 70% by a pool blanket. A total of 130 m{sup 2} of highly durable black synthetic collectors were installed on a support structure at a 30{degree} angle from the horizontal, oriented to the south. Circulation of pool water though the collectors, which is controlled by a differential thermostat, was done with the existing pool pump. Before installation the pool temperature averaged 16{degree}C; after installation it ranged from 20{degree} to 26{degree}C. It was hard to distinguish how much pool heating was due to the solar system and how much heat was retained by the pool blanket. However, the pool season was extended by five weeks and attendance tripled. 2 figs.

  7. Opportunities and challenges when pooling milk samples using ELISA

    DEFF Research Database (Denmark)

    Græsbøll, Kaare; Andresen, Lars Ole; Hisham Beshara Halasa, Tariq

    2017-01-01

    -positive samples by pooling. To illustrate this, the sensitivity of antibody ELISA on pooled samples of bovine milk for Salmonella Dublin, Mycobacterium avium spp. paratuberculosis, and bovine virus diarrhea was tested. For these milk assays, the analytical sensitivity decreased rapidly with increasing pool sizes...

  8. Swimming-pool piles

    International Nuclear Information System (INIS)

    Trioulaire, M.

    1959-01-01

    In France two swimming-pool piles, Melusine and Triton, have just been set in operation. The swimming-pool pile is the ideal research tool for neutron fluxes of the order of 10 13 . This type of pile can be of immediate interest to many research centres, but its cost must be reduced and a break with tradition should be observed in its design. It would be an advantage: - to bury the swimming-pool; - to reject the experimental channel; - to concentrate the cooling circuit in the swimming-pool; - to carry out all manipulations in the water; - to double the core. (author) [fr

  9. Spent fuel storage pool

    International Nuclear Information System (INIS)

    Murakami, Naoshi.

    1996-01-01

    Fences are disposed to a fuel exchange floor surrounding the upper surface of a fuel pool for preventing overflow of pool water. The fences comprise a plurality of flat boards arranged in parallel with each other in the longitudinal direction while being vertically inclined, and slits are disposed between the boards for looking down the pool. Further, the fences comprise wide boards and are constituted so as to be laid horizontally on the fuel exchange floor in a normal state and uprisen by means of the signals from an earthquake sensing device. Even if pool water is overflow from the fuel pool by the vibrations occurred upon earthquake and flown out to the floor of the fuel exchange floor, the overflow from the fuel exchange floor is prevented by the fences. An operator who monitors the fuel pool can observe the inside of the fuel pool through the slits formed to the fences during normal operation. The fences act as resistance against overflowing water upon occurrence of an earthquake thereby capable of reducing the overflowing amount of water due to the vibrations of pool water. The effect of preventing overflowing water can be enhanced. (N.H.)

  10. Collaborative Car Pooling System

    OpenAIRE

    João Ferreira; Paulo Trigo; Porfírio Filipe

    2009-01-01

    This paper describes the architecture for a collaborative Car Pooling System based on a credits mechanism to motivate the cooperation among users. Users can spend the accumulated credits on parking facilities. For this, we propose a business model to support the collaboration between a car pooling system and parking facilities. The Portuguese Lisbon-s Metropolitan area is used as application scenario.

  11. 13 CFR 120.611 - Pools backing Pool Certificates.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Pools backing Pool Certificates. 120.611 Section 120.611 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Secondary Market Certificates § 120.611 Pools backing Pool Certificates. (a) Pool characteristics. As set...

  12. Current practice and perspectives in CRO oversight based on a survey performed among members of the German Association of Research-Based Pharmaceutical Companies (vfa).

    Science.gov (United States)

    Hennig, Michael; Hundt, Ferdinand; Busta, Susanne; Mikus, Stefan; Sanden, Per-Holger; Sörgel, Andrea; Ruppert, Thorsten

    2017-01-01

    In recent years, the number and scope of outsourced activities in the pharmaceutical industry have increased heavily. In addition, also the type of outsourcing has changed significantly in that time. This raises the question of whether and how sponsors retain the capability to select and to control the contract research organizations (CROs) involved and what expertise still has to be present in the development department as well as other relevant departments to ensure adequate oversight, also in line with the expectations of regulators and health authorities. In order to answer these questions, a survey was conducted among the German vfa member companies. The survey describes the latest developments and experiences in outsourcing by 18 German vfa member companies. It concentrates on measures how to implement Quality Assurance (QA) when performing outsourced clinical studies. This study shows that the majority of companies apply a full-outsourcing, preferred-provider model of clinical trial services, with the clinical research department playing the major role in this process. A large amount of guiding documents, processes and tools are used to ensure an adequate oversight of the services performed by the CRO(s). Finally the guiding principles for all oversight processes should be transparent communication, a clearly established expectation for quality, a precise definition of accountability and responsibility while avoiding silo mentality, and a comprehensive documentation of the oversight's evidence. For globally acting and outsourcing sponsors, oversight processes need to be aligned with regards to local and global perspectives. This survey shows that the current implementation of oversight processes in the participating companies covers all relevant areas to ensure highest quality and integrity of the data produced by the outsourced clinical trial.

  13. Current practice and perspectives in CRO oversight based on a survey performed among members of the German Association of Research-Based Pharmaceutical Companies (vfa

    Directory of Open Access Journals (Sweden)

    Hennig, Michael

    2017-01-01

    Full Text Available In recent years, the number and scope of outsourced activities in the pharmaceutical industry have increased heavily. In addition, also the type of outsourcing has changed significantly in that time. This raises the question of whether and how sponsors retain the capability to select and to control the contract research organizations (CROs involved and what expertise still has to be present in the development department as well as other relevant departments to ensure adequate oversight, also in line with the expectations of regulators and health authorities. In order to answer these questions, a survey was conducted among the German vfa member companies. The survey describes the latest developments and experiences in outsourcing by 18 German vfa member companies. It concentrates on measures how to implement Quality Assurance (QA when performing outsourced clinical studies.This study shows that the majority of companies apply a full-outsourcing, preferred-provider model of clinical trial services, with the clinical research department playing the major role in this process. A large amount of guiding documents, processes and tools are used to ensure an adequate oversight of the services performed by the CRO(s.Finally the guiding principles for all oversight processes should be transparent communication, a clearly established expectation for quality, a precise definition of accountability and responsibility while avoiding silo mentality, and a comprehensive documentation of the oversight’s evidence. For globally acting and outsourcing sponsors, oversight processes need to be aligned with regards to local and global perspectives. This survey shows that the current implementation of oversight processes in the participating companies covers all relevant areas to ensure highest quality and integrity of the data produced by the outsourced clinical trial.

  14. Quantitative Gd-DOTA uptake from cerebrospinal fluid into rat brain using 3D VFA-SPGR at 9.4T.

    Science.gov (United States)

    Lee, Hedok; Mortensen, Kristian; Sanggaard, Simon; Koch, Palle; Brunner, Hans; Quistorff, Bjørn; Nedergaard, Maiken; Benveniste, Helene

    2018-03-01

    We propose a quantitative technique to assess solute uptake into the brain parenchyma based on dynamic contrast-enhanced MRI (DCE-MRI). With this approach, a small molecular weight paramagnetic contrast agent (Gd-DOTA) is infused in the cerebral spinal fluid (CSF) and whole brain gadolinium concentration maps are derived. We implemented a 3D variable flip angle spoiled gradient echo (VFA-SPGR) longitudinal relaxation time (T1) technique, the accuracy of which was cross-validated by way of inversion recovery rapid acquisition with relaxation enhancement (IR-RARE) using phantoms. Normal Wistar rats underwent Gd-DOTA infusion into CSF via the cisterna magna and continuous MRI for approximately 130 min using T1-weighted imaging. Dynamic Gd-DOTA concentration maps were calculated and parenchymal uptake was estimated. In the phantom study, T1 discrepancies between the VFA-SPGR and IR-RARE sequences were approximately 6% with a transmit coil inhomogeneity correction. In the in vivo study, contrast transport profiles indicated maximal parenchymal retention of approximately 19% relative to the total amount delivered into the cisterna magna. Imaging strategies for accurate 3D contrast concentration mapping at 9.4T were developed and whole brain dynamic concentration maps were derived to study solute transport via the glymphatic system. The newly developed approach will enable future quantitative studies of the glymphatic system in health and disease states. Magn Reson Med 79:1568-1578, 2018. © 2017 International Society for Magnetic Resonance in Medicine. © 2017 International Society for Magnetic Resonance in Medicine.

  15. Vitamin D Pooling Project

    Science.gov (United States)

    The Vitamin D Pooling Project of Rarer Cancers brought together investigators from 10 cohorts to conduct a large prospective epidemiologic study of the association between vitamin D status and seven rarer cancers.

  16. Swimming pool special; Zwembadspecial

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2010-05-15

    This issue includes a few articles and messages on the use of heat pump systems in swimming pools. [Dutch] Dit nummer bevat onder meer een paar artikelen over het gebruik van warmtepompsystemen in zwembaden.

  17. Thermal analyses of solar swimming pool heating in Pakistan

    International Nuclear Information System (INIS)

    Ahmad, I.

    2011-01-01

    Hotels and swimming clubs in Pakistan pay huge gas bills for heating Swimming pools in winter. Winter days in most parts of Pakistan remain sunny and unglazed low cost solar collectors may be used to extend the swimming season. Installing the pool in a wind-protected area, which receives unobstructed solar radiation, may further reduce the size of the solar collectors required to heat the swimming pools. The pools should be covered with plastic sheet to eliminate evaporative heat losses and to prevent dust and tree leaves falling in the pool. The results of the thermal analysis show that in some parts of the country, a solar exposed pool can maintain comfortable temperature simply by using a plastic sheet on the pool surface. On the other hand, there are cities where solar collector array equal to twice the surface area of the pool is required to keep desired temperature in winter. (author)

  18. Characteristics of pools used by adult summer steelhead oversummering in the New River, California

    Science.gov (United States)

    Rodney J. Nakamoto

    1994-01-01

    Abstract - I assessed characteristics of pools used by oversummering adults of summer steelhead Oncorhynchus mykiss between July and October 1991 in the New River, northwestern California. Most fish occupied channel confluence pools and other pools of moderate size (200-1,200 m 2); these pools had less than 35% substrate embeddedness and mean water depths of about 1.0...

  19. Pool water cleaning facility

    Energy Technology Data Exchange (ETDEWEB)

    Yoshikawa, Kazuhiro; Kinoshita, Shoichiro [Hitachi Ltd., Tokyo (Japan); Asano, Takashi

    1998-05-29

    Only one system comprising a suppression poor water cleaning system (SPCU) and a filtration desalting tower (F/D) is connected for a plurality of nuclear power plants. Pipelines/valves for connecting the one system of the SPCU pump, the F/D and the plurality of nuclear power plants are disposed, and the system is used in common with the plurality of nuclear power plants. Pipelines/valves for connecting a pipeline for passing SP water to the commonly used SPCU pump and a skimmer surge tank are disposed, and fuel pool water is cooled and cleaned by the commonly used SPCU pump and the commonly used F/D. The number of SPCU pumps and the F/D facilities can be reduced, and a fuel pool water cooling operation mode and a fuel pool water cleaning operation mode which were conducted by an FPC pump so far are conducted by the SPCU pump. (N.H.)

  20. DNA pooling strategies for categorical (ordinal) traits

    Science.gov (United States)

    Despite reduced genotyping costs in recent years, obtaining genotypes for all individuals in a population may still not be feasible when sample size is large. DNA pooling provides a useful alternative to determining genotype effects. Clustering algorithms allow for grouping of individuals (observati...

  1. Liquid sodium pool fires

    Energy Technology Data Exchange (ETDEWEB)

    Casselman, C [DSN/SESTR, Centre de Cadarache, Saint-Paul-lez-Durance (France)

    1979-03-01

    Experimental sodium pool combustion results have led to a definition of the combustion kinetics, and have revealed the hazards of sodium-concrete contact reactions and the possible ignition of organic matter (paint) by hydration of sodium peroxide aerosols. Analysis of these test results shows that the controlling mechanism is sodium evaporation diffusion. (author)

  2. Income pooling within families

    DEFF Research Database (Denmark)

    Bonke, Jens; Uldall-Poulsen, Hans

    This paper analyses the phenomenon of income-pooling by applying the Danish household expenditure survey, merged with authoritative register information. Responses to additional questions on income sharing among 1696 couples also allows us to analyses whether the intra-household distribution...

  3. Liquid sodium pool fires

    International Nuclear Information System (INIS)

    Casselman, C.

    1979-01-01

    Experimental sodium pool combustion results have led to a definition of the combustion kinetics, and have revealed the hazards of sodium-concrete contact reactions and the possible ignition of organic matter (paint) by hydration of sodium peroxide aerosols. Analysis of these test results shows that the controlling mechanism is sodium evaporation diffusion. (author)

  4. Simulation of pool scrubbing experiments using BUSCA

    International Nuclear Information System (INIS)

    Dehbi, A.; Guentay, S.

    1994-01-01

    BUSCA-PSI is a computer code which predicts the aerosol scrubbing taking place when gas bubbles containing fission products rise through stagnant pools of water after a postulated severe accident. A Lagrangian formulation is adopted to follow the path of a bubble as it rises toward the surface of the pool. The BUSCA model includes most aerosol removal mechanisms which are thought to be significant, namely: Jet Impaction at tile orifice, Convection/Diffusiophoresis during steam condensation, Thermophoresis, Sedimentation, Centrifugal Impaction during bubble rise, and Brownian Diffusion. The hydraulic modelling offers a variety of options for the initial globule volume, the stable bubble size, tile bubble rise velocity, and the bubble shape. The heat and mass transfer part of tile model uses correlations found in the relevant literature. BUSCA simulations were performed to determine the decontamination factor (DF) dependence on key aerosol and thermal hydraulic parameters. The decontamination factor increases with height, pool temperature subcooling, and steam content. The decontamination factor exhibits a parabolic dependence on the particle radius. At low particle sizes, the DF is high due to Brownian Diffusion which is the dominant removal mechanism. The DF hits a minimum and then increases with particle size as Centrifugal Impaction and Sedimentation become important. In separate calculations, BUSCA was used to the simulate the aerosol scrubbing experiments performed by EPRI. For cold pool tests, the predicted scrubbing efficiencies were in a good, conservative agreement with the data for both Tin and CsI, and the discrepancies were within the reported measurement errors. For hot pool tests, the code systematically underpredicted the scrubbing DF's; this is potentially due to condensation in the gas space above the pool, a situation not currently modelled by BUSCA. The code was also tested against data produced by the Tepco-Toshiba-Hitachi experiments. The

  5. Pool gateway seal

    International Nuclear Information System (INIS)

    Starr, J.A.; Steinert, L.A.

    1983-01-01

    A device for sealing a gateway between interconnectable pools in a nuclear facility comprising a frame supporting a liquid impermeable sheet positioned in a u-shaped gateway between the pools. An inflatable tube carried in a channel in the periphery of the frame and adjoining the gateway provides a seal therebetween when inflated. A restraining arrangement on the bottom edge of the frame is releasably engagable with an adjacent portion of the gateway to restrict the movement of the frame in the u-shaped gateway upon inflation of the tube, thereby enhancing the seal. The impermeable sheet is formed of an elastomer and thus is conformable to a liquid permeable supportive wall upon application of liquid pressure to the side of the sheet opposite the wall

  6. Backfitting swimming pool reactors

    International Nuclear Information System (INIS)

    Roebert, G.A.

    1978-01-01

    Calculations based on measurements in a critical assembly, and experiments to disclose fuel element surface temperatures in case of accidents like stopping of primary coolant flow during full power operation, have shown that the power of the swimming pool type research reactor FRG-2 (15 MW, operating since 1967) might be raised to 21 MW within the present rules of science and technology, without major alterations of the pool buildings and the cooling systems. A backfitting program is carried through to adjust the reactor control systems of FRG-2 and FRG-1 (5 MW, housed in the same reactor hall) to the present safety rules and recommendations, to ensure FRG-2 operation at 21 MW for the next decade. (author)

  7. Fuel assembly storage pool

    International Nuclear Information System (INIS)

    Hiranuma, Hiroshi.

    1976-01-01

    Object: To remove limitation of the number of storage of fuel assemblies to increase the number of storage thereof so as to relatively reduce the water depth required for shielding radioactive rays. Structure: Fuel assembly storage rack containers for receiving a plurality of spent fuel assembly racks are stacked in multi-layer fashion within a storage pool filled with water for shielding radioactive rays and removing heat. (Furukawa, Y.)

  8. CERN Electronics Pool presentations

    CERN Multimedia

    2011-01-01

    The CERN Electronics Pool has organised a series of presentations in collaboration with oscilloscope manufacturers. The last one will take place according to the schedule below.   Time will be available at the end of the presentation to discuss your personal needs. The Agilent presentation had to be postponed and will be organised later. -     Lecroy: Thursday, 24 November 2011, in 530-R-030, 14:00 to 16:30.

  9. Benthic assemblages of rock pools in northern Portugal: seasonal and between-pool variability

    Directory of Open Access Journals (Sweden)

    Iacopo Bertocci

    2012-11-01

    Full Text Available We investigated the seasonal (winter vs summer and within season and spatial (between-pool variability of benthic assemblages of rock pools at mid-intertidal level along the shore of Viana do Castelo (North Portugal. Physical traits of rock pools, including size, depth and position along the shore, were also compared between pools. While pools did not differ for any of the examined physical traits, results indicated a clear seasonal difference in the structure of assemblages, including a total of 49 macroalgal and 13 animal taxa. This finding was driven by six taxa that are more abundant in winter (the reef-forming polychaete Sabellaria alveolata, the articulated coralline algae Corallina spp., the brown alga Bifurcaria bifurcata, the encrusting coralline alga Lithophyllum incrustans, the red alga Chondracanthus acicularis and the grazing snails Gibbula spp. and four algal taxa that are more abundant in summer (the invasive brown Sargassum muticum, the green Ulva spp., the kelp Laminaria ochroleuca and the filamentous red Ceramium spp.. These data provide a new contribution to the knowledge of rock pool systems and have potential implications for monitoring programmes aimed at assessing ecological modifications related to natural and anthropogenic disturbances and for identifying processes responsible for the variability of rock pool assemblages.

  10. Environmental controls of C, N and P biogeochemistry in peatland pools.

    Science.gov (United States)

    Arsenault, Julien; Talbot, Julie; Moore, Tim R

    2018-08-01

    Pools are common in northern peatlands but studies have seldom focused on their nutrient biogeochemistry, especially in relation to their morphological characteristics and through seasons. We determined the environmental characteristics controlling carbon (C), nitrogen (N) and phosphorus (P) biogeochemistry in pools and assessed their evolution over the course of the 2016 growing season in a subboreal ombrotrophic peatland of eastern Canada. We showed that water chemistry variations in 62 pools were significantly explained by depth (81.9%) and the surrounding vegetation type (14.8%), but not by pool area or shape. Shallow pools had larger dissolved organic carbon (DOC) and total nitrogen (TN) concentrations and lower pH than deep pools, while pools surrounded by coniferous trees had more recalcitrant DOC than pools where vegetation was dominated by mosses. The influence of depth on pool biogeochemistry was confirmed by the seasonal survey of pools of different sizes with 47.1% of the variation in pool water chemistry over time significantly explained. Of this, 67.3% was explained by the interaction between time and pool size and 32.7% by pool size alone. P concentrations were small in all pools all summer long and combined with high N:P ratios, are indicative of P-limitation. Our results show that pool biogeochemistry is influenced by internal processes and highlight the spatial and temporal heterogeneity of nutrient biogeochemistry in ombrotrophic peatlands. Copyright © 2018 Elsevier B.V. All rights reserved.

  11. Swimming Pools and Molluscum Contagiosum

    Science.gov (United States)

    ... Travelers’ Health: Smallpox & Other Orthopoxvirus-Associated Infections Poxvirus Swimming Pools Recommend on Facebook Tweet Share Compartir The ... often ask if molluscum virus can spread in swimming pools. There is also concern that it can ...

  12. Pool-type reactor

    International Nuclear Information System (INIS)

    Hopkins, S.R.

    1977-01-01

    This invention relates to a pool nuclear reactor fitted with a perfected system to raise the buckets into a vertical position at the bottom of a channel. This reactor has an inclined channel to guide a bucket containing a fuel assembly to introduce it into the reactor jacket or extract it therefrom and a damper at the bottom of the channel to stop the drop of the bucket. An upright vertically movable rod has a horizontally articulated arm with a hook. This can pivot to touch a radial lug on the bucket and pivot the bucket around its base in a vertical position, when the rod moves up [fr

  13. Pool scrubbing and hydrodynamic experiments on jet injection regime

    International Nuclear Information System (INIS)

    Peyres, V.; Espigares, M.M.; Polo, J.; Escudero, M.J.; Herranz, L.E.; Lopez-Jimenez, J.

    1995-01-01

    Plant analyses have shown that pool scrubbing can play an important role in source term during PWR risk dominant sequences. An examination ofboundary conditions governing fission products and aerosols transport through aqueous beds revealed that most of radioactivity is discharged into the pool under jet injection regime. This fact and the lack of experimental data under such conditions pointed the need of setting out an experimental programme which provided reliable experimental data to validate code models. In this report the major results of a pool scrubbing experimental programme carried out in PECA facility are presented. One of the major findings was that a remarkable fraction of particle absorption was not a function of the residence time of bubbles rising through the pool. Such a contribution was assumed to be associated to aerosol removal mechanisms acting at the pool entrance. As a consequence, a hydrodynamic experimental plan was launched to examine the gas behaviour during the initial stages in the pool. Size and shape of gas nuclei the pool were measured and fitted to a long normal distribution. Particularly, size was found to be quite sensitive to inletgas flow and at minor extent to gas composition and pool temperature. SPARC90 and BUSCA-AUG92 were used to simulate the retention tests. Whereas SPARC90 showed a pretty good agreement with experimental data, BUSCA-AUG92 results were far away from measurements in all the cases. SPARC90consistency apparently pointed out the important role of fission products and aerosols retention at the injection zone; nonetheless, a peer examination of pool scrubbing phenomenology at the pool entrance should be carried out to test both hydrodynamic and removal models. Hence, one of the major highlights drawn from this work was the need of further research under representative severe accident conditions (i.e., saturated pools, jet injection regimes, etc.), as well as separate effect tests to validate, improve and

  14. Analysis of sodium pool fire in SFEF for assessing the limiting pool fire

    International Nuclear Information System (INIS)

    Mangarjuna Rao, P.; Ramesh, S.S.; Nashine, B.K.; Kasinathan, N.; Chellapandi, P.

    2011-01-01

    Accidental sodium leaks and resultant sodium fires in Liquid Metal Fast Breeder Reactor (LMFBR) systems can create a threat to the safe operation of the plant. To avoid this defence-in depth approach is implemented from the design stage of reactor itself. Rapid detection of sodium leak and fast dumping of the sodium into the storage tank of a defective circuit, leak collection trays, adequate lining of load bearing structural concrete and extinguishment of the sodium fire are the important defensive measures in the design, construction and operation of a LMFBR for protection against sodium leaks and their resultant fires. Evaluation of sodium leak events and their consequences by conducting large scale engineering experiments is very essential for effective implementation of the above protection measures for sodium fire safety. For this purpose a Sodium Fire Experimental Facility (SFEF) is constructed at SED, IGCAR. SFEF is having an experimental hall of size 9 m x 6 m x 10 m with 540 m 3 volume and its design pressure is 50 kPa. It is a concrete structure and provided with SS 304 liner, which is fixed to the inside surfaces of walls, ceiling and floor. A leak tight door of size (1.8 m x 2.0 m) is provided to the experimental hall and the facility is provided with a sodium equipment hall and a control room. Experimental evaluation of sodium pool fire consequences is an important activity in the LMFBR sodium fire safety related studies. An experimental program has been planned for different types of sodium fire studies in SFEF. A prior to that numerical analysis have been carried out for enclosed sodium pool fires using SOFIRE-II sodium pool fire code for SFEF experimental hall configuration to evaluate the limiting pool fire. This paper brings out results of the analysis carried out for this purpose. Limiting pool fire of SFEF depends on the exposed surface area of the pool, amount of sodium in the pool, oxygen concentration and initial sodium temperature. Limiting

  15. Myocardial infarct size vs duration of coronary artery occlusion in patients with acute anterior myocardial infarction. Assessment by thallium-201 emission tomography, gated cardiac pool study and CK-MB release

    Energy Technology Data Exchange (ETDEWEB)

    Tamaki, Shunichi; Kambara, Hirofumi; Kadota, Kazunori; Murakami, Tomoyuki; Suzuki, Yukisono [Kyoto Univ. (Japan). Faculty of Medicine

    1984-03-01

    Relationship between the duration of coronary artery occlusion and myocardial infarct size was investigated in 24 patients with acute anterior myocardial infarction associated with occlusion of the left anterior descending artery. The duration of coronary artery occlusion was divided into (A) 4 hours or less, (B) 4-10 hours, and (C) 10 hours or more. Defect score obtained by thallium-201 emission computed tomography was significantly greater, and left ventricular ejection fraction was significantly lower as the duration of coronary artery occlusion increased. Creatine kinase-MB (..sigma..CK-MB) was higher in cases of longer duration of occlusion. However, this was not significant between the groups A and B, suggesting the influence of reperfusion on the ..sigma..CK-MB release. The duration of coronary artery occlusion was considered to be an important factor to determine the infarct size, and significance of early reperfusion was suggested.

  16. Microscopic bubble behaviour in suppression pool during wetwell venting

    Science.gov (United States)

    Zablackaite, G.; Nagasaka, H.; Kikura, H.

    2017-10-01

    During a severe accident PCV failure should be avoided and fission products inside PCV should be confined as much as possible. In order to minimize FPs release, Wetwell venting is conducted by releasing steam-non-condensable gas mixture carrying FPs from the Drywell to Suppression Pool. Steam is condensed by subcooled water in the pool, and most of FPs are retained into water. The removal of FP in the water pool is referred to as “Pool Scrubbing effect”. Hydrodynamic parameters of bubbles have impact on pool scrubbing effect. However, there is only few data available to evaluate quantitatively the bubble behaviour under depressurization and/or thermal stratification conditions. Series of experiments were conducted to evaluate the influence of temperature distribution, non-condensable gas content and pressure in the Wetwell on bubble behaviour. Bubbles were visualized using High Speed Camera and adopting shadowgraphy technique. Applying Particle Tracking Velocimetry, bubble velocity and size distribution were obtained from recorded images. Experimental results show that with increasing suppression pool temperature, bubbles reaching the pool surface decreased in size and traveling velocity became slower. In pressurized wetwell, bubble behaviour was similar to that in the heated up suppression pool case, although bubble parameters were similar to the low temperature case. Higher air content induced water surface movement and bubbles were smaller due to break up.

  17. Livestock Grazing as a Driver of Vernal Pool Ecohydrology

    Science.gov (United States)

    Michaels, J.; McCarten, N. F.

    2017-12-01

    Vernal pools are seasonal wetlands that host rare plant communities of high conservation priority. Plant community composition is largely driven by pool hydroperiod. A previous study found that vernal pools grazed by livestock had longer hydroperiods compared with pools excluded from grazing for 10 years, and suggests that livestock grazing can be used to protect plant diversity. It is important to assess whether observed differences are due to the grazing or due to water balance variables including upland discharge into or out of the pools since no a priori measurements were made of the hydrology prior to grazing. To address this question, in 2016 we compared 15 pools that have been grazed continuously and 15 pools that have been fenced off for over 40 years at a site in Sacramento County. We paired pools based on abiotic characteristics (size, shape, slope, soil type) to minimize natural variation. We sampled vegetation and water depth using Solinst level loggers. We found that plant diversity and average hydroperiod was significantly higher in the grazed pools. We are currently measuring groundwater connectivity and upland inputs in order to compare the relative strength of livestock grazing as a driver of hydroperiod to these other drivers.

  18. Reserve growth in oil pools of Alberta : model and forecast

    Energy Technology Data Exchange (ETDEWEB)

    Verma, M.; Cook, T. [United States Geological Survey, Denver, CO (United States). Central Region

    2010-09-15

    This paper presented a reserve growth study that was conducted on oil pools in Alberta, Canada. Historical oil reserve data were evaluated to assess the potential for future reserve growth in both pools and fields, and reserve growth models and functions were developed to better forecast hydrocarbon volumes. The study also considered the sensitivity of reserve growth to such factors as pool size, porosity, and oil gravity. From 1960 to 2005, the reported known recoverable oil in Alberta, excluding the Athabasca oil sands and including only pools with adequate data, increased from 4.2 to 13.9 billion barrels of oil (BBO). New discoveries contributed 3.7 BBO and reserve growth added 6 BBO. Most reserve growth occurred in pools with more than 125,000 barrels of oil. Light-oil pools account for most of the total known oil volume and consequently showed the lowest growth. Pools with greater than 30 percent porosity grew more than pools with lower porosity reservoirs. Oil field growth was found to be almost twice that of pool growth, possibly because the analysis evaluated fields with two or more pools discovered in different years. The growth in oil volumes in Alberta pools is projected to be about 454 million barrels of oil in the period from 2006 to 2010. Over a 25-year period, the cumulative reserve growth in Alberta oil pools was substantially lower than other major petroleum-producing regions, but the growth at the field level compares well. 8 refs., 2 tabs., 9 figs.

  19. Pool Boiling CHF in Inclined Narrow Annuli

    International Nuclear Information System (INIS)

    Kang, Myeong Gie

    2010-01-01

    Pool boiling heat transfer has been studied extensively since it is frequently encountered in various heat transfer equipment. Recently, it has been widely investigated in nuclear power plants for application to the advanced light water reactors designs. Through the review on the published results it can be concluded that knowledge on the combined effects of the surface orientation and a confined space on pool boiling heat transfer is of great practical importance and also of great academic interest. Fujita et al. investigated pool boiling heat transfer, from boiling inception to the critical heat flux (CHF, q' CHF ), in a confined narrow space between heated and unheated parallel rectangular plates. They identified that both the confined space and the surface orientation changed heat transfer much. Kim and Suh changed the surface orientation angles of a downward heating rectangular channel having a narrow gap from the downward-facing position (180 .deg.) to the vertical position (90 .deg.). They observed that the CHF generally decreased as the inclination angle (θ ) increased. Yao and Chang studied pool boiling heat transfer in a confined heat transfer for vertical narrow annuli with closed bottoms. They observed that when the gap size ( s ) of the annulus was decreased the effect of space confinement to boiling heat transfer increased. The CHF was occurred at much lower value for the confined space comparing to the unconfined pool boiling. Pool boiling heat transfer in narrow horizontal annular crevices was studied by Hung and Yao. They concluded that the CHF decreased with decreasing gap size of the annuli and described the importance of the thin film evaporation to explain the lower CHF of narrow crevices. The effect of the inclination angle on the CHF on countercurrent boiling in an inclined uniformly heated tube with closed bottoms was also studied by Liu et al. They concluded that the CHF reduced with the inclination angle decrease. A study was carried out

  20. Corium quench in deep pool mixing experiments

    International Nuclear Information System (INIS)

    Spencer, B.W.; McUmber, L.; Gregorash, D.; Aeschlimann, R.; Sienicki, J.J.

    1985-01-01

    The results of two recent corium-water thermal interaction (CWTI) tests are described in which a stream of molten corium was poured into a deep pool of water in order to determine the mixing behavior, the corium-to-water heat transfer rates, and the characteristic sizes of the quenched debris. The corium composition was 60% UO 2 , 16% ZrO 2 , and 24% stainless steel by weight; its initial temperature was 3080 K, approx.160 K above the oxide phase liquidus temperature. The corium pour stream was a single-phase 2.2 cm dia liquid column which entered the water pool in film boiling at approx.4 m/s. The water subcooling was 6 and 75C in the two tests. Test results showed that with low subcooling, rapid steam generation caused the pool to boil up into a high void fraction regime. In contrast, with large subcooling no net steam generation occurred, and the pool remained relatively quiescent. Breakup of the jet appeared to occur by surface stripping. In neither test was the breakup complete during transit through the 32 cm deep water pool, and molten corium channeled to the base where it formed a melt layer. The characteristic heat transfer rates measured 3.5 MJ/s and 2.7 MJ/s during the fall stage for small and large subcooling, respectively; during the initial stage of bed quench, the surface heat fluxes measured 2.4 MW/m 2 and 3.7 MW/m 2 , respectively. A small mass of particles was formed in each test, measuring typically 0.1 to 1 mm and 1 to 5 mm dia for the large and small subcooling conditions, respectively. 9 refs., 13 figs., 1 tab

  1. Model of large pool fires

    Energy Technology Data Exchange (ETDEWEB)

    Fay, J.A. [Department of Mechanical Engineering, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States)]. E-mail: jfay@mit.edu

    2006-08-21

    A two zone entrainment model of pool fires is proposed to depict the fluid flow and flame properties of the fire. Consisting of combustion and plume zones, it provides a consistent scheme for developing non-dimensional scaling parameters for correlating and extrapolating pool fire visible flame length, flame tilt, surface emissive power, and fuel evaporation rate. The model is extended to include grey gas thermal radiation from soot particles in the flame zone, accounting for emission and absorption in both optically thin and thick regions. A model of convective heat transfer from the combustion zone to the liquid fuel pool, and from a water substrate to cryogenic fuel pools spreading on water, provides evaporation rates for both adiabatic and non-adiabatic fires. The model is tested against field measurements of large scale pool fires, principally of LNG, and is generally in agreement with experimental values of all variables.

  2. Model of large pool fires

    International Nuclear Information System (INIS)

    Fay, J.A.

    2006-01-01

    A two zone entrainment model of pool fires is proposed to depict the fluid flow and flame properties of the fire. Consisting of combustion and plume zones, it provides a consistent scheme for developing non-dimensional scaling parameters for correlating and extrapolating pool fire visible flame length, flame tilt, surface emissive power, and fuel evaporation rate. The model is extended to include grey gas thermal radiation from soot particles in the flame zone, accounting for emission and absorption in both optically thin and thick regions. A model of convective heat transfer from the combustion zone to the liquid fuel pool, and from a water substrate to cryogenic fuel pools spreading on water, provides evaporation rates for both adiabatic and non-adiabatic fires. The model is tested against field measurements of large scale pool fires, principally of LNG, and is generally in agreement with experimental values of all variables

  3. Design of hydrotherapy exercise pools.

    Science.gov (United States)

    Edlich, R F; Abidin, M R; Becker, D G; Pavlovich, L J; Dang, M T

    1988-01-01

    Several hydrotherapy pools have been designed specifically for a variety of aquatic exercise. Aqua-Ark positions the exerciser in the center of the pool for deep-water exercise. Aqua-Trex is a shallow underwater treadmill system for water walking or jogging. Swim-Ex generates an adjustable laminar flow that permits swimming without turning. Musculoskeletal conditioning can be accomplished in the above-ground Arjo shallow-water exercise pool. A hydrotherapy pool also can be custom designed for musculoskeletal conditioning in its shallow part and cardiovascular conditioning in a deeper portion of the pool. Regardless of the type of exercise, there is general agreement that the specific exercise conducted in water requires significantly more energy expenditure than when the same exercise is performed on land.

  4. Pricing Electricity in Pools With Wind Producers

    DEFF Research Database (Denmark)

    Morales González, Juan Miguel; Conejo, A. J.; Kai Liu

    2012-01-01

    This paper considers an electricity pool that includes a significant number of wind producers and is cleared through a network-constrained auction, one day in advance and on an hourly basis. The hourly auction is formulated as a two-stage stochastic programming problem, where the first stage...... represents the clearing of the market and the second stage models the system operation under a number of plausible wind production realizations. This formulation co-optimizes energy and reserve, and allows deriving both pool energy prices and balancing energy prices. These prices result in both cost recovery...... for producers and revenue reconciliation. A case study of realistic size is used to illustrate the functioning of the proposed pricing scheme....

  5. Sediment transport through self-adjusting, bedrock-walled waterfall plunge pools

    Science.gov (United States)

    Scheingross, Joel S.; Lamb, Michael P.

    2016-05-01

    Many waterfalls have deep plunge pools that are often partially or fully filled with sediment. Sediment fill may control plunge-pool bedrock erosion rates, partially determine habitat availability for aquatic organisms, and affect sediment routing and debris flow initiation. Currently, there exists no mechanistic model to describe sediment transport through waterfall plunge pools. Here we develop an analytical model to predict steady-state plunge-pool depth and sediment-transport capacity by combining existing jet theory with sediment transport mechanics. Our model predicts plunge-pool sediment-transport capacity increases with increasing river discharge, flow velocity, and waterfall drop height and decreases with increasing plunge-pool depth, radius, and grain size. We tested the model using flume experiments under varying waterfall and plunge-pool geometries, flow hydraulics, and sediment size. The model and experiments show that through morphodynamic feedbacks, plunge pools aggrade to reach shallower equilibrium pool depths in response to increases in imposed sediment supply. Our theory for steady-state pool depth matches the experiments with an R2 value of 0.8, with discrepancies likely due to model simplifications of the hydraulics and sediment transport. Analysis of 75 waterfalls suggests that the water depths in natural plunge pools are strongly influenced by upstream sediment supply, and our model provides a mass-conserving framework to predict sediment and water storage in waterfall plunge pools for sediment routing, habitat assessment, and bedrock erosion modeling.

  6. Controls on Filling and Evacuation of Sediment in Waterfall Plunge Pools

    Science.gov (United States)

    Scheingross, J. S.; Lamb, M. P.

    2014-12-01

    Many waterfalls are characterized by the presence of deep plunge pools that experience periods of sediment fill and evacuation. These cycles of sediment fill are a first order control on the relative magnitude of lateral versus vertical erosion at the base of waterfalls, as vertical incision requires cover-free plunge pools to expose the bedrock floor, while lateral erosion can occur when pools are partially filled and plunge-pool walls are exposed. Currently, there exists no mechanistic model describing sediment transport through waterfall plunge pools, limiting our ability to predict waterfall retreat. To address this knowledge gap, we performed detailed laboratory experiments measuring plunge-pool sediment transport capacity (Qsc_pool) under varying waterfall and plunge-pool geometries, flow hydraulics, and sediment size. Our experimental plunge-pool sediment transport capacity measurements match well with a mechanistic model we developed which combines existing waterfall jet theory with a modified Rouse profile to predict sediment transport capacity as a function of water discharge and suspended sediment concentration at the plunge-pool lip. Comparing the transport capacity of plunge pools to lower gradient portions of rivers (Qsc_river) shows that, for transport limited conditions, plunge pools fill with sediment under modest water discharges when Qsc_river > Qsc_pool, and empty to bedrock under high discharges when Qsc_pool > Qsc_river. These results are consistent with field observations of sand-filled plunge pools with downstream boulder rims, implying filling and excavation of plunge pools over single-storm timescales. Thus, partial filling of waterfall plunge pools may provide a mechanism to promote lateral undercutting and retreat of waterfalls in homogeneous rock in which plunge-pool vertical incision occurs during brief large floods that expose bedrock, whereas lateral erosion may prevail during smaller events.

  7. ENERGY STAR Certified Pool Pumps

    Data.gov (United States)

    U.S. Environmental Protection Agency — Certified models meet all ENERGY STAR requirements as listed in the Version 1.1 ENERGY STAR Program Requirements for Pool Pumps that are effective as of February 15,...

  8. Pooling and correlated neural activity

    Directory of Open Access Journals (Sweden)

    Robert Rosenbaum

    2010-04-01

    Full Text Available Correlations between spike trains can strongly modulate neuronal activity and affect the ability of neurons to encode information. Neurons integrate inputs from thousands of afferents. Similarly, a number of experimental techniques are designed to record pooled cell activity. We review and generalize a number of previous results that show how correlations between cells in a population can be amplified and distorted in signals that reflect their collective activity. The structure of the underlying neuronal response can significantly impact correlations between such pooled signals. Therefore care needs to be taken when interpreting pooled recordings, or modeling networks of cells that receive inputs from large presynaptic populations. We also show that the frequently observed runaway synchrony in feedforward chains is primarily due to the pooling of correlated inputs.

  9. Grundfoss: Chlorination of Swimming Pools

    DEFF Research Database (Denmark)

    Hjorth, Poul G.; Hogan, John; Andreassen, Viggo

    1998-01-01

    Grundfos asked for a model, describing the problem of mixing chemicals, being dosed into water systems, to be developed. The application of the model should be dedicated to dosing aqueous solution of chlorine into swimming pools.......Grundfos asked for a model, describing the problem of mixing chemicals, being dosed into water systems, to be developed. The application of the model should be dedicated to dosing aqueous solution of chlorine into swimming pools....

  10. Sustainability of common pool resources

    OpenAIRE

    Timilsina, Raja Rajendra; Kotani, Koji; Kamijo, Yoshio

    2017-01-01

    Sustainability has become a key issue in managing natural resources together with growing concerns for capitalism, environmental and resource problems. We hypothesize that the ongoing modernization of competitive societies, which we refer to as "capitalism," affects human nature for utilizing common pool resources, thus compromising sustainability. To test this hypothesis, we design and implement a set of dynamic common pool resource games and experiments in the following two types of Nepales...

  11. Mathematical modeling of the energy consumption of heated swimming pools

    Energy Technology Data Exchange (ETDEWEB)

    Le Bel, C.; Millette, J. [LTE Shawinigan, Shawinigan, PQ (Canada)

    2007-07-01

    A mathematical model was developed to estimate the water temperature of a residential swimming pool. The model can compare 2 different situations and, if local climatic conditions are known, it can accurately predict energy costs of the pool relative to the total energy consumption of the house. When used with the appropriate energy transfer coefficient and weather file, the model can estimate the water temperature of a residential swimming pool having specific characteristics, such as in-ground, above-ground, heated or non-heated. The model is suitable for determining residential loads. It can be applied to different pool types and sizes, for different water heating scenarios and different climatic regions. Data obtained from the monitoring of water temperature and electricity use of 57 residential swimming pools was used to validate the model. In addition, 5 above-ground pools were installed on the property of LTE Shawinigan to allow for a more detailed study of the parameters involved in the thermal balance of a pool. The mathematical model, based on a global heat transfer coefficient, can determine the effect of a solar blanket and the effect of water volume. 14 refs., 5 tabs., 11 figs.

  12. Pool scrubbing and hydrodynamic experiment on jet injection regime

    Energy Technology Data Exchange (ETDEWEB)

    Peyres, V.; Espigares, M.M.; Polo, J.; Escudero, M.J.; Herranz, L.E.; Lopez, J.

    1995-07-01

    Plant analyses nave shown that pool scrubbing can play an important role in source term during PWR risk dominant sequences. An examination of boundary conditions governing fission products and aerosols transport through aqueous beds revealed that most of radioactivity is discharged into the pool under jet injection regime. This fact and the lack of experimental data under such conditions pointed the need of setting out an experimental programme which provided reliable experimental data to validate code models. In this report the major results of a pool scrubbing experimental programme carried out in PECA facility are presented. One of the major findings was that a remarkable fraction of particle absorption was not a function of the residence time of bubbles rising through the pool. Such a contribution was assumed to be associated to aerosol removal mechanism acting at the pool entrance. As a consequence. a hydrodynamic experimental plan was launched to examine the gas behaviour during the initial stages in the pool. Size and shape of gas nuclei in the pool were measured and fitted to a lognormal distribution. Particularly, size was found to be quite sensitive to inlet gas flow and at minor extent to gas composition and pool temperature. SPARC90 and BUSCA-AUG92 were used to simulate the retention tests. Whereas SPARC90 showed a pretty good agreement with experimental data, BUSCA-AUG92 results were far away from measurements in all the cases. SPARC90 consistency apparently pointed out the important role of fission products and aerosols retention at the injection zone; nonetheless, a peer examination of pool scrubbing phenomenology at the pool entrance should be carried out to test both hydrodynamic and removal models. Hence, one of the major high lights drawn from this work was the need of further research under representative severe accident conditions (i.e., saturated pools, jet injection regimes, etc.), as well as separate effect tests to validate, improve and

  13. Pool scrubbing and hydrodynamic experiment on jet injection regime

    International Nuclear Information System (INIS)

    Peyres, V.; Espigares, M.M.; Polo, J.; Escudero, M.J.; Herranz, L.E.; Lopez, J.

    1995-01-01

    Plant analyses nave shown that pool scrubbing can play an important role in source term during PWR risk dominant sequences. An examination of boundary conditions governing fission products and aerosols transport through aqueous beds revealed that most of radioactivity is discharged into the pool under jet injection regime. This fact and the lack of experimental data under such conditions pointed the need of setting out an experimental programme which provided reliable experimental data to validate code models. In this report the major results of a pool scrubbing experimental programme carried out in PECA facility are presented. One of the major findings was that a remarkable fraction of particle absorption was not a function of the residence time of bubbles rising through the pool. Such a contribution was assumed to be associated to aerosol removal mechanism acting at the pool entrance. As a consequence. a hydrodynamic experimental plan was launched to examine the gas behaviour during the initial stages in the pool. Size and shape of gas nuclei in the pool were measured and fitted to a lognormal distribution. Particularly, size was found to be quite sensitive to inlet gas flow and at minor extent to gas composition and pool temperature. SPARC90 and BUSCA-AUG92 were used to simulate the retention tests. Whereas SPARC90 showed a pretty good agreement with experimental data, BUSCA-AUG92 results were far away from measurements in all the cases. SPARC90 consistency apparently pointed out the important role of fission products and aerosols retention at the injection zone; nonetheless, a peer examination of pool scrubbing phenomenology at the pool entrance should be carried out to test both hydrodynamic and removal models. Hence, one of the major high lights drawn from this work was the need of further research under representative severe accident conditions (i.e., saturated pools, jet injection regimes, etc.), as well as separate effect tests to validate, improve and

  14. Laser weld process monitoring and control using chromatic filtering of thermal radiation from a weld pool

    International Nuclear Information System (INIS)

    Kim, Cheol Jung; Kim, Min Suk; Baik, Sung Hoon; Chung, Chin Man

    2000-06-01

    The application of high power Nd: YAG lasers for precision welding in industry has been growing quite fast these days in diverse areas such as the automobile, the electronics and the aerospace industries. These diverse applications also require the new developments for the precise control and the reliable process monitoring. Due to the hostile environment in laser welding, a remote monitoring is required. The present development relates in general to weld process monitoring techniques, and more particularly to improved methods and apparatus for real-time monitoring of thermal radiation of a weld pool to monitor a size variation and a focus shift of the weld pool for weld process control, utilizing the chromatic aberration of focusing lens or lenses. The monitoring technique of the size variation and the focus shift of a weld pool is developed by using the chromatic filtering of the thermal radiation from a weld pool. The monitoring of weld pool size variation can also be used to monitor the weld depth in a laser welding. Furthermore, the monitoring of the size variation of a weld pool is independent of the focus shift of a weld pool and the monitoring of the focus shift of a weld pool is independent of the size variation of a weld pool

  15. Laser weld process monitoring and control using chromatic filtering of thermal radiation from a weld pool

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Cheol Jung; Kim, Min Suk; Baik, Sung Hoon; Chung, Chin Man

    2000-06-01

    The application of high power Nd: YAG lasers for precision welding in industry has been growing quite fast these days in diverse areas such as the automobile, the electronics and the aerospace industries. These diverse applications also require the new developments for the precise control and the reliable process monitoring. Due to the hostile environment in laser welding, a remote monitoring is required. The present development relates in general to weld process monitoring techniques, and more particularly to improved methods and apparatus for real-time monitoring of thermal radiation of a weld pool to monitor a size variation and a focus shift of the weld pool for weld process control, utilizing the chromatic aberration of focusing lens or lenses. The monitoring technique of the size variation and the focus shift of a weld pool is developed by using the chromatic filtering of the thermal radiation from a weld pool. The monitoring of weld pool size variation can also be used to monitor the weld depth in a laser welding. Furthermore, the monitoring of the size variation of a weld pool is independent of the focus shift of a weld pool and the monitoring of the focus shift of a weld pool is independent of the size variation of a weld pool.

  16. Seismic analysis of large pools

    Energy Technology Data Exchange (ETDEWEB)

    Dong, R.G.; Tokarz, F.J.

    1976-11-17

    Large pools for storing spent, nuclear fuel elements are being proposed to augment present storage capacity. To preserve the ability to isolate portions of these pools, a modularization requirement appears desirable. The purpose of this project was to investigate the effects of modularization on earthquake resistance and to assess the adequacy of current design methods for seismic loads. After determining probable representative pool geometries, three rectangular pool configurations, all 240 x 16 ft and 40 ft deep, were examined. One was unmodularized; two were modularized into 80 x 40 ft cells in one case and 80 x 80 ft cells in the other. Both embedded and above-ground installations for a hard site and embedded installations for an intermediate hard site were studied. It was found that modularization was unfavorable in terms of reducing the total structural load attributable to dynamic effects, principally because one or more cells could be left unfilled. The walls of unfilled cells would be subjected to significantly higher loads than the walls of a filled, unmodularized pool. Generally, embedded installations were preferable to above-ground installations, and the hard site was superior to the intermediate hard site. It was determined that Housner's theory was adequate for calculating hydrodynamic effects on spent fuel storage pools. Current design methods for seismic loads were found to be satisfactory when results from these methods were compared with those from LUSH analyses. As a design method for dynamic soil pressure, we found the Mononobe-Okabe theory, coupled with correction factors as suggested by Seed, to be acceptable. The factors we recommend for spent fuel storage pools are tabulated.

  17. Seismic analysis of large pools

    International Nuclear Information System (INIS)

    Dong, R.G.; Tokarz, F.J.

    1976-01-01

    Large pools for storing spent, nuclear fuel elements are being proposed to augment present storage capacity. To preserve the ability to isolate portions of these pools, a modularization requirement appears desirable. The purpose of this project was to investigate the effects of modularization on earthquake resistance and to assess the adequacy of current design methods for seismic loads. After determining probable representative pool geometries, three rectangular pool configurations, all 240 x 16 ft and 40 ft deep, were examined. One was unmodularized; two were modularized into 80 x 40 ft cells in one case and 80 x 80 ft cells in the other. Both embedded and above-ground installations for a hard site and embedded installations for an intermediate hard site were studied. It was found that modularization was unfavorable in terms of reducing the total structural load attributable to dynamic effects, principally because one or more cells could be left unfilled. The walls of unfilled cells would be subjected to significantly higher loads than the walls of a filled, unmodularized pool. Generally, embedded installations were preferable to above-ground installations, and the hard site was superior to the intermediate hard site. It was determined that Housner's theory was adequate for calculating hydrodynamic effects on spent fuel storage pools. Current design methods for seismic loads were found to be satisfactory when results from these methods were compared with those from LUSH analyses. As a design method for dynamic soil pressure, we found the Mononobe-Okabe theory, coupled with correction factors as suggested by Seed, to be acceptable. The factors we recommend for spent fuel storage pools are tabulated

  18. 21 CFR 1250.89 - Swimming pools.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Swimming pools. 1250.89 Section 1250.89 Food and... SANITATION Sanitation Facilities and Conditions on Vessels § 1250.89 Swimming pools. (a) Fill and draw swimming pools shall not be installed or used. (b) Swimming pools of the recirculation type shall be...

  19. Patent pools: Intellectual property rights and competition.

    NARCIS (Netherlands)

    Rodriguez, V.F.

    2010-01-01

    Patent pools do not correct all problems associated with patent thickets. In this respect, patent pools might not stop the outsider problem from striking pools. Moreover, patent pools can be expensive to negotiate, can exclude patent holders with smaller numbers of patents or enable a group of major

  20. Swimming pools and intra-city climates: Influences on residential ...

    African Journals Online (AJOL)

    While determinants such as household income, regional climate, water price, property size and household occupancy have been comprehensively studied and modelled, other determinants such as swimming pools and intra-city climates have not. This study examines residential water consumption in the City of Cape Town ...

  1. Efficient pooling designs for library screening

    OpenAIRE

    Bruno, William J.; Knill, Emanuel; Balding, David J.; Bruce, D. C.; Doggett, N. A.; Sawhill, W. W.; Stallings, R. L.; Whittaker, Craig C.; Torney, David C.

    1994-01-01

    We describe efficient methods for screening clone libraries, based on pooling schemes which we call ``random $k$-sets designs''. In these designs, the pools in which any clone occurs are equally likely to be any possible selection of $k$ from the $v$ pools. The values of $k$ and $v$ can be chosen to optimize desirable properties. Random $k$-sets designs have substantial advantages over alternative pooling schemes: they are efficient, flexible, easy to specify, require fewer pools, and have er...

  2. EP BICYCLE POOL - VIGNETTES 2002

    CERN Multimedia

    EP-SMI Help Desk

    2002-01-01

    The vignettes (insurance certificates) for 2002 become obligatory from 1 June. If you have a bicycle from the EP Pool, please bring it to the EP-SMI Help Desk (Building 124) on any working day up to 31 May between 8h.30 - 12h.00 or 13h.30 - 17h.30. EP-SMI Help Desk

  3. Sculpting the Barnyard Gene Pool

    Science.gov (United States)

    Childers, Gina; Wolfe, Kim; Dupree, Alan; Young, Sheila; Caver, Jessica; Quintanilla, Ruby; Thornton, Laura

    2016-01-01

    Project-based learning (PBL) takes student engagement to a higher level through reflective collaboration, inquiry, critical thinking, problem solving, and personal relevance. This article explains how six high school teachers developed an interconnected, interdisciplinary STEM-focused PBL called "Sculpting the Barnyard Gene Pool." The…

  4. SBWR PCCS vent phenomena and suppression pool mixing

    Energy Technology Data Exchange (ETDEWEB)

    Coddington, P. [Thermal-Hydraulics Lab., Paul Scherrer Institute, Villigen (Switzerland); Andreani, M. [Nuclear Engineering Lab., Swiss Federal Institute of Technology, Zurich (Switzerland)

    1995-09-01

    The most important phenomena influencing the effectiveness of the pressure suppression capability of the water pool within the Wetwell compartment of the SBWR Containment, during the period of Passive Containment Cooling System (PCCS) venting, have been critically reviewed. In addition, calculations have been carried-out to determine the condensation of the vented steam and the distribution of the energy deposited in the liquid pool. It has been found that a large contribution to the vapour suppression is due to condensation inside the vent pipe. The condensation rate of the steam inside the bubbles, produced at the vent exit, during their rise to the surface, may however be rather low, because of the large size bubbles. This can lead to vapour channelling to the Wetwell gas space. The above comments are likely to be ameliorated if the vent exit is a distributed source or sparger. Due to the large water flow rates within the {open_quotes}bubbly two-phase plume{close_quotes} generated by the gas injection, the water in the pool above the vent exit is likely to be heated nearly isothermally (perfect mixing). The effect of the suppression pool walls would be to enhance the recirculation and, consequently to promote mixing. The large size of the bubbles therein and of the walls on pool mixing are the most severe difficulties in extrapolating the results from scaled experiments to prototypical conditions.

  5. Measurements in large JP-4 pool fires

    International Nuclear Information System (INIS)

    Keltner, N.R.; Kent, L.A.; Schneider, M.E.

    1987-01-01

    Over the past four years, Sandia National Laboratories has conducted a number of large pool fire tests to evaluate the design of radioactive material (RAM) shipping containers. Some of these tests have been designed to define the thermal environment and some have been used for certification testing. In each test there have been a number of fire diagnostic measurements. The simplest sets of diagnostics have involved measurements of temperature at several elevations on arrays of towers, measurements of hot wall heat flux with small calorimeters suspended from the towers, the average fuel recession rate, and the wind speed and direction. The most complex sets of diagnostics have included the above and in various tests added radiometers in the lower flame zone, centerline velocity measurements at a number of elevations, radiometers and calorimeters at the fuel surface, large cylindrical and flat plate calorimeters, infrared imaging, time resolved fuel recession rates, and a variety of soot particle concentration and size measurements made in the plume with a tethered balloon and an instrumented airplane. All of the large fires have been conducted in a 9.1 m by 18.3 m pool using JP-4 as the fuel. Typical duration is one-half hour. Covering all of the results is beyond the scope of a single paper. Conditionally sampled temperature and velocity measurements from one fire will be presented; for this fire, a 20 cm layer of fuel was floated on 61 cm of water. Pool surface heat flux, fuel recession rate data, and smoke emission data from a second fire are given. Because the wind has a strong effect on the temperature and velocity measurements, conditional sampling has been used to try to obtain data during periods of low winds. 10 refs., 3 figs

  6. "Ripples" in an Aluminum Pool?

    Science.gov (United States)

    Rohr, James; Wang, Si-Yin; Nesterenko, Vitali F.

    2018-05-01

    Our motivation for this article is for students to realize that opportunities for discovery are all around them. Discoveries that can still puzzle present day researchers. Here we explore an observation by a middle school student concerning the production of what appears to be water-like "ripples" produced in aluminum foil when placed between two colliding spheres. We both applaud and explore the student's reasoning that the ripples were formed in a melted aluminum pool.

  7. Sustainability of common pool resources.

    Science.gov (United States)

    Timilsina, Raja Rajendra; Kotani, Koji; Kamijo, Yoshio

    2017-01-01

    Sustainability has become a key issue in managing natural resources together with growing concerns for capitalism, environmental and resource problems. We hypothesize that the ongoing modernization of competitive societies, which we refer to as "capitalism," affects human nature for utilizing common pool resources, thus compromising sustainability. To test this hypothesis, we design and implement a set of dynamic common pool resource games and experiments in the following two types of Nepalese areas: (i) rural (non-capitalistic) and (ii) urban (capitalistic) areas. We find that a proportion of prosocial individuals in urban areas is lower than that in rural areas, and urban residents deplete resources more quickly than rural residents. The composition of proself and prosocial individuals in a group and the degree of capitalism are crucial in that an increase in prosocial members in a group and the rural dummy positively affect resource sustainability by 65% and 63%, respectively. Overall, this paper shows that when societies move toward more capitalistic environments, the sustainability of common pool resources tends to decrease with the changes in individual preferences, social norms, customs and views to others through human interactions. This result implies that individuals may be losing their coordination abilities for social dilemmas of resource sustainability in capitalistic societies.

  8. Flashing oscillation in pool water

    International Nuclear Information System (INIS)

    Takamasa, Tomoji; Kondo, Koichi; Hazuku, Tatsuya

    1996-01-01

    This paper presents an experimental study of high-pressure saturated water discharging into the pool water. The purpose of the experiment is to clarify the phenomena that occur in blow-down of high-pressure saturated water from the pressure vessel into the water-filled containment in the case of a wall-crack accident or a LOCA in an advanced reactor. The results revealed that a flashing oscillation (FO) occurs when high-pressure saturated water discharges into the pool water, under specified experimental settings. The range of the flashing oscillates between a point very close to and some distance from the vent hole. The pressures in the vent tube and pool water vary according to the flashing oscillation. The pressure oscillation and frequency of flashing position might be caused by the balancing action between the supply of saturated water, flashing at the control volume and its condensation on the steam-water interface. A linear analysis was conducted using a spherical flashing bubble model. The period of the flashing oscillation in the experiments can be explained by theoretical analysis

  9. Pressure supression pool thermal mixing

    International Nuclear Information System (INIS)

    Cook, D.H.

    1984-10-01

    A model is developed and verified to describe the thermal mixing that occurs in the pressure suppression pool (PSP) of a commercial BWR. The model is designed specifically for a Mark-I containment and is intended for use in severe accident sequence analyses. The model developed in this work produces space and time dependent temperature results throughout the PSP and is useful for evaluating the bulk PSP thermal mixing, the condensation effectiveness of the PSP, and the long-term containment integrity. The model is designed to accommodate single or multiple discharging T-quenchers, a PSP circumferential circulation induced by the residual heat removal system discharge, and the thermal stratification of the pool that occurs immediately after the relief valves close. The PSP thermal mixing is verified by comparing the model-predicted temperatures to experimental temperatures that were measured in an operating BWR suppression pool. The model is then used to investigate several PSP thermal mixing problems that include the time to saturate at full relief valve flow, the temperature response to a typical stuck open relief valve scenario, and the effect of operator rotation of the relief valve discharge point

  10. Pressure suppression pool thermal mixing

    International Nuclear Information System (INIS)

    Cook, D.H.

    1984-01-01

    A model is developed and verified to describe the thermal mixing that occurs in the pressure suppression pool (PSP) of a commercial BWR. The model is designed specifically for a Mark-I containment and is intended for use in severe accident sequence analyses. The model produces space and time dependent temperature results throughout the PSP and is useful for evaluating the bulk PSP thermal mixing, the condensation effectiveness of the PSP, and the long-term containment integrity. The model is designed to accommodate single or multiple discharging T-quenchers, a PSP circumferential circulation induced by the residual heat removal system discharge, and the thermal stratification of the pool that occurs immediately after the relief valves close. The PSP thermal mixing model is verified by comparing the model predicted temperatures to experimental temperatures that were measured in an operating BWR suppression pool. The model is then used to investigate several PSP thermal mixing problems that include the time to saturate at full relief valve flow, the temperature response to a typical stuck open relief valve scenario, and the effect of operator rotation of the relief valve discharge point

  11. Comparison of fecal pooling strategies for detection of Mycobacterium avium ssp. paratuberculosis in cattle.

    Science.gov (United States)

    McKenna, S L B; Ritter, C; Dohoo, I; Keefe, G P; Barkema, H W

    2018-05-23

    In herds with typical moderate to low within-herd prevalence, testing for Mycobacterium avium ssp. paratuberculosis (MAP), the infectious agent of Johne's disease, will be more cost-effective if individual fecal samples are cultured in composite pools. However, sensitivity to classify a pool containing 1 or more positive individual samples as positive may depend on pool size and number of individual positive samples within a pool. Fecal samples collected from 994 dairy cows sampled at slaughter were cultured to detect MAP. Culturing was done both individually and as composite pooled samples using the TREK ESP Culture System II broth medium (Thermo Fisher Scientific, Trek Diagnostic Systems Inc., Cleveland, OH). Composite samples consisted of pools containing feces from 3, 5, 8, 10, or 15 cows. The number of individual fecal culture-positive cows within each pool ranged from 0 to 4. Culture of individual fecal samples detected MAP in 36 (3.6%) of the 994 cows. Individual samples that were detected within the first 50 d by TREK ESP Culture System II were more likely to lead to a positive pool result. In total, 840 pooled fecal samples were examined for presence of MAP, and of those, 272 pools actually contained feces from fecal culture-positive cows. The crude sensitivity (proportion of pools that contained at least 1 fecal-positive cow that tested positive) for pools of 3, 5, 8, 10, and 15 was 47, 67, 44, 59, and 39%, respectively. Across pools, an increase of the number of fecal culture-positive samples from 1 to 2 enhanced overall crude sensitivity from 44 to 71%. However, sensitivity did not further increase for pools with 3 or 4 fecal culture-positive samples (63 and 60%, respectively). Additionally, a simulation analysis assessing probability of pooled fecal samples being positive in herds of 50 and 100 cows was conducted. The simulation assumed that 1, 2, or 5 cows per herd were MAP fecal culture-positive and that pools of 5 and 10 were used. This low

  12. Core disruptive accident and recriticality analysis with FX2-POOL

    International Nuclear Information System (INIS)

    Abramson, P.B.

    1976-01-01

    The current state of development of FX2-POOL, a two-dimensional hydrodynamic, thermodynamic and neutronic scoping model for Hypothetical Core Disruptive Accident analysis is described. Checkout comparisons to VENUS for prompt burst conditions were good. Use of FX2-POOL to examine the importance of fuel to steel heat transfer during a prompt burst indicates that heat transfer plays no important role on that time scale. Scoping studies of material thermohydrodynamics for about 20 to 30 milliseconds following the prompt burst indicate that heat transfer is important on the time scale necessary for the CDA bubble to grow to the size of the original core. Preliminary results are presented for energetics of boiling fuel steel pools which are forced recritical by local surface pressurization

  13. Experimental investigation of particulate debris spreading in a pool

    Energy Technology Data Exchange (ETDEWEB)

    Konovalenko, A., E-mail: kono@kth.se [Division of Nuclear Power Safety, Royal Institute of Technology (KTH) , Roslagstullsbacken 21, Stockholm 106 91 (Sweden); Basso, S., E-mail: simoneb@kth.se [Division of Nuclear Power Safety, Royal Institute of Technology (KTH) , Roslagstullsbacken 21, Stockholm 106 91 (Sweden); Kudinov, P., E-mail: pkudinov@kth.se [Division of Nuclear Power Safety, Royal Institute of Technology (KTH) , Roslagstullsbacken 21, Stockholm 106 91 (Sweden); Yakush, S.E., E-mail: yakush@ipmnet.ru [Institute for Problems in Mechanics of the Russian Academy of Sciences, Ave. Vernadskogo 101 Bldg 1, Moscow 119526 (Russian Federation)

    2016-02-15

    Termination of severe accident progression by core debris cooling in a deep pool of water under reactor vessel is considered in several designs of light water reactors. However, success of this accident mitigation strategy is contingent upon the effectiveness of heat removal by natural circulation from the debris bed. It is assumed that a porous bed will be formed in the pool in the process of core melt fragmentation and quenching. Debris bed coolability depends on its properties and system conditions. The properties of the bed, including its geometry are the outcomes of the debris bed formation process. Spreading of the debris particles in the pool by two-phase turbulent flows induced by the heat generated in the bed can affect the shape of the bed and thus influence its coolability. The goal of this work is to provide experimental data on spreading of solid particles in the pool by large-scale two-phase flow. The aim is to provide data necessary for understanding of separate effects and for development and validation of models and codes. Validated codes can be then used for prediction of debris bed formation under prototypic severe accident conditions. In PDS-P (Particulate Debris Spreading in the Pool) experiments, air injection at the bottom of the test section is employed as a means to create large-scale flow in the pool in isothermal conditions. The test section is a rectangular tank with a 2D slice geometry, it has fixed width (72 mm), adjustable length (up to 1.5 m) and allows water filling to the depth of up to 1 m. Variable pool length and depth allows studying two-phase circulating flows of different characteristic sizes and patterns. The average void fraction in the pool is determined by video recording and subsequent image processing. Particles are supplied from the top of the facility above the water surface. Results of several series of PDS-P experiments are reported in this paper. The influence of the gas flow rate, pool dimensions, particle density

  14. Single-Track Melt-Pool Measurements and Microstructures in Inconel 625

    Science.gov (United States)

    Ghosh, Supriyo; Ma, Li; Levine, Lyle E.; Ricker, Richard E.; Stoudt, Mark R.; Heigel, Jarred C.; Guyer, Jonathan E.

    2018-02-01

    We use single-track laser melting experiments and simulations on Inconel 625 to estimate the dimensions and microstructure of the resulting melt pool. Our work is based on a design-of-experiments approach which uses multiple laser power and scan speed combinations. Single-track experiments generated melt pools of certain dimensions that showed reasonable agreement with our finite-element calculations. Phase-field simulations were used to predict the size and segregation of the cellular microstructure that formed along the melt-pool boundaries for the solidification conditions that changed as a function of melt-pool dimensions.

  15. Single-Track Melt-Pool Measurements and Microstructures in Inconel 625

    Science.gov (United States)

    Ghosh, Supriyo; Ma, Li; Levine, Lyle E.; Ricker, Richard E.; Stoudt, Mark R.; Heigel, Jarred C.; Guyer, Jonathan E.

    2018-06-01

    We use single-track laser melting experiments and simulations on Inconel 625 to estimate the dimensions and microstructure of the resulting melt pool. Our work is based on a design-of-experiments approach which uses multiple laser power and scan speed combinations. Single-track experiments generated melt pools of certain dimensions that showed reasonable agreement with our finite-element calculations. Phase-field simulations were used to predict the size and segregation of the cellular microstructure that formed along the melt-pool boundaries for the solidification conditions that changed as a function of melt-pool dimensions.

  16. An evaluation of different target enrichment methods in pooled sequencing designs for complex disease association studies.

    Directory of Open Access Journals (Sweden)

    Aaron G Day-Williams

    Full Text Available Pooled sequencing can be a cost-effective approach to disease variant discovery, but its applicability in association studies remains unclear. We compare sequence enrichment methods coupled to next-generation sequencing in non-indexed pools of 1, 2, 10, 20 and 50 individuals and assess their ability to discover variants and to estimate their allele frequencies. We find that pooled resequencing is most usefully applied as a variant discovery tool due to limitations in estimating allele frequency with high enough accuracy for association studies, and that in-solution hybrid-capture performs best among the enrichment methods examined regardless of pool size.

  17. CDC Study Finds Fecal Contamination in Pools

    Science.gov (United States)

    ... Communication (404) 639-3286 CDC study finds fecal contamination in pools A study of public pools done ... The E. coli is a marker for fecal contamination. Finding a high percentage of E. coli-positive ...

  18. 1968 Listing of Swimming Pool Equipment.

    Science.gov (United States)

    National Sanitation Foundation, Ann Arbor, MI. Testing Lab.

    An up-to-date listing of swimming pool equipment including--(1) companies authorized to display the National Sanitation Foundation seal of approval, (2) equipment listed as meeting NSF swimming pool equipment standards relating to diatomite type filters, (3) equipment listed as meeting NSF swimming pool equipment standard relating to sand type…

  19. Laboratory investigation and simulation of breakthrough curves in karst conduits with pools

    Science.gov (United States)

    Zhao, Xiaoer; Chang, Yong; Wu, Jichun; Peng, Fu

    2017-12-01

    A series of laboratory experiments are performed under various hydrological conditions to analyze the effect of pools in pipes on breakthrough curves (BTCs). The BTCs are generated after instantaneous injections of NaCl tracer solution. In order to test the feasibility of reproducing the BTCs and obtain transport parameters, three modeling approaches have been applied: the equilibrium model, the linear graphical method and the two-region nonequilibrium model. The investigation results show that pools induce tailing of the BTCs, and the shapes of BTCs depend on pool geometries and hydrological conditions. The simulations reveal that the two-region nonequilibrium model yields the best fits to experimental BTCs because the model can describe the transient storage in pools by the partition coefficient and the mass transfer coefficient. The model parameters indicate that pools produce high dispersion. The increased tailing occurs mainly because the partition coefficient decreases, as the number of pools increases. When comparing the tracer BTCs obtained using the two types of pools with the same size, the more appreciable BTC tails that occur for symmetrical pools likely result mainly from the less intense exchange between the water in the pools and the water in the pipe, because the partition coefficients for the two types of pools are virtually identical. Dispersivity values decrease as flow rates increase; however, the trend in dispersion is not clear. The reduced tailing is attributed to a decrease in immobile water with increasing flow rate. It provides evidence for hydrodynamically controlled tailing effects.

  20. Clinical blood pool MR Imaging

    Energy Technology Data Exchange (ETDEWEB)

    Leiner, Tim [Maastrich University Medical Center (Netherlands). Dept. of Radiology; Goyen, Martin [University Medical Center Hamburg-Eppendorf (Germany); Rohrer, Mathias [Bayer Schering Pharma AG, Berlin (Germany). European Business Unit Diagnostic Imaging; Schoenberg, Stefan O. (eds.) [University Hospital Mannheim Medical Faculty Mannheim - Heidelberg Univ. (Germany). Dept. of Clinical Radiology and Nuclear Medicine

    2008-07-01

    Clinical Blood Pool MR Imaging - This excellent treatise on Vasovist {sup registered} created by a team of exceptional faculty who are pioneers in MR Angiography covers the basic techniques, safety, efficacy, image processing and pharmaco-economic details to successfully implement a new level of MRA image quality with this new contrast agent. Martin Prince, Cornell University, New York The editors and authors have made groundbreaking contributions towards establishing MR angiography in various investigative settings, rendering it more precise and applying it for diverse indications. The work presented here is founded upon the extensive experience of the editors, as well as the broad range of experience from other scientific working groups. Maximilian Reiser, Ludwig Maximilian University, Munich Vasovist {sup registered} (Gadofosveset), worldwide the first blood pool agent, has only recently become available for clinical use, but has already gained wide acceptance as a tool to improve magnetic resonance angiography. This book presents the first in-depth introduction to the basic physicochemical aspects of the agent, the application of Vasovist {sup registered} in clinical MRA, as well as potential clinical applications beyond MRA and patient management-related aspects. The first part of the book explains basic and technical properties of the agent and the differences of Vasovist {sup registered} compared to currently available extracellular agents. The second part contains detailed chapters on safety and efficacy. In the third part the focus is on MR angiographic applications, and in the fourth part of the book potential clinical fields beyond MRA are explored. All clinical chapters feature ready-to-use clinical protocols and a series of take home messages that concisely summarize the current role of blood pool imaging for each specific indication. (orig.)

  1. Are Fast Food “Trans-Fat” Claims True? An Infraspec VFA-IR Spectrometer Analysis of Trans-fat content in select food items purchased from Long John Silver’s

    Directory of Open Access Journals (Sweden)

    Sharron Jenkins

    2014-10-01

    Full Text Available Studies linking high trans-fat diets to coronary heart disease (CHD have prompted the need to regulate, limit, or completely ban trans-fat from all commercial food products, including fast foods. Many U.S. fast food chains now claim that their food items, particularly French fries, have "no trans-fat". In a previous study, our lab tested the validity of trans-fat claims made by several popular fast food restaurants by experimentally determining the %trans-fat in oil extracted from fast food French fries. In some cases, the trans-fat content was nearly twice as high as the amount reported by the restaurant in their literature. Long John Silver's, for example, reported a trans-fat content of 25% for their French fries, while our lab actually found over 40% trans-fat. The purpose of this study is to broaden our study of Long John Silver's trans-fat claims by analyzing a variety of their food items and comparing our findings with the %trans-fat reported by the restaurant literature (nutrition fact tables. Variable Filter Array (VFA IR spectroscopy was used to assess the trans-fat content of oil extracted from food samples. Our preliminary findings suggest that nearly every food item under study contained considerably more trans-fat than the amount reported in the restaurant’s literature.

  2. Method of measuring a liquid pool volume

    Science.gov (United States)

    Garcia, G.V.; Carlson, N.M.; Donaldson, A.D.

    1991-03-19

    A method of measuring a molten metal liquid pool volume and in particular molten titanium liquid pools is disclosed, including the steps of (a) generating an ultrasonic wave at the surface of the molten metal liquid pool, (b) shining a light on the surface of a molten metal liquid pool, (c) detecting a change in the frequency of light, (d) detecting an ultrasonic wave echo at the surface of the molten metal liquid pool, and (e) computing the volume of the molten metal liquid. 3 figures.

  3. Large-scale pool fires

    Directory of Open Access Journals (Sweden)

    Steinhaus Thomas

    2007-01-01

    Full Text Available A review of research into the burning behavior of large pool fires and fuel spill fires is presented. The features which distinguish such fires from smaller pool fires are mainly associated with the fire dynamics at low source Froude numbers and the radiative interaction with the fire source. In hydrocarbon fires, higher soot levels at increased diameters result in radiation blockage effects around the perimeter of large fire plumes; this yields lower emissive powers and a drastic reduction in the radiative loss fraction; whilst there are simplifying factors with these phenomena, arising from the fact that soot yield can saturate, there are other complications deriving from the intermittency of the behavior, with luminous regions of efficient combustion appearing randomly in the outer surface of the fire according the turbulent fluctuations in the fire plume. Knowledge of the fluid flow instabilities, which lead to the formation of large eddies, is also key to understanding the behavior of large-scale fires. Here modeling tools can be effectively exploited in order to investigate the fluid flow phenomena, including RANS- and LES-based computational fluid dynamics codes. The latter are well-suited to representation of the turbulent motions, but a number of challenges remain with their practical application. Massively-parallel computational resources are likely to be necessary in order to be able to adequately address the complex coupled phenomena to the level of detail that is necessary.

  4. Structural integrity assessment of HANARO pool cover

    International Nuclear Information System (INIS)

    Ryu, Jeong Soo

    2001-11-01

    This report is for the seismic analysis and the structural integrity evaluation of HANARO Pool Cover in accordances with the requirement of the Technical Specification for Seismic Analysis of HANARO Pool Cover. For performing the seismic analysis and evaluating the structural integrity for HANARO Pool Cover, the finite element analysis model using ANSYS 5.7 was developed and the dynamic characteristics were analyzed. The seismic response spectrum analyses of HANARO Pool Cover under the design floor response spectrum loads of OBE and SSE were performed. The analysis results show that the stress values in HANARO Pool Cover for the seismic loads are within the ASME Code limits. It is also confirmed that the fatigue usage factor is less than 1.0. Therefore any damage on structural integrity is not expected when an HANARO Pool Cover is installed in the upper part of the reactor pool

  5. PRELIMINARY STUDY OF FISH CULTURE IN ABANDONED SAND MINING POOL

    Directory of Open Access Journals (Sweden)

    Bambang Gunadi

    2006-12-01

    Full Text Available One of main problems in freshwater aquaculture development in Indonesia, especially in Java, is unavailability of developing zone. It is important to find an underutilized area that meets for industrial scale freshwater aquaculture, i.e. sufficient water supply, wide area, and located in one area or zone. The abandoned mining (sand, tin, etc. pools distributed along the country might be the potential area for freshwater aquaculture business. For example, there are at least 13 water pools with total surface area of 250 ha at 15 km side of Citarum River in Karawang District (West Java Province. This study was conducted to obtain preliminary data about the prospect and potency of fish culture (tilapia, clariid catfish, and ‘patin’ catfish in abandoned sand-mining pools in Karawang District. Mini floating net cages of 1 x 1 x 1.5 m3 size were used for culturing fish, i.e. patin catfish (Pangasianodon hypophthalmus, nile tilapia (Oreochromis niloticus, and clariid catfish (Clarias gariepinus, separately. Patin catfish were stocked at a size of 2 g with a density of 300 fish per cage, tilapia were stocked at a size of 6 g with a density of 400 fish per cage, while  the clariid catfish were stocked at a size of 1.4 g with a density of 980 fish per cage. A floating commercial feed (30%—32% protein, 3%—5% fat was used at a daily rate of 9% biomass weight at the beginning and reduced gradually to 3% at the final culture period. Observed data showed that patin catfish grew from the initial size of 2.08 g to the final size 299.59 g in 5 months, nile tilapia grew from individual initial size of 5.92 g to the final size of 247.12 g in 14 weeks, and clariid catfish grew from initial size of 1.39 g to the final size of 73.10 g in 8 weeks. These three species were technically prospective for aquaculture development in the abandoned sand-mining pools.

  6. Livermore pool-type reactor

    International Nuclear Information System (INIS)

    Mann, L.G.

    1977-01-01

    The Livermore Pool-Type Reactor (LPTR) has served a dual purpose since 1958--as an instrument for fundamental research and as a tool for measurement and calibration. Our early efforts centered on neutron-diffraction, fission, and capture gamma-ray studies. During the 1960's it was used for extensive calibration work associated with radiochemical and physical measurements on nuclear-explosive tests. Since 1970 the principal applications have been for trace-element measurements and radiation-damage studies. Today's research program is dominated by radiochemical studies of the shorter-lived fission products and by research on the mechanisms of radiation damage. Trace-element measurement for the National Uranium Resource Evaluation (NURE) program is the major measurement application today

  7. Cardiac blood pool emission tomography

    International Nuclear Information System (INIS)

    Itti, R.; Philippe, L.; Lorgeron, J.M.; Charbonnier, B.; Raynaud, P.; Brochier, M.

    1983-01-01

    After blood pool labeling using technetium-99m, a series of cardiac pictures is acquired during the rotation of a gamma-camera about the patient. Computer processing leads to reconstruction of various tomographic slices from the original planar projection. Electrocardiographic gating selects the different phases of the cardiac cycle. Individual slices through the left ventricular region are added in order to provide ''thick'' slices on which global and regional parameters of the left ventricular function can be determined. Due to the proportionality existing between count rates and labeled blood volumes, any geometrical model can be avoided. The delineation of regions of interest for count integration is made easier due to the absence of superimposition of structures; no correction for background is necessary. Tomography thus appears to be more consistent and more accurate than the classical methods using planar projections. In addition, right ventricular morphological and kinetic studies can be performed in the same conditions as for the left ventricle [fr

  8. Arc-weld pool interactions

    International Nuclear Information System (INIS)

    Glickstein, S.S.

    1978-08-01

    The mechanisms involved in arc-weld pool interactions are extremely complex and no complete theory is presently available to describe much of the phenomena observed during welding. For the past several years, experimental and analytical studies have been undertaken at the Bettis Atomic Power Laboratory to increase basic understanding of the gas tungsten arc welding process. These studies have included experimental spectral analysis of the arc in order to determine arc temperature and analytical modeling of the arc and weld puddle. The investigations have been directed toward determining the cause and effects of variations in the energy distribution incident upon the weldment. In addition, the effect of weld puddle distortion on weld penetration was investigated, and experimental and analytical studies of weld process variables have been undertaken to determine the effects of the variables upon weld penetration and configuration. A review of the results and analysis of these studies are presented

  9. Just like the lottery? Player behaviour and anomalies in the market for football pools.

    Science.gov (United States)

    Forrest, David; Pérez, Levi

    2015-06-01

    Football pools were an antecedent to lotto in providing a long-odds, high-prize gambling opportunity for a mass market in Europe. Even after lotto has become well established, pools games continue to occupy a significant niche in the gaming market in several jurisdictions, most notably Spain. This paper employs 23 years of sales data from the national pools game in Spain to investigate similarities between the behaviour of lotto players and pools players. It observes similar phenomena as have been noted in lotto sales studies, including strong sensitivity of sales to the size of jackpot on offer, significant habit effects, a halo effect whereby there is some short-term persistence in increased sales whenever a high jackpot is offered (even after jackpot size has returned to normal), and a tendency to jackpot fatigue (over time, the size of the jackpot has to be increased to more than before to stimulate the same increase in sales). Notwithstanding that the football pools are marketed as based on knowledge and understanding of sport whereas lotto is a pure numbers game, modelling sales of the pools therefore yields findings very similar to those reported in the literature on lotto. This suggests that both sets of players share common psychological and cognitive traits and economic motivation. Those responsible for promoting pools should therefore be able to draw on findings from the much more extensive literature on lotto when formulating strategy in terms of game design and marketing.

  10. Evaluation of clinical trials by Ethics Committees in Germany – results and a comparison of two surveys performed among members of the German Association of Research-Based Pharmaceutical Companies (vfa

    Directory of Open Access Journals (Sweden)

    Russ, Hagen

    2015-01-01

    Full Text Available [english] Objective: The objective of this project was to evaluate the quality and quantity of initial applications for a clinical trial according to § 7 of the German Good Clinical Practice (GCP ordinance (German: GCP-Verordnung, GCP-V, the quality of evaluations of those applications by Ethics Committees (ECs/Investigational Review Boards (IRBs in Germany as well as the pattern of EC objections in their reasoned opinions (vote. In order to identify a change over time, the results of the present survey were also compared with a survey performed in 2008.Methods: Based on reasoned opinions issued by the respective EC in charge of the coordinating principle investigator (coordinating EC in 2011, a written survey among members of the German Association of Research-Based Pharmaceutical Companies (vfa was conducted in 2012. The answers to the questionnaire were analyzed descriptively. Since the data set collected in 2011 was structurally identical with the data set gained in 2007 both surveys were compared.Results: Of the 24 companies represented on the vfa Clinical Research/Quality Assurance Subcommittee, 75% (18 took part in the survey. Survey evaluation was based on a total of 251 applications of these 18 companies submitted to 43 ECs. These account for about 21% of 1,214 applications for authorization of commercial and non-commercial phase I–IV clinical trials submitted to the regulatory authorities (BfArM and PEI in 2011.In comparison to 2007, a lower amount of applications (n=251 in 2011 vs. n=288 in 2007 was submitted to a slightly higher number of ECs (43 in 2011 vs. 40 in 2007. The amount of objections increased by 21% from 1,299 (2007 to 1,574 (2011 resulting in an average of 4.5 (2007 vs. 6.3 (2011 objections per application. Overall, the analysis of both formal and content related objections revealed almost the same pattern as in the previous survey. In total, the most frequent objections applied to the patient information and consent

  11. Evaluation of clinical trials by Ethics Committees in Germany--results and a comparison of two surveys performed among members of the German Association of Research-Based Pharmaceutical Companies (vfa).

    Science.gov (United States)

    Russ, Hagen; Busta, Susanne; Jost, Bertfried; Bethke, Thomas D

    2015-01-01

    The objective of this project was to evaluate the quality and quantity of initial applications for a clinical trial according to § 7 of the German Good Clinical Practice (GCP) ordinance (German: GCP-Verordnung, GCP-V), the quality of evaluations of those applications by Ethics Committees (ECs)/Investigational Review Boards (IRBs) in Germany as well as the pattern of EC objections in their reasoned opinions (vote). In order to identify a change over time, the results of the present survey were also compared with a survey performed in 2008. Based on reasoned opinions issued by the respective EC in charge of the coordinating principle investigator (coordinating EC) in 2011, a written survey among members of the German Association of Research-Based Pharmaceutical Companies (vfa) was conducted in 2012. The answers to the questionnaire were analyzed descriptively. Since the data set collected in 2011 was structurally identical with the data set gained in 2007 both surveys were compared. Of the 24 companies represented on the vfa Clinical Research/Quality Assurance Subcommittee, 75% (18) took part in the survey. Survey evaluation was based on a total of 251 applications of these 18 companies submitted to 43 ECs. These account for about 21% of 1,214 applications for authorization of commercial and non-commercial phase I-IV clinical trials submitted to the regulatory authorities (BfArM and PEI) in 2011. In comparison to 2007, a lower amount of applications (n=251 in 2011 vs. n=288 in 2007) was submitted to a slightly higher number of ECs (43 in 2011 vs. 40 in 2007). The amount of objections increased by 21% from 1,299 (2007) to 1,574 (2011) resulting in an average of 4.5 (2007) vs. 6.3 (2011) objections per application. Overall, the analysis of both formal and content related objections revealed almost the same pattern as in the previous survey. In total, the most frequent objections applied to the patient information and consent form followed in descending order by trial

  12. Evaluation of clinical trials by Ethics Committees in Germany: Experience of applicants with the review of requests for opinion of the Ethics Committees - results of a survey among members of the German Association of Research-Based Pharmaceutical Companies (VFA

    Directory of Open Access Journals (Sweden)

    Russ, Hagen

    2009-07-01

    Full Text Available The review of requests for a positive opinion of the ethics committees (application procedure as a requirement to start a clinical trial in Germany has been completely redesigned with the transposition of EU Directive 2001/20/EC in the 12th Amendment of the German Medicines Act in August 2004. The experience of applicants (sponsors, legal representatives of sponsors in the EU and persons or organizations authorized by the sponsors to make the application, respectively in terms of interactions with the ethics committees in Germany has been positive overall, especially with respect to ethics committee adherence to the statutory timelines applicable for review of requests. However, inconsistencies between ethics committees exist in terms of the form and content of the requirements for application documents and their evaluation.With the objective of further improving both the quality of applications and the evaluation of those applications by ethics committees, a survey among members of the German Association of Research-Based Pharmaceutical Companies (VFA was conducted from January to April 2008. Based on reasoned opinions issued by the respective ethics committee in charge of the coordinating principal investigator (coordinating ethics committee, the type and frequency of formal and content-related objections to applications according to § 7 of the German Good Clinical Practice (GCP Regulation were systematically documented, and qualitative and quantitative analyses performed. 21 out of 44 members of the VFA participated in the survey. 288 applications for Phase I–IV studies submitted between January and December 2007 to 40 ethics committees were evaluated.This survey shows that about one in six applications is incomplete and has formal and/or content objections, respectively, especially those that pertain to documents demonstrating the qualification of the investigator and/or suitability of the facilities. These objections are attributable to

  13. Theoretical assessment of particle generation from sodium pool fires

    Energy Technology Data Exchange (ETDEWEB)

    Garcia, M., E-mail: monica.gmartin@ciemat.es [CIEMAT, Unit of Nuclear Safety Research, Av. Complutense, 40, 28040 Madrid (Spain); Herranz, L.E., E-mail: luisen.herranz@ciemat.es [CIEMAT, Unit of Nuclear Safety Research, Av. Complutense, 40, 28040 Madrid (Spain); Kissane, M.P., E-mail: Martin.KISSANE@oecd.org [Nuclear Safety Technology and Regulation Division, OECD Nuclear Energy Agency (NEA), 46 quai Alphonse Le Gallo, 92100 Boulogne-Billancourt (France)

    2016-12-15

    Highlights: • Development of particle generation model for sodium-oxides aerosol formation. • Development of partially validated numerical simulations to build up maps of saturation ratio. • Nucleation of supersaturated vapours as relevant source of aerosols over sodium pools. • Prediction of high concentrations of primary particles in the combustion zone. - Abstract: Potential sodium discharge in the containment during postulated Beyond Design Basis Accidents (BDBAs) in Sodium-cooled Fast Reactors (SFRs) would have major consequences for accident development in terms of energetics and source term. In the containment, sodium vaporization and subsequent oxidation would result in supersaturated oxide vapours that would undergo rapid nucleation creating toxic aerosols. Therefore, modelling this vapour nucleation is essential to proper source term assessment in SFRs. In the frame of the EU-JASMIN project, a particle generation model to calculate the particle generation rate and their primary size during an in-containment sodium pool fire has been developed. Based on a suite of individual models for sodium vaporization, oxygen natural circulation (3D modelling), sodium-oxygen chemical reactions, sodium-oxides-vapour nucleation and condensation, its consistency has been partially validated by comparing with available experimental data. As an outcome, large temperature and vapour concentration gradients set over the sodium pool have been found which result in large particle concentrations in the close vicinity of the pool.

  14. Guide for decontaminating swimming pool at schools

    International Nuclear Information System (INIS)

    Matsuhashi, Shimpei; Kurikami, Hiroshi; Yasuda, Ryo; Takano, Takao; Seko, Noriaki; Naganawa, Hirochika; Kuroki, Ryota; Saegusa, Jun

    2012-07-01

    Because of TEPCO Fukushima Dai-ichi Nuclear Power Plant accident due to the Great East Japan Earthquake, a huge amount of radioactive materials was widely dispersed and precipitated into the environment. Swimming pools in Fukushima prefectures were contaminated with the radioactives. We JAEA carried out several demonstration tests to decontaminate the radioactives and discharge the pool water safely. We concluded the results obtained from the tests as 'Guide for decontaminating Swimming Pool at School' and released it quickly. Following this, we also released the guide in English. This manuscript, as an experimental report of the swimming pool water decontamination, is consisted from the guide in Japanese and English prepared. (author)

  15. Current operating practices of nuclear insurance pools

    International Nuclear Information System (INIS)

    O'Connell, J.M.

    1993-01-01

    This paper discusses the nuclear pooling system and co-operation between the pools, present practice and capacity, with a breakdown of the limits for third party liability and material damage. The author also describes the relationship between the pools and the nuclear operators (the policyholders), and concludes that the nuclear pools have been successful in serving the interests of their member companies, their policyholders and the governments as they have provided a stable insurance market by making available capacity in amounts that had never before been assembled and placed at risk in a single location. 2 tabs

  16. Guide for decontaminating swimming pool at schools

    Energy Technology Data Exchange (ETDEWEB)

    Matsuhashi, Shimpei; Kurikami, Hiroshi; Yasuda, Ryo; Takano, Takao; Seko, Noriaki; Naganawa, Hirochika; Kuroki, Ryota; Saegusa, Jun

    2012-07-15

    Because of TEPCO Fukushima Dai-ichi Nuclear Power Plant accident due to the Great East Japan Earthquake, a huge amount of radioactive materials was widely dispersed and precipitated into the environment. Swimming pools in Fukushima prefectures were contaminated with the radioactives. We JAEA carried out several demonstration tests to decontaminate the radioactives and discharge the pool water safely. We concluded the results obtained from the tests as 'Guide for decontaminating Swimming Pool at School' and released it quickly. Following this, we also released the guide in English. This manuscript, as an experimental report of the swimming pool water decontamination, is consisted from the guide in Japanese and English prepared. (author)

  17. Structure for nuclear fuel storage pools

    International Nuclear Information System (INIS)

    Ebata, Sakae; Nichiei, Shinji.

    1979-01-01

    Purpose: To enable leak detection in nuclear fuel storage pools, as well as prevent external leakages while keeping the strength of the constructional structures. Constitution: Protection plates are provided around pool linear plates and a leak reception is provided to the bottom. Leakages are detected by leak detecting pipeways and the external leakages are prevented by collecting them in a detection area provided in the intermediate layer. Since ferro-reinforcements at the bottom wall of the pool are disconnected by the protection plate making it impossible to form the constructional body, body hunches are provided to the bottom wall of the pool for processing the ferro-reinforcements. (Yoshino, Y.)

  18. Seismic loads in modularized and unmodularized large pools located on hard or intermediate hard sites

    Energy Technology Data Exchange (ETDEWEB)

    Dong, R G [California Univ., Livermore (USA). Lawrence Livermore Lab.

    1977-12-01

    To augment the present capacity of pools for storing spent nuclear fuel elements, pools larger than those in current use are being planned. These pools may or may not be modularized into cells. Because of the large size of the pools, seismic loads are of significant interest. In particular, the effects of modularization and site hardness are of concern. The study presented in this paper reveals that modularization is generally unfavourable, because it creates the option of leaving one or more cells empty which in turn results in higher structural loads. The wall which separates a filled cell from an empty cell, or the wall which bears against earth on one side and faces an empty cell on the other, becomes very highly stressed. For the particular pool geometries examined, a hard site is generally preferred over an intermediate hard site in terms of structural loads.

  19. Oxidation kinetics of corium pool

    Energy Technology Data Exchange (ETDEWEB)

    Sulatsky, A.A., E-mail: andrei314@mail.ru [Alexandrov Research Institute of Technologies (NITI), Sosnovy Bor (Russian Federation); Smirnov, S.A. [D.V. Efremov Scientific Research Institute of Electrophysical Apparatus (NIIEFA), St. Petersburg (Russian Federation); Granovsky, V.S.; Khabensky, V.B.; Krushinov, E.V.; Vitol, S.A.; Kotova, S.Yu. [Alexandrov Research Institute of Technologies (NITI), Sosnovy Bor (Russian Federation); Fischer, M.; Hellmann, S. [AREVA NP GmbH, Erlangen (Germany); Tromm, W.; Miassoedov, A. [Forschungzentrum Karlsruhe (FZK), Karlsruhe (Germany); Bottomley, D. [EUROPÄISCHE KOMMISSION, Joint Research Centre Institut für Transurane (ITU), Karlsruhe (Germany); Piluso, P. [CEA Cadarache-DEN/DTN/STRI, St.Paul-lez-Durance (France); Barrachin, M. [Institut de Radioprotection et Sûreté Nucléaire, St.Paul-lez-Durance (France)

    2013-09-15

    Highlights: • The analysis of experimental data on molten corium oxidation was been carried out. • The analysis has revealed the main factors influencing the oxidation kinetics. • The analysis was used for developing a qualitative analytical model. • The numerical modeling has confirmed the results of experimental data analysis. -- Abstract: Experimental, theoretical and numerical studies of oxidation kinetics of an open surface corium pool have been reported. The experiments have been carried out within OECD MASCA program and ISTC METCOR, METCOR-P and EVAN projects. It has been shown that the melt oxidation is controlled by an oxidant supply to the melt free surface from the atmosphere, not by the reducer supply from the melt. The project experiments have not detected any input of the zirconium oxidation kinetics into the process chemistry. The completed analysis puts forward a simple analytical model, which gives an explanation of the main features of melt oxidation process. The numerical modeling results are in good agreement with experimental data and theoretical considerations.

  20. Oxidation kinetics of corium pool

    International Nuclear Information System (INIS)

    Sulatsky, A.A.; Smirnov, S.A.; Granovsky, V.S.; Khabensky, V.B.; Krushinov, E.V.; Vitol, S.A.; Kotova, S.Yu.; Fischer, M.; Hellmann, S.; Tromm, W.; Miassoedov, A.; Bottomley, D.; Piluso, P.; Barrachin, M.

    2013-01-01

    Highlights: • The analysis of experimental data on molten corium oxidation was been carried out. • The analysis has revealed the main factors influencing the oxidation kinetics. • The analysis was used for developing a qualitative analytical model. • The numerical modeling has confirmed the results of experimental data analysis. -- Abstract: Experimental, theoretical and numerical studies of oxidation kinetics of an open surface corium pool have been reported. The experiments have been carried out within OECD MASCA program and ISTC METCOR, METCOR-P and EVAN projects. It has been shown that the melt oxidation is controlled by an oxidant supply to the melt free surface from the atmosphere, not by the reducer supply from the melt. The project experiments have not detected any input of the zirconium oxidation kinetics into the process chemistry. The completed analysis puts forward a simple analytical model, which gives an explanation of the main features of melt oxidation process. The numerical modeling results are in good agreement with experimental data and theoretical considerations

  1. 13 CFR 120.1708 - Pool Certificates.

    Science.gov (United States)

    2010-01-01

    ... United States. (c) SBA purchase of a Loan Interest. SBA will determine whether to purchase a Loan... reserves the right to purchase a Loan Interest from a Pool at any time. (d) Self-liquidating. A Pool... market conditions and program experience, and will publish any such change in the Federal Register. (h...

  2. Compact fuel storage rack for fuel pools

    International Nuclear Information System (INIS)

    Parras, F.; Louvat, J.P.

    1986-01-01

    ETS LEMER and FRAMATOME propose a new compact storage rack. This rack permits a considerable increase of the storage capacity of cooling pools. A short description of the structure and the components is presented, to propose racks that are: . Inalterable, . Compact, . Insensitive to earthquakes. Installation in pools already in operation is simplified by their light structure and the bearing device [fr

  3. The warm pool in the Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Vinayachandran, P.N.; Shetye, S.R.

    is larger and warmer, a peculiarity of the pool in the Indian Ocean is its seasonal variation. The surface area of the pool changes from 24 x 106 km2 in April to 8 x 106 km2 in September due to interaction with the southwest monsoon. The annual cycles of sea...

  4. Shedding Light on Dark Liquidity Pools

    NARCIS (Netherlands)

    Degryse, H.A.; van Achter, M.; Wuyts, G.

    2008-01-01

    This article reviews the recent developments on dark liquidity pools starting from the theoretical and empirical academic literature. The number of dark liquidity pools as well as their trading volume has grown substantially in the last couple of years. We highlight the incentives of providers as

  5. Measurements in large pool fires with an actively cooled calorimeter

    International Nuclear Information System (INIS)

    Koski, J.A.; Wix, S.D.

    1995-01-01

    The pool fire thermal test described in Safety Series 6 published by the International Atomic Energy Agency (IAEA) or Title 10, Code of Federal Regulations, Part 71 (10CFR71) in the United States is one of the most difficult tests that a container for larger ''Type B'' quantities of nuclear materials must pass. If retests of a container are required, costly redesign and project delays can result. Accurate measurements and modeling of the pool fire environment will ultimately lower container costs by assuring that containers past the pool fire test on the first attempt. Experiments indicate that the object size or surface temperature of the container can play a role in determining local heat fluxes that are beyond the effects predicted from the simple radiative heat transfer laws. An analytical model described by Nicolette and Larson 1990 can be used to understand many of these effects. In this model a gray gas represents soot particles present in the flame structure. Close to the container surface, these soot particles are convectively and radiatively cooled and interact with incident energy from the surrounding fire. This cooler soot cloud effectively prevents some thermal radiation from reaching the container surface, reducing the surface heat flux below the value predicted by a transparent medium model. With some empirical constants, the model suggested by Nicolette and Larson can be used to more accurately simulate the pool fire environment. Properly formulated, the gray gas approaches also fast enough to be used with standard commercial computer codes to analyze shipping containers. To calibrate this type of model, accurate experimental measurements of radiative absorption coefficients, flame temperatures, and other parameters are necessary. A goal of the calorimeter measurements described here is to obtain such parameters so that a fast, useful design tool for large pool fires can be constructed

  6. Big city consultants shut down our pool : a shocking community pool gets checked for stray voltage

    Energy Technology Data Exchange (ETDEWEB)

    Lynch, P. [Power Line Systems Engineering Inc., Markham, ON (Canada)

    2009-12-15

    This article discussed an investigation conducted at a community pool where swimmers complained of receiving electrical shocks both in the pool and on the pool's deck area. Electrical measurements taken at the pool revealed current flows from the pool water to various points around the deck area. Measured current flow in the pool area was 30 amps even when the main pool service breaker was opened to shut off power to the entire facility. Thirty amps of primary neutral current was then measured on the primary side aerial neutral in front of the pool. A 10 amp primary feeder from the pool joined up with the complex's primary neutral wire to increase the neutral current to 40 amps. The combined 40 amps current then returned to the secondary side of a nearby utility transformer substation. The study showed that the underground wet low-resistance grounded surface area of the pool was attracting the 30 amps of utility current from the surrounding ground area. The local utility disconnected the primary and secondary neutral interconnection at the pool's main 600-volt step-down transformer. The pool deck was removed in order to install additional copper bonding grounds. In order to avert serious injuries, many experts propose that all electric utilities should be required by law to reconfigure their power systems to prevent primary power neutral currents from entering private buildings. 1 tab., 2 figs.

  7. Ripples in a superconducting tidal pool

    CERN Document Server

    Hudson, E

    2003-01-01

    The behaviour of electrons in a metal is often compared to that of water in a pool. An empty pool is like a material that has all of its electrons removed. As electrons are 'poured' into the metal, they first occupy the lowest energies available - the bottom of the pool - and eventually fill up to the Fermi energy, the top of the pool. At this point we no longer discuss electrons but quasiparticles. These are electrons that have modified properties due to their interactions within the material. Waves in a pool can be excited, and their properties will depend on the depth of the water. Similarly in a metal, quasiparticles behave like waves that have a material-dependent dispersion relation between their energy and their wavevector, which specifies their direction and wavelength. This simple analogy also hints at an indirect method of measuring the dispersion relation of a metal, and hence the myriad of properties that depend on it. (U.K.)

  8. 76 FR 62605 - Virginia Graeme Baker Pool and Spa Safety Act; Interpretation of Unblockable Drain

    Science.gov (United States)

    2011-10-11

    ... the VGB Act defines an ``unblockable drain'' as ``a drain of any size and shape that a human body... intentions. They claim that for this reason, backup systems are necessary, and a swimming pool or spa with a... of an ``unblockable drain,'' at 16 CFR 1450.2(b) and believe it was in error. Regardless of the size...

  9. Analysis of an open-air swimming pool solar heating system by using an experimentally validated TRNSYS model

    Energy Technology Data Exchange (ETDEWEB)

    Ruiz, Elisa; Martinez, Pedro J. [Universidad Miguel Hernandez - Edificio Torreblanca, Avda. de la Universidad s/n, 03202 Elche (Spain)

    2010-01-15

    In the case of private outdoor swimming pools, seldom larger than 100 m{sup 2}, conventional auxiliary heating systems are being installed less and less. Solar heating is an option to extend the swimming season. The temperature evolution of an open-air swimming pool highly depends on the wind speed directly on the water surface, which at the same time is influenced by the surroundings of the pool. In this paper, the TRNSYS model of a private open-air pool with a 50-m{sup 2} surface was validated by registering the water temperature evolution and the meteorological data at the pool site. Evaporation is the main component of energy loss in swimming pools. Six different sets of constants found in literature were considered to evaluate the evaporative heat transfer coefficient with the purpose of finding the most suitable one for the TRNSYS pool model. In order to do that, the evolution of the pool water temperature predicted by the TRNSYS pool model was compared with the experimentally registered one. The simulation with TRNSYS of the total system, including the swimming pool and the absorber circuit integrated into the existing filter circuit, provided information regarding the increase of the pool temperature for different collector areas during the swimming season. This knowledge, together with the economic costs, support the decision about the absorber field size. (author)

  10. Titanium distribution in swimming pool water is dominated by dissolved species

    International Nuclear Information System (INIS)

    David Holbrook, R.; Motabar, Donna; Quiñones, Oscar; Stanford, Benjamin; Vanderford, Brett; Moss, Donna

    2013-01-01

    The increased use of titanium dioxide nanoparticles (nano-TiO 2 ) in consumer products such as sunscreen has raised concerns about their possible risk to human and environmental health. In this work, we report the occurrence, size fractionation and behavior of titanium (Ti) in a children's swimming pool. Size-fractionated samples were analyzed for Ti using ICP-MS. Total titanium concentrations ([Ti]) in the pool water ranged between 21 μg/L and 60 μg/L and increased throughout the 101-day sampling period while [Ti] in tap water remained relatively constant. The majority of [Ti] was found in the dissolved phase (<1 kDa), with only a minor fraction of total [Ti] being considered either particulate or microparticulate. Simple models suggest that evaporation may account for the observed variation in [Ti], while sunscreen may be a relevant source of particulate and microparticule Ti. Compared to diet, incidental ingestion of nano-Ti from swimming pool water is minimal. -- Highlights: •Total titanium concentrations in unfiltered swimming pool water ranged between 21 and 60 μg/L. •Evaporation of the swimming pool water is suspected of causing a temporal increase in [Ti]. •The vast majority of Ti is found in the dissolved phase (<1 kD). •Swimming pools are not a significant Ti source for human exposure via ingestion. -- In children's swimming pool water, the majority of titanium is found in the dissolved phase

  11. Design and Construction of Pool Door for Research Reactor

    Energy Technology Data Exchange (ETDEWEB)

    Jung, Kwangsub; Lee, Sangjin; Choi, Jinbok; Oh, Jinho; Lee, Jongmin [KAERI, Daejeon (Korea, Republic of)

    2016-05-15

    The pool door is a structure to isolate the reactor pool from the service pool for maintenance. The pool door is installed before the reactor pool is drained. The pool door consists of structural component and sealing component. The main structures of the pool door are stainless steel plates and side frames. The plates and frames are assembled by welded joints. Lug is welded at the top of the plate. The pool door is submerged in the pool water when it is used. Materials of the pool door should be resistive to corrosion and radiation. Stainless steel is used in structural components and air nozzle assemblies. Features of design and construction of the pool door for the research reactor are introduced. The pool door is designed to isolate the reactor pool for maintenance. Structural analysis is performed to evaluate the structural integrity during earthquake. Tests and inspections are also carried out during construction to identify the safety and function of the pool door.

  12. Design and Construction of Pool Door for Research Reactor

    International Nuclear Information System (INIS)

    Jung, Kwangsub; Lee, Sangjin; Choi, Jinbok; Oh, Jinho; Lee, Jongmin

    2016-01-01

    The pool door is a structure to isolate the reactor pool from the service pool for maintenance. The pool door is installed before the reactor pool is drained. The pool door consists of structural component and sealing component. The main structures of the pool door are stainless steel plates and side frames. The plates and frames are assembled by welded joints. Lug is welded at the top of the plate. The pool door is submerged in the pool water when it is used. Materials of the pool door should be resistive to corrosion and radiation. Stainless steel is used in structural components and air nozzle assemblies. Features of design and construction of the pool door for the research reactor are introduced. The pool door is designed to isolate the reactor pool for maintenance. Structural analysis is performed to evaluate the structural integrity during earthquake. Tests and inspections are also carried out during construction to identify the safety and function of the pool door

  13. Pool scrubbing models for iodine components

    Energy Technology Data Exchange (ETDEWEB)

    Fischer, K [Battelle Ingenieurtechnik GmbH, Eschborn (Germany)

    1996-12-01

    Pool scrubbing is an important mechanism to retain radioactive fission products from being carried into the containment atmosphere or into the secondary piping system. A number of models and computer codes has been developed to predict the retention of aerosols and fission product vapours that are released from the core and injected into water pools of BWR and PWR type reactors during severe accidents. Important codes in this field are BUSCA, SPARC and SUPRA. The present paper summarizes the models for scrubbing of gaseous Iodine components in these codes, discusses the experimental validation, and gives an assessment of the state of knowledge reached and the open questions which persist. The retention of gaseous Iodine components is modelled by the various codes in a very heterogeneous manner. Differences show up in the chemical species considered, the treatment of mass transfer boundary layers on the gaseous and liquid sides, the gas-liquid interface geometry, calculation of equilibrium concentrations and numerical procedures. Especially important is the determination of the pool water pH value. This value is affected by basic aerosols deposited in the water, e.g. Cesium and Rubidium compounds. A consistent model requires a mass balance of these compounds in the pool, thus effectively coupling the pool scrubbing phenomena of aerosols and gaseous Iodine species. Since the water pool conditions are also affected by drainage flow of condensate water from different regions in the containment, and desorption of dissolved gases on the pool surface is determined by the gas concentrations above the pool, some basic limitations of specialized pool scrubbing codes are given. The paper draws conclusions about the necessity of coupling between containment thermal-hydraulics and pool scrubbing models, and proposes ways of further simulation model development in order to improve source term predictions. (author) 2 tabs., refs.

  14. Pool scrubbing models for iodine components

    International Nuclear Information System (INIS)

    Fischer, K.

    1996-01-01

    Pool scrubbing is an important mechanism to retain radioactive fission products from being carried into the containment atmosphere or into the secondary piping system. A number of models and computer codes has been developed to predict the retention of aerosols and fission product vapours that are released from the core and injected into water pools of BWR and PWR type reactors during severe accidents. Important codes in this field are BUSCA, SPARC and SUPRA. The present paper summarizes the models for scrubbing of gaseous Iodine components in these codes, discusses the experimental validation, and gives an assessment of the state of knowledge reached and the open questions which persist. The retention of gaseous Iodine components is modelled by the various codes in a very heterogeneous manner. Differences show up in the chemical species considered, the treatment of mass transfer boundary layers on the gaseous and liquid sides, the gas-liquid interface geometry, calculation of equilibrium concentrations and numerical procedures. Especially important is the determination of the pool water pH value. This value is affected by basic aerosols deposited in the water, e.g. Cesium and Rubidium compounds. A consistent model requires a mass balance of these compounds in the pool, thus effectively coupling the pool scrubbing phenomena of aerosols and gaseous Iodine species. Since the water pool conditions are also affected by drainage flow of condensate water from different regions in the containment, and desorption of dissolved gases on the pool surface is determined by the gas concentrations above the pool, some basic limitations of specialized pool scrubbing codes are given. The paper draws conclusions about the necessity of coupling between containment thermal-hydraulics and pool scrubbing models, and proposes ways of further simulation model development in order to improve source term predictions. (author) 2 tabs., refs

  15. Atlantic Warm Pool Trigger for the Younger Dryas Climate Event

    Science.gov (United States)

    Abdul, N. A.; Mortlock, R. A.; Wright, J. D.; Fairbanks, R. G.; Teneva, L. T.

    2011-12-01

    There is growing evidence that variability in the size and heat content of the tropical Atlantic Warm Pool impacts circum-North Atlantic climate via the Atlantic Multi-decadal Oscillation mode (Wang et al., 2008). The Atlantic Warm Pool spans the Gulf of Mexico, Caribbean Sea and the western tropical North Atlantic. Barbados is located near the center of the tropical Atlantic Warm Pool and coupled ocean models suggest that Barbados remains near the center of the tropical Atlantic Warm Pool under varying wind stress simulations. Measurements of the oxygen isotope paleothermometer in Acropora palmata coral species recovered from cores offshore Barbados, show a 3oC monotonic decrease in sea surface temperature from 13106 ± 83 to 12744 ± 61 years before present (errors given as 2 sigma). This interval corresponds to a sea level rise from 71.4 meters to 67.1 meters below present levels at Barbados. The 3oC temperature decrease is captured in eight A. palmata specimens that are in stratigraphic sequence, 230Th/234U dated, and analyzed for oxygen isotopes. All measurements are replicated. We are confident that this is the warm pool equivalent of the Younger Dryas climate event. The initiation of this temperature drop in the Atlantic Warm Pool predates the Younger Dryas start in Greenland ice cores, reported to start at 12896 ± 138 years (relative to AD 2000) (Rasmussen et al., 2006), while few other Younger Dryas climate records are dated with similar accuracy to make the comparison. Rasmussen, S.O., Andersen, K.K., Svensson, A.M., Steffensen, J.P., Vinther, B.M., Clausen, H.B., Siggaard-Andersen, M.L., Johnsen, S.J., Larsen, L.B., Dahl-Jensen, D., Bigler, M., Röthlisberger, R., Fischer, H., Goto-Azuma, K., Hansson, M.E., and Ruth, U., 2006, A new Greenland ice core chronology for the last glacial termination: J. Geophys. Res., v. 111, p. D06102. Wang, C., Lee, S.-K., and Enfield, D.B., 2008, Atlantic Warm Pool acting as a link between Atlantic Multidecadal

  16. Maintenance of an obstruction-forced pool in a gravel-bed channel: streamflow, channel morphology, and sediment transport.

    Science.gov (United States)

    Richard D. Woodsmith; Marwan A. Hassan

    2005-01-01

    Maintenance of pool morphology in a stream channel with a mobile bed requires hydraulic conditions at moderate to high flows that route bed load through the pool as it is delivered from upstream. Through field measurements of discharge, vertical velocity profiles, bed load transport, and streambed scour, fill, and grain-size distribution, we found that maintenance of a...

  17. New set of convective heat transfer coefficients established for pools and validated against CLARA experiments for application to corium pools

    Energy Technology Data Exchange (ETDEWEB)

    Michel, B., E-mail: benedicte.michel@irsn.fr

    2015-05-15

    Highlights: • A new set of 2D convective heat transfer correlations is proposed. • It takes into account different horizontal and lateral superficial velocities. • It is based on previously established correlations. • It is validated against recent CLARA experiments. • It has to be implemented in a 0D MCCI (molten core concrete interaction) code. - Abstract: During an hypothetical Pressurized Water Reactor (PWR) or Boiling Water Reactor (BWR) severe accident with core meltdown and vessel failure, corium would fall directly on the concrete reactor pit basemat if no water is present. The high temperature of the corium pool maintained by the residual power would lead to the erosion of the concrete walls and basemat of this reactor pit. The thermal decomposition of concrete will lead to the release of a significant amount of gases that will modify the corium pool thermal hydraulics. In particular, it will affect heat transfers between the corium pool and the concrete which determine the reactor pit ablation kinetics. A new set of convective heat transfer coefficients in a pool with different lateral and horizontal superficial gas velocities is modeled and validated against the recent CLARA experimental program. 155 tests of this program, in two size configurations and a high range of investigated viscosity, have been used to validate the model. Then, a method to define different lateral and horizontal superficial gas velocities in a 0D code is proposed together with a discussion about the possible viscosity in the reactor case when the pool is semi-solid. This model is going to be implemented in the 0D ASTEC/MEDICIS code in order to determine the impact of the convective heat transfer in the concrete ablation by corium.

  18. Operation and maintenance techniques of pool and pool water purification system in IMEF

    Energy Technology Data Exchange (ETDEWEB)

    Soong, Woong Sup

    1999-03-01

    IMEF pool is used pass way between pool and hot cell in order to inlet and outlet of fuel pin in cask. All operation is performed conforming with naked eyes. Therefore floating matter is filtered so as to easy under water handling. Also radioactivity in pool water is controlled according to the nuclear law, radioactivity ration maintained less than 15mR/hr on pool side. Perfect operation and maintenance can be achieved well trained operator. Result obtained from the perfection can give more influence over restrain, spreading contamination of radioactivity materials. This report describes operation and maintenance technique of pool water purification system in IMEF. (Author). 7 refs., 13 figs.

  19. Operation and maintenance techniques of pool and pool water purification system in IMEF

    International Nuclear Information System (INIS)

    Soong, Woong Sup

    1999-03-01

    IMEF pool is used pass way between pool and hot cell in order to inlet and outlet of fuel pin in cask. All operation is performed conforming with naked eyes. Therefore floating matter is filtered so as to easy under water handling. Also radioactivity in pool water is controlled according to the nuclear law, radioactivity ration maintained less than 15mR/hr on pool side. Perfect operation and maintenance can be achieved well trained operator. Result obtained from the perfection can give more influence over restrain, spreading contamination of radioactivity materials. This report describes operation and maintenance technique of pool water purification system in IMEF. (Author). 7 refs., 13 figs

  20. Swimming pool hydraulics and their significance for public pools. Bedeutung der Beckenhydraulik in oeffentlichen Schwimmbaedern

    Energy Technology Data Exchange (ETDEWEB)

    Gansloser, G

    1989-11-01

    The term of swimming pool hydraulics means the process of letting in and drawing off water to and from the pool while ensuring that no inadmissible water-borne contaminant concentrations will occur anywhere within the pool. Measurements were performed on a pool to study the significance of correct pool hydraulics. The author points out that a wrong water recirculation design will bring to nought the effects of an elaborate water treatment system; by contrast, poor pool water quality can be greatly improved by redesigning the pool water hydraulics approach. In principle, systems with with water inlet at one side and water outlet at the far side will fall short of hygienic requirements. (BWI).

  1. Studies of thermal stratification in water pool

    International Nuclear Information System (INIS)

    Verma, P.K.; Chandraker, D.K.; Nayak, A.K.; Vijayan, P.K.

    2015-01-01

    Large water pools are used as a heat sink for various cooling systems used in industry. In context of advance nuclear reactors like AHWR, it is used as ultimate heat sink for passive systems for decay heat removal and containment cooling. This system incorporates heat exchangers submerged in the large water pool. However, heat transfer by natural convection in pool poses a problem of thermal stratification. Due to thermal stratification hot layers of water accumulate over the relatively cold one. The heat transfer performance of heat exchanger gets deteriorated as a hot fluid envelops it. In the nuclear reactors, the walls of the pool are made of concrete and it may subject to high temperature due to thermal stratification which is not desirable. In this paper, a concept of employing shrouds around the heat source is studied. These shrouds provide a bulk flow in the water pool, thereby facilitating mixing of hot and cold fluid, which eliminate stratification. The concept has been applied to the a scaled model of Gravity Driven Water Pool (GDWP) of AHWR in which Isolation Condensers (IC) tubes are submerged for decay heat removal of AHWR using ICS and thermal stratification phenomenon was predicted with and without shrouds. To demonstrate the adequacy of the effectiveness of shroud arrangement and to validate the simulation methodology of RELAP5/Mod3.2, experiments has been conducted on a scaled model of the pool with and without shroud. (author)

  2. Spent fuel pool cleanup and stabilization

    International Nuclear Information System (INIS)

    Miller, R.L.

    1987-06-01

    Each of the plutonium production reactors at Hanford had a large water-filled spent fuel pool to provide interim storage of irradiated fuel while awaiting shipment to the separation facilities. After cessation of reactor operations the fuel was removed from the pools and the water levels were drawn down to a 5- to 10-foot depth. The pools were maintained with the water to provide shielding and radiological control. What appeared to be a straightforward project to process the water, remove the sediments from the basin, and stabilize the contamination on the floors and walls became a very complex and time consuming operation. The sediment characteristics varied from pool to pool, the ion exchange system required modification, areas of hard-pack sediments were discovered on the floors, special arrangements to handle and package high dose rate items for shipment were required, and contract problems ensued with the subcontractor. The original schedule to complete the project from preliminary engineering to final stabilization of the pools was 15 months. The actual time required was about 25 months. The original cost estimate to perform the work was $2,651,000. The actual cost of the project was $5,120,000, which included $150,000 for payment of claims to the subcontractor. This paper summarizes the experiences associated with the cleanup and radiological stabilization of the 100-B, -C, -D, and -DR spent fuel pools, and discusses a number of lessons learned items

  3. Distributed Technologies in a Data Pool

    Science.gov (United States)

    Keiser, K.; Conover, H.; Graves, S.; He, Y.; Regner, K.; Smith, M.

    2004-12-01

    A Data Pool is an on-line repository providing interactive and programmatic access to data products through a variety of services. The University of Alabama in Huntsville has developed and deployed such a Data Pool in conjunction with the DISCOVER project, a collaboration with NASA and Remote Sensing Systems. DISCOVER provides long-term ocean and climate data from a variety of passive microwave satellite instruments, including such products as sea-surface temperature and wind, air temperature, atmospheric water vapor, cloud water and rain rate. The Data Pool provides multiple methods to access and visualize these products, including conventional HTTP and FTP access, as well as data services that provide for enhanced usability and interoperability, such as GridFTP, OPeNDAP, OpenGIS-compliant web mapping and coverage services, and custom subsetting and packaging services. This paper will focus on the distributed service technologies used in the Data Pool, which spans heterogeneous machines at multiple locations. For example, in order to provide seamless access to data at multiple sites, the Data Pool provides catalog services for all data products at the various data server locations. Under development is an automated metadata generation tool that crawls the online data repositories regularly to dynamically update the Data Pool catalog with information about newly generated data files. For efficient handling of data orders across distributed repositories, the Data Pool also implements distributed data processing services on the file servers where the data resides. Ontologies are planned to support automated service chaining for custom user requests. The UAH Data Pool is based on a configurable technology framework that integrates distributed data services with a web interface and a set of centralized database services for catalogs and order tracking. While this instantiation of the Data Pool was implemented to meet the needs of the DISCOVER project, the framework was

  4. A Pool of Distant Galaxies

    Science.gov (United States)

    2008-11-01

    Anyone who has wondered what it might be like to dive into a pool of millions of distant galaxies of different shapes and colours, will enjoy the latest image released by ESO. Obtained in part with the Very Large Telescope, the image is the deepest ground-based U-band image of the Universe ever obtained. It contains more than 27 million pixels and is the result of 55 hours of observations with the VIMOS instrument. A Sea of Galaxies ESO PR Photo 39/08 A Pool of Distant Galaxies This uniquely beautiful patchwork image, with its myriad of brightly coloured galaxies, shows the Chandra Deep Field South (CDF-S), arguably the most observed and best studied region in the entire sky. The CDF-S is one of the two regions selected as part of the Great Observatories Origins Deep Survey (GOODS), an effort of the worldwide astronomical community that unites the deepest observations from ground- and space-based facilities at all wavelengths from X-ray to radio. Its primary purpose is to provide astronomers with the most sensitive census of the distant Universe to assist in their study of the formation and evolution of galaxies. The new image released by ESO combines data obtained with the VIMOS instrument in the U- and R-bands, as well as data obtained in the B-band with the Wide-Field Imager (WFI) attached to the 2.2 m MPG/ESO telescope at La Silla, in the framework of the GABODS survey. The newly released U-band image - the result of 40 hours of staring at the same region of the sky and just made ready by the GOODS team - is the deepest image ever taken from the ground in this wavelength domain. At these depths, the sky is almost completely covered by galaxies, each one, like our own galaxy, the Milky Way, home of hundreds of billions of stars. Galaxies were detected that are a billion times fainter than the unaided eye can see and over a range of colours not directly observable by the eye. This deep image has been essential to the discovery of a large number of new galaxies

  5. Modal analysis of pool door in water tank

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Kang Soo; Jeong, Kyeong Hoon; Park, Chan Gook; Koo, In Soo [KAERI, Daejeon (Korea, Republic of)

    2012-10-15

    A pool door is installed at the chase of the pool gate by means of an overhead crane in the building of a research reactor. The principal function of the pool door, which is located between the reactor pool and service pool, is to separate the reactor pool from the service pool for the maintenance and/or the removal of the equipment either in the reactor pool or service pool. The pool door consists of stainless steel plates supported by structural steel frames and sealing components. The pool door is equipped with double inflatable gaskets. The configuration of the pool door is shown in Figure 1. The FEM analysis and theoretical calculation by the formula were performed to evaluate the natural frequency for the pool door in the water. The results from the two methods were compared.

  6. The Role of Nuclear Insurance Pools

    International Nuclear Information System (INIS)

    Reitsma, S. M. S.

    2006-01-01

    Since fifty years insurers respond to the need of both governments and the electricity industry to provide financial protection to cover the perils presented by the use of nuclear energy for peaceful purposes. This paper aims at explaining what difficulties had to be solved in order to enable insurers to provide such protection, that as a solution to these difficulties Nuclear Insurance Pools were formed, how such pools operate and what security they provide. Thereby not only a number of universal principles underlying nuclear pool insurance will be explained, but also some differences in the characteristics of such insurance per group of countries. (author)

  7. Laser surveillance systems for fuel storage pools

    International Nuclear Information System (INIS)

    Boeck, H.

    1985-06-01

    A Laser Surveillance System (LASSY) as a new safeguards device has been developed under the IAEA research contract No. 3458/RB at the Atominstitut Wien using earlier results by S. Fiarman. This system is designed to act as a sheet of light covering spent fuel assemblies in spent fuel storage pools. When movement of assemblies takes place, LASSY detects and locates the position of the movement in the pool and when interrogated, presents a list of pool positions and times of movement to the safeguards inspector. A complete prototype system was developed and built. Full scale tests showed the principal working capabilities of a LASSY underwater

  8. 10 CFR 36.63 - Pool water purity.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Pool water purity. 36.63 Section 36.63 Energy NUCLEAR... § 36.63 Pool water purity. (a) Pool water purification system must be run sufficiently to maintain the conductivity of the pool water below 20 microsiemens per centimeter under normal circumstances. If pool water...

  9. Fuzzy pool balance: An algorithm to achieve a two dimensional balance in distribute storage systems

    International Nuclear Information System (INIS)

    Wu, Wenjing; Chen, Gang

    2014-01-01

    The limitation of scheduling modules and the gradual addition of disk pools in distributed storage systems often result in imbalances among their disk pools in terms of both disk usage and file count. This can cause various problems to the storage system such as single point of failure, low system throughput and imbalanced resource utilization and system loads. An algorithm named Fuzzy Pool Balance (FPB) is proposed here to solve this problem. The input of FPB is the current file distribution among disk pools and the output is a file migration plan indicating what files are to be migrated to which pools. FPB uses an array to classify the files by their sizes. The file classification array is dynamically calculated with a defined threshold named T max that defines the allowed pool disk usage deviations. File classification is the basis of file migration. FPB also defines the Immigration Pool (IP) and Emigration Pool (EP) according to the pool disk usage and File Quantity Ratio (FQR) that indicates the percentage of each category of files in each disk pool, so files with higher FQR in an EP will be migrated to IP(s) with a lower FQR of this file category. To verify this algorithm, we implemented FPB on an ATLAS Tier2 dCache production system. The results show that FPB can achieve a very good balance in both free space and file counts, and adjusting the threshold value T max and the correction factor to the average FQR can achieve a tradeoff between free space and file count.

  10. The Nuclear Insurance Pools: Operations and Covers

    International Nuclear Information System (INIS)

    Tetley, M.

    2008-01-01

    Nuclear insurance pools have provided insurance for the nuclear industry for over fifty years and it is fair to say that the development of civil nuclear power would not have been possible without the support of the commercial insurance market. The unknown risks presented by the nascent nuclear power industry in the 1950s required a leap of faith by insurers who developed specialist pooled insurance capacity to ensure adequate capacity to back up the operators' compensation obligations. Since then, nuclear insurance pools have evolved to become comprehensive suppliers of most types of insurance for nuclear plant globally. This paper will outline the structure, development, products and current operations of nuclear insurance pools.(author)

  11. Ingestion of swimming pool water by recreational

    Data.gov (United States)

    U.S. Environmental Protection Agency — Swimming pool water ingestion data. This dataset is associated with the following publication: Dufour, A., L. Wymer, M. Magnuson, T. Behymer, and R. Cantu. Ingestion...

  12. Nuclear Insurance Pools: Worldwide Practice and Development

    International Nuclear Information System (INIS)

    Reitsma, S. M. S.

    1998-01-01

    The development of nuclear installations to produce electricity led to the establishment of Nuclear Insurance Pools and the introduction of international Conventions on Third Party Liability. Nuclear Pools offer both Third Party Liability insurance, reflecting the Conventions' principles, and other insurance products. They are market-wide, providing a facility for participation by insurers who could not otherwise write the insurance for the particularly sensitive nuclear risk. All acceptances are for the net retention of each Member without recourse to individual reinsurance protection. Common account reinsurance is arranged with other Nuclear Pools all over the world. Thus, a transparency is created, which ensures the highest degree of reinsurance security and imposes a known finite limit to each participating insurer's commitment. Therefore, Pool-members are prepared to make a greater commitment to nuclear risks than would be case where they felt uncertain as regards their total exposure following a significant loss. (author)

  13. AE/VCE Unconfirmed Vernal Pools

    Data.gov (United States)

    Vermont Center for Geographic Information — This dataset is derived from a project by the Vermont Center for Ecostudies(VCE) and Arrowwood Environmental(AE) to map vernal pools throughout the state of Vermont....

  14. AE/VCE Confirmed Vernal Pools

    Data.gov (United States)

    Vermont Center for Geographic Information — This dataset is derived from a project by the Vermont Center for Ecostudies(VCE) and Arrowwood Environmental(AE) to map vernal pools throughout the state of Vermont....

  15. Investigations in Marine Chemistry: Tide Pool Ecology.

    Science.gov (United States)

    Schlenker, Richard M.

    Students investigated the salinity of tide pools at different levels in the intertidal zone. Data are analyzed collectively. Students graphed and discussed data. Included are suggestions for evaluation and further study. (Author)

  16. 7 CFR 1126.7 - Pool plant.

    Science.gov (United States)

    2010-01-01

    ... excluded from the supply plant's shipments in computing the plant's shipping percentage. (d) A plant... part, or the plant has automatic pooling status under the other Federal order; and (7) That portion of...

  17. 7 CFR 1001.7 - Pool plant.

    Science.gov (United States)

    2010-01-01

    ... excluded from the supply plant's shipments in computing the percentages in paragraphs (c)(1) and (2) of... plant has automatic pooling status under the other Federal order. [64 FR 47954, Sept. 1, 1999, as...

  18. 7 CFR 1007.7 - Pool plant.

    Science.gov (United States)

    2010-01-01

    ...-upon use other than Class I shall be excluded from the supply plant's shipments in computing the plant... under the order in this part, or such plant has automatic pooling status under such other order. (h) Any...

  19. Microbial quality of a marine tidal pool

    CSIR Research Space (South Africa)

    Genthe, Bettina

    1995-01-01

    Full Text Available In this study the source of microbial pollution to a tidal pool was investigated. Both adjacent seawater which could contribute to possible faecal pollution and potential direct bather pollution were studied. The microbial quality of the marine...

  20. Robotic cleaning of a spent fuel pool

    International Nuclear Information System (INIS)

    Roman, H.T.; Marian, F.A.; Silverman, E.B.; Barkley, V.P.

    1987-01-01

    Spent fuel pools at nuclear power plants are not cleaned routinely, other than by purifying the water that they contain. Yet, debris can collect on the bottom of a pool and should be removed prior to fuel transfer. At Public Service Electric and Gas Company's Hope Creek Nuclear Power Plant, a submersible mobile robot - ARD Corporation's SCAVENGER - was used to clean the bottom of the spent fuel pool prior to initial fuel loading. The robotic device was operated remotely (as opposed to autonomously) with a simple forward/reverse control, and it cleaned 70-80% of the pool bottom. This paper reports that a simple cost-benefit analysis shows that the robotic device would be less expensive, on a per mission basis, than other cleaning alternatives, especially if it were used for other similar cleaning operations throughout the plant

  1. A comprehensive review on pool boiling of nanofluids

    International Nuclear Information System (INIS)

    Ciloglu, Dogan; Bolukbasi, Abdurrahim

    2015-01-01

    Nanofluids are nanoparticle suspensions of small particle size and low concentration dispersed in base fluids such as water, oil and ethylene glycol. These fluids have been considered by researchers as a unique heat transfer carrier because of their thermophysical properties and a great number of potential benefits in traditional thermal engineering applications, including power generation, transportation, air conditioning, electronics devices and cooling systems. Many attempts have been made in the literature on nanofluid boiling; however, data on the boiling heat transfer coefficient (HTC) and the critical heat flux (CHF) have been inconsistent. This paper presents a review of recent researches on the pool boiling heat transfer behaviour of nanofluid. First, the development of nanofluids and their potential applications are briefly given. Then, the effects of various parameters on nanofluids pool boiling are discussed in detail. - Highlights: • A review on the pool boiling heat transfer of nanofluid is presented and discussed. • Nanoparticle deposition considerably affects the boiling heat transfer. • The HTC decreases due to the low contact angle and the high adhesion energy. • The HTC increases due to the formation of the new cavities and liquid suction. • The CHF increases due to the increase in roughness, wettability and capillarity

  2. Numerical investigation of nucleate pool boiling heat transfer

    Directory of Open Access Journals (Sweden)

    Stojanović Andrijana D.

    2016-01-01

    Full Text Available Multidimensional numerical simulation of the atmospheric saturated pool boiling is performed. The applied modelling and numerical methods enable a full representation of the liquid and vapour two-phase mixture behaviour on the heated surface, with included prediction of the swell level and heated wall temperature field. In this way the integral behaviour of nucleate pool boiling is simulated. The micro conditions of bubble generation at the heated wall surface are modelled by the bubble nucleation site density, the liquid wetting contact angle and the bubble grow time. The bubble nucleation sites are randomly located within zones of equal size, where the number of zones equals the nucleation site density. The conjugate heat transfer from the heated wall to the liquid is taken into account in wetted heated wall areas around bubble nucleation sites. The boiling curve relation between the heat flux and the heated wall surface temperature in excess of the saturation temperature is predicted for the pool boiling conditions reported in the literature and a good agreement is achieved with experimentally measured data. The influence of the nucleation site density on the boiling curve characteristic is confirmed. In addition, the influence of the heat flux intensity on the spatial effects of vapour generation and two-phase flow are shown, such as the increase of the swell level position and the reduced wetting of the heated wall surface by the heat flux increase. [Projekat Ministarstva nauke Republike Srbije, br. TR-33018 i br. OI-174014

  3. Pooling strategies for St Petersburg gamblers

    OpenAIRE

    Csörgö, Sandor; Simons, Gordon

    2006-01-01

    Peter offers to play exactly one St Petersburg game with each of [math] players, Paul [math] , [math] , Paul [math] , whose conceivable pooling strategies are described by all possible probability distributions [math] . Comparing infinite expectations, we characterize among all [math] those admissible strategies for which the pooled winnings, each distributed as [math] , yield a finite added value for each and every one of Paul [math] , [math] , Paul [math] in comparison with their individual...

  4. Welding pool measurement using thermal array sensor

    Science.gov (United States)

    Cho, Chia-Hung; Hsieh, Yi-Chen; Chen, Hsin-Yi

    2015-08-01

    Selective laser melting (SLM) is an additive manufacturing (AM) technology that uses a high-power laser beam to melt metal powder in chamber of inert gas. The process starts by slicing the 3D CAD data as a digital information source into layers to create a 2D image of each layer. Melting pool was formed by using laser irradiation on metal powders which then solidified to consolidated structure. In a selective laser melting process, the variation of melt pool affects the yield of a printed three-dimensional product. For three dimensional parts, the border conditions of the conductive heat transport have a very large influence on the melt pool dimensions. Therefore, melting pool is an important behavior that affects the final quality of the 3D object. To meet the temperature and geometry of the melting pool for monitoring in additive manufacturing technology. In this paper, we proposed the temperature sensing system which is composed of infrared photodiode, high speed camera, band-pass filter, dichroic beam splitter and focus lens. Since the infrared photodiode and high speed camera look at the process through the 2D galvanometer scanner and f-theta lens, the temperature sensing system can be used to observe the melting pool at any time, regardless of the movement of the laser spot. In order to obtain a wide temperature detecting range, 500 °C to 2500 °C, the radiation from the melting pool to be measured is filtered into a plurality of radiation portions, and since the intensity ratio distribution of the radiation portions is calculated by using black-body radiation. The experimental result shows that the system is suitable for melting pool to measure temperature.

  5. Numerical modelling of methanol liquid pool fires

    Science.gov (United States)

    Prasad, Kuldeep; Li, Chiping; Kailasanath, K.; Ndubizu, Chuka; Ananth, Ramagopal; Tatem, P. A.

    1999-12-01

    The focus of this paper is on numerical modelling of methanol liquid pool fires. A mathematical model is first developed to describe the evaporation and burning of a two-dimensional or axisymmetric pool containing pure liquid methanol. Then, the complete set of unsteady, compressible Navier-Stokes equations for reactive flows are solved in the gas phase to describe the convection of the fuel gases away from the pool surface, diffusion of the gases into the surrounding air and the oxidation of the fuel into product species. Heat transfer into the liquid pool and the metal container through conduction, convection and radiation are modelled by solving a modified form of the energy equation. Clausius-Clapeyron relationships are invoked to model the evaporation rate of a two-dimensional pool of pure liquid methanol. The governing equations along with appropriate boundary and interface conditions are solved using the flux-corrected transport algorithm. Numerical results exhibit a flame structure that compares well with experimental observations. Temperature profiles and burning rates were found to compare favourably with experimental data from single- and three-compartment laboratory burners. The model predicts a puffing frequency of approximately 12 Hz for a 1 cm diameter methanol pool in the absence of any air co-flow. It is also observed that increasing the air co-flow velocity helps in stabilizing the diffusion flame, by pushing the vortical structures away from the flame region.

  6. Recent advances in probabilistic species pool delineations

    Directory of Open Access Journals (Sweden)

    Dirk Nikolaus Karger

    2016-07-01

    Full Text Available A species pool is the set of species that could potentially colonize and establish within a community. It has been a commonly used concept in biogeography since the early days of MacArthur and Wilson’s work on Island Biogeography. Despite their simple and appealing definition, an operational application of species pools is bundled with a multitude of problems, which have often resulted in arbitrary decisions and workarounds when defining species pools. Two recently published papers address the operational problems of species pool delineations, and show ways of delineating them in a probabilistic fashion. In both papers, species pools were delineated using a process-based, mechanistical approach, which opens the door for a multitude of new applications in biogeography. Such applications include detecting the hidden signature of biotic interactions, disentangling the geographical structure of community assembly processes, and incorporating a temporal extent into species pools. Although similar in their conclusions, both ‘probabilistic approaches’ differ in their implementation and definitions. Here I give a brief overview of the differences and similarities of both approaches, and identify the challenges and advantages in their application.

  7. Longevity of Wood-Forced Pools in an Old-Growth Forest

    Science.gov (United States)

    Buffington, J. M.; Woodsmith, R. D.; Johnson, A. C.

    2009-12-01

    Wood debris plays an important role in scouring pools in forest channels and providing resultant habitat for aquatic organisms. We investigated the longevity of such pools in a gravel-bed river flowing through old-growth forest in southeastern Alaska by aging trees and “bear’s bread” fungi (Ganoderma applanatum, Fomitopsis pinicola) growing on pool-forming wood debris. Ages were determined by counting annual growth rings from cores and cross sections of trees and fungi growing on the wood debris. These ages are minimum values because they do not account for lag time between debris recruitment and seedling/spore establishment on the debris, nor do they account for flood scour that may periodically reset tree and fungi growth on the debris. The study stream has a gradient of about 1%, bankfull width and depth of 13.3 and 0.78 m, respectively, median grain size of 18 mm, a high wood loading (0.8 pieces/m), and a correspondingly low pool spacing (0.3 bankfull widths/pool), with 81% of the pools forced by wood debris. The size of wood debris in the study stream is large relative to the channel (average log length of 7.6 m and diameter of 0.35 m), rendering most debris immobile. Eighty-one pool-forming pieces of wood were dated over 1.2 km of stream length, with 28% of these pieces causing scour of more than one pool. In all, 122 wood-forced pools were dated, accounting for 38% of all pools at the site and 47% of the wood-forced pools. Fifty-three percent of the wood-forced pools lacked datable wood because these pieces either: were newly recruited; had been scoured by floods; or were contained below the active channel elevation, prohibiting vegetation establishment on the wood debris (the most common cause). The debris age distribution declined exponentially from 2 to 113 yrs., with a median value of 18 yrs. Similar exponential residence time distributions have been reported in other studies, but our analysis focused specifically on the ages of pool-forming wood

  8. Saturated Pool Boiling in Vertical Annulus with Reduced Outflow Area

    International Nuclear Information System (INIS)

    Kang, Myeong Gie

    2012-01-01

    The mechanisms of pool boiling heat transfer have been studied extensively to design efficient heat transfer devices or to assure the integrity of safety related systems. However, knowledge on pool boiling heat transfer in a confined space is still quite limited. The confined nucleate boiling is an effective technique to enhance heat transfer. Improved heat transfer might be attributed to an increase in the heat transfer coefficient due to vaporization from the thin liquid film on the heating surface or increased bubble activity. According to Cornwell and Houston, the bubbles sliding on the heated surface agitate environmental liquid. In a confined space a kind of pulsating flow due to the bubbles is created and, as a result very active liquid agitation is generated. The increase in the intensity of liquid agitation results in heat transfer enhancement. Sometimes a deterioration of heat transfer appears at high heat fluxes for confined boiling. The cause of the deterioration is suggested as active bubble coalescence. Recently, Kang published inflow effects on pool boiling heat transfer in a vertical annulus with closed bottoms. Kang regulated the gap size at the upper regions of the annulus and identified that effects of the reduced gaps on heat transfer become evident as the heat flux increases. This kind of geometry is found in an in-pile test section. Since more detailed analysis is necessary, effects of the outflow area on nucleate pool boiling heat transfer are investigated in this study. Up to the author's knowledge, no previous results concerning to this effect have been published yet

  9. Aerosol Scrubbing Performance Test for Self-Priming Scrubbing Nozzle Submerged in Water Pool

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Doo Yong; Jung, Woo Young; Lee, Hyun Chul; Lee, Jong Chan; Kim, Gyu Tae; Song, Yong Jae [FNC Technology Co., Yongin (Korea, Republic of)

    2016-10-15

    A scrubbing nozzle is one of the key components for a wet scrubber process based Containment Filtered Venting System (CFVS). As a part of a development of Korean CFVS, a self-priming scrubbing nozzle shown in Fig. 1 has been developed based on the well-known venturi scrubber concept. The thermal-hydraulic performances such as the pressure drop across the nozzle, water suction behavior and droplet generation inside throat have been tested in the non-submerged condition as well as submerged condition. The self-priming scrubbing nozzle used for the wet scrubber based CFVS has been developed, which is submerged in the water pool. When there is gas flow at the inlet of the nozzle, the pool water is passively sucked from the water suction slit. The fine droplets generated inside the throat capture the aerosol particles and is discharged into the water pool. In the water pool, the pool scrubbing happens. The aerosol scrubbing performance tests for the developed self-priming scrubbing nozzle has been conducted under the operational conditions such as different aerosol sizes, different carrier gas steam fractions, different, different pool water level and nozzle inlet pressure. The major findings are as follows. (1) Aerosol scrubbing efficiency increases with the increase of the aerosol size. (2) Aerosol scrubbing efficiency increases with the increase of the carrier gas steam fraction. (3) Aerosol scrubbing.

  10. Aerosol Scrubbing Performance Test for Self-Priming Scrubbing Nozzle Submerged in Water Pool

    International Nuclear Information System (INIS)

    Lee, Doo Yong; Jung, Woo Young; Lee, Hyun Chul; Lee, Jong Chan; Kim, Gyu Tae; Song, Yong Jae

    2016-01-01

    A scrubbing nozzle is one of the key components for a wet scrubber process based Containment Filtered Venting System (CFVS). As a part of a development of Korean CFVS, a self-priming scrubbing nozzle shown in Fig. 1 has been developed based on the well-known venturi scrubber concept. The thermal-hydraulic performances such as the pressure drop across the nozzle, water suction behavior and droplet generation inside throat have been tested in the non-submerged condition as well as submerged condition. The self-priming scrubbing nozzle used for the wet scrubber based CFVS has been developed, which is submerged in the water pool. When there is gas flow at the inlet of the nozzle, the pool water is passively sucked from the water suction slit. The fine droplets generated inside the throat capture the aerosol particles and is discharged into the water pool. In the water pool, the pool scrubbing happens. The aerosol scrubbing performance tests for the developed self-priming scrubbing nozzle has been conducted under the operational conditions such as different aerosol sizes, different carrier gas steam fractions, different, different pool water level and nozzle inlet pressure. The major findings are as follows. (1) Aerosol scrubbing efficiency increases with the increase of the aerosol size. (2) Aerosol scrubbing efficiency increases with the increase of the carrier gas steam fraction. (3) Aerosol scrubbing

  11. Finding Biomarker Signatures in Pooled Sample Designs: A Simulation Framework for Methodological Comparisons

    Directory of Open Access Journals (Sweden)

    Anna Telaar

    2010-01-01

    Full Text Available Detection of discriminating patterns in gene expression data can be accomplished by using various methods of statistical learning. It has been proposed that sample pooling in this context would have negative effects; however, pooling cannot always be avoided. We propose a simulation framework to explicitly investigate the parameters of patterns, experimental design, noise, and choice of method in order to find out which effects on classification performance are to be expected. We use a two-group classification task and simulated gene expression data with independent differentially expressed genes as well as bivariate linear patterns and the combination of both. Our results show a clear increase of prediction error with pool size. For pooled training sets powered partial least squares discriminant analysis outperforms discriminance analysis, random forests, and support vector machines with linear or radial kernel for two of three simulated scenarios. The proposed simulation approach can be implemented to systematically investigate a number of additional scenarios of practical interest.

  12. Measurement of argon concentrations in a TRIGA Mark-III pool

    Energy Technology Data Exchange (ETDEWEB)

    Simms, R [California State University, Northridge, CA (United States)

    1974-07-01

    Argon-41, the principal radioactive effluent from a pool type reactor during normal operation, is produced by the {sup 40}A (n,{gamma}) reaction. The reactant, {sup 40}A, is introduced into the pool water by contact with the air. Reduction in radioactive argon release can be accomplished by reducing the concentration of dissolved {sup 40}A and retaining the {sup 41}A within the pool. However, little data were available concerning the mechanisms of argon introduction, production, retention, and release from a reactor pool. Experiments have therefore been performed at the Torrey Pines TRIGA Mark-III Reactor to develop techniques to sample dissolved argon and to provide data on argon concentrations in the pool for release modeling studies. Significant results for argon dissolved at different pool depths can only be obtained if the water samples are sealed at the point of collection. A special handling tool was developed to perform this remote operation. Pool samples were counted for {sup 41}A soon after collection with a NaI spectrometer. After allowing one day for decay of {sup 41}A, the concentration of {sup 40}A in the water sample was determined by neutron activation analysis. In each case, the 1.29 MeV gamma-ray peak of {sup 41}A was used. Interference from the 1.37 MeV {sup 24}Na peak was considered and its effect subtracted after determining {sup 24}Na content from the 2.75 MeV {sup 24}Na peak and a sodium standard. A Ge(Li) detector was tried and found to eliminate the problem, but it introduced an unacceptable geometrical effect dependent on bubble size within the sample bottles. Samples were taken from the 27 ft deep TRIGA pool at various locations. Results were obtained for samples taken on several different days along the same vertical line about 3-1/2 ft from the reactor centerline. Temperature measurements along this vertical traverse indicated a sharp temperature gradient at about 15 ft below the surface ({approx}6 ft above the top of the reactor). The

  13. Self-formed waterfall plunge pools in homogeneous rock

    Science.gov (United States)

    Scheingross, Joel S.; Lo, Daniel Y.; Lamb, Michael P.

    2017-01-01

    Waterfalls are ubiquitous, and their upstream propagation can set the pace of landscape evolution, yet no experimental studies have examined waterfall plunge pool erosion in homogeneous rock. We performed laboratory experiments, using synthetic foam as a bedrock simulant, to produce self-formed waterfall plunge pools via particle impact abrasion. Plunge pool vertical incision exceeded lateral erosion by approximately tenfold until pools deepened to the point that the supplied sediment could not be evacuated and deposition armored the pool bedrock floor. Lateral erosion of plunge pool sidewalls continued after sediment deposition, but primarily at the downstream pool wall, which might lead to undermining of the plunge pool lip, sediment evacuation, and continued vertical pool floor incision in natural streams. Undercutting of the upstream pool wall was absent, and our results suggest that vertical drilling of successive plunge pools is a more efficient waterfall retreat mechanism than the classic model of headwall undercutting and collapse in homogeneous rock.

  14. Structure of pool in reactor building

    International Nuclear Information System (INIS)

    Yokoyama, Shigeki.

    1997-01-01

    Shielding walls made of iron-reinforced concrete having a metal liner including two body walls rigidly combined to the upper surface of a reactor container are disposed at least to one of an equipment pool or spent fuel storage pool in a reactor building. A rack for temporarily placing an upper lattice plate is detachably attached at least above one of a steam dryer or a gas/liquid separator temporarily placed in the temporary pool, and the height from the bottom portion to the upper end of the shielding wall is determined based on the height of an upper lattice plate temporary placed on the rack and the water depth required for shielding radiation from the upper lattice plate. An operator's exposure on the operation floor can be reduced by the shielding wall, and radiation dose from the spent fuels is reduced. The increase of the height of a pool guarder enhances bending resistance as a ceiling. In addition, the total height of them is made identical with the depth of the spent fuel storage pool thereby enabling to increase storage area for spent fuels. (N.H.)

  15. Cooling device for reactor suppression pool

    International Nuclear Information System (INIS)

    Togasaki, Susumu; Kato, Kiyoshi.

    1994-01-01

    In a cooling device of a reactor suppression pool, when a temperature of pool water is abnormally increased and a heat absorbing portion is heated by, for example, occurrence of an accident, coolants are sent to the outside of the reactor container to actuates a thermally operating portion by the heat energy of coolants and drive heat exchanging fluids of a secondary cooling system. If the heat exchanging fluids are sent to a cooling portion, the coolants are cooled and returned to the heat absorbing portion of the suppression pool water. If the heat absorbing portion is heat pipes, the coolants are evaporated by heat absorbed from the suppression pool water, steams are sent to the thermally operating portion, then coolants are liquefied and caused to return to the heat absorbing portion. If the thermal operation portion is a gas turbine, the gas turbine is operated by the coolants, and it is converted to a rotational force to drive heat exchanging fluids by pumps. By constituting the cooling portion with a condensator, the coolants are condensed and liquefied and returned to the heat absorbing portion of the suppression pool water. (N.H.)

  16. Condensation in a two-phase pool

    International Nuclear Information System (INIS)

    Duffey, R.B.; Hughes, E.D.

    1991-01-01

    We consider the case of vapor condensation in a liquid pool, when the heat transfer is controlled by heat losses through the walls. The analysis is based on drift flux theory for phase separation in the pool, and determines the two-phase mixture height for the pool. To our knowledge this is the first analytical treatment of this classic problem that gives an explicit result, previous work having established the result for the evaporative case. From conservation of mass and energy in a one-dimensional steady flow, together with a void relation between the liquid and vapor fluxes, we determine the increase in the mixture level from the base level of the pool. It can be seen that the thermal and hydrodynamic influences are separable. Thus, the thermal influence of the wall heat transfer appears through its effect on the condensing length L*, so that at high condensation rates the pool is all liquid, and at low rates overflows (the level swell or foaming effect). Similarly, the phase separation effect hydrodynamically determines the height via the relative velocity of the mixture to the entering flux. We examine some practical applications of this result to level swell in condensing flows, and also examine some limits in ideal cases

  17. Predicting the emissive power of hydrocarbon pool fires

    International Nuclear Information System (INIS)

    Munoz, Miguel; Planas, Eulalia; Ferrero, Fabio; Casal, Joaquim

    2007-01-01

    The emissive power (E) of a flame depends on the size of the fire and the type of fuel. In fact, it changes significantly over the flame surface: the zones of luminous flame have high emittance, while those covered by smoke have low E values. The emissive power of each zone (that is, the luminous or clear flame and the non-luminous or smoky flame) and the portion of total flame area they occupy must be assessed when a two-zone model is used. In this study, data obtained from an experimental set-up were used to estimate the emissive power of fires and its behaviour as a function of pool size. The experiments were performed using gasoline and diesel oil as fuel. Five concentric circular pools (1.5, 3, 4, 5 and 6 m in diameter) were used. Appropriate instruments were employed to determine the main features of the fires. By superimposing IR and VHS images it was possible to accurately identify the luminous and non-luminous zones of the fire. Mathematical expressions were obtained that give a more accurate prediction of E lum , E soot and the average emissive power of a fire as a function of its luminous and smoky zones. These expressions can be used in a two-zone model to obtain a better prediction of the thermal radiation. The value of the radiative fraction was determined from the thermal flux measured with radiometers. An expression is also proposed for estimating the radiative fraction

  18. Visualization of nucleate pool boiling of freon 113

    International Nuclear Information System (INIS)

    Afify, M.A.; Fruman, D.H.

    1987-01-01

    The purpose of this investigation is to give a fine description of the behaviour of vapour bubbles in nucleate pool boiling at sites of known sizes using high speed photography. The shapes and growth history of isolated bubbles were determined for a variety of experimental conditions. Coalescence effects between two adjacent or consecutive bubbles were also visualized and the occurrence of vapour patches and continuous vapour columns was demonstrated. Quantitative analysis of the films allows to determine the history and nucleation characteristics of bubbles as a function of various parameters such as heat flux, liquid subcooling and size and nature of nucleation sites. These results are in good agreement with those found in the literature

  19. 13 CFR 120.1706 - Pool Originator's retained interest in Pool.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Pool Originator's retained interest in Pool. 120.1706 Section 120.1706 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Establishment of SBA Secondary Market Guarantee Program for First Lien Position 504 Loan...

  20. Strategies for chemically healthy public swimming pools

    DEFF Research Database (Denmark)

    Hansen, Kamilla Marie Speht

    spreading of pathogens between swimmers because of its residual disinfection effect. In addition to potential contamination of pathogenic microorganisms, swimming pool water is polluted by organic matter deposited from the bathers such as saliva, urine, sweat, hair and personal care products. Since chlorine...... is a strong oxidant it oxidizes the organic matter in the pool water and forms disinfection byproducts (DBPs). More than 100 different DBPs have been identified. Some of these have been found to be genotoxic and may pose an increased cancer risk for the bathers. The aim of this thesis was to give an overview...... of the strategies which can be used to achieve microbiological safe water with low levels of DBPs to ensure healthy environment for bathers. There are different approaches to achieve healthy environment in public swimming pools which in this thesis are divided into three strategies: alternatives to chlorination...

  1. Numerical Study of Condensation Heat Exchanger Design in a Subcooled Pool: Correlation Investigation

    International Nuclear Information System (INIS)

    Lee, Hee Joon; Ju, Yun Jae; Kang, Han Ok; Lee, Tae Ho; Park, Cheon Tae

    2012-01-01

    Generally the condensation heat exchanger has higher heat transfer coefficient compared to the single phase heat exchanger, so has been widely applied to the cooling systems of energy plant. Recently vertical or horizontal type condensation heat exchangers are being studied for the application to secondary passive cooling system of nuclear plants. Lee and Lee investigated the existing condensation correlation to the experiment for heat exchanger in saturated pool. They concluded Traviss' correlation showed most satisfactory results for the heat transfer coefficient and mass flow rate in a saturated water pool. In this study, a thermal sizing program of vertical condensation heat exchanger to design, TSCON(Thermal Sizing of CONdenser) was validated with the existing experimental data of condensation heat exchanger in a subcooled pool for pure steam condensation

  2. Titanium distribution in swimming pool water is dominated by dissolved species.

    Science.gov (United States)

    David Holbrook, R; Motabar, Donna; Quiñones, Oscar; Stanford, Benjamin; Vanderford, Brett; Moss, Donna

    2013-10-01

    The increased use of titanium dioxide nanoparticles (nano-TiO2) in consumer products such as sunscreen has raised concerns about their possible risk to human and environmental health. In this work, we report the occurrence, size fractionation and behavior of titanium (Ti) in a children's swimming pool. Size-fractionated samples were analyzed for Ti using ICP-MS. Total titanium concentrations ([Ti]) in the pool water ranged between 21 μg/L and 60 μg/L and increased throughout the 101-day sampling period while [Ti] in tap water remained relatively constant. The majority of [Ti] was found in the dissolved phase (microparticulate. Simple models suggest that evaporation may account for the observed variation in [Ti], while sunscreen may be a relevant source of particulate and microparticule Ti. Compared to diet, incidental ingestion of nano-Ti from swimming pool water is minimal. Published by Elsevier Ltd.

  3. Zooplankton at deep Red Sea brine pools

    KAUST Repository

    Kaartvedt, Stein

    2016-03-02

    The deep-sea anoxic brines of the Red Sea comprise unique, complex and extreme habitats. These environments are too harsh for metazoans, while the brine–seawater interface harbors dense microbial populations. We investigated the adjacent pelagic fauna at two brine pools using net tows, video records from a remotely operated vehicle and submerged echosounders. Waters just above the brine pool of Atlantis II Deep (2000 m depth) appeared depleted of macrofauna. In contrast, the fauna appeared to be enriched at the Kebrit Deep brine–seawater interface (1466 m).

  4. One component, volume heated, boiling pool thermohydraulics

    International Nuclear Information System (INIS)

    Bede, M.; Perret, C.; Pretrel, H.; Seiler, J.M.

    1993-01-01

    Prior work on boiling pools provided heat exchange correlations valid for bubbly flow with laminar or turbulent boundary layers. New experiments performed with water (SEBULON) and UO 2 (SCARABEE BF2) in a churn-turbulent flow configuration show unexpected heat flux distributions for which the maximum heat flux may be situated well below the pool surface. The origin of this behaviour is attributed to condensation effects, very unstable boundary layer flow and surface oscillation. A calculation model is discussed which permits to approach the experimental heat flux distribution with reasonable accuracy. (authors). 7 figs., 2 appendix., 14 refs

  5. Numerical modeling of sodium fire – Part II: Pool combustion and combined spray and pool combustion

    International Nuclear Information System (INIS)

    Sathiah, Pratap; Roelofs, Ferry

    2014-01-01

    Highlights: • A CFD based method is proposed for the simulation of sodium pool combustion. • A sodium evaporation based model is proposed to model sodium pool evaporation. • The proposed method is validated against sodium pool experiments of Newman and Payne. • The results obtained using the proposed method are in good agreement with the experiments. - Abstract: The risk of sodium-air reaction has received considerable attention after the sodium-fire accident in Monju reactor. The fires resulting from the sodium-air reaction can be detrimental to the safety of a sodium fast reactor. Therefore, predicting the consequences of a sodium fire is important from a safety point of view. A computational method based on CFD is proposed here to simulate sodium pool fire and understand its characteristics. The method solves the Favre-averaged Navier-Stokes equation and uses a non-premixed mixture fraction based combustion model. The mass transfer of sodium vapor from the pool surface to the flame is obtained using a sodium evaporation model. The proposed method is then validated against well-known sodium pool experiments of Newman and Payne. The flame temperature and location predicted by the model are in good agreement with experiments. Furthermore, the trends of the mean burning rate with initial pool temperature and oxygen concentration are captured well. Additionally, parametric studies have been performed to understand the effects of pool diameter and initial air temperature on the mean burning rate. Furthermore, the sodium spray and sodium pool combustion models are combined to simulate simultaneous spray and pool combustion. Simulations were performed to demonstrate that the combined code could be applied to simulate this. Once sufficiently validated, the present code can be used for safety evaluation of a sodium fast reactor

  6. Numerical modeling of sodium fire – Part II: Pool combustion and combined spray and pool combustion

    Energy Technology Data Exchange (ETDEWEB)

    Sathiah, Pratap, E-mail: pratap.sathiah78@gmail.com [Shell Global Solutions Ltd., Brabazon House, Concord Business Park, Threapwood Road, Manchester M220RR (United Kingdom); Roelofs, Ferry, E-mail: roelofs@nrg.eu [Nuclear Research and Consultancy Group (NRG), Westerduinweg 3, 1755ZG Petten (Netherlands)

    2014-10-15

    Highlights: • A CFD based method is proposed for the simulation of sodium pool combustion. • A sodium evaporation based model is proposed to model sodium pool evaporation. • The proposed method is validated against sodium pool experiments of Newman and Payne. • The results obtained using the proposed method are in good agreement with the experiments. - Abstract: The risk of sodium-air reaction has received considerable attention after the sodium-fire accident in Monju reactor. The fires resulting from the sodium-air reaction can be detrimental to the safety of a sodium fast reactor. Therefore, predicting the consequences of a sodium fire is important from a safety point of view. A computational method based on CFD is proposed here to simulate sodium pool fire and understand its characteristics. The method solves the Favre-averaged Navier-Stokes equation and uses a non-premixed mixture fraction based combustion model. The mass transfer of sodium vapor from the pool surface to the flame is obtained using a sodium evaporation model. The proposed method is then validated against well-known sodium pool experiments of Newman and Payne. The flame temperature and location predicted by the model are in good agreement with experiments. Furthermore, the trends of the mean burning rate with initial pool temperature and oxygen concentration are captured well. Additionally, parametric studies have been performed to understand the effects of pool diameter and initial air temperature on the mean burning rate. Furthermore, the sodium spray and sodium pool combustion models are combined to simulate simultaneous spray and pool combustion. Simulations were performed to demonstrate that the combined code could be applied to simulate this. Once sufficiently validated, the present code can be used for safety evaluation of a sodium fast reactor.

  7. 13 CFR 120.1705 - Pool formation requirements.

    Science.gov (United States)

    2010-01-01

    ... requirements. SBA may adjust the Pool characteristics periodically based on program experience and market... a Pool involving a Pool Loan it does not own, it must purchase the Loan Interest it proposes to pool... purchase the Loan Interest and take it into inventory or settle the purchase of the Loan Interest through...

  8. Delineating probabilistic species pools in ecology and biogeography

    OpenAIRE

    Karger, Dirk Nikolaus; Cord, Anna F; Kessler, Michael; Kreft, Holger; Kühn, Ingolf; Pompe, Sven; Sandel, Brody; Sarmento Cabral, Juliano; Smith, Adam B; Svenning, Jens-Christian; Tuomisto, Hanna; Weigelt, Patrick; Wesche, Karsten

    2016-01-01

    Aim To provide a mechanistic and probabilistic framework for defining the species pool based on species-specific probabilities of dispersal, environmental suitability and biotic interactions within a specific temporal extent, and to show how probabilistic species pools can help disentangle the geographical structure of different community assembly processes. Innovation Probabilistic species pools provide an improved species pool definition based on probabilities in conjuncti...

  9. A strategy for optimizing item-pool management

    NARCIS (Netherlands)

    Ariel, A.; van der Linden, Willem J.; Veldkamp, Bernard P.

    2006-01-01

    Item-pool management requires a balancing act between the input of new items into the pool and the output of tests assembled from it. A strategy for optimizing item-pool management is presented that is based on the idea of a periodic update of an optimal blueprint for the item pool to tune item

  10. Portion size

    Science.gov (United States)

    ... of cards One 3-ounce (84 grams) serving of fish is a checkbook One-half cup (40 grams) ... for the smallest size. By eating a small hamburger instead of a large, you will save about 150 calories. ...

  11. Factors driving semi-aquatic predator occurrence in traditional cattle drinking pools: conservation issues

    Directory of Open Access Journals (Sweden)

    Raoul Manenti

    2016-08-01

    Full Text Available In several cases, human impact on water bodies and on their freshwater communities is detrimental, but in some cases the human activity may favour and enhance the biodiversity of small water bodies, as traditional cattle drinking pools. Despite their small size, small water bodies may constitute hot spot of biodiversity often representing the only lentic aquatic biotope in landscapes where superficial water lacks or flows in lotic environments like creeks and streams. Predators are good indicators of biodiversity in ponds and give information of food chain web complexity. In particular, semi-aquatic predators like amphibians and dragonflies may account for a substantial percentage of energy flow between aquatic and terrestrial ecosystems. In this study, we evaluated the conservation value of traditional cattle drinking pools building by assessing the factors determining the occurrence and distribution of the semi-aquatic predators. From April to August 2015, we investigated 30 distinct pools recording several abiotic and biotic environmental variables. We detected 4 semi-aquatic predators: Salamandra salamandra larvae, Triturus carnifex, Aeshna sp. larvae and Libellula sp. larvae. Abiotic features played a major role in shaping the predator community that resulted linked to stable, with no dryness period, and large drinking pools. Invertebrate prey biomass was not particularly important, while vegetation cover and occurrence of unpalatable tadpoles were the most important biotic features of the pools. Our study provides novel evidence on the importance of cattle drinking pools management to preserve biodiversity especially in areas where traditional pastoral activity is disappearing.

  12. Mercury concentrations and pools in four adjacent coniferous and deciduous upland forests in Beijing, China

    Science.gov (United States)

    Zhou, Jun; Wang, Zhangwei; Zhang, Xiaoshan; Gao, Yu

    2017-05-01

    Understanding of forest mercury (Hg) pools is important for quantifying the global atmospheric Hg removal. We studied gaseous elemental Hg (GEM) concentrations, litterfall Hg depositions, and pool sizes in four adjacent stands at Mount Dongling to assess Hg dynamics in the forested catchment and the potential of Hg release during wildfires. The average GEM concentration was 2.5 ± 0.5 ng m-3, about 1.5 times of the background levels in the Northern Hemisphere. In all four stands, Hg concentrations increase in the following order: bole wood mineral soil litter < Oe soil < Oa organic soil. The Hg pools of aboveground biomass were comparable in the forests of larch, oak, and Chinese pine, which were much greater than that of mixed broadleaf stands due to lower biomass. The total Hg pools in ecosystems were similar in the four stands, because of the comparable Hg pool in the soil horizons (0-40 cm), which accounted for over 97% of the total ecosystem Hg storage in the four stands. Although Hg pools of the forest ecosystem in north China were comparable to North America and North Europe, Hg storage in forests constituted a high threat for large Hg emission pulses to the atmosphere by wildfires. The potential Hg emissions from the combustion at the four stands were ranged from 0.675 to 1.696 mg m-2.

  13. Public Swimming Pools | Florida Department of Health

    Science.gov (United States)

    Illness Disease Reporting and Surveillance Bureau of Public Health Laboratories Environmental Health Air Air Monitoring Carbon Monoxide Indoor Air Quality Mold Radon Water Aquatic Toxins Beach Water Quality purification, testing, treatment, and disinfection procedures. To ensure that the pool technicians are

  14. 28 CFR 540.64 - Press pools.

    Science.gov (United States)

    2010-07-01

    ... Judicial Administration BUREAU OF PRISONS, DEPARTMENT OF JUSTICE INSTITUTIONAL MANAGEMENT CONTACT WITH PERSONS IN THE COMMUNITY Contact With News Media § 540.64 Press pools. (a) The Warden may establish a... shall notify all news media representatives who have requested interviews or visits that have not been...

  15. Stein's neuronal model with pooled renewal input

    Czech Academy of Sciences Publication Activity Database

    Rajdl, K.; Lánský, Petr

    2015-01-01

    Roč. 109, č. 3 (2015), s. 389-399 ISSN 0340-1200 Institutional support: RVO:67985823 Keywords : Stein’s model * Poisson process * pooled renewal processes * first-passage time Subject RIV: BA - General Mathematics Impact factor: 1.611, year: 2015

  16. Phase analysis in gated blood pool tomography

    International Nuclear Information System (INIS)

    Nakajima, Kenichi; Bunko, Hisashi; Tada, Akira; Taki, Junichi; Nanbu, Ichiro

    1984-01-01

    Phase analysis of gated blood pool study has been applied to detect the site of accessory conduction pathway (ACP) in the Wolff-Parkinson-White (WPW) syndrome; however, there was a limitation to detect the precise location of ACP by phase analysis alone. In this study, we applied phase analysis to gated blood pool tomography using seven pin hole tomography (7PT) and gated emission computed tomography (GECT) in 21 patients with WPW syndrome and 3 normal subjects. In 17 patients, the sites of ACPs were confirmed by epicardial mapping and the result of the surgical division of ACP. In 7PT, the site of ACP grossly agreed to the abnormal initial phase in phase image in 5 out of 6 patients with left cardiac type. In GECT, phase images were generated in short axial, vertical and horizontal long axial sections. In 8 out of 9 patients, the site of ACP was correctly identified by phase images, and in a patient who had two ACPs, initial phase corresponded to one of the two locations. Phase analysis of gated blood pool tomography has advantages for avoiding overlap of blood pools and for estimating three-dimensional propagation of the contraction, and can be a good adjunctive method in patients with WPW syndrome. (author)

  17. Swimming-pool piles; Piles piscines

    Energy Technology Data Exchange (ETDEWEB)

    Trioulaire, M [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires

    1959-07-01

    In France two swimming-pool piles, Melusine and Triton, have just been set in operation. The swimming-pool pile is the ideal research tool for neutron fluxes of the order of 10{sup 13}. This type of pile can be of immediate interest to many research centres, but its cost must be reduced and a break with tradition should be observed in its design. It would be an advantage: - to bury the swimming-pool; - to reject the experimental channel; - to concentrate the cooling circuit in the swimming-pool; - to carry out all manipulations in the water; - to double the core. (author) [French] En France, deux piles piscines, Melusine et Triton, viennent d'entrer en service. La pile piscine est l'outil de recherche ideal pour des flux de neutrons de l'ordre de 10{sup 13}. Ce type de pile peut interesser des maintenant de nombreux centres de recherches mais il faut reduire son prix de revient et rompre avec le conformisme de sa conception. Il y a avantage: - a enterrer la piscine; - a supprimer les canaux experimentaux; - a concentrer le circuit de refrigeration dans la piscine; - a effectuer toutes les manipulations dans l'eau; - a doubler le coeur. (auteur)

  18. Spectrum pooling in MnWave Networks

    DEFF Research Database (Denmark)

    Boccardi, Federico; Shokri-Ghadikolaei, Hossein; Fodor, Gabor

    2016-01-01

    Motivated by the specific characteristics of mmWave technologies, we discuss the possibility of an authorization regime that allows spectrum sharing between multiple operators, also referred to as spectrum pooling. In particular, considering user rate as the performance measure, we assess...

  19. Pooling Objects for Recognizing Scenes without Examples

    NARCIS (Netherlands)

    Kordumova, S.; Mensink, T.; Snoek, C.G.M.

    2016-01-01

    In this paper we aim to recognize scenes in images without using any scene images as training data. Different from attribute based approaches, we do not carefully select the training classes to match the unseen scene classes. Instead, we propose a pooling over ten thousand of off-the-shelf object

  20. The new pooled cohort equations risk calculator

    DEFF Research Database (Denmark)

    Preiss, David; Kristensen, Søren L

    2015-01-01

    disease and any measure of social deprivation. An early criticism of the Pooled Cohort Equations Risk Calculator has been its alleged overestimation of ASCVD risk which, if confirmed in the general population, is likely to result in statin therapy being prescribed to many individuals at lower risk than...

  1. Pooling ASR data for closely related languages

    CSIR Research Space (South Africa)

    Van Heerden, C

    2010-05-01

    Full Text Available We describe several experiments that were conducted to assess the viability of data pooling as a means to improve speech-recognition performance for under-resourced languages. Two groups of closely related languages from the Southern Bantu language...

  2. "Teisele poole" Agambeniga ja Agambenita / Ragne Nukk

    Index Scriptorium Estoniae

    Nukk, Ragne, 1984-

    2012-01-01

    Tallinna Fotokuu rahvusvahelise fotonäituse "Teisele poole" ideeliste lähtekohtade tõlgendamisest. Autor kõrvutab Adam Budaki kuraatornäituse aluseks olnud Giorgio Agambeni esseed „Viimne kohtupäev“ näitusel eksponeeritud piltidega

  3. 7 CFR 1033.7 - Pool plant.

    Science.gov (United States)

    2010-01-01

    ... association and it fulfills the following conditions: (1) The aggregate monthly quantity supplied by all... or aseptically-processed fluid milk products. (c) A supply plant from which the quantity of bulk... operator of a supply plant located within the marketing area may include deliveries to pool distributing...

  4. Effect of turbulent natural convection on sodium pool combustion in the steam generator building of a fast breeder reactor

    International Nuclear Information System (INIS)

    Karthikeyan, S.; Sundararajan, T.; Shet, U.S.P.; Selvaraj, P.

    2009-01-01

    A computational model is proposed to simulate sodium pool combustion considering the effect of turbulent natural convection in a vented enclosure of the steam generator building (SGB) of a fast breeder reactor. The model is validated by comparing the simulated results with the experimental results available in literature for sodium pool combustion in a CSTF vessel. After validation, the effects of vents and the location of the pool on the burning rate of sodium and the associated heat transfer to the walls are studied in an enclosure comparable in size to one floor of the steam generator building. In the presence of ventilation, the burning rate of sodium increases, but the total heat transferred to the walls of the enclosure is reduced. It is also found that the burning rate of sodium pool and the heat transfer to the walls of the enclosures vary significantly with the location of sodium pool.

  5. Generalizing Pooling Functions in CNNs: Mixed, Gated, and Tree.

    Science.gov (United States)

    Lee, Chen-Yu; Gallagher, Patrick; Tu, Zhuowen

    2018-04-01

    In this paper, we seek to improve deep neural networks by generalizing the pooling operations that play a central role in the current architectures. We pursue a careful exploration of approaches to allow pooling to learn and to adapt to complex and variable patterns. The two primary directions lie in: (1) learning a pooling function via (two strategies of) combining of max and average pooling, and (2) learning a pooling function in the form of a tree-structured fusion of pooling filters that are themselves learned. In our experiments every generalized pooling operation we explore improves performance when used in place of average or max pooling. We experimentally demonstrate that the proposed pooling operations provide a boost in invariance properties relative to conventional pooling and set the state of the art on several widely adopted benchmark datasets. These benefits come with only a light increase in computational overhead during training (ranging from additional 5 to 15 percent in time complexity) and a very modest increase in the number of model parameters (e.g., additional 1, 9, and 27 parameters for mixed, gated, and 2-level tree pooling operators, respectively). To gain more insights about our proposed pooling methods, we also visualize the learned pooling masks and the embeddings of the internal feature responses for different pooling operations. Our proposed pooling operations are easy to implement and can be applied within various deep neural network architectures.

  6. Sparse feature learning for instrument identification: Effects of sampling and pooling methods.

    Science.gov (United States)

    Han, Yoonchang; Lee, Subin; Nam, Juhan; Lee, Kyogu

    2016-05-01

    Feature learning for music applications has recently received considerable attention from many researchers. This paper reports on the sparse feature learning algorithm for musical instrument identification, and in particular, focuses on the effects of the frame sampling techniques for dictionary learning and the pooling methods for feature aggregation. To this end, two frame sampling techniques are examined that are fixed and proportional random sampling. Furthermore, the effect of using onset frame was analyzed for both of proposed sampling methods. Regarding summarization of the feature activation, a standard deviation pooling method is used and compared with the commonly used max- and average-pooling techniques. Using more than 47 000 recordings of 24 instruments from various performers, playing styles, and dynamics, a number of tuning parameters are experimented including the analysis frame size, the dictionary size, and the type of frequency scaling as well as the different sampling and pooling methods. The results show that the combination of proportional sampling and standard deviation pooling achieve the best overall performance of 95.62% while the optimal parameter set varies among the instrument classes.

  7. Suncatcher and cool pool. Project report

    Energy Technology Data Exchange (ETDEWEB)

    Hammond, J.

    1981-03-01

    The Suncatcher is a simple, conical solar concentrating device that captures light entering clerestory windows and directs it onto thermal storage elements at the back of a south facing living space. The cone shape and inclination are designed to capture low angle winter sunlight and to reflect away higher angle summer sunlight. It is found that winter radiation through a Suncatcher window is 40 to 50% higher than through an ordinary window, and that the average solar fraction is 59%. Water-filled steal culvert pipes used for thermal storage are found to undergo less stratification, and thus to be more effective, when located where sunlight strikes the bottom rather than the top. Five Suncatcher buildings are described. Designs are considered for 32/sup 0/, 40/sup 0/ and 48/sup 0/ north latitude, and as the latitude increases, the inclination angle of the cone should be lowered. The Cool Pool is an evaporating, shaded roof pond which thermosiphons cool water into water-filled columns within a building. Preliminary experiments indicate that the best shade design has unimpeded north sky view, good ventilation, complete summer shading, a low architectural profile, and low cost attic vent lowers work. Another series of experiments established the satisfactory performance of the Cool Pool on a test building using four water-filled cylinders, two cylinders, and two cylinders connected to the Cool Pool through a heat exchanger. Although an unshaded pool cools better at night than a shaded one, daytime heat gain far offsets this advantage. A vinyl waterbag heat exchanger was developed for use with the Cool Pool. (LEW)

  8. On tropical cyclone frequency and the warm pool area

    Directory of Open Access Journals (Sweden)

    R. E. Benestad

    2009-04-01

    Full Text Available The proposition that the rate of tropical cyclogenesis increases with the size of the "warm pool" is tested by comparing the seasonal variation of the warm pool area with the seasonality of the number of tropical cyclones. An analysis based on empirical data from the Northern Hemisphere is presented, where the warm pool associated with tropical cyclone activity is defined as the area, A, enclosed by the 26.5°C SST isotherm. Similar analysis was applied to the temperature weighted area AT with similar results.

    An intriguing non-linear relationship of high statistical significance was found between the temperature weighted area in the North Atlantic and the North-West Pacific on the one hand and the number of cyclones, N, in the same ocean basin on the other, but this pattern was not found over the North Indian Ocean. A simple statistical model was developed, based on the historical relationship between N and A. The simple model was then validated against independent inter-annual variations in the seasonal cyclone counts in the North Atlantic, but the correlation was not statistically significant in the North-West Pacific. No correlation, however, was found between N and A in the North Indian Ocean.

    A non-linear relationship between the cyclone number and temperature weighted area may in some ocean basins explain both why there has not been any linear trend in the number of cyclones over time as well as the recent upturn in the number of Atlantic hurricanes. The results also suggest that the notion of the number of tropical cyclones being insensitive to the area A is a misconception.

  9. Observations of Cold Pool Properties during GoAmazon2014/5

    Science.gov (United States)

    Mayne, S. L.; Schumacher, C.; MacDonald, L.; Turner, D. D.

    2017-12-01

    Convectively generated cold pools are instrumental in both the development of the sub-cloud layer and the organization of deep convection. Despite this, analyses of cold pools in the tropics are constrained by a lack of observational data; insight into the phenomena therefore relies heavily on numerical models. GoAmazon2014/5, a 2-year DOE-sponsored field campaign centered on Manacapuru, Brazil in the central Amazon, provides a unique opportunity to characterize tropical cold pools and allows for the comparison of observational data with theoretical results from model cold pool simulations and parameterizations. This investigation analyzes radar, disdrometer, and profiler measurements at the DOE mobile facility site to study tropical cold pool characteristics. The Brazilian military (SIPAM) operational S-band radar in Manaus is used to provide a broad context of convective systems, while measurements from Parsivel disdrometers are used to assess drop-size distributions (DSDs) at the surface. A unique aspect of this research is the use of the Atmospheric Emitted Radiance Interferometer (AERI) instrument, which utilizes down-welling IR measurements to obtain vertical profiles of thermodynamic quantities such as temperature and water vapor in the lowest few km of the atmosphere. Combined with surface observations and sounding data, these datasets will result in a thorough investigation of the horizontal and vertical characteristics of cold pools over the tropical rain forest. Preliminary analyses of 20 events reveal a mean cold pool height of 220 m and a mean radius of approximately 8.5 km. The average cold pool experienced a temperature (specific humidity) decrease of approximately 1 K (0.4 g/kg) at the surface. The temperature decrease is consistent with modeling studies and limited observations from previous studies over the tropics. The small decrease in specific humidity is attributed to the high moisture content within the cold pools. AERI retrievals of

  10. Sustainable Sizing.

    Science.gov (United States)

    Robinette, Kathleen M; Veitch, Daisy

    2016-08-01

    To provide a review of sustainable sizing practices that reduce waste, increase sales, and simultaneously produce safer, better fitting, accommodating products. Sustainable sizing involves a set of methods good for both the environment (sustainable environment) and business (sustainable business). Sustainable sizing methods reduce (1) materials used, (2) the number of sizes or adjustments, and (3) the amount of product unsold or marked down for sale. This reduces waste and cost. The methods can also increase sales by fitting more people in the target market and produce happier, loyal customers with better fitting products. This is a mini-review of methods that result in more sustainable sizing practices. It also reviews and contrasts current statistical and modeling practices that lead to poor fit and sizing. Fit-mapping and the use of cases are two excellent methods suited for creating sustainable sizing, when real people (vs. virtual people) are used. These methods are described and reviewed. Evidence presented supports the view that virtual fitting with simulated people and products is not yet effective. Fit-mapping and cases with real people and actual products result in good design and products that are fit for person, fit for purpose, with good accommodation and comfortable, optimized sizing. While virtual models have been shown to be ineffective for predicting or representing fit, there is an opportunity to improve them by adding fit-mapping data to the models. This will require saving fit data, product data, anthropometry, and demographics in a standardized manner. For this success to extend to the wider design community, the development of a standardized method of data collection for fit-mapping with a globally shared fit-map database is needed. It will enable the world community to build knowledge of fit and accommodation and generate effective virtual fitting for the future. A standardized method of data collection that tests products' fit methodically

  11. Size matter!

    DEFF Research Database (Denmark)

    Hansen, Pelle Guldborg; Jespersen, Andreas Maaløe; Skov, Laurits Rhoden

    2015-01-01

    trash bags according to size of plates and weighed in bulk. Results Those eating from smaller plates (n=145) left significantly less food to waste (aver. 14,8g) than participants eating from standard plates (n=75) (aver. 20g) amounting to a reduction of 25,8%. Conclusions Our field experiment tests...... the hypothesis that a decrease in the size of food plates may lead to significant reductions in food waste from buffets. It supports and extends the set of circumstances in which a recent experiment found that reduced dinner plates in a hotel chain lead to reduced quantities of leftovers....

  12. Pressure suppression pool mixing in passive advanced BWR plants

    International Nuclear Information System (INIS)

    Gamble, Robert E.; Nguyen, Thuy T.; Shiralkar, Bharat S.; Peterson, Per F.; Greif, Ralph; Tabata, H.

    2001-01-01

    In the SBWR passive boiling water reactor, the long-term post-accident containment pressure is determined by the combination of noncondensible gas pressure and steam pressure in the wetwell gas space. The suppression pool (SP) surface temperature, which determines the vapor partial pressure, is very important to overall containment performance. Therefore, the thermal stratification of the SP due to blowdown is of primary importance. This work looks at the various phases and phenomena present during the blowdown event and identifies those that are important to thermal stratification, and the scaling necessary to model them in reduced size tests. This is important in determining which of the large body of blowdown to SP data is adequate for application to the stratification problem. The mixing by jets from the main vents is identified as the key phenomena influencing the thermal response of the suppression pool and analytical models are developed to predict the jet influence on thermal stratification. The analytical models are implemented into a system simulation code, TRACG, and used to model thermal stratification behavior in a scaled test facility. The results show good general agreement with the test data

  13. Installation Test of Cold Neutron Soruce In-pool Assembly

    International Nuclear Information System (INIS)

    Lee, Kye Hong; Choi, J.; Wu, S. I.; Kim, Y. K.; Cho, Y. G.; Lee, C. H.; Kim, K. R.

    2006-04-01

    Before installation of the final cold neutron source in-pool assembly (IPA) in the vertical CN hole at the HANARO, the research reactor, the installation test of IPA has been conducted in the CN hole of the reactor using a full-scaled mock-up in-pool assembly. The well-known cold neutron sources, being safely operated or being now constructed, had been constructed together with each research reactor; therefore, there was little limitation to obtain the optimal cold neutron source since a cold neutron source had been decided to be installed in the reactor from the beginning of the design for the reactor construction. Unlikely, the HANARO has been operated for 10 years so that we have got lots of design limitation in terms of the decisions in the optimal shape, size, minimal light-water gap, and adhesion degree to the CN beam tube, IPA installation tools, etc. for the construction of the CNS. Accordingly, the main objective of this test is to understand any potential problem or interference happened inside the reactor by installing the mock-up IPA and installation bracket. The outcomes from this test is reflected on the finalizing process of the IPA detail design

  14. Application of burnup credit for PWR spent fuel storage pool

    International Nuclear Information System (INIS)

    Shin, Hee Sung; Ro, Seung-Gy; Bae, Kang Mok; Kim, Ik Soo; Shin, Young Joon

    1999-01-01

    A study on the application of burnup credit for a PWR spent fuel storage pool has been investigated using a computer code system such as CSAS6 module of SCALE 4.3 in association with 44-group SCALE cross-section library. The calculation bias of the code system at a 95% probability with a 95% confidence level seems to be 0.00951 by benchmarking the system for forty six experimental data. With the aid of this computer code system, criticality analysis has been performed for the PWR spent fuel storage pool. Uncertainties due to postulated abnormal and accidental conditions, and manufacturing tolerance such as stainless steel thickness of storage rack, fuel enrichment, fuel density and box size have statistically been combined and resulted in 0.00674. Also, isotopic correction factor which was based on the calculated and measured concentration of 43 isotopes for both selected actinides and fission products important in burnup credit application has been taken into account in the criticality analysis. It is revealed that the minimum burnup with the corrected isotopic concentrations as required for the safe storage is 5,730 MWd/tU in enriched fuel of 5.0 wt%. (author)

  15. Talent Management - Case Study on Determining the Collective Pool of Talent

    Directory of Open Access Journals (Sweden)

    Mirabela-Constanta MATEI

    2012-11-01

    Full Text Available Our paper focuses on the importance of attracting and retaining talent in a company. Attracting talent refers not only to the selection of talented employees from outside the company, but also to their identification among existing employees by determining and developing the collective pool of talent. The aim of our paper is to get a better view on how companies understand, attract and retain talent. To achieve this aim, we first reviewed the literature in the field of interest and then conducted a case study on determining the collective pool of talent within a medium size company from Bihor County. Results are discussed.

  16. Theoretical and experimental studies of thermal stratification in hot and cold pools of PFBR

    International Nuclear Information System (INIS)

    Velusamy, K.; Titus, G.; Rajakumar, A.; Ravichandran, G.; Padmakumar, G.; Vaidyanathan, G.; Kale, R.D.; Chetal, S.C.; Bhoje, S.B.

    1994-01-01

    Results of experimental studies carried out in two water models of size 1/24 and 1/15, to assess the free level fluctuation in the hot pool of PFBR are presented. The results when extrapolated to the prototype gives a ripple height of 50 mm. The results of thermal stratification studies carried out in 1/24 scale model, using hot and cold water indicates that the interface velocity can be correlated with the Richardson number. The paper also gives the details of computer codes developed for the estimation of flow and temperature fields in the pools. (author)

  17. Exploring Size.

    Science.gov (United States)

    Brand, Judith, Ed.

    1995-01-01

    "Exploring" is a magazine of science, art, and human perception that communicates ideas museum exhibits cannot demonstrate easily by using experiments and activities for the classroom. This issue concentrates on size, examining it from a variety of viewpoints. The focus allows students to investigate and discuss interconnections among…

  18. Horizontal above-rack pool storage

    International Nuclear Information System (INIS)

    Moscardini, R.L.

    1993-08-01

    This report describes a unique method for storing spent, six year out of core, fuel at a prototypical PWR nuclear power station. The study describes a conceptual design, with favorable structural, thermal and criticality technical evaluations. However, economic considerations and licensing risks are judged to be less favorable. The concept study prescribes a fuel over fuel arrangement in an existing Spent Fuel Pool (SFP) with full maintenance of ALARA principles. This concept study is specific to a prototypical pool design, but may easily be projected to other nuclear facilities with other SFP conditions. For the prototypical PWR, the conceptual fuel bridge design will store over 200 additional fuel assemblies without significant facility modifications and for an indefinite time period

  19. Sodium pool fire model for CONACS code

    International Nuclear Information System (INIS)

    Yung, S.C.

    1982-01-01

    The modeling of sodium pool fires constitutes an important ingredient in conducting LMFBR accident analysis. Such modeling capability has recently come under scrutiny at Westinghouse Hanford Company (WHC) within the context of developing CONACS, the Containment Analysis Code System. One of the efforts in the CONACS program is to model various combustion processes anticipated to occur during postulated accident paths. This effort includes the selection or modification of an existing model and development of a new model if it clearly contributes to the program purpose. As part of this effort, a new sodium pool fire model has been developed that is directed at removing some of the deficiencies in the existing models, such as SOFIRE-II and FEUNA

  20. Review and assessment of pool scrubbing models

    International Nuclear Information System (INIS)

    Herranz, L.E.; Escudero, M.J.; Peyres, V.; Polo, J.; Lopez-Jimenez, J.

    1996-01-01

    Decontamination of fission products bearing bubbles as they through aqueous pools becomes a crucial phenomenon for source term evaluation of hypothetical risk dominant sequences of Light Water Reactors. In the present report a peer review and assessment of models encapsulated in SPARC andBUSCA codes is presented. Several aspects of pool scrubbing have been addressed: particle removal, fission product vapour retention and bubble hydrodynamics. Particular emphasis has been given to the close link between retention and hydrodynamics, from both modelling and experimental point of view. In addition, RHR and SGTR sequences were simulated with SPARC90 and BUSCA-AUG92 codes, and their results were compared with those obtained with MAAP 3.0B.As a result of this work, model capabilities and shortcomings have beenassessed and some areas susceptible of further research have been identified.(Author) 73 refs

  1. Review and assessment of pool scrubbing models

    International Nuclear Information System (INIS)

    Herranz, L.E.; Escudero, M.J.; Peyres, V.; Polo, J.; Lopez, J.

    1996-01-01

    Decontamination of fission products bearing bubbles as they pass through aqueous pools becomes a crucial phenomenon for source term evaluation of hypothetical risk dominant sequences of Light Water Reactors. In the present report a peer review and assessment of models encapsulated in SPARC and BUSCA codes is presented. Several aspects of pool scrubbing have been addressed: particle removal, fission product vapour retention and bubble hydrodynamics. Particular emphasis has been given to the close link between retention and hydrodynamics, from both modelling and experimental point of view. In addition, RHR and SGTR sequences were simulated with SPARC90 and BUSCA-AUG92 codes, and their results were compared with those obtained with MAAP 3.0B. As a result of this work, model capabilities and shortcomings have been assessed and some areas susceptible of further research have been identified. (Author) 73 refs

  2. Review and assessment of pool scrubbing models

    Energy Technology Data Exchange (ETDEWEB)

    Herranz, L.E.; Escudero, M.J.; Peyres, V.; Polo, J.; Lopez, J.

    1996-07-01

    Decontamination of fission products bearing bubbles as they pass through aqueous pools becomes a crucial phenomenon for source term evaluation of hypothetical risk dominant sequences of Light Water Reactors. In the present report a peer review and assessment of models encapsulated in SPARC and BUSCA codes is presented. Several aspects of pool scrubbing have been addressed: particle removal, fission product vapour retention and bubble hydrodynamics. Particular emphasis has been given to the close link between retention and hydrodynamics, from both modelling and experimental point of view. In addition, RHR and SGTR sequences were simulated with SPARC90 and BUSCA-AUG92 codes, and their results were compared with those obtained with MAAP 3.0B. As a result of this work, model capabilities and shortcomings have been assessed and some areas susceptible of further research have been identified. (Author) 73 refs.

  3. Pool type liquid metal fast breeder reactors

    International Nuclear Information System (INIS)

    Guthrie, B.M.

    1978-08-01

    Various technical aspects of the liquid metal fast breeder reactor (LMFBR), specifically pool type LMFBR's, are summarized. The information presented, for the most part, draws upon existing data. Special sections are devoted to design, technical feasibility (normal operating conditions), and safety (accident conditions). A survey of world fast reactors is presented in tabular form, as are two sets of reference reactor parameters based on available data from present and conceptual LMFBR's. (auth)

  4. Finding determinants of audit delay by pooled OLS regression analysis

    Directory of Open Access Journals (Sweden)

    Tina Vuko

    2014-03-01

    Full Text Available The aim of this paper is to investigate determinants of audit delay. Audit delay is measured as the length of time (i.e. the number of calendar days from the fiscal year-end to the audit report date. It is important to understand factors that influence audit delay since it directly affects the timeliness of financial reporting. The research is conducted on a sample of Croatian listed companies, covering the period of four years (from 2008 to 2011. We use pooled OLS regression analysis, modelling audit delay as a function of the following explanatory variables: audit firm type, audit opinion, profitability, leverage, inventory and receivables to total assets, absolute value of total accruals, company size and audit committee existence. Our results indicate that audit committee existence, profitability and leverage are statistically significant determinants of audit delay in Croatia.

  5. Heat transfer from internally-heated molten UO2 pools

    International Nuclear Information System (INIS)

    Stein, R.P.; Baker, L. Jr.; Gunther, W.H.; Cook, C.

    1978-01-01

    Experimental measurements of heat transfer from internally heated pools of molten UO 2 have been obtained for two cell sizes: 10 cm x 10 cm and 20 cm x 20 cm. The experiments with the large cell have supported a previous conclusion from early small data that the measured downward heat fluxes are higher than would be expected on the basis of considerations of thermal convection. A convective model underpredicts the downward heat fluxes by a factor of 2.5 to 4.5 for all but one early experiment. Arbitrary assumptions of increased thermal conductivity do not account for the discrepancy. A single model based on internal thermal radiation heat transfer is able to account for the high values. The model uses the optically thick Rosseland approximation. Because of this, it is tentatively concluded that thermal radiation plays a dominant role in controlling the heat transfer from internally heated molted fuel

  6. Condensation of vapor bubble in subcooled pool

    Science.gov (United States)

    Horiuchi, K.; Koiwa, Y.; Kaneko, T.; Ueno, I.

    2017-02-01

    We focus on condensation process of vapor bubble exposed to a pooled liquid of subcooled conditions. Two different geometries are employed in the present research; one is the evaporation on the heated surface, that is, subcooled pool boiling, and the other the injection of vapor into the subcooled pool. The test fluid is water, and all series of the experiments are conducted under the atmospheric pressure condition. The degree of subcooling is ranged from 10 to 40 K. Through the boiling experiment, unique phenomenon known as microbubble emission boiling (MEB) is introduced; this phenomenon realizes heat flux about 10 times higher than the critical heat flux. Condensation of the vapor bubble is the key phenomenon to supply ambient cold liquid to the heated surface. In order to understand the condensing process in the MEB, we prepare vapor in the vapor generator instead of the evaporation on the heated surface, and inject the vapor to expose the vapor bubble to the subcooled liquid. Special attention is paid to the dynamics of the vapor bubble detected by the high-speed video camera, and on the enhancement of the heat transfer due to the variation of interface area driven by the condensation.

  7. Gene pool conservation of teak in Myanmar

    International Nuclear Information System (INIS)

    Tin-Tun

    1995-01-01

    Myanmar with an area of 261, 228 Sq. miles is endowed with various types of forests which occupied nearly 50% of the country. Teak (Tectona grandis Linn. f.) is one of the most valuable timber species for its excellent wood quality and properties which are not observed with other timbers. Gene pool can be defined as a group of individual trees growing over a wide range of environmental conditions, and constituting different genetic complexes which can be transmitted to the offsprings. Topics such as: objectives of gene pool conservation, genetically improved seeds for large scale forest plantations, methodology of conservation, are discussed in the article. Myanmar teak dominates the world's teak market, and thus it is crucial to maintain the superiority in the conservation of gene complexes of teak. To some extent, the conservation of gene pools of teak and tree improvements are being undertaken by the Forest Research Institute of Myanmar. It is felt that the dissemination of the philosophy and concept of gene conservation to the personal involved in the forestry activities of the country are still inadequate

  8. The Phoenix series large scale LNG pool fire experiments.

    Energy Technology Data Exchange (ETDEWEB)

    Simpson, Richard B.; Jensen, Richard Pearson; Demosthenous, Byron; Luketa, Anay Josephine; Ricks, Allen Joseph; Hightower, Marion Michael; Blanchat, Thomas K.; Helmick, Paul H.; Tieszen, Sheldon Robert; Deola, Regina Anne; Mercier, Jeffrey Alan; Suo-Anttila, Jill Marie; Miller, Timothy J.

    2010-12-01

    The increasing demand for natural gas could increase the number and frequency of Liquefied Natural Gas (LNG) tanker deliveries to ports across the United States. Because of the increasing number of shipments and the number of possible new facilities, concerns about the potential safety of the public and property from an accidental, and even more importantly intentional spills, have increased. While improvements have been made over the past decade in assessing hazards from LNG spills, the existing experimental data is much smaller in size and scale than many postulated large accidental and intentional spills. Since the physics and hazards from a fire change with fire size, there are concerns about the adequacy of current hazard prediction techniques for large LNG spills and fires. To address these concerns, Congress funded the Department of Energy (DOE) in 2008 to conduct a series of laboratory and large-scale LNG pool fire experiments at Sandia National Laboratories (Sandia) in Albuquerque, New Mexico. This report presents the test data and results of both sets of fire experiments. A series of five reduced-scale (gas burner) tests (yielding 27 sets of data) were conducted in 2007 and 2008 at Sandia's Thermal Test Complex (TTC) to assess flame height to fire diameter ratios as a function of nondimensional heat release rates for extrapolation to large-scale LNG fires. The large-scale LNG pool fire experiments were conducted in a 120 m diameter pond specially designed and constructed in Sandia's Area III large-scale test complex. Two fire tests of LNG spills of 21 and 81 m in diameter were conducted in 2009 to improve the understanding of flame height, smoke production, and burn rate and therefore the physics and hazards of large LNG spills and fires.

  9. POOL WATER TREATMENT AND COOLING SYSTEM DESCRIPTION DOCUMENT

    International Nuclear Information System (INIS)

    King, V.

    2000-01-01

    The Pool Water Treatment and Cooling System is located in the Waste Handling Building (WHB), and is comprised of various process subsystems designed to support waste handling operations. This system maintains the pool water temperature within an acceptable range, maintains water quality standards that support remote underwater operations and prevent corrosion, detects leakage from the pool liner, provides the capability to remove debris from the pool, controls the pool water level, and helps limit radiological exposure to personnel. The pool structure and liner, pool lighting, and the fuel staging racks in the pool are not within the scope of the Pool Water Treatment and Cooling System. Pool water temperature control is accomplished by circulating the pool water through heat exchangers. Adequate circulation and mixing of the pool water is provided to prevent localized thermal hotspots in the pool. Treatment of the pool water is accomplished by a water treatment system that circulates the pool water through filters, and ion exchange units. These water treatment units remove radioactive and non-radioactive particulate and dissolved solids from the water, thereby providing the water clarity needed to conduct waste handling operations. The system also controls pool water chemistry to prevent advanced corrosion of the pool liner, pool components, and fuel assemblies. Removal of radioactivity from the pool water contributes to the project ALARA (as low as is reasonably achievable) goals. A leak detection system is provided to detect and alarm leaks through the pool liner. The pool level control system monitors the water level to ensure that the minimum water level required for adequate radiological shielding is maintained. Through interface with a demineralized water system, adequate makeup is provided to compensate for loss of water inventory through evaporation and waste handling operations. Interface with the Site Radiological Monitoring System provides continuous

  10. Size matters

    Energy Technology Data Exchange (ETDEWEB)

    Forst, Michael

    2012-11-01

    The shakeout in the solar cell and module industry is in full swing. While the number of companies and production locations shutting down in the Western world is increasing, the capacity expansion in the Far East seems to be unbroken. Size in combination with a good sales network has become the key to success for surviving in the current storm. The trade war with China already looming on the horizon is adding to the uncertainties. (orig.)

  11. Infections Unlikely to be Spread Through Swimming Pools

    Science.gov (United States)

    ... Water Home Infections Unlikely to be Spread Through Swimming Pools Language: English (US) Español (Spanish) Recommend on ... included below. Infections Unlikely to be Spread by Swimming Pools Head Lice Head lice are unlikely to ...

  12. A new pooling strategy for high-throughput screening: the Shifted Transversal Design

    Directory of Open Access Journals (Sweden)

    Thierry-Mieg Nicolas

    2006-01-01

    Full Text Available Abstract Background In binary high-throughput screening projects where the goal is the identification of low-frequency events, beyond the obvious issue of efficiency, false positives and false negatives are a major concern. Pooling constitutes a natural solution: it reduces the number of tests, while providing critical duplication of the individual experiments, thereby correcting for experimental noise. The main difficulty consists in designing the pools in a manner that is both efficient and robust: few pools should be necessary to correct the errors and identify the positives, yet the experiment should not be too vulnerable to biological shakiness. For example, some information should still be obtained even if there are slightly more positives or errors than expected. This is known as the group testing problem, or pooling problem. Results In this paper, we present a new non-adaptive combinatorial pooling design: the "shifted transversal design" (STD. It relies on arithmetics, and rests on two intuitive ideas: minimizing the co-occurrence of objects, and constructing pools of constant-sized intersections. We prove that it allows unambiguous decoding of noisy experimental observations. This design is highly flexible, and can be tailored to function robustly in a wide range of experimental settings (i.e., numbers of objects, fractions of positives, and expected error-rates. Furthermore, we show that our design compares favorably, in terms of efficiency, to the previously described non-adaptive combinatorial pooling designs. Conclusion This method is currently being validated by field-testing in the context of yeast-two-hybrid interactome mapping, in collaboration with Marc Vidal's lab at the Dana Farber Cancer Institute. Many similar projects could benefit from using the Shifted Transversal Design.

  13. Experimental study of aerosol reentrainment from flashing pool in ALPHA program

    International Nuclear Information System (INIS)

    Kudo, T.; Yamano, N.; Moriyama, K.; Maruyama, Y.; Sugimoto, J.

    1994-01-01

    Aerosol reentrainment experiments are being performed as a part of the ALPHA (Assessment of Loads and Performance of Containment in a Hypothetical Accident) program at JAERI (Japan Atomic Energy Research Institute). The major objective of the experiments is to quantify and characterize the reentrainment of the dissolved material from a flashing pool during the rapid depressurization of a reactor containment vessel. Two experiments were performed. In the experiments a water pool dissolving sodium sulfate as FP simulant was located in the model containment vessel and the containment breach area was simulated with an orifice with 24 mm diameter. This orifice was estimated to give the same order of depressurization rate as the case of BWR Mark 1 containment failure with most likely breach size. In the first experiment ARE001, a pool water of 800 kg dissolving 50 kg of sodium sulfate was employed. The model containment was depressurized from 1.5 MPa to 0.1 MPa in approximately 45 minutes. In the second experiment ARE002, the mass of the pool water was reduced to 400 kg dissolving 25 kg of sodium sulfate. The internal pressure of the containment was decreased from 1.3 MPa to 0.1 MPa in approximately 40 minutes. At the beginning of the depressurization the pool water was heated to the saturation temperature at the internal pressure of the containment. The entrained droplets were sampled during depressurization period. Sodium sulfate deposited in all parts of the test facility was collected and weighed after the experiments. Results of the experiments showed that very small fraction of the dissolved material (less than 0.03%) was reentrained although approximately, 20% of water was evaporated from the pool water. The reentrained mass predicted with the Kataoka-Ishii model was approximately 1/110 of the mass evaluated in the experiments. This may be due to multi-dimensional features of the pool geometry. (author)

  14. (Important hygienic aspects for swimming pools (author's transl))

    Energy Technology Data Exchange (ETDEWEB)

    Somosi, G

    1981-01-01

    The major epidemics which occurred in Hungary and originated from water in swimming pools are reported. The difficulties encountered in producing epidemiological evidence and in monitoring infections originating from water in swimming pools are mentioned. The possibilities of controlling the water quality in swimming pools and of preventing infections are discussed. Reference is made to the existing bacteriological limit values in Hungary to be observed in the recirculation of water in swimming pools.

  15. Development of INSPCT-S for inspection of spent fuel pool

    Energy Technology Data Exchange (ETDEWEB)

    Walters, W.; Haghighat, A. [Nuclear Engineering Program, Mechanical Engineering Dept., Virginia Tech., Blacksburg, VA 24061 (United States); Sitaraman, S.; Ham, Y. [Lawrence Livermore National Laboratory, 7000 East Ave., Livermore, CA 94550 (United States)

    2011-07-01

    In this paper, we discuss an accurate and fast software tool (INSPCT-S, Inspection of Nuclear Spent fuel-Pool Calculation Tool, version Spreadsheet) developed for calculation of the response of fission chambers placed in a spent fuel pool, such as Atucha-I. INSPCT-S is developed for identification of suspicious regions of the pool that may have missing or substitute assemblies. INSPCT-S uses a hybrid algorithm based on the adjoint function methodology. The neutron source is comprised of spontaneous fission, ({alpha}, n) interactions, and subcritical multiplication. The former is evaluated using the ORIGEN-ARP code, and the latter is obtained with the fission matrix (FM) formulation. The FM coefficients are determined using the MCNP Monte Carlo code, and the importance function is determined using the PENTRAN 3-D parallel Sn code. Three databases for the neutron source, FM elements, and adjoint flux are prepared as functions of different parameters including burnup, cooling time, enrichment, and pool lattice size. INSPCT-S uses the aforementioned databases and systems of equations to calculate detector responses, which are subsequently compared with normalized experimental data. If this comparison is not satisfied, INSPCT-S utilizes color coding to identify the suspicious regions of a spent fuel pool. (authors)

  16. Seismic analysis and design of spent subassembly storage bay (SSSB) pool

    International Nuclear Information System (INIS)

    Abdul Gani, H.I.; Ramanjaneyulu, K.V.S.; Pillai, C.S.; Chetal, S.C.

    2003-01-01

    Fuel bundles, after their specified stay in reactor core, are replaced by fresh fuel for sustaining power generation at rated levels. The irradiated fuel subassembly, removed fresh from core, known as spent fuel sub assembly, is radioactive and decay heat generating. It needs to be cooled before it becomes amenable for handling, either for reprocessing or for immobilisation. For this purpose, it is immersed in a pool of water, retained in a concrete structure referred as Spent Subassembly Storage Bay (SSSB) pool. The height of water column above fuel bundles is arrived from shielding considerations. SSSB pool is one of the nuclear safety related structures and warrants rigorous analysis and design. The SSSB pool, in case of PFBR 500 MW(e) is located in fuel building. It is a stainless steel lined. water retaining rectangular R.C.C. open tank of size 7.5 X 29.0 m, with a height of 11.0 m. This structure is analysed for two levels of site specific earthquakes taking in to account liquid structure interactions as per ASCE-4, 1998. The design of walls and bottom slab is carried out satisfying the AERB code for nuclear safety related structures. Analysis and design of SSSB pool of PFBR is presented in the following paper. (author)

  17. NACUBO's Guide to Unitizing Investment Pools. Second Edition

    Science.gov (United States)

    Wheeler, Mary S.

    2011-01-01

    The National Association of College and University Business Officers' (NACUBO's) "Guide to Unitizing Investment Pools" addresses the principles and concepts for administering a consolidated investment pool. Unitization is the mechanism by which investment funds are pooled to maximize investment efficiencies and provide information for donors,…

  18. A skeleton for distributed work pools in Eden

    DEFF Research Database (Denmark)

    Dieterle, Mischa; Berthold, Jost; Loogen, Rita

    2010-01-01

    We present a flexible skeleton for implementing distributed work pools in our parallel functional language Eden. The skeleton manages a pool of tasks (work pool) in a distributed manner using a demand-driven work stealing approach for load balancing. All coordination is done locally within...

  19. 17 CFR 4.22 - Reporting to pool participants.

    Science.gov (United States)

    2010-04-01

    ..., the financial statements are not required to include consolidated information for all series. (7) For... event that the International Financial Reporting Standards require consolidated financial statements for... reporting pool's consolidated financial statements. (ii) The commodity pool operator of a pool that meets...

  20. 48 CFR 873.114 - Best value pool.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Best value pool. 873.114... SUPPLEMENTARY REGULATIONS SIMPLIFIED ACQUISITION PROCEDURES FOR HEALTH-CARE RESOURCES 873.114 Best value pool... solicitation. These vendors constitute the best value pool. This determination is within the sole discretion of...

  1. Gated cardiac blood pool studies in arrhythmias

    International Nuclear Information System (INIS)

    Itti, R.; Casset, D.; Philippe, L.; Cosnay, P.; Fauchier, J.P.

    1988-01-01

    Biventricular phase analysis a gated blood pool studies may help to solve two fundamental questions raised by patients suffering from arrhythmias: localization of an electrical cardiac activation abnormality by means of contraction mapping and assesment of an underlying organic disease using the phase histograms and their standard deviations. Three groups of patients have been evaluated to demonstrate the usefulness of radioisotopic techniques in arrhythmias: 36 patients with a Wolff-Parkinson-White syndrom, 27 patients studied during a ventricular tachycardia attack and 32 patients suspected of arrhythmogenic ventricular dysplasia. Correlations with invasive electrophysiologic studies are presented and the diagnostic and therapeutic implications of these results are discussed [fr

  2. Pool boiling visualization on open microchannel surfaces

    Directory of Open Access Journals (Sweden)

    Kaniowski Robert

    2017-01-01

    Full Text Available The paper presents visualization investigations into pool boiling heat transfer for open minichannel surfaces. The experiments were carried out wih saturated water at atmospheric pressure. Parallel microchannels fabricated by machining were about 0.3 mm wide and 0.2 to 0.4 mm deep. High-speed videos were used as an aid to understanding the heat transfer mechanism. The visualization study aimed at identifying nucleation sites of the departing bubbles and determining their diameters and frequency at various superheats.

  3. Simulation of a pool type research reactor

    International Nuclear Information System (INIS)

    Oliveira, Andre Felipe da Silva de; Moreira, Maria de Lourdes

    2011-01-01

    Computational fluid dynamic is used to simulate natural circulation condition after a research reactor shutdown. A benchmark problem was used to test the viability of usage such code to simulate the reactor model. A model which contains the core, the pool, the reflector tank, the circulation pipes and chimney was simulated. The reactor core contained in the full scale model was represented by a porous media. The parameters of porous media were obtained from a separate CFD analysis of the full core model. Results demonstrate that such studies can be carried out for research and test of reactors design. (author)

  4. Gated cardiac blood pool studies in arrhythmias

    Energy Technology Data Exchange (ETDEWEB)

    Itti, R.; Casset, D.; Philippe, L.; Cosnay, P.; Fauchier, J.P.

    1988-01-01

    Biventricular phase analysis a gated blood pool studies may help to solve two fundamental questions raised by patients suffering from arrhythmias: localization of an electrical cardiac activation abnormality by means of contraction mapping and assesment of an underlying organic disease using the phase histograms and their standard deviations. Three groups of patients have been evaluated to demonstrate the usefulness of radioisotopic techniques in arrhythmias: 36 patients with a Wolff-Parkinson-White syndrom, 27 patients studied during a ventricular tachycardia attack and 32 patients suspected of arrhythmogenic ventricular dysplasia. Correlations with invasive electrophysiologic studies are presented and the diagnostic and therapeutic implications of these results are discussed.

  5. Pool film boiling heat transfer, 5

    International Nuclear Information System (INIS)

    Sakurai, A.; Shiotsu, M.; Hata, K.

    1981-01-01

    Steady minimum film boiling heat flux and temperature were experimentally studied for a horizontal cylinder test heater in a pool of saturated water under pressures ranging from 0.1 to 2 MPa. Minimum temperature of film boiling may be determined by hydrodynamic Taylor instability for the pressures lower than around 1.0 MPa and by homogeneous nucleation temperature for the higher pressures. However, conventional correlations of minimum heat flux based on the hydrodynamic Taylor instability cannot at all predict the pressure dependency of the experimental data in the lower pressure region. Semi-empirical equation of the minimum heat flux based on the hydrodynamic Taylor instability was given. (author)

  6. Swimming pool reactor reliability and safety analysis

    International Nuclear Information System (INIS)

    Li Zhaohuan

    1997-01-01

    A reliability and safety analysis of Swimming Pool Reactor in China Institute of Atomic Energy is done by use of event/fault tree technique. The paper briefly describes the analysis model, analysis code and main results. Meanwhile it also describes the impact of unassigned operation status on safety, the estimation of effectiveness of defense tactics in maintenance against common cause failure, the effectiveness of recovering actions on the system reliability, the comparison of occurrence frequencies of the core damage by use of generic and specific data

  7. Rhizosphere size

    Science.gov (United States)

    Kuzyakov, Yakov; Razavi, Bahar

    2017-04-01

    Estimation of the soil volume affected by roots - the rhizosphere - is crucial to assess the effects of plants on properties and processes in soils and dynamics of nutrients, water, microorganisms and soil organic matter. The challenges to assess the rhizosphere size are: 1) the continuum of properties between the root surface and root-free soil, 2) differences in the distributions of various properties (carbon, microorganisms and their activities, various nutrients, enzymes, etc.) along and across the roots, 3) temporal changes of properties and processes. Thus, to describe the rhizosphere size and root effects, a holistic approach is necessary. We collected literature and own data on the rhizosphere gradients of a broad range of physico-chemical and biological properties: pH, CO2, oxygen, redox potential, water uptake, various nutrients (C, N, P, K, Ca, Mg, Mn and Fe), organic compounds (glucose, carboxylic acids, amino acids), activities of enzymes of C, N, P and S cycles. The collected data were obtained based on the destructive approaches (thin layer slicing), rhizotron studies and in situ visualization techniques: optodes, zymography, sensitive gels, 14C and neutron imaging. The root effects were pronounced from less than 0.5 mm (nutrients with slow diffusion) up to more than 50 mm (for gases). However, the most common effects were between 1 - 10 mm. Sharp gradients (e.g. for P, carboxylic acids, enzyme activities) allowed to calculate clear rhizosphere boundaries and so, the soil volume affected by roots. The first analyses were done to assess the effects of soil texture and moisture as well as root system and age on these gradients. The most properties can be described by two curve types: exponential saturation and S curve, each with increasing and decreasing concentration profiles from the root surface. The gradient based distribution functions were calculated and used to extrapolate on the whole soil depending on the root density and rooting intensity. We

  8. Chinese nuclear insurance and Chinese nuclear insurance pool

    International Nuclear Information System (INIS)

    Gong Zhiqi

    2000-01-01

    Chinese Nuclear Insurance Started with Daya Bay Nuclear Power Station, PICC issued the insurance policy. Nuclear insurance cooperation between Chinese and international pool's organizations was set up in 1989. In 1996, the Chinese Nuclear Insurance Pool was prepared. The Chinese Nuclear Insurance Pool was approved by The Chinese Insurance Regulatory Committee in May of 1999. The principal aim is to centralize maximum the insurance capacity for nuclear insurance from local individual insurers and to strengthen the reinsurance relations with international insurance pools so as to provide the high quality insurance service for Chinese nuclear industry. The Member Company of Chinese Nuclear Pool and its roles are introduced in this article

  9. A method of measuring a molten metal liquid pool volume

    Science.gov (United States)

    Garcia, G.V.; Carlson, N.M., Donaldson, A.D.

    1990-12-12

    A method of measuring a molten metal liquid pool volume and in particular molten titanium liquid pools, including the steps of (a) generating an ultrasonic wave at the surface of the molten metal liquid pool, (b) shining a light on the surface of a molten metal liquid pool, (c) detecting a change in the frequency of light, (d) detecting an ultrasonic wave echo at the surface of the molten metal liquid pool, and (e) computing the volume of the molten metal liquid. 3 figs.

  10. NblA1/A2-Dependent Homeostasis of Amino Acid Pools during Nitrogen Starvation in Synechocystis sp. PCC 6803.

    Science.gov (United States)

    Kiyota, Hiroshi; Hirai, Masami Yokota; Ikeuchi, Masahiko

    2014-06-30

    Nutrient balance is important for photosynthetic growth and biomass production in microalgae. Here, we investigated and compared metabolic responses of amino acid pools to nitrogen and sulfur starvation in a unicellular model cyanobacterium, Synechocystis sp. PCC 6803, and its mutant nblA1/A2. It is known that NblA1/A2-dependent and -independent breakdown of abundant photosynthetic phycobiliproteins and other cellular proteins supply nutrients to the organism. However, the contribution of the NblA1/A2-dependent nutrient supply to amino acid pool homeostasis has not been studied. Our study demonstrates that changes in the pool size of many amino acids during nitrogen starvation can be categorized as NblA1/A2-dependent (Gln, Glu, glutathione, Gly, Ile, Leu, Met, Phe, Pro, Ser, Thr, Tyr and Val) and NblA1/A2-independent (Ala, Asn, Lys, and Trp). We also report unique changes in amino acid pool sizes during sulfur starvation in wild type and the mutant and found a generally marked increase in the Lys pool in cyanobacteria during nutrient starvation. In conclusion, the NblA1/A2-dependent protein turnover contributes to the maintenance of many amino acid pools during nitrogen starvation.

  11. NblA1/A2-Dependent Homeostasis of Amino Acid Pools during Nitrogen Starvation in Synechocystis sp. PCC 6803

    Directory of Open Access Journals (Sweden)

    Hiroshi Kiyota

    2014-06-01

    Full Text Available Nutrient balance is important for photosynthetic growth and biomass production in microalgae. Here, we investigated and compared metabolic responses of amino acid pools to nitrogen and sulfur starvation in a unicellular model cyanobacterium, Synechocystis sp. PCC 6803, and its mutant nblA1/A2. It is known that NblA1/A2-dependent and -independent breakdown of abundant photosynthetic phycobiliproteins and other cellular proteins supply nutrients to the organism. However, the contribution of the NblA1/A2-dependent nutrient supply to amino acid pool homeostasis has not been studied. Our study demonstrates that changes in the pool size of many amino acids during nitrogen starvation can be categorized as NblA1/A2-dependent (Gln, Glu, glutathione, Gly, Ile, Leu, Met, Phe, Pro, Ser, Thr, Tyr and Val and NblA1/A2-independent (Ala, Asn, Lys, and Trp. We also report unique changes in amino acid pool sizes during sulfur starvation in wild type and the mutant and found a generally marked increase in the Lys pool in cyanobacteria during nutrient starvation. In conclusion, the NblA1/A2-dependent protein turnover contributes to the maintenance of many amino acid pools during nitrogen starvation.

  12. Study of mixed convection in sodium pool

    International Nuclear Information System (INIS)

    Wang Zhou; Chen Yan

    1995-01-01

    The mixed convection phenomena in the sodium pool of fast reactor have been studied systematically by the two dimensional modeling method. A generalized concept of circumferential line in the cylindrical coordinates was proposed to overcome the three dimensional effect induced by the pool geometry in an analysis of two dimensional modeling. A method of sub-step in time was developed for solving the turbulent equations. The treatments on the boundary condition for the auxiliary velocity field have been proposed, and the explanation of allowing the flow function method to be used in the flow field in presence of a mass source term was given. As examples of verification, the experiments were conducted with water flow in a rectangular cavity. The results from theoretical analysis were applied to the numerical computation for the mixed convection in the cavity. The mechanism of stratified flow in the cavity was studied. A numerical calculation was carried out for the mixed convection in hot plenum of a typical fast reactor

  13. Visual attention and flexible normalization pools

    Science.gov (United States)

    Schwartz, Odelia; Coen-Cagli, Ruben

    2013-01-01

    Attention to a spatial location or feature in a visual scene can modulate the responses of cortical neurons and affect perceptual biases in illusions. We add attention to a cortical model of spatial context based on a well-founded account of natural scene statistics. The cortical model amounts to a generalized form of divisive normalization, in which the surround is in the normalization pool of the center target only if they are considered statistically dependent. Here we propose that attention influences this computation by accentuating the neural unit activations at the attended location, and that the amount of attentional influence of the surround on the center thus depends on whether center and surround are deemed in the same normalization pool. The resulting form of model extends a recent divisive normalization model of attention (Reynolds & Heeger, 2009). We simulate cortical surround orientation experiments with attention and show that the flexible model is suitable for capturing additional data and makes nontrivial testable predictions. PMID:23345413

  14. Hardening Stratum, the Bitcoin Pool Mining Protocol

    Directory of Open Access Journals (Sweden)

    Recabarren Ruben

    2017-07-01

    Full Text Available Stratum, the de-facto mining communication protocol used by blockchain based cryptocurrency systems, enables miners to reliably and efficiently fetch jobs from mining pool servers. In this paper we exploit Stratum’s lack of encryption to develop passive and active attacks on Bitcoin’s mining protocol, with important implications on the privacy, security and even safety of mining equipment owners. We introduce StraTap and ISP Log attacks, that infer miner earnings if given access to miner communications, or even their logs. We develop BiteCoin, an active attack that hijacks shares submitted by miners, and their associated payouts. We build BiteCoin on WireGhost, a tool we developed to hijack and surreptitiously maintain Stratum connections. Our attacks reveal that securing Stratum through pervasive encryption is not only undesirable (due to large overheads, but also ineffective: an adversary can predict miner earnings even when given access to only packet timestamps. Instead, we devise Bedrock, a minimalistic Stratum extension that protects the privacy and security of mining participants. We introduce and leverage the mining cookie concept, a secret that each miner shares with the pool and includes in its puzzle computations, and that prevents attackers from reconstructing or hijacking the puzzles.

  15. Estimated environmental radionuclide transfer and deposition into outdoor swimming pools

    International Nuclear Information System (INIS)

    Tagami, Kazumi; Nagata, Izumi; Sueki, Keisuke

    2014-01-01

    In 2011, a large radioactive discharge occurred at the Fukushima Daiichi nuclear power plant. This plant is located within a climatically temperate region where outdoor swimming pools are popular. Although it is relatively easy to decontaminate pools by refilling them with fresh water, it is difficult to maintain safe conditions given highly contaminated diurnal dust falls from the surrounding contaminated ground. Our objectives in this paper were to conduct daily radioactivity measurements, to determine the quantity of radioactive contaminants from the surrounding environment that invade outdoor pools, and to investigate the efficacy of traditional pool cleaners in removing radioactive contaminants. The depositions in the paper filterable particulates ranged from 0 to 62,5 Bq/m 2 /day, with the highest levels found in the southern Tohoku District containing Fukushima Prefecture and in the Kanto District containing Tokyo Metro. They were approximately correlated with the ground contamination. Traditional pool cleaners eliminated 99% of contaminants at the bottom of the pool, reducing the concentration to 41 Bq/m 2 after cleaning. Authors recommended the deposition or the blown radionuclides into outdoor swimming pools must be considered into pool regulations when the environments exactly polluted with radionuclides. - Highlights: • Deposition into outdoor swimming pool in a habitable areas estimated 72 Bq/m 2 /day. • More than 500 Bq/m 2 /day deposition will exceed our national guideline (10 Bq/l) of swimming pool. • Vacuum pool cleaner eliminates 99% radionuclides deposition

  16. Plant diversity associated with pools in natural and restored peatlands

    Directory of Open Access Journals (Sweden)

    N. Fontaine

    2007-06-01

    Full Text Available This study describes plant assemblages associated with the edges of peatland pools. We conducted inventories in six natural peatlands in the province of Québec (Canada in order to measure the contribution of pools to species diversity in climatic regions where peatlands are used for peat extraction. We also carried out vegetation surveys in a peatland that has been restored after peat extraction/harvesting to determine whether pool vegetation establishes along the edges of created pools when dry surface restoration techniques only are used. Pools enhanced plant species richness in natural peatlands. Around created pools, species associated with natural pools were still absent, and non-bog species were present, six years after restoration. On this basis, we emphasise the importance of preserving natural peatlands with pools. In order to restore fully the plant diversity associated with peatlands at harvested sites, it may be necessary to modify pool excavation techniques so that created pools resemble more closely those in natural peatlands. Active introduction of the plant species or communities associated with natural pools may also be needed; candidate species for North America include Andromeda glaucophylla, Cladopodiella fluitans, Carex limosa, Eriophorum virginicum, Rhynchospora alba and Sphagnum cuspidatum.

  17. Life cycle environmental implications of residential swimming pools.

    Science.gov (United States)

    Forrest, Nigel; Williams, Eric

    2010-07-15

    Ownership of private swimming pools in the U.S. grew 2 to 4% per annum from 1997 to 2007. The environmental implications of pool ownership are analyzed by hybrid life cycle assessment (LCA) for nine U.S. cities. An operational model is constructed estimating consumption of chemicals, water, and energy for a typical residential pool. The model incorporates geographical climatic variations and upstream water and energy use from electricity and water supply networks. Results vary considerably by city: a factor of 5-6 for both water and energy use. Water use is driven by aridness and length of the swimming season, while energy use is mainly driven by length of the swimming season. Water and energy impacts of pools are significant, particularly in arid climates. In Phoenix for example pools account for 22% and 13% of a household's electricity and water use, respectively. Measures to reduce water and energy use in pools such as optimizing the pump schedule and covering the pool in winter can realize greater savings than many common household efficiency improvements. Private versus community pools are also compared. Community pools in Phoenix use 60% less swimming pool water and energy per household than subdivisions without community pools.

  18. Reduction of the pool-top radiation level in HANARO

    International Nuclear Information System (INIS)

    Lee, Choong-Sung; Park, Sang-Jun; Kim, Heonil; Park, Yong-Chul; Choi, Young-San

    1999-01-01

    HANARO is an open-tank-in-pool type reactor. Pool water is the only shielding to minimize the pool top radiation level. During the power ascension test of HANARO, the measured pool top radiation level was higher than the design value because some of the activation products in the coolant reached the pool surface. In order to suppress this rising coolant, the hot water layer system (HWL) was designed and installed to maintain l.2 meter-deep hot water layer whose temperature is 5degC higher than that of the underneath pool surface. After the installation of the HWL system, however, the radiation level of the pool-top did not satisfy the design value. The operation modes of the hot water layer system and the other systems in the reactor pool, which had an effect on the formation of the hot water layer, were changed to reduce pool-top radiation level. After the above efforts, the temperature and the radioactivity distribution in the pool was measured to confirm whether this system blocked the rising coolant. The radiation level at the pool-top was significantly reduced below one tenth of that before installing the HWL and satisfied the design value. It was also confirmed by calculation that this hot water layer system would significantly reduce the release of fission gases to the reactor hall and the environment during the hypothetical accident as well. (author)

  19. Design of inventory pools in spare part support operation systems

    Science.gov (United States)

    Mo, Daniel Y.; Tseng, Mitchell M.; Cheung, Raymond K.

    2014-06-01

    The objective of a spare part support operation is to fulfill the part request order with different service contracts in the agreed response time. With this objective to achieve different service targets for multiple service contracts and the considerations of inventory investment, it is not only important to determine the inventory policy but also to design the structure of inventory pools and the order fulfilment strategies. In this research, we focused on two types of inventory pools: multiple inventory pool (MIP) and consolidated inventory pool (CIP). The idea of MIP is to maintain separated inventory pools based on the types of service contract, while CIP solely maintains a single inventory pool regardless of service contract. Our research aims to design the inventory pool analytically and propose reserve strategies to manage the order fulfilment risks in CIP. Mathematical models and simulation experiments would be applied for analysis and evaluation.

  20. Behavior of spent nuclear fuel in water pool storage

    International Nuclear Information System (INIS)

    Johnson, A.B. Jr.

    1977-09-01

    Storage of irradiated nuclear fuel in water pools (basins) has been standard practice since nuclear reactors first began operation approximately 34 years ago. Pool storage is the starting point for all other fuel storage candidate processes and is a candidate for extended interim fuel storage until policy questions regarding reprocessing and ultimate disposal have been resolved. This report assesses the current performance of nuclear fuel in pool storage, the range of storage conditions, and the prospects for extending residence times. The assessment is based on visits to five U.S. and Canadian fuel storage sites, representing nine storage pools, and on discussions with operators of an additional 21 storage pools. Spent fuel storage experience from British pools at Winfrith and Windscale and from a German pool at Karlsruhe (WAK) also is summarized

  1. Investigation of the condition of spent-fuel pool components

    International Nuclear Information System (INIS)

    Kustas, F.M.; Bates, S.O.; Opitz, B.E.; Johnson, A.B. Jr.; Perez, J.M. Jr.; Farnsworth, R.K.

    1981-09-01

    It is currently projected that spent nuclear fuel, which is discharged from the reactor and then stored in water pools, may remain in those pools for several decades. Other studies have addressed the expected integrity of the spent fuel during extended water storage; this study assesses the integrity of metallic spent fuel pool components. Results from metallurgical examinations of specimens taken from stainless steel and aluminum components exposed in spent fuel pools are presented. Licensee Event Reports (LERs) relating to problems with spent fuel components were assessed and are summarized to define the types of operational problems that have occurred. The major conclusions of this study are: aluminum and stainless steel spent fuel pool components have a good history of performance in both deionized and borated water pools. Although some operational problems involving pool components have occurred, these problems have had minimal impacts

  2. Decontamination of outdoor school swimming pools in Fukushima

    International Nuclear Information System (INIS)

    Saegusa, Jun

    2013-01-01

    After the Fukushima Daiichi NPP accident following the Great East Japan Earthquake, many school swimming pools in Fukushima have suspended water discharge, due to concerns that pool water which contains radioactive fallout is discharged into a river or waterway for agricultural use. The Japan Atomic Energy Agency conducted researches and examinations on the existing absorbent method and the flocculation method as ways for decontaminating pool water. By reviewing and improving these methods through decontamination demonstrations at eight pools in Fukushima, a practical decontamination method for outdoor pools has been established. This report summarizes the methods and results of the decontamination demonstrations carried out at the schools. Also, the surface density of fallout estimated at one of the pools is also presented and discussed in connection with the overall collection ratio of radiocesium at the pool. (author)

  3. Investigation of the condition of spent-fuel pool components

    Energy Technology Data Exchange (ETDEWEB)

    Kustas, F.M.; Bates, S.O.; Opitz, B.E.; Johnson, A.B. Jr.; Perez, J.M. Jr.; Farnsworth, R.K.

    1981-09-01

    It is currently projected that spent nuclear fuel, which is discharged from the reactor and then stored in water pools, may remain in those pools for several decades. Other studies have addressed the expected integrity of the spent fuel during extended water storage; this study assesses the integrity of metallic spent fuel pool components. Results from metallurgical examinations of specimens taken from stainless steel and aluminum components exposed in spent fuel pools are presented. Licensee Event Reports (LERs) relating to problems with spent fuel components were assessed and are summarized to define the types of operational problems that have occurred. The major conclusions of this study are: aluminum and stainless steel spent fuel pool components have a good history of performance in both deionized and borated water pools. Although some operational problems involving pool components have occurred, these problems have had minimal impacts.

  4. Technical assessment study on pool-type LMFBR

    International Nuclear Information System (INIS)

    1986-01-01

    Technical assessment study on pool-type LMFBR was started in 1984 FY, inheriting the products from the Feasibility study, in order to accomplish cost reduction of reactor structure and enhanced structural reliability. This study consists of four major subjects; aseismic design development, component design optimization, high temperature structural design optimization and thermal hydraulics design optimization. In 1985 FY numbers of large model tests and analytical evaluations have been performed based on the prospects obtained in the first year's study. These tests and analyses have produced a lot of findings in each subject. They are concerning; (1) the effect of various building structures and analysis methods on floor response reduction, and data for evaluation of aseismic design concepts and structural integrity to seismic loading in the aseismic design development study. (2) data for evaluation of size reduction of main components in the reactor vessel, and heat transfer data required for structural integrity evaluation in the component design optimization study. (3) data for verification of inelastic analysis method, and assurance of technical applicability of disimilar weld in the high temperature structural design optimization study. (4) the effect of component size and location on thermal hydraulic characteristics, and data of thermal hydraulic similarity in thermal hydraulic design optimization study. This report summarizes the results obtained in 1985 FY. (author)

  5. Expanding the live kidney donor pool: ethical considerations regarding altruistic donors, paired and pooled programs.

    Science.gov (United States)

    Patel, Shaneel Rajendra; Chadha, Priyanka; Papalois, Vassilios

    2011-06-01

    In renal transplant, there is a well-known deficiency in organ supply relative to demand. Live donation provides superior results when compared with deceased donation including a better rate of graft success and fewer immunologic complications. This deficiency in organs leads to significant morbidity and mortality rates. Alternative avenues have been extensively explored that may expand the live donor pool. They include altruistic donation as well as paired and pooled exchange programs. Altruistic donation is a truly selfless act from a donor unknown to the recipient. Kidney paired donation involves 2 incompatible donor-recipient pairs swapping donors to produce compatibility. Pooled donation involves at least 2 pairs, and can take the form of domino chains in which altruistic input sets up a chain of transplants, in which each recipient's incompatible donor makes a donation for the next recipient. Despite application of these various methods, there lie extensive ethical issues surrounding them. Misconceptions frequently occur; for instance, the perceived benefit that donating an organ to a loved one is greater for a related donor than for an altruistic one. Additionally, it is frequently believed that immunologic incompatibility offers coerced donors liberation from surgery, and that overcoming these barriers by introducing exchange programs provides vulnerable donors less protection. This article explores these and other complex ethical issues surrounding the various methods of expanding the donor pool. The authors offer opinions that challenge the ethical issues and attempt to overcome those views that hinder progress in the field.

  6. Fluid-structure interaction analysis of a water pool under loading caused by steam injection

    International Nuclear Information System (INIS)

    Timperi, A.; Paettikangas, T.; Niemi, J.; Ilvonen, M.

    2006-04-01

    CFD and structural analysis codes. MpCCI 3.0 was used for coupling Fluent CFD code with ABAQUS FE code. ES-FSI was used for coupling Star-CD CFD code with ABAQUS. FSI analyses, in which the calculation was carried out entirely in ABAQUS, were also performed. In this case, acoustic elements were used for the fluid and the acoustic and structural domains were coupled. FSI calculations were performed for simple test cases and for a test pool at Lappeenranta University of Technology. The Method of Images was studied as an alternative method for the analyses of the pool. Particularly, the determination of pressure source for the method was studied. Earlier work carried out with the homogenous two-phase model was continued by testing the model with Fluent. Calculation of condensation of steam in a water pool was tested with a new implementation. The two-directionally coupled simulations of the pool with MpCCI and ES-FSI were found to be numerically instable. It was concluded that an implicit coupling method may have to be used in order to avoid the instability. Calculations of the pool were finally performed by using one directional coupling. In the simulations with MpCCI, the incompressible and compressible VOF models of Fluent were used. With ES-FSI, the incompressible VOF model of Star-CD was used for modelling the beginning of a steam injection experiment. The magnitudes of pressure and stress peaks in the simulation and experiment were of comparable size. Otherwise, however, differences between the simulation and experiment were large due to the simplifications used in the simulation. Results obtained with the acoustic-structural FE analyses were compared to analytical and experimental results. The results indicated that the coupled acoustic-structural analysis can be used for calculating the coupled Eigenmodes of BWR pressure suppression pools. (au)

  7. Fluid-structure interaction analysis of a water pool under loading caused by steam injection

    Energy Technology Data Exchange (ETDEWEB)

    Timperi, A.; Paettikangas, T.; Niemi, J.; Ilvonen, M. [VTT Technical Researc Centre of Finland (Finland)

    2006-04-15

    CFD and structural analysis codes. MpCCI 3.0 was used for coupling Fluent CFD code with ABAQUS FE code. ES-FSI was used for coupling Star-CD CFD code with ABAQUS. FSI analyses, in which the calculation was carried out entirely in ABAQUS, were also performed. In this case, acoustic elements were used for the fluid and the acoustic and structural domains were coupled. FSI calculations were performed for simple test cases and for a test pool at Lappeenranta University of Technology. The Method of Images was studied as an alternative method for the analyses of the pool. Particularly, the determination of pressure source for the method was studied. Earlier work carried out with the homogenous two-phase model was continued by testing the model with Fluent. Calculation of condensation of steam in a water pool was tested with a new implementation. The two-directionally coupled simulations of the pool with MpCCI and ES-FSI were found to be numerically instable. It was concluded that an implicit coupling method may have to be used in order to avoid the instability. Calculations of the pool were finally performed by using one directional coupling. In the simulations with MpCCI, the incompressible and compressible VOF models of Fluent were used. With ES-FSI, the incompressible VOF model of Star-CD was used for modelling the beginning of a steam injection experiment. The magnitudes of pressure and stress peaks in the simulation and experiment were of comparable size. Otherwise, however, differences between the simulation and experiment were large due to the simplifications used in the simulation. Results obtained with the acoustic-structural FE analyses were compared to analytical and experimental results. The results indicated that the coupled acoustic-structural analysis can be used for calculating the coupled Eigenmodes of BWR pressure suppression pools. (au)

  8. Technical specification for fabrication of HANARO pool cover

    Energy Technology Data Exchange (ETDEWEB)

    Ryu, Jeong Soo; Woo, Sang Ik

    2001-06-01

    This technical specification details the requirements and the acceptance criteria for design, seismic analysis, function test, installation and quality assurance for HANARO pool cover which will be installed at the top of reactor pool. The pool cover is classified as non-nuclear safety, seismic category II and quality class T. The basic design of the pool cover for increasing HANARO applications has been carried out for supporting the driving devices which can load, unload and rotate the irradiation targets in the in-core and out-core vertical irradiation holes under on-power operation. The comments of HANARO user group related with irradiation tests have optimally considered in the process of design. The interference between fuel handling and control absorber units in the reactor pool and activities to load, unload and rotate the irradiation targets at the top of the reactor pool have been minimized. The pool cover can be moved for maintenance and can protect the reactor pool from unexpected drop of foreign materials. It provides the space to vertical access of driving devices for NTD, CT/IR and OR4/OR5 under on-power operation. And the pool cover assembly must maintain its structural integrity under seismic load. Based on the above design concept, the HANARO pool cover has been proposed as supporting structure of driving devices for NTD, fission moly and RI production under on-power operation.

  9. Technical Facilities Management, Loan Pool, and Calibration

    Science.gov (United States)

    Smith, Jacob

    2011-01-01

    My work at JPL for the SURF program began on June 11, 2012 with the Technical Facilities Management group (TFM). As well as TFM, I worked with Loan Pool and Metrology to help them out with various tasks. Unlike a lot of other interns, I did not have a specific project rather many different tasks to be completed over the course of the 10 weeks.The first task to be completed was to sort through old certification reports in 6 different boxes to locate reports that needed to be archived into a digital database. There were no reports within these boxes that needed to be archived but rather were to be shredded. The reports went back to the early 1980's and up to the early 2000's. I was looking for reports dated from 2002 to 2012

  10. Soil carbon pools in different pasture systems

    Directory of Open Access Journals (Sweden)

    Francisco M. Cardozo, Jr.

    2016-03-01

    Full Text Available The aim of this study was to assess the carbon pools of a tropical soil where the native forest was replaced with different pasture systems. We studied five pasture production systems, including four monoculture systems with forage grasses such as Andropogon, Brachiaria, Panicum, and Cynodon, and an agroforestry system as well as a native vegetation plot. Greater availability of fulvic acid was detected in the agroforestry system as compared with that in the other systems. Higher lability of C was detected in the Andropogon system during the dry and rainy seasons and during the dry season in Cynodon. During the dry season, all pastures systems showed deficits in the net removal of atmospheric CO2. The structure and practices of the agroforestry system enables more carbon to be sequestered in the soil as compared with the monoculture pasture, suggesting that it is an important practice to mitigate climatic change and to improve soil quality.

  11. Corrosion surveillance in spent fuel storage pools

    International Nuclear Information System (INIS)

    Howell, J.P.

    1996-01-01

    In mid-1991, corrosion of aluminum-clad spent nuclear fuel was observed in the light-water filled basins at the Savannah River site. A corrosion surveillance program was initiated in the P, K, L-Reactor basins and in the Receiving Basin for Offsite Fuels (RBOF). This program verified the aggressive nature of the pitting corrosion and provided recommendations for changes in basin operations to permit extended longer term interim storage. The changes were implemented during 1994--1996 and have resulted in significantly improved basin water quality with conductivity in the 1--3 microS/cm range. Under these improved conditions, no new pitting has been observed over the last three years. This paper describes the corrosion surveillance program at SRS and what has been learned about the corrosion of aluminum-clad in spent fuel storage pools

  12. Drop Impact on to Moving Liquid Pools

    Science.gov (United States)

    Muñoz-Sánchez, Beatriz Natividad; Castrejón-Pita, José Rafael; Castrejón-Pita, Alfonso Arturo; Hutchings, Ian M.

    2014-11-01

    The deposition of droplets on to moving liquid substrates is an omnipresent situation both in nature and industry. A diverse spectrum of phenomena emerges from this simple process. In this work we present a parametric experimental study that discerns the dynamics of the impact in terms of the physical properties of the fluid and the relative velocity between the impacting drop and the moving liquid pool. The behaviour ranges from smooth coalescence (characterized by little mixing) to violent splashing (generation of multiple satellite droplets and interfacial vorticity). In addition, transitional regimes such as bouncing and surfing are also found. We classify the system dynamics and show a parametric diagram for the conditions of each regime. This work was supported by the EPSRC (Grant EP/H018913/1), the Royal Society, Becas Santander Universidades and the International Relationships Office of the University of Extremadura.

  13. One knowledge base or many knowledge pools?

    DEFF Research Database (Denmark)

    Lundvall, Bengt-Åke

    It is increasingly realized that knowledge is the most important resource and that learning is the most important process in the economy. Sometimes this is expressed by coining the current era as characterised by a ‘knowledge based economy'. But this concept might be misleading by indicating...... that there is one common knowledge base on which economic activities can be built. In this paper we argue that it is more appropriate to see the economy as connecting to different ‘pools of knowledge'. The argument is built upon a conceptual framework where we make distinctions between private/public, local....../global, individual/collective and tacit/codified knowledge. The purpose is both ‘academic' and practical. Our analysis demonstrates the limits of a narrowly economic perspective on knowledge and we show that these distinctions have important implications both for innovation policy and for management of innovation....

  14. Hydrodynamics of AHWR gravity driven water pool under simulated LOCA conditions

    International Nuclear Information System (INIS)

    Thangamani, I.; Verma, Vishnu; Ali, Seik Mansoor

    2015-01-01

    The Advanced Heavy Water Reactor (AHWR) employs a double containment concept with a large inventory of water within the Gravity Driven Water Pool (GDWP) located at a high elevation within the primary containment building. GDWP performs several important safety functions in a passive manner, and hence it is essential to understand the hydrodynamics that this pool will be subjected to in case of an accident such as LOCA. In this paper, a detailed thermal hydraulic analysis for AHWR containment transients is presented for postulated LOCA scenarios involving RIH break sizes ranging from 2% to 50%. The analysis is carried out using in-house containment thermal hydraulics code 'CONTRAN'. The blowdown mass and energy discharge data for each break size, along with the geometrical details of the AHWR containment forms the main input for the analysis. Apart from obtaining the pressure and temperature transients within the containment building, the focus of this work is on simulating the hydrodynamic phenomena of vent clearing and pool swell occurring in the GDWP. The variation of several key parameters such as primary containment V1 and V2 volume pressure, temperature and V1-V2 differential pressure with time, BOP rupture time, vent clearing velocity, effect of pool swell on the V2 air-space pressure, GDWP water level etc. are discussed in detail and important findings are highlighted. Further, the effect of neglecting the pool swell phenomenon on the containment transients is also clearly brought out by a comparative study. The numerical studies presented in this paper give insight into containment transients that would be useful to both the system designer as well as the regulator. (author)

  15. Effect of corn grain particle size on ruminal fermentation and blood metabolites of Holstein steers fed total mixed ration

    Directory of Open Access Journals (Sweden)

    Do Hyung Kim

    2018-01-01

    Full Text Available Objective This study was conducted to investigate the effect of corn grain particle size on ruminant fermentation and blood metabolites in Holstein steers fed total mixed ration (TMR as a basal diet to explain fundamental data of corn grain for cattle in Korea. Methods Four ruminally cannulated Holstein steers (body weight 592±29.9 kg fed TMR as a basal diet were housed individually in an auto temperature and humidity modulated chamber (24°C and 60% for 22 h/d. Treatments in a 4×4 Latin square design were TMR only (control, TMR with whole corn grain (WC, coarsely ground corn grain (CC, and finely ground corn grain (FC, respectively. The corn feeds substituted for 20% energy intake of TMR intake. To measure the ruminal pH, ammonia N, and volatile fatty acids (VFA, ruminal digesta was sampled through ruminal cannula at 1 h intervals after the morning feeding to determine ruminal fermentation characteristics. Blood was sampled via the jugular vein after the ruminal digesta sampling. Results There was no difference in dry matter (DM intake between different corn particle size because the DM intake was restricted to 1.66% of body weight. Different corn particle size did not change mean ammonia N and total VFA concentrations whereas lower (p<0.05 ruminal pH and a ratio of acetate to propionate, and higher (p<0.05 propionate concentration were noted when the steers consumed CC compared with WC and FC. Concentration of blood metabolites were not affected by different particle size of corn grain except for blood triglyceride concentration, which was significantly (p<0.05 increased by FC. Conclusion Results indicate that feeding CC may increase feed digestion in the rumen, whereas the FC group seemed to obtain inadequate corn retention time for microbial degradation in the rumen.

  16. Improvement of sampling plans for Salmonella detection in pooled table eggs by use of real-time PCR

    DEFF Research Database (Denmark)

    Pasquali, Frédérique; De Cesare, Alessandra; Valero, Antonio

    2014-01-01

    Eggs and egg products have been described as the most critical food vehicles of salmonellosis. The prevalence and level of contamination of Salmonella on table eggs are low, which severely affects the sensitivity of sampling plans applied voluntarily in some European countries, where one to five...... pools of 10 eggs are tested by the culture based reference method ISO 6579:2004. In the current study we have compared the testing-sensitivity of the reference culture method ISO 6579:2004 and an alternative real-time PCR method on Salmonella contaminated egg-pool of different sizes (4-9 uninfected eggs...... mixed with one contaminated egg) and contamination levels (10°-10(1), 10(1)-10(2), 10(2)-10(3)CFU/eggshell). Two hundred and seventy samples corresponding to 15 replicates per pool size and inoculum level were tested. At the lowest contamination level real-time PCR detected Salmonella in 40...

  17. Indoor swimming pools. Humidity caused problems and suggested solutions

    Energy Technology Data Exchange (ETDEWEB)

    1989-01-01

    Reports have been received from across Canada on premature deterioration and other problems of indoor swimming pool buildings. This technical paper has been prepared to assist pool managers to solve these problems, which typically include leaking roofs, condensation on inside walls, peeling paint, efflorescence, rusting of metal elements, deterioration of concrete block structures, and high costs for pool heating. An effective insulation and vapor barrier system for a swimming pool roof is described, and the high relative humidity of the typical pool building is discussed as the primary cause of most problems. Proper sealing to cut down air infiltration is recommended, along with proper maintenance and painting. High energy costs are often due to low insulation values and to excessive ventilation used for decreasing the humidity. By using dehumidifiers capable of heat recovery, and by placing an insulating blanket on the pool after operating hours, it is shown that substantial cost savings are possible. 10 figs.

  18. Turbulence model for melt pool natural convection heat transfer

    International Nuclear Information System (INIS)

    Kelkar, K.M.; Patankar, S.V.

    1994-01-01

    Under severe reactor accident scenarios, pools of molten core material may form in the reactor core or in the hemispherically shaped lower plenum of the reactor vessel. Such molten pools are internally heated due to the radioactive decay heat that gives rise to buoyant flows in the molten pool. The flow in such pools is strongly influenced by the turbulent mixing because the expected Rayleigh numbers under accidents scenarios are very high. The variation of the local heat flux over the boundaries of the molten pools are important in determining the subsequent melt progression behavior. This study reports results of an ongoing effort towards providing a well validated mathematical model for the prediction of buoyant flow and heat transfer in internally heated pool under conditions expected in severe accident scenarios

  19. Sharing as risk pooling in a social dilemma experiment

    Directory of Open Access Journals (Sweden)

    Todd L. Cherry

    2015-03-01

    Full Text Available In rural economies with missing or incomplete markets, idiosyncratic risk is frequently pooled through informal networks. Idiosyncratic shocks, however, are not limited to private goods but can also restrict an individual from partaking in or benefiting from a collective activity. In these situations, a group must decide whether to provide insurance to the affected member. We describe results of a laboratory experiment designed to test whether a simple sharing institution can sustain risk pooling in a social dilemma with idiosyncratic risk. We tested whether risk could be pooled without a commitment device and, separately, whether effective risk pooling induced greater cooperation in the social dilemma. We found that even in the absence of a commitment device or reputational considerations, subjects voluntarily pooled risk, thereby reducing variance in individual earnings. In spite of effective risk pooling, however, cooperation in the social dilemma was unaffected.

  20. The burning and smoke release rates of sodium pool fires

    International Nuclear Information System (INIS)

    Newman, R.N.; Payne, J.F.B.

    1976-10-01

    The burning rates and smoke release fractions of sodium pool fires have been measured over the pool temperature range 250 0 C to 750 0 C. A theoretical model is derived which satisfactorily predicts the burning rate over the above temperature range. The theory further predicts that the burning rate should be independent of pool diameter, a prediction supported by a comparison of burning rate data from this study and available data from other studies. (author)

  1. Investigating the influence of DNAPL spill characteristics on source zone architecture and mass removal in pool-dominated source zones

    Science.gov (United States)

    Wallace, K. A.; Abriola, L.; Chen, M.; Ramsburg, A.; Pennell, K. D.; Christ, J.

    2009-12-01

    Multiphase, compositional simulators were employed to investigate the spill characteristics and subsurface properties that lead to pool-dominated, dense non-aqueous phase liquid (DNAPL) source zone architectures. DNAPL pools commonly form at textural interfaces where low permeability lenses restrict the vertical migration of DNAPL, allowing for DNAPL to accumulate, reaching high saturation. Significant pooling has been observed in bench-scale experiments and field settings. However, commonly employed numerical simulations rarely predict the pooling suspected in the field. Given the importance of pooling on the efficacy of mass recovery and the down-gradient contaminant signal, it is important to understand the predominant factors affecting the creation of pool-dominated source zones and their subsequent mass discharge. In this work, contaminant properties, spill characteristics and subsurface permeability were varied to investigate the factors contributing to the development of a pool-dominated source zone. DNAPL infiltration and entrapment simulations were conducted in two- and three-dimensional domains using the University of Texas Chemical Compositional (UTCHEM) simulator. A modified version of MT3DMS was then used to simulate DNAPL dissolution and mass discharge. Numerical mesh size was varied to investigate the importance of numerical model parameters on simulations results. The temporal evolution of commonly employed source zone architecture metrics, such as the maximum DNAPL saturation, first and second spatial moments, and fraction of DNAPL mass located in pools, was monitored to determine how the source zone architecture evolved with time. Mass discharge was monitored to identify the link between source zone architecture and down-gradient contaminant flux. Contaminant characteristics and the presence of extensive low permeability lenses appeared to have the most influence on the development of a pool-dominated source zone. The link between DNAPL mass

  2. (Microbiological studies of small hot-bath-pools and hot-whirl-pools (author's transl))

    Energy Technology Data Exchange (ETDEWEB)

    Exner, M; Havenith, N

    1981-01-01

    Hot small bathing pools and hot whirl-pools have the following characteristics: small watervolume, thick squeeze of swimmers, high water temperature (37-40 degrees C) and small dimension of filters. By this, the quality of bathing-water is influenced detrimentally. To elaborate the hygienic problems, bathing-water samples were taken before, during and after the visiting-hours and were tested for facultative-pathogenic microorganisms. During this investigation E. coli was isolated in 25 degrees, Coliforms and Proteus species in 37.3%, P. aeruginosa in 36%, S. aureus in 26.3%, Enterococci in 42.3 %, Candida albicans in 3.6% and yeast totally in 8.3%.

  3. The atmospheric wet pool: definition and comparison with the oceanic warm pool

    Institute of Scientific and Technical Information of China (English)

    ZHANG Caiyun; CHEN Ge

    2008-01-01

    The oceanic warm pool (OWP) defined by sea surface temperature (SST) is known as the "heat reservoir" in the ocean. The warmest portion in the ocean mirrors the fact that the wettest region with the largest accumulation of water vapor (WV) in the atmosphere, termed atmospheric wet pool (AWP), should be identified because of the well-known Clausius-Clapeyron relationship between SST and WV. In this study, we used 14-year simultaneous observations of WV and SST from January 1988 to December 2001 to define the AWP and investigate its coupling and co-variations with the OWP. The joint examination of the area variations, centroid locations, and zonal migrations of the AWP and OWP lead to a number of interesting findings. The results hopefully can contribute to our understanding of the air-sea interaction in general and characterization of El Nifio/La Nina events in particular.

  4. The relationship between variation in size of the primordial follicle pool and age at natural menopause

    NARCIS (Netherlands)

    Depmann, M.; Faddy, M. J.; Van Der Schouw, Y. T.; Peeters, P. H M; Broer, S. L.; Kelsey, T. W.; Nelson, S. M.; Broekmans, F. J M

    2015-01-01

    Context: Menopause has been hypothesized to occur when the nongrowing follicle (NGF) number falls below a critical threshold. Age at natural menopause can be predicted using NGF numbers and this threshold. These predictions support the use of ovarian reserve tests, reflective of the ovarian follicle

  5. Species pool size and realized species richness affect productivity differently: A modeling study

    Czech Academy of Sciences Publication Activity Database

    Stachová, T.; Lepš, Jan

    2010-01-01

    Roč. 36, č. 6 (2010), s. 578-586 ISSN 1146-609X R&D Projects: GA ČR GD206/08/H044; GA MŠk LC06073 Institutional research plan: CEZ:AV0Z50070508 Keywords : biodiversity * ecosystem functioning * diversity-productivity relationship Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 1.460, year: 2010 http://www.sciencedirect.com/science/article/pii/S1146609X10001037

  6. 10 CFR 905.32 - Resource extensions and resource pool size.

    Science.gov (United States)

    2010-01-01

    ... 905.32 Energy DEPARTMENT OF ENERGY ENERGY PLANNING AND MANAGEMENT PROGRAM Power Marketing Initiative... begin, to existing customers with long-term firm power contracts. The remaining unextended power will be... Projects. (b) At two 5-year intervals after the effective date of the extension to existing customers...

  7. Measuring size and composition of species pools: a comparison of dark diversity estimates

    Czech Academy of Sciences Publication Activity Database

    de Bello, Francesco; Fibich, Pavel; Zelený, D.; Kopecký, Martin; Mudrák, Ondřej; Chytrý, M.; Pyšek, Petr; Wild, Jan; Michalcová, D.; Sádlo, Jiří; Šmilauer, P.; Lepš, Jan; Pärtel, M.

    2016-01-01

    Roč. 6, č. 12 (2016), s. 4088-4101 ISSN 2045-7758 R&D Projects: GA ČR GB14-36079G; GA ČR GAP505/12/1296 Grant - others:AV ČR(CZ) AP1002 Program:Akademická prémie - Praemium Academiae Institutional support: RVO:67985939 ; RVO:60077344 Keywords : Beals smoothing * Biodiversity monitoring * Biomod Subject RIV: EH - Ecology, Behaviour Impact factor: 2.440, year: 2016

  8. Aerosol release from a hot sodium pool and behaviour in inert gas atmosphere

    International Nuclear Information System (INIS)

    Sauter, H.; Schuetz, W.

    1986-01-01

    In the KfK-NALA program, experiments were carried out on the subject of aerosol release from a contaminated sodium pool into inert gas atmosphere under various conditions. Besides the determination of retention factors for fuel and fission products, the sodium aerosol system was investigated and characterized, concerning aerosol generation (evaporation rate), particle size, mass concentration, and deposition behaviour. Pool temperatures were varied between 700 and 1000 K at different geometrical and convective conditions. Technical scale experiments with a 531-cm 2 pool surface area were performed at natural convection in a 2.2-m 3 heated vessel, as well as additional small scale experiments at forced convection and 38.5-cm 2 pool surface area. A best-fit formula is given for the specific evaporation rate into a 400 K argon atmosphere. Approximately, the very convenient relation (dm/dt) (kg/m 2 /h) = 0.1 p (mm Hg) was found. The sodium aerosol diameter lay between 0.6 μm, less than 1 sec after production, and 2.5 μm at maximum concentration. The deposition behaviour was characterized by very small quantities ( 80%) on the bottom cover of the vessel. In the model theoretic studies with the PARDISEKO code, calculations were performed of the mass concentration, particle diameter and deposition behaviour. Agreement with the experimental values could not be achieved until a modulus was introduced to allow for turbulent deposition. (author)

  9. The influence of labor market changes on first-time medical school applicant pools.

    Science.gov (United States)

    Cort, David A; Morrison, Emory

    2014-12-01

    To explore whether the number and composition of first-time applicants to U.S. MD-granting medical schools, which have fluctuated over the past 30 years, are related to changes in labor market strength, specifically the unemployment rate and wages. The authors merged time series data from 1980 through 2010 (inclusive) from five sources and used multivariate time series models to determine whether changes in labor market strength (and several other macro-level factors) were related to the number of the medical school applicants as reported by the American Medical College Application Service. Analyses were replicated across specific sex and race/ethnicity applicant pools. Two results surfaced in the analyses. First, the strength of the labor market was not influential in explaining changes in applicant pool sizes for all applicants, but was strongly influential in explaining changes for black and Hispanic males. Increases of $1,000 in prevailing median wages produced a 1.6% decrease in the white male applicant pool, while 1% increases in the unemployment rate were associated with 4.5% and 3.1% increases in, respectively, the black and Hispanic male applicant pools. Second, labor market strength was a more important determinant in applications from males than in applications from females. Although stakeholders cannot directly influence the overall economic market, they can plan and prepare for fewer applications from males, especially those who are black and Hispanic, when the labor market is strong.

  10. Chin Shan analyses show advantages of whole pool multi-rack approach

    International Nuclear Information System (INIS)

    Singh, K.P.; Soler, A.I.

    1991-01-01

    Nuclear fuel storage racks are essentially thin-walled, cellular structures of prismatic cross-section. Although the details of design vary from one supplier to another, certain key physical attributes are common to all designs. For example, all racks feature square cells of sufficient opening size and height to enable insertion and withdrawal of the fuel assembly. The array of cells is positioned in a vertical orientation and is supported off the pool slab surface by four or more support legs. The spent fuel pool is filled with the individual fuel racks. The plenum created by the support legs is essential for proper cooling of the fuel assemblies stored in the rack, which relies on natural convective cooling to extract the heat emitted by the spent fuel. However, it has the insalutary effect of making it kinematically less stable. Regulatory authorities require careful and comprehensive analysis of the response of the racks under the seismic motions postulated for the pool slab. Results from whole pool multi-rack (WPMR) analyses at the Chin Shan and Oyster Creek nuclear plants point up the potential inadequacies of single rack 3D analyses, and show just how important it is to carry out WPMR simulations, despite their abstruseness and high cost. (author)

  11. CFD aided analysis of a scaled down model of the Brazilian Multipurpose Reactor (RMB) pool

    International Nuclear Information System (INIS)

    Schweizer, Fernando L.A.; Lima, Claubia P.B.; Costa, Antonella L.; Veloso, Maria A.F.

    2013-01-01

    Research reactors are commonly built inside deep pools that provide radiological and thermal protection and easy access to its core. Reactors with thermal power in the order of MW usually use an auxiliary thermal-hydraulic circuit at the top of its pool to create a purified hot water layer (HWL). Thermal-hydraulic analysis of the flow configuration in the pool and HWL is paramount to insure radiological protection. A useful tool for these analyses is the application of CFD (Computational Fluid Dynamics). To obtain satisfactory results using CFD it is necessary the verification and validation of the CFD numerical model. Verification is divided in code and solution verifications. In the first one establishes the correctness of the CFD code implementation and in the former estimates the numerical accuracy of a particular calculation. Validation is performed through comparison of numerical and experimental results. This paper presents a dimensional analysis of the RMB (Brazilian Multipurpose Reactor) pool to determine a scaled down experimental installation able to aid in the HWL numerical investigation. Two CFD models were created one with the same dimensions and boundary conditions of the reactor prototype and the other with 1/10 proportion size and boundary conditions set to achieve the same inertial and buoyant forces proportions represented by Froude Number between the two models. Results comparing the HWL thickness show consistence between the prototype and the scaled down model behavior. (author)

  12. Nuclear Insurance Pools: World-wide Practice and Prospective

    International Nuclear Information System (INIS)

    Reitsma, S. M. S.

    2000-01-01

    The following paper explains why Nuclear Insurance Pools were established, how they operate and what insurance protection they offer to the operations of nuclear installations. It will be shown that the clear interrelationship of the Pool-insurance operations, both on a national and an international level, has resulted in a transparency of each individual Pool-Member's exposure, which enables him to make the highest possible commitment to nuclear risks. Finally, some views will be given as regards the future prospective for the long proven method of pooling this particularly sensitive class of business. (author)

  13. A Double Evolutionary Pool Memetic Algorithm for Examination Timetabling Problems

    Directory of Open Access Journals (Sweden)

    Yu Lei

    2014-01-01

    Full Text Available A double evolutionary pool memetic algorithm is proposed to solve the examination timetabling problem. To improve the performance of the proposed algorithm, two evolutionary pools, that is, the main evolutionary pool and the secondary evolutionary pool, are employed. The genetic operators have been specially designed to fit the examination timetabling problem. A simplified version of the simulated annealing strategy is designed to speed the convergence of the algorithm. A clonal mechanism is introduced to preserve population diversity. Extensive experiments carried out on 12 benchmark examination timetabling instances show that the proposed algorithm is able to produce promising results for the uncapacitated examination timetabling problem.

  14. Crust formation and its effect on the molten pool coolability

    Energy Technology Data Exchange (ETDEWEB)

    Park, R.J.; Lee, S.J.; Sim, S.K. [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)

    1995-09-01

    Experimental and analytical studies of the crust formation and its effect on the molten pool coolability have been performed to examine the crust formation process as a function of boundary temperatures as well as to investigate heat transfer characteristics between molten pool and overlying water in order to evaluate coolability of the molten pool. The experimental test results have shown that the surface temperature of the bottom plate is a dominant parameter in the crust formation process of the molten pool. It is also found that the crust thickness of the case with direct coolant injection into the molten pool is greater than that of the case with a heat exchanger. Increasing mass flow rate of direct coolant injection to the molten pool does not affect the temperature of molten pool after the crust has been formed in the molten pool because the crust behaves as a thermal barrier. The Nusselt number between the molten pool and the coolant of the case with no crust formation is greater than that of the case with crust formation. The results of FLOW-3D analyses have shown that the temperature distribution contributes to the crust formation process due to Rayleigh-Benard natural convection flow.

  15. Automated management of engineering infrastructure of pools of different purpose

    Directory of Open Access Journals (Sweden)

    Shirokov Lev Alekseevich

    2016-10-01

    Full Text Available Pools play an important role in people’s life. They answer people’s demand in rest and improve their health. At the same time pools are rather important for industrial use, for example in construction industry. In order to solve different construction problems it is essential to investigate the influence of microclimatic parameters on construction materials and structures. For this aim pools are in demand as special test sites for construction materials and structures in different environmental conditions including the case of a direct water impact. The efficient use of pools presupposes the necessity of constant hydroclimatic contro: air humidity and temperature, water temperature, chemical composition of water and air. Classification of pools of different purposes is presented in the article. The author considers the main problems of operation of pools as objects with complicated air-and-water environment. The questions of maintaining optimal microclimatic parameters in a pool are considered. The necessity of use of the control system of a microclimate, its efficiency, profitability and social effect of its implementation is described. A mathematical model of the thermal mode of a pool area is constructed. The process of indoor temperature regulation in the pool is considered.

  16. Steam blowdown experiments with the condensation pool test rig

    International Nuclear Information System (INIS)

    Purhonen, H.; Puustinen, M.; Laine, J.; Raesaenen, A.; Kyrki-Rajamaeki, R.; Vihavainen, J.

    2005-01-01

    During a possible loss-of-coolant accident (Local) a large amount of non-condensable (nitrogen) and condensable (steam) gas is blown from the upper drywell of the containment to the condensation pool through the blowdown pipes at the boiling water reactors (BWRs). The wet well pool serves as the major heat sink for condensation of steam. The blowdown causes both dynamic and structural loads to the condensation pool. There might also be a risk that the gas discharging to the pool could push its way to the emergency core cooling systems (ECCS) and undermine their performance. (author)

  17. Evaporation-preventive device for nuclear reactor pool water

    International Nuclear Information System (INIS)

    Kurusu, Yoshihisa; Akabori, Shiro.

    1986-01-01

    Purpose: To prevent pool water from evaporating by a great amount in a reactor pool such as a spent fuel storing pool. Constitution: Air discharge and in-take ports are disposed just above the surface of the pool water and charge and discharge of airs are forcively carried out to form air curtains above the pool water. Water vapor evaporated from the surface of the pool water does not diffuse above the air curtains due to the air stream of the curtains, but is intaken into the intake port and then condensated into water by a steam condensator and re-supplied to the pool. Since diffusion of water vapor and radioactive materials are suppressed above the air curtains, the working circumstance in the pool chamber can be maintained desirably thereby keeping the radioactivity dose in the atmosphere. Further, incorporation of dusts from above into the pool can also be prevented by the air curtains to provide an effect for the prevention of radioactive contamination. Further, since covers are not used, visual observation can be insured. (Kawakami, Y.)

  18. Evaporation rate measurement in the pool of IEAR-1 reactor

    International Nuclear Information System (INIS)

    Torres, Walmir Maximo; Cegalla, Miriam A.; Baptista Filho, Benedito Dias

    2000-01-01

    The surface water evaporation in pool type reactors affects the ventilation system operation and the ambient conditions and dose rates in the operation room. This paper shows the results of evaporation rate experiment in the pool of IEA-R1 research reactor. The experiment is based on the demineralized water mass variation inside cylindrical metallic recipients during a time interval. Other parameters were measured, such as: barometric pressure, relative humidity, environmental temperature, water temperature inside the recipients and water temperature in the reactor pool. The pool level variation due to water contraction/expansion was calculated. (author)

  19. Comparison of individual and pooled stool samples for the assessment of intensity of Schistosoma mansoni and soil-transmitted helminth infections using the Kato-Katz technique.

    Science.gov (United States)

    Kure, Ashenafi; Mekonnen, Zeleke; Dana, Daniel; Bajiro, Mitiku; Ayana, Mio; Vercruysse, Jozef; Levecke, Bruno

    2015-09-24

    Our group has recently provided a proof-of-principle for the examination of pooled stool samples using McMaster technique as a strategy for the rapid assessment of intensity of soil-transmitted helminth infections (STH, Ascaris lumbricoides, Trichuris trichiura and hookworm). In the present study we evaluated this pooling strategy for the assessment of intensity of both STH and Schistosoma mansoni infections using the Kato-Katz technique. A cross-sectional survey was conducted in 360 children aged 5-18 years from six schools in Jimma Zone (southwest Ethiopia). We performed faecal egg counts (FECs) in both individual and pooled samples (pools sizes of 5, 10 and 20) to estimate the number of eggs per gram of stool (EPG) using the Kato-Katz technique. We also assessed the time to screen both individual and pooled samples. Except for hookworms, there was a significant correlation (correlation coefficient = 0.53-0.95) between the mean of individual FECs and the FECs of pooled samples for A. lumbricoides, T. trichiura and S. mansoni, regardless of the pool size. Mean FEC were 2,596 EPG, 125 EPG, 47 EPG, and 41 EPG for A. lumbricoides, T. trichiura, S. mansoni and hookworm, respectively. There was no significant difference in FECs between the examination of individual and pooled stool samples, except for hookworms. For this STH, pools of 10 resulted in a significant underestimation of infection intensity. The total time to obtain individual FECs was 65 h 5 min. For pooled FECs, this was 19 h 12 min for pools of 5, 14 h 39 min for pools of 10 and 12 h 42 min for pools of 20. The results indicate that pooling of stool sample holds also promise as a rapid assessment of infections intensity for STH and S. mansoni using the Kato-Katz technique. In this setting, the time in the laboratory was reduced by 70 % when pools of 5 instead of individual stool samples were screened.

  20. Utility of the pooling approach as applied to whole genome association scans with high-density Affymetrix microarrays

    Directory of Open Access Journals (Sweden)

    Gray Joanna

    2010-11-01

    Full Text Available Abstract Background We report an attempt to extend the previously successful approach of combining SNP (single nucleotide polymorphism microarrays and DNA pooling (SNP-MaP employing high-density microarrays. Whereas earlier studies employed a range of Affymetrix SNP microarrays comprising from 10 K to 500 K SNPs, this most recent investigation used the 6.0 chip which displays 906,600 SNP probes and 946,000 probes for the interrogation of CNVs (copy number variations. The genotyping assay using the Affymetrix SNP 6.0 array is highly demanding on sample quality due to the small feature size, low redundancy, and lack of mismatch probes. Findings In the first study published so far using this microarray on pooled DNA, we found that pooled cheek swab DNA could not accurately predict real allele frequencies of the samples that comprised the pools. In contrast, the allele frequency estimates using blood DNA pools were reasonable, although inferior compared to those obtained with previously employed Affymetrix microarrays. However, it might be possible to improve performance by developing improved analysis methods. Conclusions Despite the decreasing costs of genome-wide individual genotyping, the pooling approach may have applications in very large-scale case-control association studies. In such cases, our study suggests that high-quality DNA preparations and lower density platforms should be preferred.

  1. Human-caused Indo-Pacific warm pool expansion.

    Science.gov (United States)

    Weller, Evan; Min, Seung-Ki; Cai, Wenju; Zwiers, Francis W; Kim, Yeon-Hee; Lee, Donghyun

    2016-07-01

    The Indo-Pacific warm pool (IPWP) has warmed and grown substantially during the past century. The IPWP is Earth's largest region of warm sea surface temperatures (SSTs), has the highest rainfall, and is fundamental to global atmospheric circulation and hydrological cycle. The region has also experienced the world's highest rates of sea-level rise in recent decades, indicating large increases in ocean heat content and leading to substantial impacts on small island states in the region. Previous studies have considered mechanisms for the basin-scale ocean warming, but not the causes of the observed IPWP expansion, where expansion in the Indian Ocean has far exceeded that in the Pacific Ocean. We identify human and natural contributions to the observed IPWP changes since the 1950s by comparing observations with climate model simulations using an optimal fingerprinting technique. Greenhouse gas forcing is found to be the dominant cause of the observed increases in IPWP intensity and size, whereas natural fluctuations associated with the Pacific Decadal Oscillation have played a smaller yet significant role. Further, we show that the shape and impact of human-induced IPWP growth could be asymmetric between the Indian and Pacific basins, the causes of which remain uncertain. Human-induced changes in the IPWP have important implications for understanding and projecting related changes in monsoonal rainfall, and frequency or intensity of tropical storms, which have profound socioeconomic consequences.

  2. A Pooled Genome-Wide Association Study of Asperger Syndrome.

    Directory of Open Access Journals (Sweden)

    Varun Warrier

    Full Text Available Asperger Syndrome (AS is a neurodevelopmental condition characterized by impairments in social interaction and communication, alongside the presence of unusually repetitive, restricted interests and stereotyped behaviour. Individuals with AS have no delay in cognitive and language development. It is a subset of Autism Spectrum Conditions (ASC, which are highly heritable and has a population prevalence of approximately 1%. Few studies have investigated the genetic basis of AS. To address this gap in the literature, we performed a genome-wide pooled DNA association study to identify candidate loci in 612 individuals (294 cases and 318 controls of Caucasian ancestry, using the Affymetrix GeneChip Human Mapping version 6.0 array. We identified 11 SNPs that had a p-value below 1x10-5. These SNPs were independently genotyped in the same sample. Three of the SNPs (rs1268055, rs7785891 and rs2782448 were nominally significant, though none remained significant after Bonferroni correction. Two of our top three SNPs (rs7785891 and rs2782448 lie in loci previously implicated in ASC. However, investigation of the three SNPs in the ASC genome-wide association dataset from the Psychiatric Genomics Consortium indicated that these three SNPs were not significantly associated with ASC. The effect sizes of the variants were modest, indicating that our study was not sufficiently powered to identify causal variants with precision.

  3. Improvement of sampling plans for Salmonella detection in pooled table eggs by use of real-time PCR.

    Science.gov (United States)

    Pasquali, Frédérique; De Cesare, Alessandra; Valero, Antonio; Olsen, John Emerdhal; Manfreda, Gerardo

    2014-08-01

    Eggs and egg products have been described as the most critical food vehicles of salmonellosis. The prevalence and level of contamination of Salmonella on table eggs are low, which severely affects the sensitivity of sampling plans applied voluntarily in some European countries, where one to five pools of 10 eggs are tested by the culture based reference method ISO 6579:2004. In the current study we have compared the testing-sensitivity of the reference culture method ISO 6579:2004 and an alternative real-time PCR method on Salmonella contaminated egg-pool of different sizes (4-9 uninfected eggs mixed with one contaminated egg) and contamination levels (10°-10(1), 10(1)-10(2), 10(2)-10(3)CFU/eggshell). Two hundred and seventy samples corresponding to 15 replicates per pool size and inoculum level were tested. At the lowest contamination level real-time PCR detected Salmonella in 40% of contaminated pools vs 12% using ISO 6579. The results were used to estimate the lowest number of sample units needed to be tested in order to have a 95% certainty not falsely to accept a contaminated lot by Monte Carlo simulation. According to this simulation, at least 16 pools of 10 eggs each are needed to be tested by ISO 6579 in order to obtain this confidence level, while the minimum number of pools to be tested was reduced to 8 pools of 9 eggs each, when real-time PCR was applied as analytical method. This result underlines the importance of including analytical methods with higher sensitivity in order to improve the efficiency of sampling and reduce the number of samples to be tested. Copyright © 2013 Elsevier B.V. All rights reserved.

  4. Total quality in spent fuel pool reracking

    International Nuclear Information System (INIS)

    Cranston, J.S.; Bradbury, R.B.; Cacciapouti, R.J.

    1993-01-01

    The nuclear utility environment is one of strict cost control under prescriptive regulations and increasing public scrutiny. This paper presents the results of A Total Quality approach, by a dedicated team, that addresses the need for increased on-site spent fuel storage in this environment. Innovations to spent fuel pool reracking, driven by utilities' specific technical needs and shrinking budgets, have resulted in both product improvements and lower prices. A Total Quality approach to the entire turnkey project is taken, thereby creating synergism and process efficiency in each of the major phases of the project: design and analysis, licensing, fabrication, installation and disposal. Specific technical advances and the proven quality of the team members minimizes risk to the utility and its shareholders and provides a complete, cost effective service. Proper evaluation of spent fuel storage methods and vendors requires a full understanding of currently available customer driven initiatives that reduce cost while improving quality. In all phases of a spent fuel reracking project, from new rack design and analysis through old rack disposal, the integration of diverse experts, at all levels and throughout all phases of a reracking project, better serves utility needs. This Total Quality environment in conjunction with many technical improvements results in a higher quality product at a lower cost

  5. Positive year for Alberta power pool

    International Nuclear Information System (INIS)

    Reid-Carlson, D.

    1997-01-01

    The electricity power pool in Alberta completed its first year under deregulation. Results to date indicate that the competitive market has operated as intended. The effects of electricity pricing on the oil industry following deregulation were described, given the fact that electricity prices represent the second largest cost item to the oil industry after labour. The peculiarities of the mechanism of electricity pricing (based on hourly matching of supply offers to demand bids) were explained, highlighting the opportunities and risks to the oil industry caused by the hourly price variations and the difficulties involved in accurately forecasting on-peak and off-peak prices a full year in advance. In 1996 predicted average price was $14 to $17/MWh. The actual average price was $13.40/MWh. The general conclusion was that Alberta continues to have a surplus of electricity generation and is well positioned to to take advantage of its low generating costs, at least over the longer term. Short term bidding practices, however, may results in slightly higher system marginal prices

  6. Pool critical assembly pressure vessel facility benchmark

    International Nuclear Information System (INIS)

    Remec, I.; Kam, F.B.K.

    1997-07-01

    This pool critical assembly (PCA) pressure vessel wall facility benchmark (PCA benchmark) is described and analyzed in this report. Analysis of the PCA benchmark can be used for partial fulfillment of the requirements for the qualification of the methodology for pressure vessel neutron fluence calculations, as required by the US Nuclear Regulatory Commission regulatory guide DG-1053. Section 1 of this report describes the PCA benchmark and provides all data necessary for the benchmark analysis. The measured quantities, to be compared with the calculated values, are the equivalent fission fluxes. In Section 2 the analysis of the PCA benchmark is described. Calculations with the computer code DORT, based on the discrete-ordinates method, were performed for three ENDF/B-VI-based multigroup libraries: BUGLE-93, SAILOR-95, and BUGLE-96. An excellent agreement of the calculated (C) and measures (M) equivalent fission fluxes was obtained. The arithmetic average C/M for all the dosimeters (total of 31) was 0.93 ± 0.03 and 0.92 ± 0.03 for the SAILOR-95 and BUGLE-96 libraries, respectively. The average C/M ratio, obtained with the BUGLE-93 library, for the 28 measurements was 0.93 ± 0.03 (the neptunium measurements in the water and air regions were overpredicted and excluded from the average). No systematic decrease in the C/M ratios with increasing distance from the core was observed for any of the libraries used

  7. Iodine release from sodium pool combustion

    International Nuclear Information System (INIS)

    Sagawa, N.; Fukushima, Y.; Yokota, N.; Akagane, K.; Mochizuki, K.

    1979-01-01

    Iodine release associated with sodium pool combustion was determined by heating 20 gr sodium containing sodium iodide, which was labelled with 131 I and dissolved in the sodium in concentration of 1∼1,000 ppm, to burn on a nickel crucible in conditioned atmosphere in a closed vessel of 0.4 m 3 . Oxygen concentration was changed in 5∼21% and humidity in 0∼89% by mixing nitrogen gas and air. Combustion products were trapped by a Maypack filter composed of particle filters, copper screens and activated charcoal beds and by a glass beads pack cooled by liquid argon. Iodine collected on these filter elements was determined by radio-gas chromatography. When the sodium sample burned in the atmosphere of air at room temperature, the release fractions observed were 6∼33% for sodium and 1∼20% for iodine added in the sodium. The release iodine was present in aerosol at a ratio of 98%, and the remainder in the gas form. The release fraction of iodine trended to decrease as oxygen concentration and humidity in the atmosphere increased. No organic iodide was detected in the combustion products. (author)

  8. Swimming pools as heat sinks for air conditioners: Model design and experimental validation for natural thermal behavior of the pool

    Energy Technology Data Exchange (ETDEWEB)

    Woolley, Jonathan; Harrington, Curtis; Modera, Mark [University of California Davis, Western Cooling Efficiency Center, 1450 Drew Avenue, Suite 100, Davis, CA 95618 (United States)

    2011-01-15

    Swimming pools as thermal sinks for air conditioners could save approximately 40% on peak cooling power and 30% of overall cooling energy, compared to standard residential air conditioning. Heat dissipation from pools in semi-arid climates with large diurnal temperature shifts is such that pool heating and space cooling may occur concurrently; in which case heat rejected from cooling equipment could directly displace pool heating energy, while also improving space cooling efficiency. The performance of such a system relies on the natural temperature regulation of swimming pools governed by evaporative and convective heat exchange with the air, radiative heat exchange with the sky, and conductive heat exchange with the ground. This paper describes and validates a model that uses meteorological data to accurately predict the hourly temperature of a swimming pool to within 1.1 C maximum error over the period of observation. A thorough review of literature guided our choice of the most appropriate set of equations to describe the natural mass and energy exchange between a swimming pool and the environment. Monitoring of a pool in Davis, CA, was used to confirm the resulting simulations. Comparison of predicted and observed pool temperature for all hours over a 56 day experimental period shows an R-squared relatedness of 0.967. (author)

  9. Macroinvertebrate community assembly in pools created during peatland restoration.

    Science.gov (United States)

    Brown, Lee E; Ramchunder, Sorain J; Beadle, Jeannie M; Holden, Joseph

    2016-11-01

    Many degraded ecosystems are subject to restoration attempts, providing new opportunities to unravel the processes of ecological community assembly. Restoration of previously drained northern peatlands, primarily to promote peat and carbon accumulation, has created hundreds of thousands of new open water pools. We assessed the potential benefits of this wetland restoration for aquatic biodiversity, and how communities reassemble, by comparing pool ecosystems in regions of the UK Pennines on intact (never drained) versus restored (blocked drainage-ditches) peatland. We also evaluated the conceptual idea that comparing reference ecosystems in terms of their compositional similarity to null assemblages (and thus the relative importance of stochastic versus deterministic assembly) can guide evaluations of restoration success better than analyses of community composition or diversity. Community composition data highlighted some differences in the macroinvertebrate composition of restored pools compared to undisturbed peatland pools, which could be used to suggest that alternative end-points to restoration were influenced by stochastic processes. However, widely used diversity metrics indicated no differences between undisturbed and restored pools. Novel evaluations of restoration using null models confirmed the similarity of deterministic assembly processes from the national species pool across all pools. Stochastic elements were important drivers of between-pool differences at the regional-scale but the scale of these effects was also similar across most of the pools studied. The amalgamation of assembly theory into ecosystem restoration monitoring allows us to conclude with more certainty that restoration has been successful from an ecological perspective in these systems. Evaluation of these UK findings compared to those from peatlands across Europe and North America further suggests that restoring peatland pools delivers significant benefits for aquatic fauna by

  10. 76 FR 72923 - Pool Corporation; Analysis To Aid Public Comment

    Science.gov (United States)

    2011-11-28

    ... manufacturers, warehouse them, and then resell the products to pool retail stores, pool service companies and.... ADDRESSES: Interested parties may file a comment online or on paper, by following the instructions in the... 0115'' on your comment, and file your comment online at https://ftcpublic.commentworks.com/ftc...

  11. Solar collectors for swimming pools still going strong

    Energy Technology Data Exchange (ETDEWEB)

    1975-01-01

    According to the opinion of the experts, solar energy heating may be technically 'mature' but the profitability is by no means that far. However, solar systems are a good alternative for heating the water in swimming pools. Four solar collector systems developed by different firms to heat swimming pools, including prices, are presented.

  12. 48 CFR 28.304 - Risk-pooling arrangements.

    Science.gov (United States)

    2010-10-01

    ... CONTRACTING REQUIREMENTS BONDS AND INSURANCE Insurance 28.304 Risk-pooling arrangements. Agencies may establish risk-pooling arrangements. These arrangements are designed to use the services of the insurance industry for safety engineering and the handling of claims at minimum cost to the Government. The agency...

  13. Biomass and carbon pools of disturbed riparian forests

    Science.gov (United States)

    Laura A. B. Giese; W. M. Aust; Randall K. Kolka; Carl C. Trettin

    2003-01-01

    Quantification of carbon pools as affected by forest age/development can facilitate riparian restoration and increase awareness of the potential for forests to sequester global carbon. Riparian forest biomass and carbon pools were quantified for four riparian forests representing different seral stages in the South Carolina Upper Coastal Plain. Three of the riparian...

  14. 17 CFR 275.206(4)-8 - Pooled investment vehicles.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Pooled investment vehicles... COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT ADVISERS ACT OF 1940 § 275.206(4)-8 Pooled investment vehicles. (a) Prohibition. It shall constitute a fraudulent, deceptive, or manipulative act...

  15. Mathematical-programming approaches to test item pool design

    NARCIS (Netherlands)

    Veldkamp, Bernard P.; van der Linden, Willem J.; Ariel, A.

    2002-01-01

    This paper presents an approach to item pool design that has the potential to improve on the quality of current item pools in educational and psychological testing andhence to increase both measurement precision and validity. The approach consists of the application of mathematical programming

  16. Anticipated corrosion in the Vermont Yankee spent fuel pool

    International Nuclear Information System (INIS)

    Weeks, J.R.

    1977-06-01

    The report provides additional information relating to a proposed modification to the spent fuel pool at the Vermont Yankee Nuclear Power Station (VYNPS) and addresses corrosion of spent fuel pool storage materials and zircaloy, and provides an analysis of the effectiveness of the Boral sealing

  17. Numerical analysis of weld pool oscillation in laser welding

    Energy Technology Data Exchange (ETDEWEB)

    Cho, Jung Ho [Chungbuk National University, Cheongju (Korea, Republic of); Farson, Dave F [The Ohio State University, Columbus (United States); Hollis, Kendall; Milewski, John O. [Los Alamos National Laboratory, Los Alamos (United States)

    2015-04-15

    Volume of fluid (VOF) numerical simulation was used to investigate melt flow and volumetric oscillation of conduction-mode pulsed laser weld pools. The result is compared to high speed video stream of titanium laser spot welding experiment. The total simulation time is 10ms with the first 5 ms being heating and melting under constant laser irradiation and the remaining 5 ms corresponding to resolidification of the weld pool. During the melting process, the liquid pool did not exhibit periodic oscillation but was continually depressed by the evaporation recoil pressure. After the laser pulse, the weld pool was excited into volumetric oscillation by the release of pressure on its surface and oscillation of the weld pool surface was analyzed. The simulation model suggested adjusting thermal diffusivity to match cooling rate and puddle diameter during solidification which is distinguishable from previous weld pool simulation. The frequency continuously increased from several thousand cycles per second to tens of thousands of cycles per second as the weld pool solidified and its diameter decreased. The result is the first trial of investigation of small weld pool oscillation in laser welding although there have been several reports about arc welding.

  18. 13 CFR 120.1709 - Transfers of Pool Certificates.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Transfers of Pool Certificates. 120.1709 Section 120.1709 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Establishment of SBA Secondary Market Guarantee Program for First Lien Position 504 Loan Pools § 120.1709...

  19. 13 CFR 120.1714 - Seller's Pool Loan servicing.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Seller's Pool Loan servicing. 120.1714 Section 120.1714 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Establishment of SBA Secondary Market Guarantee Program for First Lien Position 504 Loan Pools § 120.1714 Seller...

  20. 13 CFR 120.1715 - Seller's Pool Loan liquidation.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Seller's Pool Loan liquidation. 120.1715 Section 120.1715 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Establishment of SBA Secondary Market Guarantee Program for First Lien Position 504 Loan Pools § 120.1715 Seller...

  1. 13 CFR 120.1713 - Seller's Pool Loan origination.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Seller's Pool Loan origination. 120.1713 Section 120.1713 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Establishment of SBA Secondary Market Guarantee Program for First Lien Position 504 Loan Pools § 120.1713 Seller...

  2. 13 CFR 120.1717 - Seller's Pool Loan deferments.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Seller's Pool Loan deferments. 120.1717 Section 120.1717 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Establishment of SBA Secondary Market Guarantee Program for First Lien Position 504 Loan Pools § 120.1717 Seller...

  3. AUS burnup module CHAR and the associated data pool

    International Nuclear Information System (INIS)

    Robinson, G.S.

    1975-12-01

    The CHAR module of the AUS reactor neutronics scheme solves the multiregion nuclide depletion equations using an analytic method. The module obtains cross section, flux and geometry data from AUS data pools, and uses the STATUS data pool which has been designed for the storage of nuclide compositions, spatial smearing factors and other miscellaneous information. (author)

  4. Phytomass carbon pool of trees and forests in India

    NARCIS (Netherlands)

    Kaul, M.; Mohren, G.M.J.; Dadhwal, V.K.

    2011-01-01

    The study reports estimates of above ground phytomass carbon pools in Indian forests for 1992 and 2002 using two different methodologies. The first estimate was derived from remote sensing based forest area and crown density estimates, and growing stock data for 1992 and 2002 and the estimated pool

  5. Odonata (Insecta at a wadi Pool near Nizwa, northern Oman

    Directory of Open Access Journals (Sweden)

    Elaine M. Cowan

    2015-07-01

    Full Text Available Fourteen damselfly and dragonfly species were recorded in 68 visits to a wadi pool in northern Oman, March 2012 to June 2014.  All identifications were based on photographs.  Apparently the pool has a core community of eight resident species.  Paragomphus sinaiticus, globally Near Threatened, was regularly  recorded. 

  6. Electricity prices and generator behaviour in gross pool electricity markets

    International Nuclear Information System (INIS)

    O'Mahoney, Amy; Denny, Eleanor

    2013-01-01

    Electricity market liberalisation has become common practice internationally. The justification for this process has been to enhance competition in a market traditionally characterised by statutory monopolies in an attempt to reduce costs to end-users. This paper endeavours to see whether a pool market achieves this goal of increasing competition and reducing electricity prices. Here the electricity market is set up as a sealed bid second price auction. Theory predicts that such markets should result with firms bidding their marginal cost, thereby resulting in an efficient outcome and lower costs to consumers. The Irish electricity system with a gross pool market experiences among the highest electricity prices in Europe. Thus, we analyse the Irish pool system econometrically in order to test if the high electricity prices seen there are due to participants bidding outside of market rules or out of line with theory. Overall we do not find any evidence that the interaction between generator and the pool in the Irish electricity market is not efficient. Thus, the pool element of the market structure does not explain the high electricity prices experienced in Ireland. - Highlights: • We consider whether a gross pool achieves competitive behaviour. • We analyse the Irish pool system econometrically. • Results indicate the Irish pool system appears to work efficiently. • Generators appear to be bidding appropriately

  7. Branchipodopsis species — specialists of ephemeral rock pools ...

    African Journals Online (AJOL)

    Such rock pools were studied in the Drakensberg region, in the eastern Free State and in south-eastern Botswana. Common features ... While short-range dispersal of floating eggs by overflows is common, long-range dispersal (e.g. by wind) seems to be rare and to be restricted to shallow pools with little vegetation. Limited ...

  8. Thermal analysis and modeling of a swimming pool heating system by utilizing waste energy rejected from a chiller unit of an ice rink

    Directory of Open Access Journals (Sweden)

    Kuyumcu Muhammed Enes

    2017-01-01

    Full Text Available This study deals with the thermal analysis and modeling of a swimming pool heating system in which the waste energy rejected from the chiller unit of an ice rink is used as an energy source. The system consists of a swimming pool and an ice rink coupled by a chiller unit. The swimming pool and the ice rink both indoor types and were constructed in city of Gaziantep, Turkey. The thermal energy requirement for each section is determined by thermal analysis of each component of the system. Effects of different design parameters such as ceiling insulation thickness, ceiling emissivity, Carnot efficiency factor and size of the ice rink on the thermal energy requirements and coefficient of performance of the chiller unit are investigated. As a result of analyses of the system, the minimum ice rink area is determined in order to meet annual total heat energy demand of the olympic-sized swimming pool.

  9. Fouling of Structured Surfaces during Pool Boiling of Aqueous Solutions

    International Nuclear Information System (INIS)

    Esawy, M.

    2011-01-01

    Bubble characteristics in terms of density, size, frequency and motion are key factors that contribute to the superiority of nucleate pool boiling over the other modes of heat transfer. Nevertheless, if heat transfer occurs in an environment which is prone to fouling, the very same parameters may lead to accelerated deposit formation due to concentration effects beneath the growing bubbles. This has led heat exchanger designers frequently to maintain the surface temperature below the boiling point if fouling occurs, e.g. in thermal seawater desalination plants. The present study investigates the crystallization fouling of various structured surfaces during nucleate pool boiling of CaSO 4 solutions to shed light into their fouling behaviour compared with that of plain surfaces for the same operating conditions. As for the experimental part, a comprehensive set of clean and fouling experiments was performed rigorously. The structured tubes included low finned tubes of different fin densities, heights and materials and re-entrant cavity Turbo-B tube types.The fouling experiments were carried out at atmospheric pressure for different heat fluxes ranging from 100 to 300 k W/m 2 and CaSO 4 concentrations of 1.2 and 1.6 g/L. For the sake of comparison, similar runs were performed on plain stainless steel and copper tubes.Overall for the finned tubes, the experimental results showed a significant reduction of fouling resistances of up to 95% compared to those of the stainless steel and copper plain tubes. In addition, the scale formation that occurred on finned tubes was primarily a scattered and thin crystalline layer which differs significantly from those of plain tubes which suffered from a thick and homogenous layer of deposit with strong adhesion. Higher fin densities and lower fin heights always led to better antifouling performance for all investigated finned tubes. It was also shown that the surface material strongly affects the scale formation of finned tubes i

  10. Experimental study on heat pipe heat removal capacity for passive cooling of spent fuel pool

    International Nuclear Information System (INIS)

    Xiong, Zhenqin; Wang, Minglu; Gu, Hanyang; Ye, Cheng

    2015-01-01

    Highlights: • A passively cooling SFP heat pipe with an 8.2 m high evaporator was tested. • Heat removed by the heat pipe is in the range of 3.1–16.8 kW. • The heat transfer coefficient of the evaporator is 214–414 W/m 2 /K. • The heat pipe performance is sensitive to the hot water temperature. - Abstract: A loop-type heat pipe system uses natural flow with no electrically driven components. Therefore, such a system was proposed to passively cool spent fuel pools during accidents to improve nuclear power station safety especially for station blackouts such as those in Fukushima. The heat pipe used for a spent fuel pool is large due to the spent fuel pool size. An experimental heat pipe test loop was developed to estimate its heat removal capacity from the spent fuel pool during an accident. The 7.6 m high evaporator is heated by hot water flowing vertically down in an assistant tube with a 207-mm inner diameter. R134a was used as the potential heat pipe working fluid. The liquid R134a level was 3.6 m. The tests were performed for water velocities from 0.7 to 2.1 × 10 −2 m/s with water temperatures from 50 to 90 °C and air velocities from 0.5 m/s to 2.5 m/s. The results indicate significant heat is removed by the heat pipe under conditions that may occur in the spent fuel pool

  11. Aerosol and activity release from contaminated sodium pools in inert gas atomosphere

    International Nuclear Information System (INIS)

    Sauter, H.; Schuetz, W.

    1983-07-01

    A description is given of parameters and results from technical scale experiments (1 kg Na, 531 cm 2 pool surface area, 481-632 0 C pool temperature, UO 2 -, NaI-, SrO-admixtures from 0.2 up to 20 g, 2.2 m 3 vessel to be heated up to 130 0 C) and from laboratory scale experiments in a glove box (100 g Na, 38.5 cm 2 pool surface area, 550 0 C pool temperature, UO 2 and SrO admixtures from 0.2 up to 5 g, with the released quantities being sucked into cold traps and filters). The main objective of the tests was to determine the retention factors RF for U, I and Sr including their time behaviour as well as differences in local deposition. Liquid sodium has a very high retention capability for U and Sr; in the early phase (about 10% of the pool vaporized), RF (U) is of the order of 10 3 to 10 4 , and RF (Sr) of the order of 500, with increasing tendencies with time. RF (I), however, was found to be between 1 and 10. The iodine release may be explained by evaporation, whereas strong evidence exists for mechanical release processes (small particle release) in case of UO 2 and SrO. A best-fit formula is given for the specific evaporation rate of sodium, based on its proportionality to the vapor pressure. The sodium aerosol system was investigated with respect to mass concentration, particle size spectrum and deposition behaviour. Model calculations were performed using the PARDISEKO computer code. Agreement with the experiment was achieved after introducing a turbulent deposition module into the code. (orig./HP) [de

  12. Characteristics of fission product release from a molten pool

    International Nuclear Information System (INIS)

    Yun, J.I.; Suh, K.Y.; Kang, C.S.

    2001-01-01

    The volatile fission products are released from the debris pool, while the less volatile fission products tend to remain as condensed phases because of their low vapor pressure. The release of noble gases and the volatile fission products is dominated by bubble dynamics. The release of the less volatile fission products from the pool can be analyzed based on mass transport through a liquid with the convection flow. The physico-numerical models were orchestrated from existing submodels in various disciplines of engineering to estimate the released fraction of fission products from a molten pool. It was assumed that the pool has partially filled hemispherical geometry. For the high pool pressure, the diameter of the bubbles at detachment was calculated utilizing the Cole and Shulman correlation with the effect of system pressure. Sensitivity analyses were performed and results of the numerical calculations were compared with analysis results for the TMI-2 accident. (author)

  13. Tax credits and purchasing pools: will this marriage work?

    Science.gov (United States)

    Trude, S; Ginsburg, P B

    2001-04-01

    Bipartisan interest is growing in Congress for using federal tax credits to help low-income families buy health insurance. Regardless of the approach taken, tax credit policies must address risk selection issues to ensure coverage for the chronically ill. Proposals that link tax credits to purchasing pools would avoid risk selection by grouping risks similar to the way large employers do. Voluntary purchasing pools have had only limited success, however. This Issue Brief discusses linking tax credits to purchasing pools. It uses information from the Center for Studying Health System Change's (HSC) site visits to 12 communities as well as other research to assess the role of purchasing pools nationwide and the key issues and implications of linking tax credits and pools.

  14. Controlling pool depth during VAR of Alloy 718

    Science.gov (United States)

    Lopez, F.; Beaman, J.; Williamson, R.; Evans, D.

    2016-07-01

    A longtime goal of superalloy producers has been to control the geometry of the liquid pool in solidifying ingots. Accurate pool depth control at appropriate values is expected to result in ingots free of segregation defects. This article describes an industrial VAR experiment in which a 430mm (17 in) diameter Alloy 718 electrode was melted into a 510mm (20 in) ingot. In the experiment, the depth of the liquid pool at the mid-radius was controlled to three different set-points: 137 mm (nominal), 193 mm (deep) and 118 mm (shallow). At each level, the pool depth was marked by a power cutback of several minutes. The ingot was sectioned and longitudinal slices were cut out. Analysis of the photographed ingot revealed that accurate control was obtained for both the nominal and deep pool cases, while the third one was not conclusive.

  15. Parametric tomography of the cardiac blood pool

    International Nuclear Information System (INIS)

    Meyer, M.; Schwartz, K.D.

    1990-01-01

    In nuclear cardiology image processing is performed usually in 3 of 4 dimensions. ECG-gated SPECT (GSPECT) would make it possible to obtain all 4 dimensions of space and time during one examination, but its duration as well as radiation dose is limited resulting in a low signal-to-noise ratio. Sensitive feature extractions from the amount of data are necessary, e.g. Fourier filtering or extracting isovolumetric intervals. The relatively large amount of calculations and storage requirements often handicaps tomographic ventriculography because a high number of sections have to be processed and the temporal resolution is limited. A new list-mode oriented tomographic algorithm demands less storage and fewer calculations: The Fourier coefficient extraction and the filtered back projection, both of which are linear operations, could be interchanged in the case of thoracic SPECT. The feature extraction algorithm process internal list-mode heart cycles for discrimination of invalid cycles, for end-diastolic and end-systolic synthesis as well as for Fourier analysis of the first harmonic in 10 ms steps. Reconstruction operations are applied also to modified distribution matrices of Fourier coefficients. By only processing 4 spatial matrix sequences (end-diastolic and end-systolic images, amplitude and phase values) parametric tomography becomes practicable and could be also performed by a minicomputer with 64 KByte memory in addition to the possibilities of the planar left ventricular gated imaging. If there are 3 or more processors available a complete feature extraction on-the-fly will be possible. The numerical algorithms were tested with respect to stable reconstructions by phantoms. First results of a patient examination are used to explore effective display techniques, and preliminary modes are demonstrated. It is the purpose of this study to obtain additional information about the gated planar cardiac blood pool imaging in the field of SPECT. (author)

  16. Cardiac tumours: non invasive detection and assessment by gated cardiac blood pool radionuclide imaging

    International Nuclear Information System (INIS)

    Pitcher, D.; Wainwright, R.; Brennand-Roper, D.; Deverall, P.; Sowton, E.; Maisey, M.

    1980-01-01

    Four patients with cardiac tumours were investigated by gated cardiac blood pool radionuclide imaging and echocardiography. Contrast angiocardiography was performed in three of the cases. Two left atrial tumours were detected by all three techniques. In one of these cases echocardiography alone showed additional mitral valve stenosis, but isotope imaging indicated tumour size more accurately. A large septal mass was detected by all three methods. In this patient echocardiography showed evidence of left ventricular outflow obstruction, confirmed at cardiac catheterisation, but gated isotope imaging provided a more detailed assessment of the abnormal cardiac anatomy. In the fourth case gated isotope imaging detected a large right ventricular tumour which had not been identified by echocardiography. Gated cardiac blood pool isotope imaging is a complementary technique to echocardiography for the non-invasive detection and assessment of cardiac tumours. (author)

  17. On the relation between water pools and water holding capacity in cod muscle

    DEFF Research Database (Denmark)

    Andersen, Charlotte Møller; Jørgensen, Bo

    2004-01-01

    Low-field 1H nuclear magnetic resonance (NMR) relaxations were measured on muscle, minced muscle and centrifuged mince from cod that had been treated under various frozen and chill storage conditions. By using multi-way chemometrics, uni-exponential profiles were obtained, from which the transverse...... relaxation times (T2-values) and the water pool sizes (m- values) were determined. Three pools of water were identified with the different relaxation times and m-values in the centrifuged samples reflecting the removal of loosely bound water. The m-values and the full NMR-signal decays were correlated to two...... measures of water holding capacity (WHC) in a way that WHC related to the original water content could be predicted well for the whole and the minced muscle. The centrifuged samples gave optimal predictions of WHC related to the dry matter content, probably because the centrifuged samples are similar...

  18. Influence of corium oxidation on fission product release from molten pool

    Energy Technology Data Exchange (ETDEWEB)

    Bechta, S.V., E-mail: bechta@sbor.spb.s [Alexandrov Scientific-Research Institute of Technology (NITI), Sosnovy Bor (Russian Federation); Krushinov, E.V.; Vitol, S.A.; Khabensky, V.B.; Kotova, S.Yu.; Sulatsky, A.A. [Alexandrov Scientific-Research Institute of Technology (NITI), Sosnovy Bor (Russian Federation); Gusarov, V.V.; Almyashev, V.I. [Grebenschikov Institute of Silicate Chemistry of the Russian Academy of Sciences (ISC RAS), St. Petersburg (Russian Federation); Ducros, G.; Journeau, C. [CEA, DEN, Cadarache, F-13108 St. Paul lez Durance (France); Bottomley, D. [Joint Research Centre Institut fuer Transurane (ITU), Karlsruhe (Germany); Clement, B. [Institut de Radioprotection et Surete Nucleaire (IRSN), St. Paul lez Durance (France); Herranz, L. [CIEMAT, Madrid (Spain); Guentay, S. [PSI, Wuerenlingen (Switzerland); Trambauer, K. [GRS, Muenchen (Germany); Auvinen, A. [VTT, Espoo (Finland); Bezlepkin, V.V. [SPbAEP, St. Petersburg (Russian Federation)

    2010-05-15

    Qualitative and quantitative determination of the release of low-volatile fission products and core materials from molten oxidic corium was investigated in the EVAN project under the auspices of ISTC. The experiments carried out in a cold crucible with induction heating and RASPLAV test facility are described. The results are discussed in terms of reactor application; in particular, pool configuration, melt oxidation kinetics, critical influence of melt surface temperature and oxidation index on the fission product release rate, aerosol particle composition and size distribution. The relevance of measured high release of Sr from the molten pool for the reactor application is highlighted. Comparisons of the experimental data with those from the COLIMA CA-U3 test and the VERCORS tests, as well as with predictions from IVTANTHERMO and GEMINI/NUCLEA codes are made. Recommendations for further investigations are proposed following the major observations and discussions.

  19. Design and computational analysis of passive siphon breaker for 49-2 swimming pool reactor

    International Nuclear Information System (INIS)

    Yue Zhiting; Song Yunpeng; Liu Xingmin; Zou Yao; Wu Yuanyuan

    2014-01-01

    Based on safety considerations, a passive siphon breaker will be added to the primary cooling system of 49-2 Swimming Pool Reactor (SPR). With the breaker location determined, the capability of siphon breakers with diameters of 1.5 cm and 2.0 cm was calculated and analyzed respectively by RELAP5/MOD3.3 code. The results show that in the condition of large break loss of coolant accident these two sizes of siphon breakers are able to break the siphon phenomena, and maintain the pool water level above the reactor core when the reactor and the pump are shutdown. In the end, to be conservative, the siphon breaker with diameter of 2.0 cm is adopted. (authors)

  20. An infrared scattering by evaporating droplets at the initial stage of a pool fire suppression by water sprays

    Science.gov (United States)

    Dombrovsky, Leonid A.; Dembele, Siaka; Wen, Jennifer X.

    2018-06-01

    The computational analysis of downward motion and evaporation of water droplets used to suppress a typical transient pool fire shows local regions of a high volume fraction of relatively small droplets. These droplets are comparable in size with the infrared wavelength in the range of intense flame radiation. The estimated scattering of the radiation by these droplets is considerable throughout the entire spectrum except for a narrow region in the vicinity of the main absorption peak of water where the anomalous refraction takes place. The calculations of infrared radiation field in the model pool fire indicate the strong effect of scattering which can be observed experimentally to validate the fire computational model.

  1. Enhancement of the SPARC90 code to pool scrubbing events under jet injection regime

    Energy Technology Data Exchange (ETDEWEB)

    Berna, C., E-mail: ceberes@iie.upv.es [Instituto de Ingeniería Energética, Universitat Politècnica de València (UPV), Camino de Vera 14, 46022 Valencia (Spain); Escrivá, A.; Muñoz-Cobo, J.L. [Instituto de Ingeniería Energética, Universitat Politècnica de València (UPV), Camino de Vera 14, 46022 Valencia (Spain); Herranz, L.E., E-mail: luisen.herranz@ciemat.es [Unit of Nuclear Safety Research Division of Nuclear Fission, CIEMAT, Avda. Complutense 22, 28040 Madrid (Spain)

    2016-04-15

    has been forcefully limited since very few pool scrubbing tests are available in the jet injection regime (i.e., ACE, LACE, POSEIDON II and RCA). But nevertheless, a considerable improvement in the estimation of the Decontamination Factor (DF) has been reached, as well as it has been proven that sizes of aerosol particles and submergencies are factors of major influence, however there is still a long road ahead. We have extended the SPARC90 capabilities to study jet discharge processes, then the new SPARC90-Jet version is able to study globular and jet discharge processes, i.e. pool discharges under low and high velocity conditions. Therefore, the work here presented should be understood as a promising first step toward an effective code extension to the jet regime.

  2. Enhancement of the SPARC90 code to pool scrubbing events under jet injection regime

    International Nuclear Information System (INIS)

    Berna, C.; Escrivá, A.; Muñoz-Cobo, J.L.; Herranz, L.E.

    2016-01-01

    has been forcefully limited since very few pool scrubbing tests are available in the jet injection regime (i.e., ACE, LACE, POSEIDON II and RCA). But nevertheless, a considerable improvement in the estimation of the Decontamination Factor (DF) has been reached, as well as it has been proven that sizes of aerosol particles and submergencies are factors of major influence, however there is still a long road ahead. We have extended the SPARC90 capabilities to study jet discharge processes, then the new SPARC90-Jet version is able to study globular and jet discharge processes, i.e. pool discharges under low and high velocity conditions. Therefore, the work here presented should be understood as a promising first step toward an effective code extension to the jet regime.

  3. Effects of particle size and dry matter content of a total mixed ration on intraruminal equilibration and net portal flux of volatile fatty acids in lactating dairy cows

    DEFF Research Database (Denmark)

    Storm, Adam Christian; Kristensen, Niels Bastian

    2010-01-01

    Effects of physical changes in consistency of ruminal contents on intraruminal equilibration and net portal fluxes of volatile fatty acids (VFA) in dairy cows were studied. Four Danish Holstein cows (121 ± 17 d in milk, 591 ± 24 kg of body weight, mean ± SD) surgically fitted with a ruminal cannula...... and permanent indwelling catheters in the major splanchnic blood vessels were used. The experimental design was a 4 × 4 Latin square with a 2 × 2 factorial design of treatments. Treatments differed in forage (grass hay) particle size (FPS; 3.0 and 30 mm) and feed dry matter (DM) content of the total mixed...... ration (44.3 and 53.8%). The feed DM did not affect chewing time, ruminal variables, or net portal flux of VFA. However, decreasing the FPS decreased the overall chewing and rumination times by 151 ± 55 and 135 ± 29 min/d, respectively. No effect of the reduced chewing time was observed on ruminal p...

  4. Anthropogenic impact on amorphous silica pools in temperate soils

    Directory of Open Access Journals (Sweden)

    W. Clymans

    2011-08-01

    Full Text Available Human land use changes perturb biogeochemical silica (Si cycling in terrestrial ecosystems. This directly affects Si mobilisation and Si storage and influences Si export from the continents, although the magnitude of the impact is unknown. A major reason for our lack of understanding is that very little information exists on how land use affects amorphous silica (ASi storage in soils. We have quantified and compared total alkali-extracted (PSia and easily soluble (PSie Si pools at four sites along a gradient of anthropogenic disturbance in southern Sweden. Land use clearly affects ASi pools and their distribution. Total PSia and PSie for a continuous forested site at Siggaboda Nature Reserve (66 900 ± 22 800 kg SiO2 ha−1 and 952 ± 16 kg SiO2 ha−1 are significantly higher than disturbed land use types from the Råshult Culture Reserve including arable land (28 800 ± 7200 kg SiO2 ha−1 and 239 ± 91 kg SiO2 ha−1, pasture sites (27 300 ± 5980 kg SiO2 ha−1 and 370 ± 129 kg SiO2 ha−1 and grazed forest (23 600 ± 6370 kg SiO2 ha−1 and 346 ± 123 kg SiO2 ha−1. Vertical PSia and PSie profiles show significant (p < 0.05 variation among the sites. These differences in size and distribution are interpreted as the long-term effect of reduced ASi replenishment, as well as changes in ecosystem specific pedogenic processes and increased mobilisation of the PSia in disturbed soils. We have also made a first, though rough, estimate of the magnitude of change in temperate continental ASi pools due to human disturbance. Assuming that our data are representative, we estimate that total ASi storage in soils has declined by ca. 10 % since the onset of agricultural development (3000 BCE

  5. Experiments on Pool-riffle Sequences with Multi-fractional Sediment Bed During Floods

    Science.gov (United States)

    Rodriguez, J. F.; Vahidi, E.; Bayat, E.; de Almeida, G. A. M.; Saco, P. M.

    2017-12-01

    The morphodynamics of pools and riffles has been the subject of research for over a century and has more recently attracted intense attention for their central role in providing habitat diversity conditions, both in terms of flow and substrate. Initial efforts to explain the long-term stability of the pool-riffle (PR) sequences (often referred to as self-maintenance) focused almost exclusively on cross sectional flow characteristics (either average or near bed velocity or shear stress), using episodic shifts in higher shear stress or velocities from riffles to pools during floods (i.e. reversal conditions) as an indication of the long-term self-maintenance of the structures.. However, less attention has been paid to the interactions of flow unsteadiness, sediment supply and sedimentological contrasts as the drivers for maintaining PR sequences. Here we investigate these effects through laboratory experiments on a scaled-down PR sequence of an existing gravel bed river. Froude similitude and equality of Shields' number were applied to scale one- to four-year recurrence flood events and sediment size distributions, respectively. We conducted experiments with different hydrographs and different sedimentological conditions. In each experiment we continuously measured velocities and shear stresses (using acoustic velocity profilers) bed levels (using a bed profiler) and bed grain size distribution (using an automatic digital technique on the painted bed sediments) during the hydrographs. Our results show that the most important factors for self-maintenance were the sediment bed composition, the level of infilling of the pool and the sediment supply grainsize distribution. These results highlight the need to consider the time varying sedimentological characteristics of a PR sequence to assess its capacity for self-maintenance.

  6. Internalization and cellular pools of never growth factor in pheochromocytoma (PC12) cells

    International Nuclear Information System (INIS)

    Neet, K.E.; Kasaian, M.

    1987-01-01

    Nerve Growth Factor (NGF) binds to a cell surface receptor on responsive neuronal cells to initiate cell maintenance and/or differentiation regimes. The purpose of these studies was to define quantitatively the fate of NGF in PC12 cells with respect to various cellular compartments in a single series of biochemical experiments. Different binding methodologies were evaluated in suspension and on plates. 50 pM 125 I-NGF was bound to rat PC12 cells in suspension for 30 min at 37 0 , followed by various methods and combinations of methods to remove subsets of bound ligand. Distinction could be made between NGF bound to fast vs. slow cell surface receptors, NGF bound to slow receptors at the cell surface vs. cell interior, and detergent-soluble vs. cytoskeletally-attached NGF. These treatments defined the relative size of five pools, including the fast receptor (65%), two intracellular compartments (12% and 3%) susceptible to nonionic detergent, and a detergent-stable intracellular pool of ligand (16%). At 37 0 the cold chase stable and the acid stable pools were about the same size because of rapid internalization, but the slow receptor was measurable at 4 0 . Inhibitors were used to define the route of NGF through the cell from the plasma membrane to degradation. Chloroquine caused accumulation of NGF only in pools that were not associated with the cytoskeleton, implicating this compartment in supplying ligand to the lysosome. Results with cytochalasin B and colchicine and suggested both microfilament and microtubule pathways in NGF degradation. A model for the movement of NGF through the cell was developed based on these observations

  7. poolHiTS: A Shifted Transversal Design based pooling strategy for high-throughput drug screening

    Directory of Open Access Journals (Sweden)

    Woolf Peter J

    2008-05-01

    Full Text Available Abstract Background A key goal of drug discovery is to increase the throughput of small molecule screens without sacrificing screening accuracy. High-throughput screening (HTS in drug discovery involves testing a large number of compounds in a biological assay to identify active compounds. Normally, molecules from a large compound library are tested individually to identify the activity of each molecule. Usually a small number of compounds are found to be active, however the presence of false positive and negative testing errors suggests that this one-drug one-assay screening strategy can be significantly improved. Pooling designs are testing schemes that test mixtures of compounds in each assay, thereby generating a screen of the whole compound library in fewer tests. By repeatedly testing compounds in different combinations, pooling designs also allow for error-correction. These pooled designs, for specific experiment parameters, can be simply and efficiently created using the Shifted Transversal Design (STD pooling algorithm. However, drug screening contains a number of key constraints that require specific modifications if this pooling approach is to be useful for practical screen designs. Results In this paper, we introduce a pooling strategy called poolHiTS (Pooled High-Throughput Screening which is based on the STD algorithm. In poolHiTS, we implement a limit on the number of compounds that can be mixed in a single assay. In addition, we show that the STD-based pooling strategy is limited in the error-correction that it can achieve. Due to the mixing constraint, we show that it is more efficient to split a large library into smaller blocks of compounds, which are then tested using an optimized strategy repeated for each block. We package the optimal block selection algorithm into poolHiTS. The MATLAB codes for the poolHiTS algorithm and the corresponding decoding strategy are also provided. Conclusion We have produced a practical version

  8. A Mechanistic Model of Waterfall Plunge Pool Erosion into Bedrock

    Science.gov (United States)

    Scheingross, Joel S.; Lamb, Michael P.

    2017-11-01

    Landscapes often respond to changes in climate and tectonics through the formation and upstream propagation of knickzones composed of waterfalls. Little work has been done on the mechanics of waterfall erosion, and instead most landscape-scale models neglect waterfalls or use rules for river erosion, such as stream power, that may not be applicable to waterfalls. Here we develop a physically based model to predict waterfall plunge pool erosion into rock by abrasion from particle impacts and test the model against flume experiments. Both the model and experiments show that evolving plunge pools have initially high vertical erosion rates due to energetic particle impacts, and erosion slows and eventually ceases as pools deepen and deposition protects the pool floor from further erosion. Lateral erosion can continue after deposition on the pool floor, but it occurs at slow rates that become negligible as pools widen. Our work points to the importance of vertical drilling of successive plunge pools to drive upstream knickzone propagation in homogenous rock, rather than the classic mechanism of headwall undercutting. For a series of vertically drilling waterfalls, we find that upstream knickzone propagation is faster under higher combined water and sediment fluxes and for knickzones composed of many waterfalls that are closely spaced. Our model differs significantly from stream-power-based erosion rules in that steeper knickzones can retreat faster or more slowly depending on the number and spacing of waterfalls within a knickzone, which has implications for interpreting climatic and tectonic history through analysis of river longitudinal profiles.

  9. Addressing data privacy in matched studies via virtual pooling.

    Science.gov (United States)

    Saha-Chaudhuri, P; Weinberg, C R

    2017-09-07

    Data confidentiality and shared use of research data are two desirable but sometimes conflicting goals in research with multi-center studies and distributed data. While ideal for straightforward analysis, confidentiality restrictions forbid creation of a single dataset that includes covariate information of all participants. Current approaches such as aggregate data sharing, distributed regression, meta-analysis and score-based methods can have important limitations. We propose a novel application of an existing epidemiologic tool, specimen pooling, to enable confidentiality-preserving analysis of data arising from a matched case-control, multi-center design. Instead of pooling specimens prior to assay, we apply the methodology to virtually pool (aggregate) covariates within nodes. Such virtual pooling retains most of the information used in an analysis with individual data and since individual participant data is not shared externally, within-node virtual pooling preserves data confidentiality. We show that aggregated covariate levels can be used in a conditional logistic regression model to estimate individual-level odds ratios of interest. The parameter estimates from the standard conditional logistic regression are compared to the estimates based on a conditional logistic regression model with aggregated data. The parameter estimates are shown to be similar to those without pooling and to have comparable standard errors and confidence interval coverage. Virtual data pooling can be used to maintain confidentiality of data from multi-center study and can be particularly useful in research with large-scale distributed data.

  10. Preliminary Calculation on a Spent Fuel Pool Accident using GOTHIC

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jaehwan; Choi, Yu Jung; Hong, Tae Hyub; Kim, Hyeong-Taek [KHNP-CRI, Daejeon (Korea, Republic of)

    2015-10-15

    The probability of an accident happening at the spent fuel pool was believed to be quite low until the 2011 Fukushima accident occurred. Notably, large amount of spent fuel are normally stored in the spent fuel pool for a long time compared to the amount of fuel in the reactor core and the total heat released from the spent fuel is high enough to boil the water of the spent fuel pool when the cooling system does not operate. In addition, the enrichment and the burnup of the fuel have both increased in the past decade and heat generation from the spent fuel thereby has also increased. The failure of the cooling system at the spent fuel pool (hereafter, a loss-of-cooling accident) is one of the principal hypothetical causes of an accident that could occur at the spent fuel pool. In this paper, the preliminary calculation of a loss-of-cooling accident was performed. In this paper, the preliminary calculation of a loss-of cooling accident was performed with GOTHIC. The calculation results show boiling away of water in the spent fuel pool due to the loss-of-cooling accident and similar thermal performance of the spent fuel pool with previous research results.

  11. 3D finite element simulation of TIG weld pool

    Science.gov (United States)

    Kong, X.; Asserin, O.; Gounand, S.; Gilles, P.; Bergheau, J. M.; Medale, M.

    2012-07-01

    The aim of this paper is to propose a three-dimensional weld pool model for the moving gas tungsten arc welding (GTAW) process, in order to understand the main factors that limit the weld quality and improve the productivity, especially with respect to the welding speed. Simulation is a very powerful tool to help in understanding the physical phenomena in the weld process. A 3D finite element model of heat and fluid flow in weld pool considering free surface of the pool and traveling speed has been developed for the GTAW process. Cast3M software is used to compute all the governing equations. The free surface of the weld pool is calculated by minimizing the total surface energy. The combined effects of surface tension gradient, buoyancy force, arc pressure, arc drag force to drive the fluid flow is included in our model. The deformation of the weld pool surface and the welding speed affect fluid flow, heat flow and thus temperature gradients and molten pool dimensions. Welding trials study is presented to compare our numerical results with macrograph of the molten pool.

  12. Study on water evaporation rate from indoor swimming pools

    Directory of Open Access Journals (Sweden)

    Rzeźnik Ilona

    2017-01-01

    Full Text Available The air relative humidity in closed spaces of indoor swimming pools influences significantly on users thermal comfort and the stability of the building structure, so its preservation on suitable level is very important. For this purpose, buildings are equipped with HVAC systems which provide adequate level of humidity. The selection of devices and their technical parameters is made using the mathematical models of water evaporation rate in the unoccupied and occupied indoor swimming pool. In the literature, there are many papers describing this phenomena but the results differ from each other. The aim of the study was the experimental verification of published models of evaporation rate in the pool. The tests carried out on a laboratory scale, using model of indoor swimming pool, measuring 99cm/68cm/22cm. The model was equipped with water spray installation with six nozzles to simulate conditions during the use of the swimming pool. The measurements were made for conditions of sports pools (water temperature 24°C and recreational swimming pool (water temperature 34°C. According to the recommendations the air temperature was about 2°C higher than water temperature, and the relative humidity ranged from 40% to 55%. Models Shah and Biasin & Krumm were characterized by the best fit to the results of measurements on a laboratory scale.

  13. Security cost allocation under combined bilateral-pool market dispatch

    International Nuclear Information System (INIS)

    Abdullah, M.P.; Hassan, M.Y.; Hussin, F.

    2008-01-01

    Most electricity markets around the world are a combination of bilateral and pool markets, such as NordPool and NYPOOL. In these models, market participants bid into the pool and also make bilateral contracts with each other. This paper addressed the issue of congestion management and security cost allocation in a power pool market model. The basic idea of security cost allocation is to divide the incurred security cost due to congestion relief into pool and bilateral market based on their flow contribution to the congested line. A newly proposed security cost allocation strategy of the combined bilateral-pool market was also presented along with case studies using IEEE-14 bus system that tested the proposed method. Using the proposed method, it was shown that security costs are allocated to market participants at different prices which reflect the load contribution to the security problem. This solves the problem of the uniform security cost allocation in a pure pool market system having uniform pricing, and provides a proper security signal to market participants. 11 refs., 3 tabs., 4 figs

  14. Loss of spent fuel pool cooling PRA: Model and results

    International Nuclear Information System (INIS)

    Siu, N.; Khericha, S.; Conroy, S.; Beck, S.; Blackman, H.

    1996-09-01

    This letter report documents models for quantifying the likelihood of loss of spent fuel pool cooling; models for identifying post-boiling scenarios that lead to core damage; qualitative and quantitative results generated for a selected plant that account for plant design and operational practices; a comparison of these results and those generated from earlier studies; and a review of available data on spent fuel pool accidents. The results of this study show that for a representative two-unit boiling water reactor, the annual probability of spent fuel pool boiling is 5 x 10 -5 and the annual probability of flooding associated with loss of spent fuel pool cooling scenarios is 1 x 10 -3 . Qualitative arguments are provided to show that the likelihood of core damage due to spent fuel pool boiling accidents is low for most US commercial nuclear power plants. It is also shown that, depending on the design characteristics of a given plant, the likelihood of either: (a) core damage due to spent fuel pool-associated flooding, or (b) spent fuel damage due to pool dryout, may not be negligible

  15. Study on velocity distribution in a pool by submersible mixers

    International Nuclear Information System (INIS)

    Tian, F; Shi, W D; Lu, X N; Chen, B; Jiang, H

    2012-01-01

    To study the distribution of submersible mixers and agitating effect in the sewage treatment pool, Pro/E software was utilized to build the three-dimensional model. Then, the large-scale computational fluid dynamics software FLUENT6.3 was used. ICEM software was used to build unstructured grid of sewage treatment pool. After that, the sewage treatment pool was numerically simulated by dynamic coordinate system technology and RNG k-ε turbulent model and PIOS algorithm. The macro fluid field and each section velocity flow field distribution were analyzed to observe the efficiency of each submersible mixer. The average velocity and mixing area in the sewage pool were studied simultaneously. Results show that: the preferred project B, two submersible mixers speed is 980 r/min, and setting angles are all 30°. Fluid mixing area in the pool has reached more than 95%. Under the action of two mixers, the fluid in the sewage pool form a continuous circulating water flow. The fluid is mixed adequately and average velocity of fluid in the pool is at around 0.241m/s, which agreed with the work requirements. Consequently it can provide a reference basis for practical engineering application of submersible mixers by using this method.

  16. ENERGY SAVING AT OPERATION OF OUTDOOR SWIMMING POOLS

    Directory of Open Access Journals (Sweden)

    V. F. Ivin

    2013-09-01

    Full Text Available Purpose. Energy saving is a major problem in modern power engineering and various energy-consuming devices. They include outdoor swimming pools. In order to maintain them in working condition, especially in winter period, it takes significant amount of thermal energy. Task of heat loss substantial decrease in open swimming pools is considered in the article (on DNURT example. Methodology. The method of determining the mass and heat loss on the basis of criteria equations of heat and mass transfer theory is used. Findings. Calculations of the actual DNURT pool heat loss for different seasons, as for natural convection both for air forced motion above the free water surface are performed. It is shown that for the adiabatic evaporation conditions of water from the pool in winter during blow-off with wind the heat loss can be up to 2 kW/m2 on surface. To reduce these losses it is offered to cover water surface in a pool with a special material with low thermal conductivity on the basis of porous polyethylene during the time when the pool is not used for other purposes. It is shown that the implementation of these standards will reduce the actual heat loss, at least 5-6 times. Originality. The solution of important environmental and energy problem thanks to reducing heat losses by the pool in different times of a year and correspondingly lower emissions of power generating enterprises. Practical value. It is shown that the coating surface of the pool with poorly heat-conducting and easy to install coating will let, at a minimum, to reduce the actual heat loss on 5-6 times and reduce the emissions of power plants generating energy for pool heating.

  17. Flow dynamics of volume-heated boiling pools

    International Nuclear Information System (INIS)

    Ginsberg, T.; Jones, O.C.; Chen, J.C.

    1979-01-01

    Safety analyses of fast breeder reactors require understanding of the two-phase fluid dynamic and heat transfer characteristics of volume-heated boiling pool systems. Design of direct contact three-phase boilers, of practical interest in the chemical industries also requires understanding of the fundamental two-phase flow and heat transfer behavior of volume boiling systems. Several experiments have been recently reported relevant to the boundary heat-loss mechanisms of boiling pool systems. Considerably less is known about the two-phase fluid dynamic behavior of such systems. This paper describes an experimental investigation of the steady-state flow dynamics of volume-heated boiling pool systems

  18. Mitochondrial deoxyribonucleoside triphosphate pools in thymidine kinase 2 deficiency.

    Science.gov (United States)

    Saada, Ann; Ben-Shalom, Efrat; Zyslin, Rivka; Miller, Chaya; Mandel, Hanna; Elpeleg, Orly

    2003-10-24

    Deficiency of mitochondrial thymidine kinase (TK2) is associated with mitochondrial DNA (mtDNA) depletion and manifests by severe skeletal myopathy in infancy. In order to elucidate the pathophysiology of this condition, mitochondrial deoxyribonucleoside triphosphate (dNTP) pools were determined in patients' fibroblasts. Despite normal mtDNA content and cytochrome c oxidase (COX) activity, mitochondrial dNTP pools were imbalanced. Specifically, deoxythymidine triphosphate (dTTP) content was markedly decreased, resulting in reduced dTTP:deoxycytidine triphosphate ratio. These findings underline the importance of balanced mitochondrial dNTP pools for mtDNA synthesis and may serve as the basis for future therapeutic interventions.

  19. Non-electric applications of pool-type nuclear reactors

    International Nuclear Information System (INIS)

    Adamov, E.O.; Cherkashov, Yu.M.; Romenkov, A.A.

    1997-01-01

    This paper recommends the use of pool-type light water reactors for thermal energy production. Safety and reliability of these reactors were already demonstrated to the public by the long-term operation of swimming pool research reactors. The paper presents the design experience of two projects: Apatity Underground Nuclear Heating Plant and Nuclear Sea-Water Desalination Plant. The simplicity of pool-type reactors, the ease of their manufacturing and maintenance make this type of a heat source attractive to the countries without a developed nuclear industry. (author). 6 figs, 1 tab

  20. Macroinvertebrate community assembly in pools created during peatland restoration

    International Nuclear Information System (INIS)

    Brown, Lee E.; Ramchunder, Sorain J.; Beadle, Jeannie M.; Holden, Joseph

    2016-01-01

    Many degraded ecosystems are subject to restoration attempts, providing new opportunities to unravel the processes of ecological community assembly. Restoration of previously drained northern peatlands, primarily to promote peat and carbon accumulation, has created hundreds of thousands of new open water pools. We assessed the potential benefits of this wetland restoration for aquatic biodiversity, and how communities reassemble, by comparing pool ecosystems in regions of the UK Pennines on intact (never drained) versus restored (blocked drainage-ditches) peatland. We also evaluated the conceptual idea that comparing reference ecosystems in terms of their compositional similarity to null assemblages (and thus the relative importance of stochastic versus deterministic assembly) can guide evaluations of restoration success better than analyses of community composition or diversity. Community composition data highlighted some differences in the macroinvertebrate composition of restored pools compared to undisturbed peatland pools, which could be used to suggest that alternative end-points to restoration were influenced by stochastic processes. However, widely used diversity metrics indicated no differences between undisturbed and restored pools. Novel evaluations of restoration using null models confirmed the similarity of deterministic assembly processes from the national species pool across all pools. Stochastic elements were important drivers of between-pool differences at the regional-scale but the scale of these effects was also similar across most of the pools studied. The amalgamation of assembly theory into ecosystem restoration monitoring allows us to conclude with more certainty that restoration has been successful from an ecological perspective in these systems. Evaluation of these UK findings compared to those from peatlands across Europe and North America further suggests that restoring peatland pools delivers significant benefits for aquatic fauna by

  1. Macroinvertebrate community assembly in pools created during peatland restoration

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Lee E., E-mail: l.brown@leeds.ac.uk; Ramchunder, Sorain J.; Beadle, Jeannie M.; Holden, Joseph

    2016-11-01

    Many degraded ecosystems are subject to restoration attempts, providing new opportunities to unravel the processes of ecological community assembly. Restoration of previously drained northern peatlands, primarily to promote peat and carbon accumulation, has created hundreds of thousands of new open water pools. We assessed the potential benefits of this wetland restoration for aquatic biodiversity, and how communities reassemble, by comparing pool ecosystems in regions of the UK Pennines on intact (never drained) versus restored (blocked drainage-ditches) peatland. We also evaluated the conceptual idea that comparing reference ecosystems in terms of their compositional similarity to null assemblages (and thus the relative importance of stochastic versus deterministic assembly) can guide evaluations of restoration success better than analyses of community composition or diversity. Community composition data highlighted some differences in the macroinvertebrate composition of restored pools compared to undisturbed peatland pools, which could be used to suggest that alternative end-points to restoration were influenced by stochastic processes. However, widely used diversity metrics indicated no differences between undisturbed and restored pools. Novel evaluations of restoration using null models confirmed the similarity of deterministic assembly processes from the national species pool across all pools. Stochastic elements were important drivers of between-pool differences at the regional-scale but the scale of these effects was also similar across most of the pools studied. The amalgamation of assembly theory into ecosystem restoration monitoring allows us to conclude with more certainty that restoration has been successful from an ecological perspective in these systems. Evaluation of these UK findings compared to those from peatlands across Europe and North America further suggests that restoring peatland pools delivers significant benefits for aquatic fauna by

  2. Modeling of the Temperature Field Recovery in the Oil Pool

    Science.gov (United States)

    Khabibullin, I. L.; Davtetbaev, A. Ya.; Mar'in, D. F.; Khisamov, A. A.

    2018-05-01

    This paper considers the problem on mathematical modeling of the temperature field recovery in the oil pool upon termination of injection of water into the pool. The problem is broken down into two stages: injection of water and temperature and pressure recovery upon termination of injection. A review of the existing mathematical models is presented, analytical solutions for a number of cases have been constructed, and a comparison of the analytical solutions of different models has been made. In the general form, the expression has been obtained that permits determining the temperature change in the oil pool upon termination of injection of water (recovery of the temperature field).

  3. Core-concrete molten pool dynamics and interfacial heat transfer

    International Nuclear Information System (INIS)

    Benjamin, A.S.

    1980-01-01

    Theoretical models are derived for the heat transfer from molten oxide pools to an underlying concrete surface and from molten steel pools to a general concrete containment. To accomplish this, two separate effects models are first developed, one emphasizing the vigorous agitation of the molten pool by gases evolving from the concrete and the other considering the insulating effect of a slag layer produced by concrete melting. The resulting algebraic expressions, combined into a general core-concrete heat transfer representation, are shown to provide very good agreement with experiments involving molten steel pours into concrete crucibles

  4. Interfacial bubbles formed by plunging thin liquid films in a pool

    Science.gov (United States)

    Salkin, Louis; Schmit, Alexandre; David, Richard; Delvert, Alexandre; Gicquel, Eric; Panizza, Pascal; Courbin, Laurent

    2017-06-01

    We show that the immersion of a horizontally suspended thin film of liquid in a pool of the same fluid creates an interfacial bubble, that is, a bubble at the liquid-air interface. Varying the fluid properties, the film's size, and its immersion velocity, our experiments unveil two formation regimes characterized by either a visco-capillary or an inertio-capillary mechanism that controls the size of a produced bubble. To rationalize these results, we compare the pressure exerted by the air flow under a plunging film with the Laplace pressure needed to generate film dimpling, which subsequently yields air entrapment and the production of a bubble. This physical model explains the power-law variations of the bubble size with the governing dimensionless number for each regime.

  5. Dicty_cDB: VFA373 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qlfqeilkkmfnmplkvsngwvy*vlmkkl*irilqsivfalyskr nsltklvnvm*lslnitlssntlivqkkkfhhsfvmvfqmvvlqlhsllvfqlvsqlnss lmvklqlevllvq*llilftnfrei...kixkyxxxklnkk*kikkklifkkn Homology vs CSM-cDNA Score E S

  6. Dicty_cDB: VFA445 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available C: teinnvi*lq*dlshstssirkgknrr*ikscr*iwfkeqkrsmespirfsqnqkgc*rt prs**krpktyl*rfss...kr*rrkln**--- ---teinnvi*lq*dlshstssirkgknrr*ikscr*iwfkeqkrsmespirfsqnqkgc *rtprs**krpktyl*rfsspp*tpqirchgri

  7. Dicty_cDB: VFA863 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ore E Sequences producing significant alignments: (bits) Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott...gnificant alignments: (bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott-A... 83

  8. Dicty_cDB: VFA628 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 8 |pid:none) Methanobrevibacter smithii ATCC ... 42 0.017 CP001390_1265( CP001390 |pid:none) Geobacter sp. F...000678_1111( CP000678 |pid:none) Methanobrevibacter smithii ATCC... 36 0.91 (Q9Z3...otrophomonas maltophilia K27... 36 1.2 CP000678_996( CP000678 |pid:none) Methanobrevibacter smithii ATCC ......:none) Methanobrevibacter smithii ATCC ... 34 3.5 protein update 2009. 6.16 PSORT psg: 0.85 gvh: 0.47 alm: 0

  9. Dicty_cDB: VFA387 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e) Dechloromonas aromatica RCB, comp... 315 3e-84 CU633749_120( CU633749 |pid:none) Cupriavidus taiwanensis ...complet... 313 1e-83 CU633749_1505( CU633749 |pid:none) Cupriavidus taiwanensis str. LM... 313 1e-83 protein

  10. Dicty_cDB: VFA207 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0.005 1 AB022770 |AB022770.1 Human rotavirus mRNA for NSP2, complete cds. 52 0.005 1 X57944 |X57944.1 Human rotavirus...clone RP11-291E21 from 4, complete sequence. 42 0.011 5 Z21640 |Z21640.1 Bovine rotavirus (Strain RF) mRNA f

  11. Retail Demand Response in Southwest Power Pool

    Energy Technology Data Exchange (ETDEWEB)

    Bharvirkar, Ranjit; Heffner, Grayson; Goldman, Charles

    2009-01-30

    In 2007, the Southwest Power Pool (SPP) formed the Customer Response Task Force (CRTF) to identify barriers to deploying demand response (DR) resources in wholesale markets and develop policies to overcome these barriers. One of the initiatives of this Task Force was to develop more detailed information on existing retail DR programs and dynamic pricing tariffs, program rules, and utility operating practices. This report describes the results of a comprehensive survey conducted by LBNL in support of the Customer Response Task Force and discusses policy implications for integrating legacy retail DR programs and dynamic pricing tariffs into wholesale markets in the SPP region. LBNL conducted a detailed survey of existing DR programs and dynamic pricing tariffs administered by SPP's member utilities. Survey respondents were asked to provide information on advance notice requirements to customers, operational triggers used to call events (e.g. system emergencies, market conditions, local emergencies), use of these DR resources to meet planning reserves requirements, DR resource availability (e.g. seasonal, annual), participant incentive structures, and monitoring and verification (M&V) protocols. Nearly all of the 30 load-serving entities in SPP responded to the survey. Of this group, fourteen SPP member utilities administer 36 DR programs, five dynamic pricing tariffs, and six voluntary customer response initiatives. These existing DR programs and dynamic pricing tariffs have a peak demand reduction potential of 1,552 MW. Other major findings of this study are: o About 81percent of available DR is from interruptible rate tariffs offered to large commercial and industrial customers, while direct load control (DLC) programs account for ~;;14percent. o Arkansas accounts for ~;;50percent of the DR resources in the SPP footprint; these DR resources are primarily managed by cooperatives. o Publicly-owned cooperatives accounted for 54percent of the existing DR resources

  12. Pool Onistarist kuulub kütusefirma omanikele / Sirje Niitra

    Index Scriptorium Estoniae

    Niitra, Sirje, 1948-

    2001-01-01

    Alkoholikontserni Onistar kiiret tõusu Eesti alkoholiturul toetavad Vene rahvusest ärimeestele kuuluvate kütusefirmade Infast Oil ja Saurix Petroleum omanikud, kellele kuulub pool Eesti viinaturu liidri aktsiatest

  13. Environmental assessment, K Pool fish rearing, Hanford Site, Richland, Washington

    International Nuclear Information System (INIS)

    1996-12-01

    The US Department of Energy (DOE) has a need to respond to a request to lease facilities at the Hanford Site 100-KE and 100-KW filter plant pools (K Pools) for fish rearing activities. These fish rearing activities would be: (1) business ventures with public and private funds and (2) long-term enhancement and supplementation programs for game fish populations in the Columbia River Basin. The proposed action is to enter into a use permit or lease agreement with the YIN or other parties who would rear fish in the 100-K Area Pools. The proposed action would include necessary piping, pump, and electrical upgrades of the facility; cleaning and preparation of the pools; water withdrawal from the Columbia River, and any necessary water or wastewater treatment; and introduction, rearing and release of fish. Future commercial operations may be included

  14. 41 CFR 101-25.109-2 - Equipment pools.

    Science.gov (United States)

    2010-07-01

    ... number and location of equipment pools, consideration shall be given to economy of operation, mobility of... available for sharing or loan. Information concerning the availability of this equipment can be maintained...

  15. Open Architecture, Inventory Pooling and Spare Maintenance Assets

    National Research Council Canada - National Science Library

    Ferrer, Geraldo

    2007-01-01

    .... This article focuses on the benefits provided by pooling together the inventory necessary to meet the demand of many users into a small number of storage sites with reduced product variety obtained...

  16. Investigation to radioactive contamination of pool water in IMEF

    International Nuclear Information System (INIS)

    Song, Ung Sup; Jung, Yang Hong; Lee, J. H.; Lee, H. K.

    2003-06-01

    The pool (3x6x10) in irradiated materials examination facility is usually used for the purpose of taking the specimen out of cask loaded into the pool, and carrying in/out the specimen to/ from the hot cell. Always, it must be cared for the water into the pool to be fine condition because all operation are worked with the naked eye during taking an irradiated materials out of the cask and plunging them in the bucket-elevator. In the aspects of the radioactive remained substances in the water must be controlled so that the amount of substances to be lower than the standard amount prescribed by RCA Korea Activity in a part of radioactive contamination control. In consequence, an expertness of status and a practical use of skill make possible the prevention of radioactive material's diffusion or the radioactive contamination of pool water and safety work

  17. Allegheny County Public Swimming Pool, Hot Tub, and Spa Inspections

    Data.gov (United States)

    Allegheny County / City of Pittsburgh / Western PA Regional Data Center — Public swimming pool, hot tub, and spa facilities are licensed and inspected once each year to assure proper water quality, sanitation, lifeguard coverage and...

  18. 17 CFR 229.1111 - (Item 1111) Pool assets.

    Science.gov (United States)

    2010-04-01

    ... information for the asset pool, including statistical information regarding delinquencies and losses. (d.... Present statistical information in tabular or graphical format, if such presentation will aid understanding. Present statistical information in appropriate distributional groups or incremental ranges in...

  19. Equilibrium blood pool scanning in the evaluation of hemophilic arthropathy

    International Nuclear Information System (INIS)

    Spies, S.; Green, D.; Rana, N.A.; Milgram, J.W.; Mintzer, R.

    1978-01-01

    Arthropathy was evaluated in six patients with severe hemophilia (factor VIII<1%) using the technique of blood pool scanning. Employing an in vivo method for erythrocyte labelling with technetium-99m, a dynamic perfusion sequence was obtained using a scintillation camera over the joint(s) to be examined. Subsequently, equilibrium blood pool images of the joints were obtained to determine regional blood volume. In young patients with repeated episodes of acute hemarthrosis, increased vascularity and increased blood pool in the affected joints were demonstrated. In older patients with fixed, contracted joints and degenerative arthropathy, vascularity and regional blood volume were not abnormal. Blood pool scanning is a safe, non-invasive technique that augments the clinical and radiographic examination of the joints. The method is helpful in distinguishing acute joint bleeding from chronic synovitis and arthritis, and may prove useful in selecting patients for synovectomy. (author)

  20. LCG Persistency Framework (POOL, CORAL, COOL) - Status and Outlook

    CERN Multimedia

    CERN. Geneva

    2012-01-01

    The LCG Persistency Framework consists of three software packages (POOL, CORAL and COOL) that address the data access requirements of the LHC experiments in several different areas. The project is the result of the collaboration between the CERN IT Department and the three experiments (ATLAS, CMS and LHCb) that are using some or all of the Persistency Framework components to access their data. The POOL package is a hybrid technology store for C++ objects, using a mixture of streaming and relational technologies to implement both object persistency and object metadata catalogs and collections. POOL provides generic components that can be used by the experiments to store both their event data and their conditions data. The CORAL package is an abstraction layer with an SQL-free API for accessing data stored using relational database technologies. It is used directly by experiment-specific applications and internally by both COOL and POOL. The COOL package provides specific software components and tools for the h...

  1. Environmental assessment, K Pool fish rearing, Hanford Site, Richland, Washington

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-01

    The US Department of Energy (DOE) has a need to respond to a request to lease facilities at the Hanford Site 100-KE and 100-KW filter plant pools (K Pools) for fish rearing activities. These fish rearing activities would be: (1) business ventures with public and private funds and (2) long-term enhancement and supplementation programs for game fish populations in the Columbia River Basin. The proposed action is to enter into a use permit or lease agreement with the YIN or other parties who would rear fish in the 100-K Area Pools. The proposed action would include necessary piping, pump, and electrical upgrades of the facility; cleaning and preparation of the pools; water withdrawal from the Columbia River, and any necessary water or wastewater treatment; and introduction, rearing and release of fish. Future commercial operations may be included.

  2. Interfacial energies of aqueous mixtures and porous coverings for enhancing pool boiling heat transfer

    Energy Technology Data Exchange (ETDEWEB)

    Melendez, Elva [CIICAp, Universidad Autonoma del Estado de Morelos, 62210 (Mexico); Reyes, Rene [Departamento de Ingenieria Quimica y Alimentos, Universidad de las Americas Puebla, Santa Catarina Martir Cholula, Puebla 72820 (Mexico)

    2006-08-15

    The interfacial energies effects on pool boiling were measured for combinations of aqueous ethanol mixtures and cationic surfactants. The mixture with 16% ethanol by weight had the lowest contact angle (associated to the highest wettability) and produced the highest convective heat transfer coefficient, h, among the aqueous ethanol mixtures. The surfactant sodium-lauryl-sulfate added at 100 ppm (its calculated critical micelle concentration CMC) to the 16% ethanol aqueous mixture produced an additional increment of the wettability of the mixture and of the h values; other concentrations of the surfactant reduced de contact angle and h values. The effect of these interfacial energies represents a mass-transfer contribution to pool boiling and the proposal of mixture effects both as increased spreadability and as micelle states. Several randomly constructed porous coverings, contributing to the breakage of vapor slugs around the heater, were tested; produced the highest h values for average pore diameters of 0.5 mm, and covering thickness of 0.972 mm. The synergistic effect on h of the interfacial energies of mixtures at their critical micelle concentration, and porous coverings was measured. Therefore, the independent driving forces combined in this study for increasing pool boiling heat transfer are (a) spreadability of the liquid on the solid; (b) the bubble's size reduction, achieved by micelle states; and (c) the bubble's breakage, induced by the porous coverings, for vapor flow not under pressure drop control. (author)

  3. Predicting how altering propagule pressure changes establishment rates of biological invaders across species pools.

    Science.gov (United States)

    Brockerhoff, Eckehard G; Kimberley, Mark; Liebhold, Andrew M; Haack, Robert A; Cavey, Joseph F

    2014-03-01

    Biological invasions resulting from international trade can cause major environmental and economic impacts. Propagule pressure is perhaps the most important factor influencing establishment, although actual arrival rates of species are rarely recorded. Furthermore, the pool of potential invaders includes many species that vary in their arrival rate and establishment potential. Therefore, we stress that it is essential to consider the size and composition of species pools arriving from source regions when estimating probabilities of establishment and effects of pathway infestation rates. To address this, we developed a novel framework and modeling approach to enable prediction of future establishments in relation to changes in arrival rate across entire species pools. We utilized 13 828 border interception records from the United States and New Zealand for 444 true bark beetle (Scolytinae) and longhorned beetle (Cerambycidae) species detected between 1949 and 2008 as proxies for arrival rates to model the relationship between arrival and establishment rates. Nonlinearity in this relationship implies that measures intended to reduce the unintended transport of potential invaders (such as phytosanitary treatments) must be highly effective in order to substantially reduce the rate of future invasions, particularly if trade volumes continue to increase.

  4. Experimental Study on the Burning Behavior of Pool Fires in Rooms with Different Wall Linings

    DEFF Research Database (Denmark)

    Poulsen, Annemarie; Jomaas, Grunde

    2011-01-01

    An experimental test series, comprising 10 experiments with varying pool sizes, lining materials and amounts of liquid burning, was conducted under free burn and room burn conditions. The thermal feedback from the enclosure (ISO 9705 Room Corner Test facility) enhanced the burning rate of the poo...... in the shortest time. Given the profound difference between the enclosure tests and the free burn tests and also between enclosure tests with different linings, it is recommended to show great caution if free burn tests are to be used in design fire scenarios....

  5. Condensation pool experiments with steam using DN200 blowdown pipe

    International Nuclear Information System (INIS)

    Laine, J.; Puustinen, M.

    2005-08-01

    This report summarizes the results of the condensation pool experiments with steam using a DN200 blowdown pipe. Altogether five experiment series, each consisting of several steam blows, were carried out in December 2004 with a scaled-down test facility designed and constructed at Lappeenranta University of Technology. The main purpose of the experiments was to increase the understanding of different phenomena in the condensation pool during steam discharge. (au)

  6. Optimization of spent fuel pool weir gate driving mechanism

    Science.gov (United States)

    Liu, Chao; Du, Lin; Tao, Xinlei; Wang, Shijie; Shang, Ertao; Yu, Jianjiang

    2018-04-01

    Spent fuel pool is crucial facility for fuel storage and nuclear safety, and the spent fuel pool weir gate is the key related equipment. In order to achieve a goal of more efficient driving force transfer, loading during the opening/closing process is analyzed and an optimized calculation method for dimensions of driving mechanism is proposed. The result of optimizing example shows that the method can be applied to weir gates' design with similar driving mechanism.

  7. CHARACTERISTICS OFBENTHIC FISH COMMUNITY OF DNIEPER STORAGE POOL LITTORAL ZONE

    Directory of Open Access Journals (Sweden)

    Novitskiy R. A.

    2011-11-01

    Full Text Available Specific composition of bull-calves is analyzed together with their quantitative and quality parameters in the littoral zone of the Dnepr storage pool. The structural-functional features of organization of littoral communities of bull-calves were studied. The patterns of spatial distribution of Bull-calf (Gobiidae representatives were analyzed for the storage pool; their role in the littoral fish communities was clarified.

  8. Research progresses and future directions on pool boiling heat transfer

    OpenAIRE

    M. Kumar; V. Bhutani; P. Khatak

    2015-01-01

    This paper reviews the previous work carried on pool boiling heat transfer during heating of various liquids and commodities categorized as refrigerants and dielectric fluids, pure liquids, nanofluids, hydrocarbons and additive mixtures, as well as natural and synthetic colloidal solutions. Nucleate pool boiling is an efficient and effective method of boiling because high heat fluxes are possible with moderate temperature differences. It is characterized by the growth of bubbles on a heated s...

  9. Analysis of natural convection in volumetrically-heated melt pools

    International Nuclear Information System (INIS)

    Sehgal, B.R.; Dinh, T.N.; Nourgaliev, R.R.

    1996-12-01

    Results of series of studies on natural convection heat transfer in decay-heated core melt pools which form in a reactor lower plenum during the progression of a core meltdown accident are described. The emphasis is on modelling and prediction of turbulent heat transfer characteristics of natural convection in a liquid pool with an internal energy source. Methods of computational fluid dynamics, including direct numerical simulation, were applied for investigation

  10. Cryptosporidium and Giardia in Swimming Pools, Atlanta, Georgia

    Centers for Disease Control (CDC) Podcasts

    In this podcast, Dan Rutz speaks with Dr. Joan Shields, a guest researcher with the Healthy Swimming Program at CDC, about an article in June 2008 issue of Emerging Infectious Diseases reporting on the results of a test of swimming pools in the greater Atlanta, Georgia area. Dr. Shields tested 160 pools in metro Atlanta last year for Cryptosporidium and Giardia. These germs cause most recreational water associated outbreaks.

  11. A swimming pool array for ultra high energy showers

    Science.gov (United States)

    Yodh, Gaurang B.; Shoup, Anthony; Barwick, Steve; Goodman, Jordan A.

    1992-11-01

    A very preliminary design concept for an array using water Cherenkov counters, built out of commercially available backyard swimming pools, to sample the electromagnetic and muonic components of ultra high energy showers at large lateral distances is presented. The expected performance of the pools is estimated using the observed lateral distributions by scintillator and water Cherenkov arrays at energies above 1019 eV and simulations.

  12. Lip and tooth injuries at public swimming pools in Austria.

    Science.gov (United States)

    Lechner, Katharina; Connert, Thomas; Kühl, Sebastian; Filippi, Andreas

    2017-06-01

    There is an increased risk of orofacial injuries in swimming pool facilities. Nevertheless, only a few studies have addressed this issue. The aim of this study was to identify the frequency of lip and tooth injuries at public swimming pools in Austria. A further aim was to examine which gender and age groups were affected, where and why these injuries occurred, and whether pool attendants had sufficient knowledge of dental first-aid measures. A total of 764 pool attendants in Austria were contacted by telephone and 689 participated in the study (90.2%). The attendants were interviewed retrospectively about accident occurrences in 2014 by a standardized questionnaire. Responses to the provision of first aid and choice of storage medium for avulsed teeth were subsequently evaluated. The frequency of lip injuries was 19.0%, and tooth injuries were 11.3%. Male bathers (P < .05) and children under 12 years (P < .001) most frequently suffered injuries. The waterslide was the most common accident site. The most common cause of lip injuries was slipping on wet surfaces (39.0%), and for tooth injuries it was collisions with other persons or objects (each 28.1%). The pool attendants' responses were predominantly good or sufficient on first aid, with the exception of what storage medium to choose. Tooth rescue boxes were available in only 8.6% of all pool facilities. Orofacial injuries are a frequently occurring problem in swimming pool facilities. The pool attendants' knowledge on first-aid care of tooth injuries could still be improved. © 2017 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  13. A hierarchic sustainability dashboard to evaluate logistics pooling

    OpenAIRE

    Morana, Joëlle; Gonzalez-Feliu, Jesus

    2014-01-01

    Logistics pooling is now a major challenge in supply chain management, though it remains a little known activity in which the different actors involved use different approaches whose objectives are not always the same and with sometimes conflicting standpoints. This purpose of this article is to define, on the basis of a detailed analysis of the literature, a grid for interpreting and a dashboard for evaluating the sustainable performance of pooled delivery systems. Firstly, an analysis of th...

  14. Analysis of natural convection in volumetrically-heated melt pools

    Energy Technology Data Exchange (ETDEWEB)

    Sehgal, B.R.; Dinh, T.N.; Nourgaliev, R.R. [Royal Inst. of Tech., Stockholm (Sweden). Div. of Nuclear Power Safety

    1996-12-01

    Results of series of studies on natural convection heat transfer in decay-heated core melt pools which form in a reactor lower plenum during the progression of a core meltdown accident are described. The emphasis is on modelling and prediction of turbulent heat transfer characteristics of natural convection in a liquid pool with an internal energy source. Methods of computational fluid dynamics, including direct numerical simulation, were applied for investigation. Refs, figs, tabs.

  15. Competition and power pooling in the electricity industry

    International Nuclear Information System (INIS)

    Jasinski, P.; Yarrow, G.; Fusaro, P.

    1995-01-01

    Two contributions to the debate on power pooling and competition in the electricity supply industry are presented. In the first, the situation in England and Wales where power pooling was introduced shortly before privatization is analysed. Pooling has existed for many years in the USA but as an inter-generator arrangement designed to optimize production and costs. The British system sought in addition to establish a spot market in which bulk buyers as well as bulk suppliers could participate. There are however obvious weaknesses in the pool as a competitive market and it is argued that a combination of pooling arrangements and longer-term bilateral supply contracts are more likely to offer the prospect of workably competitive and efficient outcomes. The second contribution discusses how competitive markets will evolve in the USA under the new regime of less onerous regulation heralded by the Energy Policy Act if 1992 and the emergence of electricity trading markets which followed. In particular, the proposal by the California Public Utility commission favouring a mandatory Poolco is examined. Poolco would operate the transmission grid and dispatch generating plants while the utilities would retain ownership of transmission facilities and be required to supply the pool. This is seen as representing only partial deregulation and not to be consistent with moves to further competition and encourage free markets. (U.K.)

  16. Test Area North Pool Stabilization Project: Environmental assessment

    International Nuclear Information System (INIS)

    1996-05-01

    The Test Area North (TAN) Pool is located within the fenced TAN facility boundaries on the Idaho National Engineering Laboratory (INEL). The TAN pool stores 344 canisters of core debris from the March, 1979, Three Mile Island (TMI) Unit 2 reactor accident; fuel assemblies from Loss-of-Fluid Tests (LOFT); and Government-owned commercial fuel rods and assemblies. The LOFT and government owned commercial fuel rods and assemblies are hereafter referred to collectively as open-quotes commercial fuelsclose quotes except where distinction between the two is important to the analysis. DOE proposes to remove the canisters of TMI core debris and commercial fuels from the TAN Pool and transfer them to the Idaho Chemical Processing Plant (ICPP) for interim dry storage until an alternate storage location other than at the INEL, or a permanent federal spent nuclear fuel (SNF) repository is available. The TAN Pool would be drained and placed in an industrially and radiologically safe condition for refurbishment or eventual decommissioning. This environmental assessment (EA) identifies and evaluates environmental impacts associated with (1) constructing an Interim Storage System (ISS) at ICPP; (2) removing the TMI and commercial fuels from the pool and transporting them to ICPP for placement in an ISS, and (3) draining and stabilizing the TAN Pool. Miscellaneous hardware would be removed and decontaminated or disposed of in the INEL Radioactive Waste Management Complex (RWMC). This EA also describes the environmental consequences of the no action alternative

  17. LNG pool fire simulation for domino effect analysis

    International Nuclear Information System (INIS)

    Masum Jujuly, Muhammad; Rahman, Aziz; Ahmed, Salim; Khan, Faisal

    2015-01-01

    A three-dimensional computational fluid dynamics (CFD) simulation of liquefied natural gas (LNG) pool fire has been performed using ANSYS CFX-14. The CFD model solves the fundamental governing equations of fluid dynamics, namely, the continuity, momentum and energy equations. Several built-in sub-models are used to capture the characteristics of pool fire. The Reynolds-averaged Navier–Stokes (RANS) equation for turbulence and the eddy-dissipation model for non-premixed combustion are used. For thermal radiation, the Monte Carlo (MC) radiation model is used with the Magnussen soot model. The CFD results are compared with a set of experimental data for validation; the results are consistent with experimental data. CFD results show that the wind speed has significant contribution on the behavior of pool fire and its domino effects. The radiation contours are also obtained from CFD post processing, which can be applied for risk analysis. The outcome of this study will be helpful for better understanding of the domino effects of pool fire in complex geometrical settings of process industries. - Highlights: • Simulation of pool fire using computational fluid dynamics (CFD) model. • Integration of CFD based pool fire model with domino effect. • Application of the integrated CFD based domino effect analysis

  18. Seasonal variation in Chironomid emergence from coastal pools

    Directory of Open Access Journals (Sweden)

    Alexander T. Egan

    2015-07-01

    Full Text Available Understanding the phenology of emergences can be useful in determining seasonal chironomid life cycle patterns, which are often influenced by ice cover and temperature in cold climates. Lake Superior is the largest lake in North America and with a mean surface temperature of 3.9 °C influences regional climate. Coastal pools at Isle Royale, a wilderness archipelago in the northern part of the lake, occur in dense patches on low-gradient volcanic bedrock between the lakeshore and forest, creating variable microhabitats for Chironomidae. Four sites were sampled monthly from April to October, 2010. Surface-floating pupal exuviae were collected from a series of pools in two zones: a lower zone near the lake influenced by wave splash, and an upper zone near the forest and influenced by upland runoff. We used Jaccard’s and Whittaker’s diversity indexes to test community similarity across months. Temperature loggers in pools collected hourly readings for most of the study. Assemblage emergences were stable in upper pools, with significant similarity across late spring and summer months. Assemblages were seasonally variable in lower pools, with significant dissimilarity across spring, summer, and fall months. Few species in either zone were unique to spring or fall months. However, many summer species in the splash zone had a narrow emergence period occurring during calm weather following distinct increases in mean water temperature. Regardless of input of cold lake water to the lower zone, pools from both zones generally had corresponding temperature trends.

  19. Review of steam jet condensation in a water pool

    International Nuclear Information System (INIS)

    Kim, Y. S.; Song, C. H.; Park, C. K.; Kang, H. S.; Jeon, H. G.; Yoon, Y. J.

    2002-01-01

    In the advanced nuclear power plants including APR1400, the SDVS is adopted to increase the plant safety using the concept of feed-and-bleed operation. In the case of the TLOFW, the POSRV located at the top of the pressurizer is expected to open due to the pressurization of the reactor coolant system and discharges steam and/or water mixture into the water pool, where the mixture is condensed. During the condensation of the mixture, thermal-hydraulic loads such as pressure and temperature variations are induced to the pool structure. For the pool structure design, such thermal-hydraulic aspects should be considered. Understanding the phenomena of the submerged steam jet condensation in a water pool is helpful for system designers to design proper pool structure, sparger, and supports etc. This paper reviews and evaluates the steam jet condensation in a water pool on the physical phenomena of the steam condensation including condensation regime map, heat transfer coefficient, steam plume, steam jet condensation load, and steam jet induced flow

  20. Natural convection heat transfer in the molten metal pool

    International Nuclear Information System (INIS)

    Park, R.J.; Kim, S.B.; Kim, H.D.; Choi, S.M.

    1997-01-01

    Analytical studies using the FLOW-3D computer program have been performed on natural convection heat transfer of a high density molten metal pool, in order to evaluate the coolability of the corium pool. The FLOW-3D results on the temperature distribution and the heat transfer rate in the molten metal pool region have been compared and evaluated with the experimental data. The FLOW-3D results have shown that the developed natural convection flow contributes to the solidified crust formation of the high density molten metal pool. The present FLOW-3D results, on the relationship between the Nusselt number and the Rayleigh number in the molten metal pool region, are more similar to the calculated results of Globe and Dropkin's correlation than any others. The natural convection heat transfer in the low aspect ratio case is more substantial than that in the high aspect ratio case. The FLOW-3D results, on the temperature profile and on the heat transfer rate in the molten metal pool region, are very similar to the experimental data. The heat transfer rate of the internal heat generation case is higher than that of the bottom heating case at the same heat supply condition. (author)

  1. Detection of 41Ar diffusion from a TRIGA pool

    International Nuclear Information System (INIS)

    Foss, Scott; Nelson, George

    1990-01-01

    Argon-41 levels in very low concentrations in the reactor room air can be inferred from the rate of escape from the pool water surface. The rate of Argon-41 diffusion from pool water to room air was determined by the measurement of the activity buildup in containers of air in contact with the pool surface. The Argon-41 concentration in each container was measured by gamma-ray spectrometry with a calibrated GeLi detector. At 100 KW power with the water temperature at 10 deg. Celsius the total release of Argon-41 was determined to be 3.5e10±15% atoms for 80 minutes of operation. The corresponding activity released from the pool was 98.6 microcuries, while the total activity produced in the pool was 4900 microcuries. The diffusion coefficient of Argon-41 from the pool water surface to the air at this temperature was measured to be 3.14e-14 sec-cm 2 . (author)

  2. Structural analysis of the reactor pool for the RRRP

    International Nuclear Information System (INIS)

    Alberro, J.G.; Abbate, A.D.

    2005-01-01

    The purpose of the present document is to describe the structural design of the Reactor Pool relevant to the RRRP (Replacement Research Reactor Project) for the Australian Nuclear Science and Technology Organisation. The structural analysis required coordinated design, engineering, analysis, and fabrication efforts. The pool has been designed, manufactured, and inspected following as guideline the ASME Boiler and Pressure Vessel Code, which defines the requirements for the pool to withstand hydrostatic and mechanical forces, ensuring its integrity throughout its lifetime. Standard off-the-shelf finite element programs (Nastran and Ansys codes) were used to evaluate the pool and further qualify the design and its construction. Both global and local effect analyses were carried out. The global analysis covers the structural integrity of the pool wall (6 mm thick) considering the different load states acting on it, namely hydrostatic pressure, thermal expansion, and seismic event. The local analysis evaluates the structural behaviour of the pool at specific points resulting from the interaction among components. It is confirmed that maximum stresses and displacements fall below the allowable values required by the ASME Boiler and Pressure Vessel Code. The water pressure analysis was validated by means of a hydrostatic test. (authors)

  3. Optimum allocation of imaging time and minimum detectable activity in dual isotope blood pool subtraction indium-111 platelet imaging

    International Nuclear Information System (INIS)

    Machac, J.; Horowitz, S.F.; Goldsmith, S.J.; Fuster, V.

    1984-01-01

    Indium-111 labeled platelet imaging is a tool for detection of thrombus formation in vascular spaces. Dual isotope blood pool subtraction may help differentiate focal platelet accumulation from blood pool activity. This study used a computer model to calculate the minimum excess-to-blood pool platelet ratio (EX/BP) and the optimum dual isotope imaging times under varied conditions of lesion size. The model simulated usual human imaging doses of 500 μCi of In-111 platelets and 5mCi of Tc-99m labeled RBCs giving a reference cardiac blood pool region (100cc) of 10000 cpm for Tc-99m and 500 cpm for In-111. The total imaging time was fixed at 20 minutes, while the two isotope imaging times (TIn/TTc) were varied, as were the simulated lesion size (cc) and EX/BP. The relative error of the excess counts was calculated using propagation of error theory. At the critical level of detection, where the excess lesion counts equal 3 times the standard deviation, the optimum TIn/TTc and minimum Ex/BP were determined for each lesion size. For the smallest lesion size (0.1cc), the minimum detectable EX/BP ratio was 1.6, with the best TIn/TTC ratio of 18/2 minutes, and for large lesions, an EX/BP of 0.1, with a TIn/TTc of 16/4. This model provides an estimate of the sensitivity and optimizes imaging times in dual isotope subtraction platelet imaging. The model is adaptable to varying isotope doses, total imaging times and lesion size. This information will be helpful in future in- vivo imaging studies of intravascular thrombi in humans

  4. 76 FR 64085 - Post-2014 Resource Pool-Loveland Area Projects, Final Power Allocation

    Science.gov (United States)

    2011-10-17

    ... Resource Pool; Loveland Area Projects, General Eligibility Criteria. The resource pool for capacity and... transmission in Kansas. Final allocation of the Post-2014 Resource Pool; Loveland Area Projects, is contingent...

  5. Tests of Selection in Pooled Case-Control Data: An Empirical Study

    Directory of Open Access Journals (Sweden)

    Nitin eUdpa

    2011-11-01

    Full Text Available For smaller organisms with faster breeding cycles, artificial selection can be used to create sub-populations with different phenotypic traits. Genetic tests can be employed to identify the causal markers for the phenotypes, as a precursor to engineering strains with a combination of traits. Traditional approaches involve analyzing crosses of inbred strains to test for co-segregation with genetic markers. Here we take advantage of cheaper next generation sequencing techniques to identifygenetic signatures of adaptation to the selection constraints. Obtaining individual sequencing data is often unrealistic due to cost and sample issues, so we focus on pooled genomic data.In this paper, we explore a series of statistical tests for selection using pooled case (under selection and control populations. Extensive simulations are used to show that these approaches work well for a wide range of population divergence times and strong selective pressures. We show that pooling does not have a significant impact on statistical power. The tests are also robust to reasonable variations in several different parameters, including window size, base-calling error rate, and sequencing coverage. We then demonstrate the viability (and the challenges of one of these methods in two independent Drosophila populations (Drosophila melanogaster bred under selectionfor hypoxia and accelerated development, respectively. Testing for extreme hypoxia tolerance showed clear signals of selection, pointing to loci that are important for hypoxia adaptation.Overall, we outline a strategy for finding regions under selection using pooled sequences, then devise optimal tests for that strategy. The approaches show promise for detecting selection, even several generations after fixation of the beneficial allele has occurred.

  6. Tests of selection in pooled case-control data: an empirical study.

    Science.gov (United States)

    Udpa, Nitin; Zhou, Dan; Haddad, Gabriel G; Bafna, Vineet

    2011-01-01

    For smaller organisms with faster breeding cycles, artificial selection can be used to create sub-populations with different phenotypic traits. Genetic tests can be employed to identify the causal markers for the phenotypes, as a precursor to engineering strains with a combination of traits. Traditional approaches involve analyzing crosses of inbred strains to test for co-segregation with genetic markers. Here we take advantage of cheaper next generation sequencing techniques to identify genetic signatures of adaptation to the selection constraints. Obtaining individual sequencing data is often unrealistic due to cost and sample issues, so we focus on pooled genomic data. We explore a series of statistical tests for selection using pooled case (under selection) and control populations. The tests generally capture skews in the scaled frequency spectrum of alleles in a region, which are indicative of a selective sweep. Extensive simulations are used to show that these approaches work well for a wide range of population divergence times and strong selective pressures. Control vs control simulations are used to determine an empirical False Positive Rate, and regions under selection are determined using a 1% FPR level. We show that pooling does not have a significant impact on statistical power. The tests are also robust to reasonable variations in several different parameters, including window size, base-calling error rate, and sequencing coverage. We then demonstrate the viability (and the challenges) of one of these methods in two independent Drosophila populations (Drosophila melanogaster) bred under selection for hypoxia and accelerated development, respectively. Testing for extreme hypoxia tolerance showed clear signals of selection, pointing to loci that are important for hypoxia adaptation. Overall, we outline a strategy for finding regions under selection using pooled sequences, then devise optimal tests for that strategy. The approaches show promise for

  7. Safety analysis of LWR irradiated fuel element pool storages before reprocessing

    International Nuclear Information System (INIS)

    Lefort, G.; Leclerc, J.; Hoffman, A.; Frejaville, C.; Domage, M.

    1984-01-01

    The protection of operators and environment requires imperatively that the safety must be taken into account as early as the design of the pools takes place and working conditions are defined. The analysis of criticality, irradiation, contamination, external or internal aggression hazards... allows to draw the main constraints which must be retained in the sizing of these pools: the criticality risk needs distances between fuel elements which results in a not very good utilization of the available area which leads to the utilization of neutron shieldings or requires a safe knowledge of the fuel elements burn up; the irradiation and contamination risks require a special quality of the pool water (temperature, activity, purity...) a good tightness of the basins to locate and to isolate the dubions fuel elements; the external or internal aggression risks such as earthquakes, missiles or loads drops, explosion, imply the civil engineering and involve the use of special technical devices. A brief presentation of the pool storages of the next UP2-800 and UP3 A reprocessing plants allows to show how the requirement drawn by safety analysis have been enforced, while carrying out civil engineering works without equivalent in the world, in this field. The foreseeable evolution of the uranium enrichment rate and burn-up of next PWR fuel elements have an effect upon the risk evaluations; a device apparatus, developed in CEA, for the measurement of burn up and cooling time is presented. At least, a short presentation of the mechanical structure durability studies of the reception and storage spent fuels installations are allowed to improve our knowledge in working conditions and in case of serious accidents

  8. Genome-wide Association Study for Ovarian Cancer Susceptibility using Pooled DNA

    Science.gov (United States)

    Lu, Yi; Chen, Xiaoqing; Beesley, Jonathan; Johnatty, Sharon E.; deFazio, Anna; Lambrechts, Sandrina; Lambrechts, Diether; Despierre, Evelyn; Vergotes, Ignace; Chang-Claude, Jenny; Hein, Rebecca; Nickels, Stefan; Wang-Gohrke, Shan; Dörk, Thilo; Dürst, Matthias; Antonenkova, Natalia; Bogdanova, Natalia; Goodman, Marc T.; Lurie, Galina; Wilkens, Lynne R.; Carney, Michael E.; Butzow, Ralf; Nevanlinna, Heli; Heikkinen, Tuomas; Leminen, Arto; Kiemeney, Lambertus A.; Massuger, Leon F.A.G.; van Altena, Anne M.; Aben, Katja K.; Kjaer, Susanne Krüger; Høgdall, Estrid; Jensen, Allan; Brooks-Wilson, Angela; Le, Nhu; Cook, Linda; Earp, Madalene; Kelemen, Linda; Easton, Douglas; Pharoah, Paul; Song, Honglin; Tyrer, Jonathan; Ramus, Susan; Menon, Usha; Gentry-Maharaj, Alexandra; Gayther, Simon A.; Bandera, Elisa V.; Olson, Sara H.; Orlow, Irene; Rodriguez-Rodriguez, Lorna

    2013-01-01

    Recent genome-wide association studies (GWAS) have identified four low-penetrance ovarian cancer susceptibility loci. We hypothesized that further moderate or low penetrance variants exist among the subset of SNPs not well tagged by the genotyping arrays used in the previous studies which would account for some of the remaining risk. We therefore conducted a time- and cost-effective stage 1 GWAS on 342 invasive serous cases and 643 controls genotyped on pooled DNA using the high density Illumina 1M-Duo array. We followed up 20 of the most significantly associated SNPs, which are not well tagged by the lower density arrays used by the published GWAS, and genotyping them on individual DNA. Most of the top 20 SNPs were clearly validated by individually genotyping the samples used in the pools. However, none of the 20 SNPs replicated when tested for association in a much larger stage 2 set of 4,651 cases and 6,966 controls from the Ovarian Cancer Association Consortium. Given that most of the top 20 SNPs from pooling were validated in the same samples by individual genotyping, the lack of replication is likely to be due to the relatively small sample size in our stage 1 GWAS rather than due to problems with the pooling approach. We conclude that there are unlikely to be any moderate or large effects on ovarian cancer risk untagged by the less dense arrays. However our study lacked power to make clear statements on the existence of hitherto untagged small effect variants. PMID:22794196

  9. 454 sequencing of pooled BAC clones on chromosome 3H of barley

    Directory of Open Access Journals (Sweden)

    Yamaji Nami

    2011-05-01

    Full Text Available Abstract Background Genome sequencing of barley has been delayed due to its large genome size (ca. 5,000Mbp. Among the fast sequencing systems, 454 liquid phase pyrosequencing provides the longest reads and is the most promising method for BAC clones. Here we report the results of pooled sequencing of BAC clones selected with ESTs genetically mapped to chromosome 3H. Results We sequenced pooled barley BAC clones using a 454 parallel genome sequencer. A PCR screening system based on primer sets derived from genetically mapped ESTs on chromosome 3H was used for clone selection in a BAC library developed from cultivar "Haruna Nijo". The DNA samples of 10 or 20 BAC clones were pooled and used for shotgun library development. The homology between contig sequences generated in each pooled library and mapped EST sequences was studied. The number of contigs assigned on chromosome 3H was 372. Their lengths ranged from 1,230 bp to 58,322 bp with an average 14,891 bp. Of these contigs, 240 showed homology and colinearity with the genome sequence of rice chromosome 1. A contig annotation browser supplemented with query search by unique sequence or genetic map position was developed. The identified contigs can be annotated with barley cDNAs and reference sequences on the browser. Homology analysis of these contigs with rice genes indicated that 1,239 rice genes can be assigned to barley contigs by the simple comparison of sequence lengths in both species. Of these genes, 492 are assigned to rice chromosome 1. Conclusions We demonstrate the efficiency of sequencing gene rich regions from barley chromosome 3H, with special reference to syntenic relationships with rice chromosome 1.

  10. Uncertainty analysis of suppression pool heating during an ATWS in a BWR-5 plant

    International Nuclear Information System (INIS)

    Wulff, W.; Cheng, H.S.; Mallen, A.N.; Johnsen, G.W.; Lellouche, G.S.

    1994-03-01

    The uncertainty has been estimated of predicting the peak temperature in the suppression pool of a BWR power plant, which undergoes an NRC-postulated Anticipated Transient Without Scram (ATWS). The ATWS is initiated by recirculation-pump trips, and then leads to power and flow oscillations as they had occurred at the LaSalle-2 Power Station in March of 1988. After limit-cycle oscillations have been established, the turbines are tripped, but without MSIV closure, allowing steam discharge through the turbine bypass into the condenser. Postulated operator actions, namely to lower the reactor vessel pressure and the level elevation in the downcomer, are simulated by a robot model which accounts for operator uncertainty. All balance of plant and control systems modeling uncertainties were part of the statistical uncertainty analysis that was patterned after the Code Scaling, Applicability and Uncertainty (CSAU) evaluation methodology. The analysis showed that the predicted suppression-pool peak temperature of 329.3 K (133 degrees F) has a 95-percentile uncertainty of 14.4 K (26 degrees F), and that the size of this uncertainty bracket is dominated by the experimental uncertainty of measuring Safety and Relief Valve mass flow rates under critical-flow conditions. The analysis showed also that the probability of exceeding the suppression-pool temperature limit of 352.6 K (175 degrees F) is most likely zero (it is estimated as < 5-104). The square root of the sum of the squares of all the computed peak pool temperatures is 350.7 K (171.6 degrees F)

  11. Mathematical modelling and simulation of the thermal performance of a solar heated indoor swimming pool

    OpenAIRE

    Mančić Marko V.; Živković Dragoljub S.; Milosavljević Peđa M.; Todorović Milena N.

    2014-01-01

    Buildings with indoor swimming pools have a large energy footprint. The source of major energy loss is the swimming pool hall where air humidity is increased by evaporation from the pool water surface. This increases energy consumption for heating and ventilation of the pool hall, fresh water supply loss and heat demand for pool water heating. In this paper, a mathematical model of the swimming pool was made to assess energy demands of an indoor swimming po...

  12. Pooled versus separate measurements of tree-ring stable isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Dorado Linan, Isabel, E-mail: isabel@gfz-potsdam.de [Universitat de Barcelona, Departament d' Ecologia, Diagonal 645, 08028, Barcelona (Spain); German Centre for Geosciences, Climate Dynamics and Landscape Evolution, Dendro Laboratory, Telegrafenberg, 14473, Potsdam (Germany); Gutierrez, Emilia, E-mail: emgutierrez@ub.edu [Universitat de Barcelona, Departament d' Ecologia, Diagonal 645, 08028, Barcelona (Spain); Helle, Gerhard, E-mail: ghelle@gfz-potsdam.de [German Centre for Geosciences, Climate Dynamics and Landscape Evolution, Dendro Laboratory, Telegrafenberg, 14473, Potsdam (Germany); Heinrich, Ingo, E-mail: heinrich@gfz-potsdam.de [German Centre for Geosciences, Climate Dynamics and Landscape Evolution, Dendro Laboratory, Telegrafenberg, 14473, Potsdam (Germany); Andreu-Hayles, Laia, E-mail: laiandreu@ub.edu [Universitat de Barcelona, Departament d' Ecologia, Diagonal 645, 08028, Barcelona (Spain); Tree-Ring Laboratory, Lamont-Doherty Earth Observatory of Columbia University, Palisades NY (United States); Planells, Octavi, E-mail: leocarpus@hotmail.com [Universitat de Barcelona, Departament d' Ecologia, Diagonal 645, 08028, Barcelona (Spain); Leuenberger, Markus, E-mail: leuenberger@climate.unibe.ch [Climate and Environmental Physics, Physics Institute, University of Bern, Sidlerstrasse 5, 3012 Bern (Switzerland); Oeschger Centre of Climate Change Research, University of Bern, Zaehringerstrasse 25, 3012 Bern (Switzerland); Buerger, Carmen, E-mail: buerger@gfz-potsdam.de [German Centre for Geosciences, Climate Dynamics and Landscape Evolution, Dendro Laboratory, Telegrafenberg, 14473, Potsdam (Germany); Schleser, Gerhard, E-mail: schleser@gfz-potsdam.de [German Centre for Geosciences, Climate Dynamics and Landscape Evolution, Dendro Laboratory, Telegrafenberg, 14473, Potsdam (Germany)

    2011-05-01

    {delta}{sup 13}C and {delta}{sup 18}O of tree rings contain time integrated information about the environmental conditions weighted by seasonal growth dynamics and are well established as sources of palaeoclimatic and ecophysiological data. Annually resolved isotope chronologies are frequently produced by pooling dated growth rings from several trees prior to the isotopic analyses. This procedure has the advantage of saving time and resources, but precludes from defining the isotopic error or statistical uncertainty related to the inter-tree variability. Up to now only a few studies have compared isotope series from pooled tree rings with isotopic measurements from individual trees. We tested whether or not the {delta}{sup 13}C and the {delta}{sup 18}O chronologies derived from pooled and from individual tree rings display significant differences at two locations from the Iberian Peninsula to assess advantages and constraints of both methodologies. The comparisons along the period 1900-2003 reveal a good agreement between pooled chronologies and the two mean master series which were created by averaging raw individual values (Mean) or by generating a mass calibrated mean (MassC). In most of the cases, pooled chronologies show high synchronicity with averaged individual samples at interannual scale but some differences also show up especially when comparing {delta}{sup 18}O decadal to multi-decadal variations. Moreover, differences in the first order autocorrelation among individuals may be obscured by pooling strategies. The lack of replication of pooled chronologies prevents detection of a bias due to a higher mass contribution of one sample but uncertainties associated with the analytical process itself, as sample inhomogeneity, seems to account for the observed differences. - Research Highlights: {yields} Pooled {delta}{sup 13}C and {delta}{sup 18}O chronologies are expected to be similar to the mean. {yields} Empirical pooled chronologies {delta}{sup 13}C and

  13. Pooled versus separate measurements of tree-ring stable isotopes

    International Nuclear Information System (INIS)

    Dorado Linan, Isabel; Gutierrez, Emilia; Helle, Gerhard; Heinrich, Ingo; Andreu-Hayles, Laia; Planells, Octavi; Leuenberger, Markus; Buerger, Carmen; Schleser, Gerhard

    2011-01-01

    δ 13 C and δ 18 O of tree rings contain time integrated information about the environmental conditions weighted by seasonal growth dynamics and are well established as sources of palaeoclimatic and ecophysiological data. Annually resolved isotope chronologies are frequently produced by pooling dated growth rings from several trees prior to the isotopic analyses. This procedure has the advantage of saving time and resources, but precludes from defining the isotopic error or statistical uncertainty related to the inter-tree variability. Up to now only a few studies have compared isotope series from pooled tree rings with isotopic measurements from individual trees. We tested whether or not the δ 13 C and the δ 18 O chronologies derived from pooled and from individual tree rings display significant differences at two locations from the Iberian Peninsula to assess advantages and constraints of both methodologies. The comparisons along the period 1900-2003 reveal a good agreement between pooled chronologies and the two mean master series which were created by averaging raw individual values (Mean) or by generating a mass calibrated mean (MassC). In most of the cases, pooled chronologies show high synchronicity with averaged individual samples at interannual scale but some differences also show up especially when comparing δ 18 O decadal to multi-decadal variations. Moreover, differences in the first order autocorrelation among individuals may be obscured by pooling strategies. The lack of replication of pooled chronologies prevents detection of a bias due to a higher mass contribution of one sample but uncertainties associated with the analytical process itself, as sample inhomogeneity, seems to account for the observed differences. - Research Highlights: → Pooled δ 13 C and δ 18 O chronologies are expected to be similar to the mean. → Empirical pooled chronologies δ 13 C and δ 18 O and the mean show a high synchronicity. → Pooled chronologies differ

  14. Effects of surface shape on the geometry and surface topography of the melt pool in low-power density laser melting

    KAUST Repository

    Kim, Youngdeuk

    2011-04-15

    The quantitative correlations between workpiece volume and melt pool geometry, as well as the flow and thermal features of the melt pool are established. Thermocapillary convections in melt pool with a deformable free surface are investigated with respect to surface shape and laser intensity. When the contact angle between the tangent to the top surface and the vertical wall at the hot center is acute, the free surface flattens, compared with that of the initial free surface. Otherwise, the free surface forms a bowl-like shape with a deep crater and a low peripheral rim when the contact angle at the hot center is obtuse. Increasing the workpiece volume at a fixed laser intensity and a negative radial height gradient cause linear decreases in the geometric size and magnitude of flow and temperature of the melt pool. Conversely, linear increases are observed with a positive radial height gradient. © 2011 American Institute of Chemical Engineers (AIChE).

  15. Suppression pool testing at the SIET laboratory. Experimental investigation of critical phenomena expected in the Fukushima Daiichi suppression chamber

    International Nuclear Information System (INIS)

    Pellegrini, Marco; Naitoh, Masanori; Araneo, Lucio; Ninokata, Hisashi; Ricotti, Marco; Achilli, Andrea

    2016-01-01

    possibly dependent on the distance of the pipe outlet to the pool floor. Given the reduced size of the pool compared to the plant scale, the observed phenomena should not be extrapolated for the whole S/C. The objective of the ongoing experimental activity is to construct a database based on the high-speed filming, measurements of major quantities such as water temperature, steam pressure and FPs concentration to foster the development of physical models for both lumped parameter SA codes and detailed computational fluid dynamics software, in an effort to enhance the understanding of the complex phenomena following the 1F accident. (author)

  16. Convective Cold Pool Structure and Boundary Layer Recovery in DYNAMO

    Science.gov (United States)

    Savarin, A.; Chen, S. S.; Kerns, B. W.; Lee, C.; Jorgensen, D. P.

    2012-12-01

    One of the key factors controlling convective cloud systems in the Madden-Julian Oscillation (MJO) over the tropical Indian Ocean is the property of the atmospheric boundary layer. Convective downdrafts and precipitation from the cloud systems produce cold pools in the boundary layer, which can inhibit subsequent development of convection. The recovery time is the time it takes for the boundary layer to return to pre convective conditions. It may affect the variability of the convection on various time scales during the initiation of MJO. This study examines the convective cold pool structure and boundary layer recovery using the NOAA WP-3D aircraft observations, include the flight-level, Doppler radar, and GPS dropsonde data, collected during the Dynamics of MJO (DYNAMO) field campaign from November-December 2011. The depth and strength of convective cold pools are defined by the negative buoyancy, which can be computed from the dropsonde data. Convective downdraft can be affected by environmental water vapor due to entrainment. Mid-level dry air observed during the convectively suppressed phase of MJO seems to enhance convective downdraft, making the cold pools stronger and deeper. Recovery of the cold pools in the boundary layer is determined by the strength and depth of the cold pools and also the air-sea heat and moisture fluxes. Given that the water vapor and surface winds are distinct for the convectively active and suppressed phases of MJO over the Indian Ocean, the aircraft data are stratified by the two different large-scale regimes of MJO. Preliminary results show that the strength and depth of the cold pools are inversely correlated with the surrounding mid-level moisture. During the convectively suppressed phase, the recovery time is ~5-20 hours in relative weak wind condition with small air-sea fluxes. The recovery time is generally less than 6 hours during the active phase of MJO with moist mid-levels and stronger surface wind and air-sea fluxes.

  17. UPDG: Utilities package for data analysis of Pooled DNA GWAS

    Directory of Open Access Journals (Sweden)

    Ho Daniel WH

    2012-01-01

    Full Text Available Abstract Background Despite being a well-established strategy for cost reduction in disease gene mapping, pooled DNA association study is much less popular than the individual DNA approach. This situation is especially true for pooled DNA genomewide association study (GWAS, for which very few computer resources have been developed for its data analysis. This motivates the development of UPDG (Utilities package for data analysis of Pooled DNA GWAS. Results UPDG represents a generalized framework for data analysis of pooled DNA GWAS with the integration of Unix/Linux shell operations, Perl programs and R scripts. With the input of raw intensity data from GWAS, UPDG performs the following tasks in a stepwise manner: raw data manipulation, correction for allelic preferential amplification, normalization, nested analysis of variance for genetic association testing, and summarization of analysis results. Detailed instructions, procedures and commands are provided in the comprehensive user manual describing the whole process from preliminary preparation of software installation to final outcome acquisition. An example dataset (input files and sample output files is also included in the package so that users can easily familiarize themselves with the data file formats, working procedures and expected output. Therefore, UPDG is especially useful for users with some computer knowledge, but without a sophisticated programming background. Conclusions UPDG provides a free, simple and platform-independent one-stop service to scientists working on pooled DNA GWAS data analysis, but with less advanced programming knowledge. It is our vision and mission to reduce the hindrance for performing data analysis of pooled DNA GWAS through our contribution of UPDG. More importantly, we hope to promote the popularity of pooled DNA GWAS, which is a very useful research strategy.

  18. Biophysical Interactions within Step-Pool Mountain Streams Following Wildfire

    Science.gov (United States)

    Parker, A.; Chin, A.; O'Dowd, A. P.

    2014-12-01

    Recovery of riverine ecosystems following disturbance is driven by a variety of interacting processes. Wildfires pose increasing disturbances to riverine landscapes, with rising frequencies and magnitudes owing to warming climates and increased fuel loads. The effects of wildfire include loss of vegetation, elevated runoff and flash floods, erosion and deposition, and changing biological habitats and communities. Understanding process interactions in post-fire landscapes is increasingly urgent for successful management and restoration of affected ecosystems. In steep channels, steps and pools provide prominent habitats for organisms and structural integrity in high energy environments. Step-pools are typically stable, responding to extreme events with recurrence intervals often exceeding 50 years. Once wildfire occurs, however, intensification of post-fire flood events can potentially overpower the inherent stability of these systems, with significant consequences for aquatic life and human well-being downstream. This study examined the short-term response of step-pool streams following the 2012 Waldo Canyon Fire in Colorado. We explored interacting feedbacks among geomorphology, hydrology, and ecology in the post-fire environment. At selected sites with varying burn severity, we established baseline conditions immediately after the fire with channel surveys, biological assessment using benthic macroinvertebrates, sediment analysis including pebble counts, and precipitation gauging. Repeat measurements after major storm events over several years enabled analysis of the interacting feedbacks among post-fire processes. We found that channels able to retain the step-pool structure changed less and facilitated recovery more readily. Step habitats maintained higher percentages of sensitive macroinvertebrate taxa compared to pools through post-fire floods. Sites burned with high severity experienced greater reduction in the percentage of sensitive taxa. The decimation of

  19. Mercury concentrations and pools in four Sierra Nevada forest sites, and relationships to organic carbon and nitrogen

    Directory of Open Access Journals (Sweden)

    D. Obrist

    2009-05-01

    Full Text Available This study presents data on mercury (Hg concentrations, stochiometric relations to carbon (C and nitrogen (N, and Hg pool sizes in four Sierra Nevada forest sites of similar exposure and precipitation regimes, and hence similar atmospheric deposition, to evaluate how ecosystem parameters control Hg retention in ecosystems. In all four sites, the largest amounts of Hg reside in soils which account for 94–98% of ecosystem pools. Hg concentrations and Hg/C ratios increase in the following order: Green Needles/Leavesr2=0.58 and N and C (r2=0.64 in decomposing litter, but a positive correlation between litter Hg and N (r2=0.70. These inverse relations may reflect preferential retention of N and Hg over C during decomposition, or may be due to older age of decomposed litter layers which are exposed to longer-term atmospheric Hg deposition in the field. The results indicate that litter Hg levels depend on decomposition stage and may not follow generally observed positive relationships between Hg and organic C.

    Mineral soil layers show strong positive correlations of Hg to C across all sites and soil horizons (r2=0.83, but Hg concentrations are even more closely related to N with a similar slope to that observed in litter (r2=0.92. Soil N levels alone explain over 90% of Hg pool sizes across the four Sierra Nevada forest sites. This suggests that soil organic N and C groups provide sorption sites for Hg to retain atmospheric deposition. However, the patterns could be due to indirect relationships where high soil N and C levels reflect high ecosystem productivity which leads to corresponding high atmospheric Hg deposition inputs via leaf litterfall and plant senescence. Our results also show that two of the sites previously affected by

  20. Performance of a swimming pool heating system by utilizing waste energy rejected from an ice rink with an energy storage tank

    International Nuclear Information System (INIS)

    Kuyumcu, Muhammed Enes; Tutumlu, Hakan; Yumrutaş, Recep

    2016-01-01

    Highlights: • An analytical model of the system, and a computational program were developed. • Transient behavior of the water in the buried energy storage tank was simulated. • Effects of various system parameters on the system performance were investigated. • Long period performance of the system was analyzed and obtained periodic condition. • Optimum ice rink size is determined for a semi-Olympic size swimming pool heating. - Abstract: This study deals with determining the long period performance of a swimming pool heating system by utilizing waste heat energy that is rejected from a chiller unit of ice rink and subsequently stored in an underground thermal energy storage (TES) tank. The system consists of an ice rink, a swimming pool, a spherical underground TES tank, a chiller and a heat pump. The ice rink and the swimming pool are both enclosed and located in Gaziantep, Turkey. An analytical model was developed to obtain the performance of the system using Duhamel’s superposition and similarity transformation techniques. A computational model written in MATLAB program based on the transient heat transfer is used to obtain the annual variation of the ice rink and the swimming pool energy requirements, the water temperature in the TES tank, COP, and optimum ice rink size depending on the different ground, TES tank, chiller, and heat pump characteristics. The results obtained from the analysis indicate that 6–7 years’ operational time span is necessary to obtain the annual periodic operation condition. In addition, an ice rink with a size of 475 m"2 gives the optimum performance of the system with a semi-Olympic size swimming pool (625 m"2).

  1. Effects of fumaric acid supplementation on methane production and rumen fermentation in goats fed diets varying in forage and concentrate particle size.

    Science.gov (United States)

    Li, Zongjun; Liu, Nannan; Cao, Yangchun; Jin, Chunjia; Li, Fei; Cai, Chuanjiang; Yao, Junhu

    2018-01-01

    In rumen fermentation, fumaric acid (FA) could competitively utilize hydrogen with methanogenesis to enhance propionate production and suppress methane emission, but both effects were diet-dependent. This study aimed to explore the effects of FA supplementation on methanogenesis and rumen fermentation in goats fed diets varying in forage and concentrate particle size. Four rumen-cannulated goats were used in a 4 × 4 Latin square design with a 2 × 2 factorial arrangement of treatments: low or high ratio of forage particle size: concentrate particle size (Fps:Cps), without or with FA supplementation (24 g/d). Fps:Cps was higher in the diet with chopped alfalfa hay plus ground corn than in that with ground alfalfa hay plus crushed corn. Both increasing dietary Fps:Cps and FA supplementation shifted ruminal volatile fatty acid (VFA) patterns toward more propionate and less acetate in goats. An interaction between dietary Fps:Cps and FA supplementation was observed for the ratio of acetate to propionate (A:P), which was more predominant when FA was supplemented in the low-Fps:Cps diet. Methane production was reduced by FA, and the reduction was larger in the low-Fps:Cps diet (31.72%) than in the high-Fps:Cps diet (17.91%). Fumaric acid decreased ruminal total VFA concentration and increased ruminal pH. No difference was found in ruminal DM degradation of concentrate or alfalfa hay by dietary Fps:Cps or FA. Goats presented a lower ruminal methanogen abundance with FA supplementation and a higher B. fibrisolvens abundance with high dietary Fps:Cps. Adjusting dietary Fps:Cps is an alternative dietary model for studying diet-dependent effects without changing dietary chemical composition. Fumaric acid supplementation in the low-Fps:Cps diet showed greater responses in methane mitigation and propionate increase.

  2. Gallium-68-DOTA-albumin as a PET blood-pool marker: experimental evaluation in vivo

    International Nuclear Information System (INIS)

    Hoffend, Johannes; Mier, Walter; Schuhmacher, Jochen; Schmidt, Kerstin; Dimitrakopoulou-Strauss, Antonia; Strauss, Ludwig G.; Eisenhut, Michael; Kinscherf, Ralf; Haberkorn, Uwe

    2005-01-01

    Investigations into tumor angiogenesis and antiangiogenic treatment have renewed interest in tumor perfusion. To image tumor blood-pool by PET, suitable tracers are not generally available. In this experimental study, we characterized a 68 Ga-labeled 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid (DOTA) conjugate of rat serum albumin ( 68 Ga-DOTA-RSA) in vivo using a generator-produced isotope. Biodistribution was determined in ACI rats after intravenous administration of 3-6 MBq of 68 Ga-DOTA-RSA. Three ACI rats were imaged over 1 h by dynamic PET after intravenous administration of 15-25 MBq of 68 Ga-DOTA-RSA while the blood-pool activity was recorded simultaneously in a closed extracorporeal loop (ECL) between the carotid artery and the jugular vein. Time-activity curves (TACs) were obtained from volume of interest (VOI) analysis and from the ECL data. Stability and metabolites in plasma and urine were analyzed by size exclusion HPLC (SE-HPLC) 1 h after intravenous injection of 67 Ga-DOTA-RSA. Blood radioactivity decreased by 10% and 18% from 10 to 60 min p.i. by biodistribution and PET or ECL, respectively. Tissue sampling between 10 and 60 min p.i. showed slight increases in the uptake of spleen, myocardium, kidney and skeletal muscle while hepatic accretion remained unchanged. Total urinary excretion after 60 min amounted to 9% of the injected dose. HPLC demonstrated a single urinary metabolite corresponding in size to gallium-labeled DOTA. 68 Ga-DOTA-RSA is a blood-pool tracer whose physical and biological half-life is well suited for PET. Our findings support clinical imaging using 68 Ga-DOTA-labeled human serum albumin (HSA). The generator-produced label makes 68 Ga-DOTA-labeled albumin continuously available even to centers lacking an in-house cyclotron

  3. Local flow distribution analysis inside the reactor pools of KALIMER-600 and PDRC performance test facility

    International Nuclear Information System (INIS)

    Jeong, Ji Hwan; Hwang, Seong Won; Choi, Kyeong Sik

    2010-05-01

    In the study, 3-dimensional thermal hydraulic analysis was carried out focusing on the thermal hydraulic behavior inside the reactor pools for both KALIMER-600 and one-fifth scale-down test facility. STAR-CD, one of the commercial CFD codes, was used to analyze 3-dimensional incompressible steady-state thermal hydraulic behavior in both designs of KALIMER-600 and the scale-down test facility. In the KALIMER-600 CFD analysis, the pressure drops in the core and IHX gave a good agreement within 1% error range. It was found that the porous media model was appropriate to analyze the pressure distribution inside reactor core and IHX. Also, a validation analysis showed the pressure drop through the porous media under the condition of 80% flow rate and thermal power was calculated 64% less than in 100% condition giving a physically reasonable analytic result. Since the temperatures in the hot-side pool and cold-side pool were estimated to be very close to 540 and 390 .deg. C specified on the design values respectively, the CFD models of heat source and sink was confirmed. Through the study, the methodology of 3-dimensional CFD analysis about KALIMER-600 has been established and proven. Performed with the methodology, the analysis data such as flow velocity, temperature and pressure distribution were compared by normalizing those data for the actual sized modeling and scale-down modeling. As a result, the characteristics of thermal hydraulic behavior were almost identical for the actual sized modeling and scale-down modeling and the similarity scaling law used in the design of the sodium test facility by KAERI was found to be correct

  4. Mapping Above- and Below-Ground Carbon Pools in Boreal Forests: The Case for Airborne Lidar.

    Science.gov (United States)

    Kristensen, Terje; Næsset, Erik; Ohlson, Mikael; Bolstad, Paul V; Kolka, Randall

    2015-01-01

    A large and growing body of evidence has demonstrated that airborne scanning light detection and ranging (lidar) systems can be an effective tool in measuring and monitoring above-ground forest tree biomass. However, the potential of lidar as an all-round tool for assisting in assessment of carbon (C) stocks in soil and non-tree vegetation components of the forest ecosystem has been given much less attention. Here we combine the use airborne small footprint scanning lidar with fine-scale spatial C data relating to vegetation and the soil surface to describe and contrast the size and spatial distribution of C pools within and among multilayered Norway spruce (Picea abies) stands. Predictor variables from lidar derived metrics delivered precise models of above- and below-ground tree C, which comprised the largest C pool in our study stands. We also found evidence that lidar canopy data correlated well with the variation in field layer C stock, consisting mainly of ericaceous dwarf shrubs and herbaceous plants. However, lidar metrics derived directly from understory echoes did not yield significant models. Furthermore, our results indicate that the variation in both the mosses and soil organic layer C stock plots appears less influenced by differences in stand structure properties than topographical gradients. By using topographical models from lidar ground returns we were able to establish a strong correlation between lidar data and the organic layer C stock at a stand level. Increasing the topographical resolution from plot averages (~2000 m2) towards individual grid cells (1 m2) did not yield consistent models. Our study demonstrates a connection between the size and distribution of different forest C pools and models derived from airborne lidar data, providing a foundation for future research concerning the use of lidar for assessing and monitoring boreal forest C.

  5. Pool swell sub-scale testing and code comparison

    International Nuclear Information System (INIS)

    Elisson, K.

    1981-01-01

    The main objective of the experiment was to investigate the pool swell dynamics in general and the forces on the lowered central part of the diaphragm between drywell and wetwell in particular. Apart from the high speed camera pressure transducers and strain gauges were used to monitor the transient. Data was recorded on a 14 channel FM recorder and then digitalised and plotted. In total more than one hundred tests were performed including parametric variations of for example geometry, break flow, initial drywell pressure and initial water level. In parallel to this experiment pool swell calculations have been performed with the computer codes COPTA and STEALTH. COPTA which is a lumped mass code for pressure suppression containment analysis has a slug pool swell mode. STEALTH which is a general purpose lagrangian hydrodynamics code has been used in a 2-D axisymmetric version. The STEALTH code has been used to calculate the radial variations in the vertical displacement and velocity of the pool surface and to predict the load on the lowered central part of the diaphragm. A comparison between the calculations and the experimental data indicates that both codes are sufficiently correct in their description of the pool swell transient. (orig.)

  6. Immobilization of radioactive waste sludge from spent fuel storage pool

    International Nuclear Information System (INIS)

    Pavlovic, R.; Plecas, I.

    1998-01-01

    In the last forty years, in FR Yugoslavia, as result of the research reactors' operation and radionuclides application in medicine, industry and agriculture, radioactive waste materials of the different categories and various levels of specific activities were generated. As a temporary solution, these radioactive waste materials are stored in the two hanger type interim storages for solid waste and some type of liquid waste packed in plastic barrels, and one of three stainless steal underground containers for other types of liquid waste. Spent fuel elements from nuclear reactors in the Vinca Institute have been temporary stored in water filled storage pool. Due to the fact that the water in the spent fuel elements storage pool have not been purified for a long time, all metallic components submerged in the water have been hardly corroded and significant amount of the sludge has been settled on the bottom of the pool. As a first step in improving spent fuel elements storage conditions and slowing down corrosion in the storage spent fuel elements pool we have decided to remove the sludge from the bottom of the pool. Although not high, but slightly radioactive, this sludge had to be treated as radioactive waste material. Some aspects of immobilisation, conditioning and storage of this sludge are presented in this paper. (author

  7. Research progresses and future directions on pool boiling heat transfer

    Directory of Open Access Journals (Sweden)

    M. Kumar

    2015-12-01

    Full Text Available This paper reviews the previous work carried on pool boiling heat transfer during heating of various liquids and commodities categorized as refrigerants and dielectric fluids, pure liquids, nanofluids, hydrocarbons and additive mixtures, as well as natural and synthetic colloidal solutions. Nucleate pool boiling is an efficient and effective method of boiling because high heat fluxes are possible with moderate temperature differences. It is characterized by the growth of bubbles on a heated surface. It occurs during boiling of liquids for excess temperature ranging from 5 to 30 °C in various processes related to high vaporization of liquid for specific purposes like sugarcane juice heating for jaggery making, milk heating for khoa making, steam generation, cooling of electronic equipments, refrigeration and etcetera. In this review paper, pool boiling method during heating of liquids for specific purpose is depicted. It is inferred that enhancement in pool boiling heat transfer is a challenging and complex task. Also, recent research and use of various correlations for natural convection pool boiling is reviewed.

  8. Water inventory management in condenser pool of boiling water reactor

    International Nuclear Information System (INIS)

    Gluntz, D.M.

    1996-01-01

    An improved system for managing the water inventory in the condenser pool of a boiling water reactor has means for raising the level of the upper surface of the condenser pool water without adding water to the isolation pool. A tank filled with water is installed in a chamber of the condenser pool. The water-filled tank contains one or more holes or openings at its lowermost periphery and is connected via piping and a passive-type valve (e.g., squib valve) to a high-pressure gas-charged pneumatic tank of appropriate volume. The valve is normally closed, but can be opened at an appropriate time following a loss-of-coolant accident. When the valve opens, high-pressure gas inside the pneumatic tank is released to flow passively through the piping to pressurize the interior of the water-filled tank. In so doing, the initial water contents of the tank are expelled through the openings, causing the water level in the condenser pool to rise. This increases the volume of water available to be boiled off by heat conducted from the passive containment cooling heat exchangers. 4 figs

  9. Determination of isotopomers in pools of molecules with polyisotopic elements

    International Nuclear Information System (INIS)

    Zyakun, A.M.; Brenninkmeijer, C.A.M.

    2002-01-01

    Polyisotopic element atoms that are present in a molecule form a pool of isotopomer molecules. Mono- and polyisotopomers are distinguished depending on the quantity of atoms of polyisotopic elements. Methodical approaches have been considered for the quantitative determination of the isotope composition of an element included in mono- and polyisotopic molecules. A possibility of the equally probable (homogeneous) and non-equally probable (non-homogeneous) distribution of isotopes of a polyisotopic element, the atoms of which have different positions in the molecule of polyisotopomer, has been shown. Factors disturbing the homogeneous distribution of isotopes of the element in the polyisotopomer pool have been revealed. When a polyisotopomer is involved in a mass-dependent process or reaction, the homogeneity of isotope distribution of the element is disturbed both in the residual and newly formed pools of polyisotopomer. By the example of CO 2 (polyisotopomer by oxygen) it has been shown that one can judge of the history of the analyzed pool formation by distribution of oxygen isotopes within this pool. The isotope content in the oxygen sites of polyisotopomer is a diagnostic feature of CO 2 involvement in the efflux from a reservoir or influx to the analyzed reservoir from an external source. (author)

  10. Gene Pools and the Genetic Architecture of Domesticated Cowpea

    Directory of Open Access Journals (Sweden)

    Bao-Lam Huynh

    2013-11-01

    Full Text Available Cowpea [ (L. Walp.] is a major tropical legume crop grown in warm to hot areas throughout the world and especially important to the people of sub-Saharan Africa where the crop was domesticated. To date, relatively little is understood about its domestication origins and patterns of genetic variation. In this study, a worldwide collection of cowpea landraces and African ancestral wild cowpea was genotyped with more than 1200 single nucleotide polymorphism markers. Bayesian inference revealed the presence of two major gene pools in cultivated cowpea in Africa. Landraces from gene pool 1 are mostly distributed in western Africa while the majority of gene pool 2 are located in eastern Africa. Each gene pool is most closely related to wild cowpea in the same geographic region, indicating divergent domestication processes leading to the formation of two gene pools. The total genetic variation within landraces from countries outside Africa was slightly greater than within African landraces. Accessions from Asia and Europe were more related to those from western Africa while accessions from the Americas appeared more closely related to those from eastern Africa. This delineation of cowpea germplasm into groups of genetic relatedness will be valuable for guiding introgression efforts in breeding programs and for improving the efficiency of germplasm management.

  11. Health impact of disinfection by-products in swimming pools

    Directory of Open Access Journals (Sweden)

    Cristina M. Villanueva

    2012-12-01

    Full Text Available This article is focused on the epidemiological evidence on the health impacts related to disinfection by-products (DBPs in swimming pools, which is a chemical hazard generated as an undesired consequence to reduce the microbial pathogens. Specific DBPs are carcinogenic, fetotoxic and/or irritant to the airways according to experimental studies. Epidemiological evidence shows that swimming in pools during pregnancy is not associated with an increased risk of reproductive outcomes. An epidemiological study suggested an increased risk of bladder cancer with swimming pool attendance, although evidence is inconclusive. A higher prevalence of respiratory symptoms including asthma is found among swimming pool workers and elite swimmers, although the causality of this association is unclear. The body of evidence in children indicates that asthma is not increased by swimming pool attendance. Overall, the available knowledge suggests that the health benefits of swimming outweigh the potential health risks of chemical contamination. However, the positive effects of swimming should be enhanced by minimising potential risks.

  12. Effects of long-term grassland management on the carbon and nitrogen pools of different soil aggregate fractions.

    Science.gov (United States)

    Egan, Gary; Crawley, Michael J; Fornara, Dario A

    2018-02-01

    Common grassland management practices include animal grazing and the repeated addition of lime and nutrient fertilizers to soils. These practices can greatly influence the size and distribution of different soil aggregate fractions, thus altering the cycling and storage of carbon (C) and nitrogen (N) in grassland soils. So far, very few studies have simultaneously addressed the potential long-term effect that multiple management practices might have on soil physical aggregation. Here we specifically ask whether and how grazing, liming and nutrient fertilization might influence C and N content (%) as well as C and N pools of different soil aggregate fractions in a long-term grassland experiment established in 1991 at Silwood Park, Berkshire, UK. We found that repeated liming applications over 23years significantly decreased the C pool (i.e. gCKg -1 soil) of Large Macro Aggregate (LMA>2mm) fractions and increased C pools within three smaller soil aggregate fractions: Small Macro Aggregate (SMA, 250μm-2mm), Micro Aggregate (MiA, 53-250μm), and Silt Clay Aggregate (SCAfractions was mainly caused by positive liming effects on aggregate fraction mass rather than on changes in soil C (and N) content (%). Liming effects could be explained by increases in soil pH, as this factor was significantly positively related to greater soil C and N pools of smaller aggregate fractions. Long-term grazing and inorganic nutrient fertilization had much weaker effects on both soil aggregate-fraction mass and on soil C and N concentrations, however, our evidence is that these practices could also contribute to greater C and N pools of smaller soil fractions. Overall our study demonstrates how agricultural liming can contribute to increase C pools of small (more stable) soil fractions with potential significant benefits for the long-term C balance of human-managed grassland soils. Copyright © 2017 Elsevier B.V. All rights reserved.

  13. Self-Assembled Nanomicelles as MRI Blood-Pool Contrast Agent.

    Science.gov (United States)

    Babič, Andrej; Vorobiev, Vassily; Xayaphoummine, Céline; Lapicorey, Gaëlle; Chauvin, Anne-Sophie; Helm, Lothar; Allémann, Eric

    2018-01-26

    Gadolinium-loaded nanomicelles show promise as future magnetic resonance imaging (MRI) contrast agents (CAs). Their increased size and high gadolinium (Gd) loading gives them an edge in proton relaxivity over smaller molecular Gd-complexes. Their size and stealth properties are fundamental for their long blood residence time, opening the possibility for use as blood-pool contrast agents. Using l-tyrosine as a three-functional scaffold we synthesized a nanostructure building block 8. The double C18 aliphatic chain on one side, Gd-1,4,7,10-tetraazacyclododecane-1-4-7-triacetic acid (Gd-DO3A) with access to bulk water in the center and 2 kDa PEG on the hydrophilic side gave the amphiphilic properties required for the core-shell nanomicellar architecture. The self-assembly into Gd-loaded monodispersed 10-20 nm nanomicelles occurred spontaneously in water. These nanomicelles (Tyr-MRI) display very high relaxivity at 29 mm -1  s -1 at low field strength and low cytotoxicity. Good contrast enhancement of the blood vessels and the heart together with prolonged circulation time in vivo, makes Tyr-MRI an excellent candidate for a new supramolecular blood-pool MRI CA. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  14. Pore diffusion limits removal of monochloramine in treatment of swimming pool water using granular activated carbon.

    Science.gov (United States)

    Skibinski, Bertram; Götze, Christoph; Worch, Eckhard; Uhl, Wolfgang

    2018-04-01

    Overall apparent reaction rates for the removal of monochloramine (MCA) in granular activated carbon (GAC) beds were determined using a fixed-bed reactor system and under conditions typical for swimming pool water treatment. Reaction rates dropped and quasi-stationary conditions were reached quickly. Diffusional mass transport in the pores was shown to be limiting the overall reaction rate. This was reflected consistently in the Thiele modulus, in the effect of temperature, pore size distribution and of grain size on the reaction rates. Pores <2.5 times the diameter of the monochloramine molecule were shown to be barely accessible for the monochloramine conversion reaction. GACs with a significant proportion of large mesopores were found to have the highest overall reactivity for monochloramine removal. Copyright © 2017 Elsevier Ltd. All rights reserved.

  15. Evaluation of Total Coliform, Fecal Coliform and Residual Chlorine in Swimming Pools in Kermanshah on the Season, the type of Pool, Disinfection System and Source of Water Supply in the during of three years (2010-2012

    Directory of Open Access Journals (Sweden)

    K SHarafi

    2014-11-01

    From the results , although the pools of water quality parameters has been studied in almost ideal But in summer, especially on a female pools and pools with wells water supply source than other pools , to be more oversight .

  16. Prediction of pool void fraction by new drift flux correlation

    International Nuclear Information System (INIS)

    Kataoka, I.; Ishii, M.

    1986-06-01

    A void fraction for a bubbling or boiling pool system is one of the important parameters in analyzing heat and mass transfer processes. Using the drift flux formulation, correlations for the pool void fraction have been developed in collaboration with a large number of experimental data. It has been found that the drift velocity in a pool system depends upon vessel diameter, system pressure, gas flux and fluid physical properties. The results show that the relative velocity and void fraction can be quite different from those predicted by conventional correlations. In terms of the rise velocity, four different regimes are identified. These are bubbly, churn-turbulent, slug and cap bubble regimes. The present correlations are shown to agree with the experimental data over wide ranges of parameters such as vessel diameter, system pressure, gas flux and physical properties. 39 refs., 41 figs

  17. Models for Pooled Time-Series Cross-Section Data

    Directory of Open Access Journals (Sweden)

    Lawrence E Raffalovich

    2015-07-01

    Full Text Available Several models are available for the analysis of pooled time-series cross-section (TSCS data, defined as “repeated observations on fixed units” (Beck and Katz 1995. In this paper, we run the following models: (1 a completely pooled model, (2 fixed effects models, and (3 multi-level/hierarchical linear models. To illustrate these models, we use a Generalized Least Squares (GLS estimator with cross-section weights and panel-corrected standard errors (with EViews 8 on the cross-national homicide trends data of forty countries from 1950 to 2005, which we source from published research (Messner et al. 2011. We describe and discuss the similarities and differences between the models, and what information each can contribute to help answer substantive research questions. We conclude with a discussion of how the models we present may help to mitigate validity threats inherent in pooled time-series cross-section data analysis.

  18. Human parvovirus PARV4 in plasma pools of Chinese origin.

    Science.gov (United States)

    Ma, Y-Y; Guo, Y; Zhao, X; Wang, Z; Lv, M-M; Yan, Q-P; Zhang, J-G

    2012-10-01

    Human parvovirus 4 (PARV4) is present in blood and blood products. As the presence and levels of PARV4 in Chinese source plasma pools have never been determined, we implemented real-time quantitative PCR to investigate the presence of PARV4 in source plasma pools in China. Results showed that 26·15% (51/195) of lots tested positive for PARV4. The amounts of DNA ranged from 2·83 × 10(3) copies/ml to 2·35×10(7) copies/ml plasma. The high level of PARV4 in plasma pools may pose a potential risk to recipients. Further studies on the pathogenesis of PARV4 are urgently required. © 2012 The Author(s). Vox Sanguinis © 2012 International Society of Blood Transfusion.

  19. Safety analysis of a pool Genesis II irradiator

    International Nuclear Information System (INIS)

    Rodrigues Junior, Ary de A.

    2011-01-01

    The Genesis II Irradiator manufactured by GRAT * STAR Inc. (USA) is a category III gamma irradiator in which the sealed source is contained in a water filled storage pool and is shielded permanently, i.e. the material has to move down to the source. Even though the pool is 5.6 m deep, what would happen if the water level lowered? There are a series of safety devices that will avoid this situation and calculations show that the water level has to be very low in order to deliver a significant dose; moreover, only in case a person remains at the border of the pool for a long time this would be risky. In conclusion, it is practically impossible for someone to be exposed to radiation from a Genesis II Irradiator source. (author)

  20. CFD modeling of pool swell during large break LOCA

    International Nuclear Information System (INIS)

    Yan, Jin; Bolger, Francis; Li, Guangjun; Mintz, Saul; Pappone, Daniel

    2009-01-01

    GE had conducted a series of one-third scale three-vent air tests in support the horizontal vent pressure suppression system used in Mark III containment design for General Electric BWR plants. During the test, the air-water interface has been tracked by conductivity probes. There are many pressure monitors inside the test rig. The purpose of the test was to provide a basis for the pool swell load definition for the Mark III containment. In this paper, a transient 3-Dimensional CFD model of the one-third scale Mark III suppression pool swell process is constructed. The Volume of Fluid (VOF) multiphase model is used to explicitly track the interface between the water liquid and the air. The CFD results such as flow velocity, pressure, interface locations are compared to those from the test. Through the comparisons, a technical approach to numerically model the pool swell phenomenon is established and benchmarked. (author)

  1. Analysis of radiation shields of BNPP spent fuel pool

    International Nuclear Information System (INIS)

    Ayoobian, N.; Hadad, K.; Nematollahi, M. R.

    2007-01-01

    Radioactive protection is one of the most important subjects in nuclear power plants safety. Analysis of BNPP spent fuel pool shielding , as a main source of energetic γ-rays was the main goal of this project. Firstly, we simulated the reactor core using WIMSD-4 neutronic code and the amount of fission product in the fuel assembly (FA) was calculated during the reactor operation. Then, by obtaining the results from the previous calculation and by using MCNP4C nuclear code , the intensity of γ-rays was obtained in layers of spent fuel pool shields. The results have shown that no significant γ-rays passed through these shields. Finally, an accident and resulting exposure dose above the pool was analyzed

  2. Insertion sequences enrichment in extreme Red sea brine pool vent

    KAUST Repository

    Elbehery, Ali H. A.

    2016-12-03

    Mobile genetic elements are major agents of genome diversification and evolution. Limited studies addressed their characteristics, including abundance, and role in extreme habitats. One of the rare natural habitats exposed to multiple-extreme conditions, including high temperature, salinity and concentration of heavy metals, are the Red Sea brine pools. We assessed the abundance and distribution of different mobile genetic elements in four Red Sea brine pools including the world’s largest known multiple-extreme deep-sea environment, the Red Sea Atlantis II Deep. We report a gradient in the abundance of mobile genetic elements, dramatically increasing in the harshest environment of the pool. Additionally, we identified a strong association between the abundance of insertion sequences and extreme conditions, being highest in the harshest and deepest layer of the Red Sea Atlantis II Deep. Our comparative analyses of mobile genetic elements in secluded, extreme and relatively non-extreme environments, suggest that insertion sequences predominantly contribute to polyextremophiles genome plasticity.

  3. Spent nuclear fuel storage pool thermal-hydraulic analysis

    International Nuclear Information System (INIS)

    Gay, R.R.

    1984-01-01

    Storage methods and requirements for spent nuclear fuel at U.S. commercial light water reactors are reviewed in Section 1. Methods of increasing current at-reactor storage capabilities are also outlined. In Section 2 the development of analytical methods for the thermal-hydraulic analysis of spent fuel pools is chronicled, leading up to a discussion of the GFLOW code which is described in Section 3. In Section 4 the verification of GFLOW by comparisons of the code's predictions to experimental data taken inside the fuel storage pool at the Maine Yankee nuclear power plant is presented. The predictions of GFLOW using 72, 224, and 1584 node models of the storage pool are compared to each other and to the experimental data. An example of thermal licensing analysis for Maine Yankee using the GFLOW code is given in Section 5. The GFLOW licensing analysis is compared to previous licensing analysis performed by Yankee Atomic using the RELAP-4 computer code

  4. High efficiency pool filtering systems utilising variable frequency drives

    Energy Technology Data Exchange (ETDEWEB)

    Hameiri, Z.; Sproul, A.B. [School of Photovoltaic and Renewable Energy Engineering, UNSW, Sydney, NSW 2052 (Australia); Spooner, T. [School of Electrical Engineering and Telecommunications, UNSW, Sydney, NSW 2052 (Australia)

    2009-02-15

    Over 1 year, private swimming pools in Australia will typically consume 1680 GWh of electricity, producing 2130 kt of CO{sub 2}. Redesigning a pool's filtration system and using it more efficiently can reduce the energy use, and hence the CO{sub 2} production, by a significant amount. This paper describes experimental measurements carried out on a new design of pool pump system. Initial experiments using a variable frequency drive (VFD) with a standard, single phase pump/motor system have achieved energy savings of 40%. Utilising a VFD and a three phase pump/motor energy savings of 61% have been achieved, without degrading the system performance. (author)

  5. Analyzing data distribution on disk pools for dCache

    Energy Technology Data Exchange (ETDEWEB)

    Halstenberg, S; Jung, C; Ressmann, D [Forschungszentrum Karlsruhe, Steinbuch Centre for Computing, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany)

    2010-04-01

    Most Tier-1 centers of LHC Computing Grid are using dCache as their storage system. dCache uses a cost model incorporating CPU and space costs for the distribution of data on its disk pools. Storage resources at Tier-1 centers are usually upgraded once or twice a year according to given milestones. One of the effects of this procedure is the accumulation of heterogeneous hardware resources. For a dCache system, a heterogeneous set of disk pools complicates the process of weighting CPU and space costs for an efficient distribution of data. In order to evaluate the data distribution on the disk pools, the distribution is simulated in Java. The results are discussed and suggestions for improving the weight scheme are given.

  6. Inferring local ecological processes amid species pool influences

    DEFF Research Database (Denmark)

    Lessard, Jean-Philippe; Belmaker, Jonathan; Myers, Jonathan A.

    2012-01-01

    studies, null models of community structure, and ecologically explicit definitions of the species pool as a means to compare predominant ecological processes among regions. By uniting concepts and tools from community ecology and macroecology, this approach might facilitate synthesis and resolve many......Resolving contingencies in community ecology requires comparative studies of local communities along broad-scale environmental gradients and in different biogeographic regions. However, comparisons of local ecological processes among regions require a synthetic understanding of how the species pool...... of potential community members influences the structure of ecological communities. Here, we outline an integrative approach for quantifying local ecological processes while explicitly accounting for species pool influences. Specifically, we highlight the utility of combining geographically replicated local...

  7. CAREM 25: Suppression pool cooling and purification system

    International Nuclear Information System (INIS)

    Carlevaris, Rodolfo; Patrignani, Alberto; Vindrola, Carlos; Palmerio, Hector D.; Quiroz, Horacio; Ramilo, Lucia B.

    2000-01-01

    The suppression pool cooling and purification system has the following main functions: purify and cool water from the suppression pool, cool and send water to the residual heat extraction system, and transfer water to the fuel element transference channel. In case of Loss of Coolant Accident (LOCA), the system sends water from the suppression pool to the spray network, thus cooling and reducing pressure in the primary containment. The system has been designed in accordance with the requirements of the following standards: ANSI/ANS 52.1; ANSI/ANS 57.2; ANSI/ANS 56.2; ANSI/ANS 59.1; ANSI/ANS 58.3; ANSI/ANS 58.9; and ANSI/ANS 56.5. The design of the system fulfils all the assigned functions. (author)

  8. CAREM-25. Suppression Pool Cooling and Purification System

    International Nuclear Information System (INIS)

    Carlevaris, Rodolfo; Palmerio, D.; Patrignani, A.; Quiroz, H.; Ramilo, L.; Vindrola, C.

    2000-01-01

    The Suppression Pool Cooling and Purification System has the following main functions: purify and cool water from the Suppression Pool, cool and send water to the Residual Heat Extraction System, and transfer water to the Fuel Element Transference Channel. In case of Loss of Coolant Accident (LOCA), the system sends water from the Suppression Pool to the spray network, thus cooling and reducing pressure in the primary containment.The system has been designed in accordance with the requirements of the following standards ANSI/ANS 52.1 [1], ANSI/ANS 57.2 [2], ANSI/ANS 56.2 [3], ANSI/ANS 59.1 [4] ANSI/ANS 58.3 [5], ANSI/ANS 58.9 [6], and ANSI/ANS 56.5 [7]. The design of the system fulfils all the assigned functions

  9. Analysis of the loss of pool cooling accident in a PWR spent fuel pool with MAAP5

    International Nuclear Information System (INIS)

    Wu, Xiaoli; Li, Wei; Zhang, Yapei; Tian, Wenxi; Su, Guanghui; Qiu, Suizheng

    2014-01-01

    Highlights: • A PWR spent fuel pool was modeled by using MAAP5. • Loss of pool cooling severe accident scenarios were studied. • Loss of pool cooling accidents with two mitigation measures were analyzed. - Abstract: The Fukushima Daiichi nuclear accident shows that it is necessary to study potential severe accidents and corresponding mitigation measures for the spent fuel pool (SFP) of a nuclear power plant (NPP). This paper presents the analysis of loss of pool cooling accident scenarios and the discussion of mitigation measures for the SFP at a pressurized water reactor (PWR) NPP with the MAAP5 code. Analysis of uncompensated loss of water due to the loss of pool cooling with different initial pool water levels of 12.2 m (designated as a reference case) and 10.7 m have been performed based on a MAAP5 input model. Scenarios of the accident such as overheating of uncovered fuel assemblies, oxidation of claddings and hydrogen generation, loss of intactness of fuel rod claddings, and release of radioactive fission products were predicted with the assumption that mitigation measures were unavailable. The results covered a broad spectrum of severe accident evaluations in the SFP. Furthermore, as important mitigation measures, the effects of recovering the SFP cooling system and makeup water in SFP on the accident progressions have also been investigated respectively based on the events of pool water boiling and spent fuels uncovery. Based upon the reference case, three cases with the recovery of SFP cooling system and three other cases with makeup water in SFP have been studied. The results showed that, severe accident might happen if SFP cooling system was not restored timely before the spent fuels started to become uncovered; spent fuels could be completely submerged and severe accident might be avoided if SFP makeup water system provided water with a mass flow rate larger than the average evaporation rate defined as the division of pool water mass above the

  10. Temperature dependent fission product removal efficiency due to pool scrubbing

    Energy Technology Data Exchange (ETDEWEB)

    Uchida, Shunsuke, E-mail: suchida@iae.or.jp [Institute of Applied Energy, 1-14-2, Nishi-Shimbashi, Minato-ku, Tokyo 105-0003 (Japan); Itoh, Ayumi; Naitoh, Masanori; Okada, Hidetoshi; Suzuki, Hiroyuki [Institute of Applied Energy, 1-14-2, Nishi-Shimbashi, Minato-ku, Tokyo 105-0003 (Japan); Hanamoto, Yukio [KAKEN, Inc., 1044, Hori-machi, Mito 310-0903 (Japan); Osakabe, Masahiro [Tokyo University of Marine Science & Technology, Koutou-ku, Tokyo 135-8533 (Japan); Fujikawa, Masahiro [Japan Broadcasting Corporation, 2-2-1, Jinnan, Shibuya-ku, Tokyo 150-8001 (Japan)

    2016-03-15

    Highlights: • Pool temperature effects on the FP removal were not clearly concluded in the previous publications. • It was confirmed that the removal efficiency decreased with temperature around the boiling point. • A modified empirical formula for FP removal was proposed as a function of sub-cooling temperature. • DF could be predicted with an accuracy within a factor of 2 with the proposed formula. - Abstract: The wet-well of boiling water reactors plays important roles not only to suppress the pressure in the primary containment vessel due to steam scrubbing effects during severe accidents but also to mitigate release of radioactive fission products (FP), aerosols and particulates, into the environment. The effects of steam scrubbing in the wet-well on FP removal have been well studied and reported by changing major parameters determining the removal efficiencies, e.g., aerosol diameters, submergence (depth of scrubbing nozzles) and steam/non-condensable gas volume fraction. Unfortunately, the effects of pool temperature on the FP removal were not clearly concluded in the previous publications, though it would be easily expected that boiling in the pool resulted in reduced aerosol removal efficiency. In order to determine the temperature effects on FP removal efficiency, amounts of cesium in aerosols released from scrubbing pool were measured by changing pool temperature in mini and medium scale scrubbing experiments, and then, it was confirmed that the removal efficiency clearly decreased with temperature around the boiling point. Then, a modified empirical formula to express the FP removal around the boiling point temperature was proposed as a function of sub-cooling temperature by applying the effective steam volume fraction, which was designated as the volume ratio of condensed steam in the pool versus the sum of input steam and non-condensable gas. By comparing the measured removal efficiency with the calculated, it was validated that the

  11. The pool chlorine hypothesis and asthma among boys.

    LENUS (Irish Health Repository)

    Cotter, A

    2012-01-31

    Swimming pool sanitation has largely been concerned with the microbiological quality of pool water, which is normally treated using a number of chlorine products. Recent studies have pointed to the potential hazards of chlorine by-products to the respiratory epithelium, particularly in indoor, poorly ventilated, pools. The aim of our study was to elucidate whether chronic exposure to indoor chlorinated swimming pools was associated with an increased likelihood of the development of asthma in boys. METHODS: The subjects were boys aged between 6 and 12 years. Data was collected by means of parental responses to a standardized asthma questionnaire (ISAAC: International Study of Asthma and Allergies in Childhood), supplemented with additional questions regarding frequency of attendance, number of years attendance, whether the child is a swimming team member. The questionnaire return rate was 71\\/% (n = 121). 23 boys were excluded on the basis that they had asthma before they started swimming (n = 97). There was a significant association between number of years a boy had been swimming and the likelihood of wheezing in the last 12 months (p = 0.009; OR = 1.351; 95% CI = 1.077-1.693) and diagnosed asthma (p = 0.046; OR = 1.299; 95% CI = 1.004-1.506). The greater the number the number of years a boy had been attending an indoor, chlorinated pool, the greater the likelihood of wheezing in the last 12 months or "had asthma". Age, parental smoking habits and being a swimming team member had no association with any of the asthma variables examined. Swimming pool attendance may be a risk factor in asthma in boys.

  12. Temperature dependent fission product removal efficiency due to pool scrubbing

    International Nuclear Information System (INIS)

    Uchida, Shunsuke; Itoh, Ayumi; Naitoh, Masanori; Okada, Hidetoshi; Suzuki, Hiroyuki; Hanamoto, Yukio; Osakabe, Masahiro; Fujikawa, Masahiro

    2016-01-01

    Highlights: • Pool temperature effects on the FP removal were not clearly concluded in the previous publications. • It was confirmed that the removal efficiency decreased with temperature around the boiling point. • A modified empirical formula for FP removal was proposed as a function of sub-cooling temperature. • DF could be predicted with an accuracy within a factor of 2 with the proposed formula. - Abstract: The wet-well of boiling water reactors plays important roles not only to suppress the pressure in the primary containment vessel due to steam scrubbing effects during severe accidents but also to mitigate release of radioactive fission products (FP), aerosols and particulates, into the environment. The effects of steam scrubbing in the wet-well on FP removal have been well studied and reported by changing major parameters determining the removal efficiencies, e.g., aerosol diameters, submergence (depth of scrubbing nozzles) and steam/non-condensable gas volume fraction. Unfortunately, the effects of pool temperature on the FP removal were not clearly concluded in the previous publications, though it would be easily expected that boiling in the pool resulted in reduced aerosol removal efficiency. In order to determine the temperature effects on FP removal efficiency, amounts of cesium in aerosols released from scrubbing pool were measured by changing pool temperature in mini and medium scale scrubbing experiments, and then, it was confirmed that the removal efficiency clearly decreased with temperature around the boiling point. Then, a modified empirical formula to express the FP removal around the boiling point temperature was proposed as a function of sub-cooling temperature by applying the effective steam volume fraction, which was designated as the volume ratio of condensed steam in the pool versus the sum of input steam and non-condensable gas. By comparing the measured removal efficiency with the calculated, it was validated that the

  13. Utilizing the ultrasensitive Schistosoma up-converting phosphor lateral flow circulating anodic antigen (UCP-LF CAA) assay for sample pooling-strategies.

    Science.gov (United States)

    Corstjens, Paul L A M; Hoekstra, Pytsje T; de Dood, Claudia J; van Dam, Govert J

    2017-11-01

    Methodological applications of the high sensitivity genus-specific Schistosoma CAA strip test, allowing detection of single worm active infections (ultimate sensitivity), are discussed for efficient utilization in sample pooling strategies. Besides relevant cost reduction, pooling of samples rather than individual testing can provide valuable data for large scale mapping, surveillance, and monitoring. The laboratory-based CAA strip test utilizes luminescent quantitative up-converting phosphor (UCP) reporter particles and a rapid user-friendly lateral flow (LF) assay format. The test includes a sample preparation step that permits virtually unlimited sample concentration with urine, reaching ultimate sensitivity (single worm detection) at 100% specificity. This facilitates testing large urine pools from many individuals with minimal loss of sensitivity and specificity. The test determines the average CAA level of the individuals in the pool thus indicating overall worm burden and prevalence. When requiring test results at the individual level, smaller pools need to be analysed with the pool-size based on expected prevalence or when unknown, on the average CAA level of a larger group; CAA negative pools do not require individual test results and thus reduce the number of tests. Straightforward pooling strategies indicate that at sub-population level the CAA strip test is an efficient assay for general mapping, identification of hotspots, determination of stratified infection levels, and accurate monitoring of mass drug administrations (MDA). At the individual level, the number of tests can be reduced i.e. in low endemic settings as the pool size can be increased as opposed to prevalence decrease. At the sub-population level, average CAA concentrations determined in urine pools can be an appropriate measure indicating worm burden. Pooling strategies allowing this type of large scale testing are feasible with the various CAA strip test formats and do not affect

  14. Sodium-water reaction in double pool LMFBR, (5)

    International Nuclear Information System (INIS)

    Yoshida, Kazuo; Kumagai, Hiromichi; Nishi, Yoshihisa; Uotani, Masaki

    1990-01-01

    Experiments were conducted using a 1/5 scale model of the Double Pool in order to evaluate a pressure rise caused by a large scale sodium-water reaction. The experiments were focused on the pressure rise caused by the piston motion of liquid sodium. It appeared from the results that the magnitude of this pressure rise depends on the depth of reaction point, and that a pressure rise more than 1 MPa would arise in the real Double Pool plant. A new design of steam generator is proposed to mitigate the pressure rise. (author)

  15. The CERN Electronics Pool moves to Building 13

    CERN Multimedia

    PH Department

    2010-01-01

    After 32 years in Building 4 R‐050, the CERN Electronics Pool will re‐open in Building 13 R009 on Monday 13 December at 10:00 As of this date, you will be able to come and choose the instruments you want: oscilloscopes and other measurement instruments, low and high voltage power supplies, modular instrumentation, etc. Please do not hesitate to consult the catalogue and give us any input you may have. The CERN Electronics Pool operates on a self-service basis (with a CERN budget code) and is available for any help you may need.

  16. Carbon dynamics in peatland pool systems: the role of light

    Science.gov (United States)

    Pickard, Amy; Heal, Kate; McLeod, Andy; Dinsmore, Kerry

    2016-04-01

    Open-water pools are widespread in peatlands and are considered to represent biogeochemical hotspots within the peatland landscape. However the contribution of pool systems to wider peatland C cycling has not been quantified fully and there is a lack of knowledge of the role of photochemical processes in such environments. In this study, light exposure experiments were conducted in two contrasting pools to test the reactivity of aquatic C. The first study site was located at Cross Lochs (CL), Forsinard, in the Flow Country of Northern Scotland, in a 412 m2 pool characterised by low dissolved organic carbon (DOC) concentrations (˜15 mg C L-1). The second site was located at Red Moss of Balerno (RM), a raised bog in central Scotland, in a 48 m2 pool with high DOC concentrations (˜35 mg C L-1). Experiments took place over 9 days in situ at each pool in mid-summer 2015, with 500 mL water samples contained in bags transparent to sunlight and in opaque control bags. After field exposure, optical, chemical and stable C isotope analyses were conducted on the samples. Significant differences in biogeochemical cycling of DOC were detected between the two systems, with DOC losses as a percentage of the total C pool 15% higher at RM than at CL after light exposure. The mean DOC concentration of light exposed samples at RM declined steeply initially, with 83% observed DOC degradation occurring by day 3 of the experiment. Total losses of 7.9 mg DOC L-1were observed in light exposed samples at RM, along with decreasing E4:E6 ratios, suggesting that material remaining at the end of the experiment was humified. Depletion of DOC was positively correlated with production of CO2 at both sites, with concentrations of up to 4.3 mg CO2-C L-1 recorded at RM. Stable C isotope signatures at both sites were altered under light treatment, as demonstrated by the production of enriched δ13C-DOC (+0.46 ‰ relative to opaque bags) and depleted δ13C-DIC (-0.97 ‰ relative to opaque bags) at

  17. Software for the Design of Swimming Pool Dehumidifiers Units

    Science.gov (United States)

    Rubina, Aleš; Blasinski, Petr; Tesař, Zdeněk

    2013-06-01

    The article deals with the description and solution of physical phenomena taking place during evaporation of water. The topicality of the theme is given a number of built indoor swimming pool and wellness centers at present. In addressing HVAC systems serving these areas, it is necessary to know the various design parameters in the interior including the water temperature as the pool temperature and humidity. Following is a description of the calculation module, air handling units, including optimizing the settings of the physical changes in order to ensure the lowest energy consumption for air treatment and required maintaining internal microclimate parameters.

  18. Cryptosporidium and Giardia in Swimming Pools, Atlanta, Georgia

    Centers for Disease Control (CDC) Podcasts

    2008-05-29

    In this podcast, Dan Rutz speaks with Dr. Joan Shields, a guest researcher with the Healthy Swimming Program at CDC, about an article in June 2008 issue of Emerging Infectious Diseases reporting on the results of a test of swimming pools in the greater Atlanta, Georgia area. Dr. Shields tested 160 pools in metro Atlanta last year for Cryptosporidium and Giardia. These germs cause most recreational water associated outbreaks.  Created: 5/29/2008 by Emerging Infectious Diseases.   Date Released: 5/29/2008.

  19. Measure Guideline: Replacing Single-Speed Pool Pumps with Variable Speed Pumps for Energy Savings

    Energy Technology Data Exchange (ETDEWEB)

    Hunt, A.; Easley, S.

    2012-05-01

    The report evaluates potential energy savings by replacing traditional single-speed pool pumps with variable speed pool pumps, and provide a basic cost comparison between continued uses of traditional pumps verses new pumps. A simple step-by-step process for inspecting the pool area and installing a new pool pump follows.

  20. Measure Guideline. Replacing Single-Speed Pool Pumps with Variable Speed Pumps for Energy Savings

    Energy Technology Data Exchange (ETDEWEB)

    Hunt, A. [Building Media and the Building America Retrofit Alliance (BARA), Wilmington, DE (United States); Easley, S. [Building Media and the Building America Retrofit Alliance (BARA), Wilmington, DE (United States)

    2012-05-01

    This measure guideline evaluates potential energy savings by replacing traditional single-speed pool pumps with variable speed pool pumps, and provides a basic cost comparison between continued uses of traditional pumps verses new pumps. A simple step-by-step process for inspecting the pool area and installing a new pool pump follows.