WorldWideScience

Sample records for vfa pool size

  1. Gravity and Heater Size Effects on Pool Boiling Heat Transfer

    Science.gov (United States)

    Kim, Jungho; Raj, Rishi

    2014-01-01

    The current work is based on observations of boiling heat transfer over a continuous range of gravity levels between 0g to 1.8g and varying heater sizes with a fluorinert as the test liquid (FC-72/n-perfluorohexane). Variable gravity pool boiling heat transfer measurements over a wide range of gravity levels were made during parabolic flight campaigns as well as onboard the International Space Station. For large heaters and-or higher gravity conditions, buoyancy dominated boiling and heat transfer results were heater size independent. The power law coefficient for gravity in the heat transfer equation was found to be a function of wall temperature under these conditions. Under low gravity conditions and-or for smaller heaters, surface tension forces dominated and heat transfer results were heater size dependent. A pool boiling regime map differentiating buoyancy and surface tension dominated regimes was developed along with a unified framework that allowed for scaling of pool boiling over a wide range of gravity levels and heater sizes. The scaling laws developed in this study are expected to allow performance quantification of phase change based technologies under variable gravity environments eventually leading to their implementation in space based applications.

  2. Pool sizes of precursors for phosphatidylcholine formation in adult rat lung type II cells

    NARCIS (Netherlands)

    Posta, M.; Batenburg, J.J.; Smith, B.T.; Golde, L.M.G. van

    1984-01-01

    1. 1. The pool sizes of the choline intermediates and cofactors involved in the CDPcholine pathway were studied in alveolar type II cells from adult rat lung. 2. 2. The choline phosphate pool was much larger than both the choline and CDPcholine pools. 3. 3. Kinetic analysis of the pool sizes

  3. Dicty_cDB: VFA444 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) VFA444 (Link to dictyBase) - - - Contig-U15823-1 VFA444E (Link to Original site) VFA444F 579 VFA444Z...VFA444Z 737 VFA444P 1316 VFA444E 1046 Show VFA444 Library VF (Link to library) Clone ID VFA444 (Link to...tsukuba.ac.jp/CSM/VF/VFA4-B/VFA444Q.Seq.d/ Representative seq. ID VFA444E (Link to Original site) Representative...Representative DNA sequence >VFA444 (VFA444Q) /CSM/VF/VFA4-B/VFA444Q.Seq.d/ ATAAATGGAGGCCGATCCGAGCTTAGT...significant alignments: (bits) Value VFA444 (VFA444Q) /CSM/VF/VFA4-B/VFA444Q.Seq.d/ 1608 0.0 VFM332 (VFM332Q)

  4. Project size and common pool size: An empirical test using Danish municipal mergers

    DEFF Research Database (Denmark)

    Hansen, Sune Welling

    . In this paper, the proposition is examined using recent municipal mergers in Denmark as a crucial case under less favorable conditions. The paper finds positive, statistically and economically significant effects of common pool size in the ultimate year of the treatment period. These results are consistent...

  5. Evaluation of Decontamination Factor of Aerosol in Pool Scrubber according to Bubble Shape and Size

    Energy Technology Data Exchange (ETDEWEB)

    Jo, Hyun Joung; Ha, Kwang Soon; Jang, Dong Soon [KAERI, Daejeon (Korea, Republic of)

    2016-05-15

    The scrubbing pool could play an important role in the wet type FCVS because a large amount of aerosol is captured in the water pool. The pool scrubbing phenomena have been modelled and embedded in several computer codes, such as SPARC (Suppression Pool Aerosol Removal Code), BUSCA (BUbble Scrubbing Algorithm) and SUPRA (Suppression Pool Retention Analysis). These codes aim at simulating the pool scrubbing process and estimating the decontamination factors (DFs) of the radioactive aerosol and iodine gas in the water pool, which is defined as the ratio of initial mass of the specific radioactive material to final massy after passing through the water pool. The pool scrubbing models were reviewed and an aerosol scrubbing code has been prepared to calculate decontamination factor through the pool. The developed code has been verified using the experimental results and parametric studies the decontamination factor according to bubble shape and size. To evaluate the decontamination factor more accurate whole pool scrubber phenomena, the code was improved to consider the variety shape and size of bubbles. The decontamination factor were largely evaluated in ellipsoid bubble rather than in sphere bubble. The pool scrubbing models will be enhanced to apply more various model such as aerosol condensation of hygroscopic. And, it is need to experiment to measure to bubble shape and size distribution in pool to improve bubble model.

  6. Controls on the size and occurrence of pools in coarse-grained forest rivers

    Science.gov (United States)

    John M. Buffington; Thomas E. Lisle; Richard D. Woodsmith; Sue Hilton

    2002-01-01

    Controls on pool formation are examined in gravel- and cobble-bed rivers in forest mountain drainage basins of northern California, southern Oregon, and southeastern Alaska. We demonstrate that the majority of pools at our study sites are formed by flow obstructions and that pool geometry and frequency largely depend on obstruction characteristics (size, type, and...

  7. A new VFA sensor technique for anaerobic reactor systems

    DEFF Research Database (Denmark)

    Pind, Peter Frode; Angelidaki, Irini; Ahring, Birgitte Kiær

    2003-01-01

    to monitor VFA online in one of the most difficult media: animal slurry or manure. A novel in situ filtration technique has made it possible to perform microfiltration inside a reactor system. This filter enables sampling from closed reactor systems without large-scale pumping and filters. Furthermore, due...... to its small size it can be placed in lab-scale reactors without disturbing the process. Using this filtration technique together with commercially available membrane filters we have constructed a VFA sensor system that can perform automatic analysis of animal slurry at a frequency as high as every 15...... filtration technique are being presented is this article....

  8. Surfactant phosphatidylcholine half-life and pool size measurements in premature baboons developing bronchopulmonary dysplasia

    NARCIS (Netherlands)

    D.J. Janssen; V.P. Carnielli (Virgilio); P.E. Cogo (Paola); S.R. Seidner; I.H.I. Luijendijk; J.L.D. Wattimena (Josias); A.H. Jobe (Alan); L.J.I. Zimmermann (Luc)

    2002-01-01

    textabstractBecause minimal information is available about surfactant metabolism in bronchopulmonary dysplasia, we measured half-lives and pool sizes of surfactant phosphatidylcholine in very preterm baboons recovering from respiratory distress syndrome and developing

  9. Dicty_cDB: VFA114 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFA114 (Link to dictyBase) - - - Contig-U13991-1 VFA114P (Link to Original site) VFA114F...(Link to library) Clone ID VFA114 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig...Contig-U13991-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFA1-A/VFA114Q.Seq.d/ Representative...Representative seq. ID VFA114P (Link to Original site) Representative DNA sequence >VFA114 (VFA114Q) /CSM/VF/VFA1-A/VFA114Q....Seq.d/ TAGAATCCACACATTATAATTTTATAATGGGAAAAAGAAAAACTATGCAATCATTTAACC TTGAATCCTTTGGAAAAAATTTAGAAAAAAA

  10. Dicty_cDB: VFA458 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFA458 (Link to dictyBase) - - - Contig-U16349-1 VFA458P (Link... to Original site) VFA458F 602 VFA458Z 403 VFA458P 1005 - - Show VFA458 Library VF (Link to library) Clone ID VFA458 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dict...SCNQESSTSGICDPFSILGDSCLHDMPGMSGCNNF KKLCASGSVVEQCSTVDSVTDLPTTMKMWANIKSICNEMTMTGCEKCTILNATCDVLTVY STLCLAMPEMGQCANWTQMC--- ---ICT...lpifqlq*kcgqilkvfvmk*q*qvvknaqy*mplvmy*qfi plfvlqcqrwvnvptgpkcv--- ---ICTEMAMDGCEKCSGNSPTTTCDVLPVYSSLCMAMPDM

  11. 10 CFR 905.32 - Resource extensions and resource pool size.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Resource extensions and resource pool size. 905.32 Section 905.32 Energy DEPARTMENT OF ENERGY ENERGY PLANNING AND MANAGEMENT PROGRAM Power Marketing Initiative... of penalties pursuant to § 905.17, Western may make such resources available within the marketing...

  12. A Preferentially Segregated Recycling Vesicle Pool of Limited Size Supports Neurotransmission in Native Central Synapses

    Science.gov (United States)

    Marra, Vincenzo; Burden, Jemima J.; Thorpe, Julian R.; Smith, Ikuko T.; Smith, Spencer L.; Häusser, Michael; Branco, Tiago; Staras, Kevin

    2012-01-01

    Summary At small central synapses, efficient turnover of vesicles is crucial for stimulus-driven transmission, but how the structure of this recycling pool relates to its functional role remains unclear. Here we characterize the organizational principles of functional vesicles at native hippocampal synapses with nanoscale resolution using fluorescent dye labeling and electron microscopy. We show that the recycling pool broadly scales with the magnitude of the total vesicle pool, but its average size is small (∼45 vesicles), highly variable, and regulated by CDK5/calcineurin activity. Spatial analysis demonstrates that recycling vesicles are preferentially arranged near the active zone and this segregation is abolished by actin stabilization, slowing the rate of activity-driven exocytosis. Our approach reveals a similarly biased recycling pool distribution at synapses in visual cortex activated by sensory stimulation in vivo. We suggest that in small native central synapses, efficient release of a limited pool of vesicles relies on their favored spatial positioning within the terminal. PMID:23141069

  13. Analysis of small sample size studies using nonparametric bootstrap test with pooled resampling method.

    Science.gov (United States)

    Dwivedi, Alok Kumar; Mallawaarachchi, Indika; Alvarado, Luis A

    2017-06-30

    Experimental studies in biomedical research frequently pose analytical problems related to small sample size. In such studies, there are conflicting findings regarding the choice of parametric and nonparametric analysis, especially with non-normal data. In such instances, some methodologists questioned the validity of parametric tests and suggested nonparametric tests. In contrast, other methodologists found nonparametric tests to be too conservative and less powerful and thus preferred using parametric tests. Some researchers have recommended using a bootstrap test; however, this method also has small sample size limitation. We used a pooled method in nonparametric bootstrap test that may overcome the problem related with small samples in hypothesis testing. The present study compared nonparametric bootstrap test with pooled resampling method corresponding to parametric, nonparametric, and permutation tests through extensive simulations under various conditions and using real data examples. The nonparametric pooled bootstrap t-test provided equal or greater power for comparing two means as compared with unpaired t-test, Welch t-test, Wilcoxon rank sum test, and permutation test while maintaining type I error probability for any conditions except for Cauchy and extreme variable lognormal distributions. In such cases, we suggest using an exact Wilcoxon rank sum test. Nonparametric bootstrap paired t-test also provided better performance than other alternatives. Nonparametric bootstrap test provided benefit over exact Kruskal-Wallis test. We suggest using nonparametric bootstrap test with pooled resampling method for comparing paired or unpaired means and for validating the one way analysis of variance test results for non-normal data in small sample size studies. Copyright © 2017 John Wiley & Sons, Ltd. Copyright © 2017 John Wiley & Sons, Ltd.

  14. Dicty_cDB: VFA347 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cant alignments: (bits) Value VFA347 (VFA347Q) /CSM/VF/VFA3-B/VFA347Q.Seq.d/ 373 e-103 SFE418 (SFE418Q...) /CSM/SF/SFE4-A/SFE418Q.Seq.d/ 367 e-101 VFG876 (VFG876Q) /CSM/VF/VFG8-D/VFG876Q.Seq.d

  15. Optimal Sizing and Sitting of Smart Microgrid Units under Pool Electricity Market

    DEFF Research Database (Denmark)

    Hakimi, Seyed Mehdi; Hajizadeh, Amin

    2017-01-01

    different optimization tools are considered. First, a game-theoretical (GT) model has been used for bidding strategy of smart microgrid as a price-maker, in a long-term electricity market. Secondly, a particle swarm optimization (PSO) algorithm is employed to obtain the best cost value of smart microgrids......This paper presents an approach for optimal sizing and sitting of distribution generation units in smart microgrid under pool electricity market to reduce total cost and power loss of whole smart microgrid. The costs comprise capital cost, replacement cost, operation and maintenance cost, fuel cost......, reliability cost, power loss cost and selling and buying electricity cost. The new idea of this paper is the investigation of pool electricity market aspects in optimization of smart microgrid. On the other hand, cost minimization of smart microgrid is related to their bidding strategies. Therefore two...

  16. Radiation inactivation target size of rat adipocyte glucose transporters in the plasma membrane and intracellular pools

    Energy Technology Data Exchange (ETDEWEB)

    Jacobs, D.B.; Berenski, C.J.; Spangler, R.A.; Jung, C.Y.

    1987-06-15

    The in situ assembly states of the glucose transport carrier protein in the plasma membrane and in the intracellular (microsomal) storage pool of rat adipocytes were assessed by studying radiation-induced inactivation of the D-glucose-sensitive cytochalasin B binding activities. High energy radiation inactivated the glucose-sensitive cytochalasin B binding of each of these membrane preparations by reducing the total number of the binding sites without affecting the dissociation constant. The reduction in total number of binding sites was analyzed as a function of radiation dose based on target theory, from which a radiation-sensitive mass (target size) was calculated. When the plasma membranes of insulin-treated adipocytes were used, a target size of approximately 58,000 daltons was obtained. For adipocyte microsomal membranes, we obtained target sizes of approximately 112,000 and 109,000 daltons prior to and after insulin treatment, respectively. In the case of microsomal membranes, however, inactivation data showed anomalously low radiation sensitivities at low radiation doses, which may be interpreted as indicating the presence of a radiation-sensitive inhibitor. These results suggest that the adipocyte glucose transporter occurs as a monomer in the plasma membrane while existing in the intracellular reserve pool either as a homodimer or as a stoichiometric complex with a protein of an approximately equal size.

  17. Radiation inactivation target size of rat adipocyte glucose transporters in the plasma membrane and intracellular pools.

    Science.gov (United States)

    Jacobs, D B; Berenski, C J; Spangler, R A; Jung, C Y

    1987-06-15

    The in situ assembly states of the glucose transport carrier protein in the plasma membrane and in the intracellular (microsomal) storage pool of rat adipocytes were assessed by studying radiation-induced inactivation of the D-glucose-sensitive cytochalasin B binding activities. High energy radiation inactivated the glucose-sensitive cytochalasin B binding of each of these membrane preparations by reducing the total number of the binding sites without affecting the dissociation constant. The reduction in total number of binding sites was analyzed as a function of radiation dose based on target theory, from which a radiation-sensitive mass (target size) was calculated. When the plasma membranes of insulin-treated adipocytes were used, a target size of approximately 58,000 daltons was obtained. For adipocyte microsomal membranes, we obtained target sizes of approximately 112,000 and 109,000 daltons prior to and after insulin treatment, respectively. In the case of microsomal membranes, however, inactivation data showed anomalously low radiation sensitivities at low radiation doses, which may be interpreted as indicating the presence of a radiation-sensitive inhibitor. These results suggest that the adipocyte glucose transporter occurs as a monomer in the plasma membrane while existing in the intracellular reserve pool either as a homodimer or as a stoichiometric complex with a protein of an approximately equal size.

  18. Melt-Pool Temperature and Size Measurement During Direct Laser Sintering

    Energy Technology Data Exchange (ETDEWEB)

    List, III, Frederick Alyious [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Dinwiddie, Ralph Barton [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Carver, Keith [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Gockel, Joy E. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-08-01

    Additive manufacturing has demonstrated the ability to fabricate complex geometries and components not possible with conventional casting and machining. In many cases, industry has demonstrated the ability to fabricate complex geometries with improved efficiency and performance. However, qualification and certification of processes is challenging, leaving companies to focus on certification of material though design allowable based approaches. This significantly reduces the business case for additive manufacturing. Therefore, real time monitoring of the melt pool can be used to detect the development of flaws, such as porosity or un-sintered powder and aid in the certification process. Characteristics of the melt pool in the Direct Laser Sintering (DLS) process is also of great interest to modelers who are developing simulation models needed to improve and perfect the DLS process. Such models could provide a means to rapidly develop the optimum processing parameters for new alloy powders and optimize processing parameters for specific part geometries. Stratonics’ ThermaViz system will be integrated with the Renishaw DLS system in order to demonstrate its ability to measure melt pool size, shape and temperature. These results will be compared with data from an existing IR camera to determine the best approach for the determination of these critical parameters.

  19. Phosphoinositide pool sizes and flux in rabbit aortic rings during normoxia and hypoxia

    Energy Technology Data Exchange (ETDEWEB)

    1986-03-01

    The authors wanted to determine if various ATP-dependent reactions in the phosphatidylinositol cycle are inhibited during hypoxia-induced relaxations (PO/sub 2/ 10-20 mmHg, 10 min). Rings, so treated, show decreases in Pcr/Cr/sub T/ but no change in tissue ATP. Flux measurements were made after a 30 min incubation of resting rings with /sup 3/H-myoinositol. Rings were frozen under resting conditions and 5 min after the muscle was contracted by 5.5 ..mu..M norepinephrine. Effects on pool sizes (nmoles/100 nmole total PL) (N=5) are presented. Data indicate (a) PI resynthesis in the e.r. is inhibited during hypoxia, but plasma membrane kinase reactions may be unaffected; (b) the PI cycle may be altered during hypoxia-induced relaxations of vascular smooth muscle.

  20. Total-body creatine pool size and skeletal muscle mass determination by creatine-(methyl-d3) dilution in rats

    National Research Council Canada - National Science Library

    Stephen A. Stimpson; Scott M. Turner; Lisa G. Clifton; James C. Poole; Hussein A. Mohammed; Todd W. Shearer; Greg M. Waitt; Laura L. Hagerty; Katja S. Remlinger; Marc K. Hellerstein; William J. Evans

    2012-01-01

    .... We tested in rats the hypothesis that the enrichment of creatinine-(methyl-d3) (D3-creatinine) in urine after a defined oral tracer dose of D3-creatine can be used to determine creatine pool size and skeletal muscle mass...

  1. The influence of pool size on species diversity and water chemistry ...

    African Journals Online (AJOL)

    -residence green algae were replaced by blue-green algae. The number of ... A unique rock pool community with a filter-feeding component dominated by Cladocera, and from which large branchiopods were absent, is described. Nutrient ...

  2. Pool size measurements facilitate the determination of fluxes at branching points in nonstationary metabolic flux analysis: The case of Arabidopsis thaliana

    Directory of Open Access Journals (Sweden)

    Robert eHeise

    2015-06-01

    Full Text Available Pool size measurements are important for the estimation of absolute intracellular fluxes in particular scenarios based on data from heavy carbon isotope experiments. Recently, steady-state fluxes estimates were obtained for central carbon metabolism in an intact illuminated rosette of Arabidopsis thaliana grown photoautotrophically (Szecowka et al., 2013; Heise et al., 2014. Fluxes were estimated therein by integrating mass-spectrometric data of the dynamics of the unlabeled metabolic fraction, data on metabolic pool sizes, partitioning of metabolic pools between cellular compartments and estimates of photosynthetically inactive pools, with a simplified model of plant central carbon metabolism. However, the fluxes were determined by treating the pool sizes as fixed parameters. Here we investigated whether and, if so, to what extent the treatment of pool sizes as parameters to be optimized in three scenarios may affect the flux estimates. The results are discussed in terms of benchmark values for canonical pathways and reactions, including starch and sucrose synthesis as well as the ribulose-1,5-bisphosphate carboxylation and oxygenation reactions. In addition, we discuss pathways emerging from a divergent branch point for which pool sizes are required for flux estimation, irrespective of the computational approach used for the simulation of the observable labelling pattern. Therefore, our findings indicate the necessity for development of techniques for accurate pool size measurements to improve the quality of flux estimates from nonstationary flux estimates in intact plant cells in the absence of alternative flux measurements.

  3. Vertical flow immunoassay (VFA) biosensor for a rapid one-step immunoassay.

    Science.gov (United States)

    Oh, Young Kyoung; Joung, Hyou-Arm; Kim, Sanghyo; Kim, Min-Gon

    2013-03-07

    A highly rapid, one-step immunoassay of high sensitivity C-reactive protein (hsCRP) using a biosensor with a vertical flow immunoassay (VFA) was developed. The VFA biosensor was primarily composed of a sample pad, conjugate pad, FTH film and nitrocellulose (NC) membrane, which were all vertically stacked upon one another. Anti-hsCRP and secondary antibodies were consecutively immobilized on the NC membrane at the position below the holes. Gold nanoparticles (AuNPs) conjugated with another anti-hsCRP antibody were encapsulated in the conjugation pad. Various assay conditions, including the size of the hole and the sample volume, were optimized. Under optimized conditions, hsCRP concentrations from 0.01 to 10 μg mL(-1) were detected within 2 min. In comparison with a lateral flow assay (LFA) system, the VFA sensor showed a gradual increase of signal in a concentration-dependent manner without a hook effect in the tested range.

  4. Inhibitors of inflammation and endogenous surfactant pool size as modulators of lung injury with initiation of ventilation in preterm sheep

    Directory of Open Access Journals (Sweden)

    Polglase Graeme R

    2010-10-01

    Full Text Available Abstract Background Increased pro-inflammatory cytokines in tracheal aspirates correlate with the development of BPD in preterm infants. Ventilation of preterm lambs increases pro-inflammatory cytokines and causes lung inflammation. Objective We tested the hypothesis that selective inhibitors of pro-inflammatory signaling would decrease lung inflammation induced by ventilation in preterm newborn lambs. We also examined if the variability in injury response was explained by variations in the endogenous surfactant pool size. Methods Date-mated preterm lambs (n = 28 were operatively delivered and mechanically ventilated to cause lung injury (tidal volume escalation to 15 mL/kg by 15 min at age. The lambs then were ventilated with 8 mL/kg tidal volume for 1 h 45 min. Groups of animals randomly received specific inhibitors for IL-8, IL-1, or NF-κB. Unventilated lambs (n = 7 were the controls. Bronchoalveolar lavage fluid (BALF and lung samples were used to quantify inflammation. Saturated phosphatidylcholine (Sat PC was measured in BALF fluid and the data were stratified based on a level of 5 μmol/kg (~8 mg/kg surfactant. Results The inhibitors did not decrease the cytokine levels or inflammatory response. The inflammation increased as Sat PC pool size in BALF decreased. Ventilated lambs with a Sat PC level > 5 μmol/kg had significantly decreased markers of injury and lung inflammation compared with those lambs with Conclusion Lung injury caused by high tidal volumes at birth were decreased when endogenous surfactant pool sizes were larger. Attempts to decrease inflammation by blocking IL-8, IL-1 or NF-κB were unsuccessful.

  5. Why and when channelling can decrease pool size at constant net flux in a simple dynamic channel.

    Science.gov (United States)

    Mendes, P; Kell, D B; Westerhoff, H V

    1996-03-15

    Cornish-Bowden and Cárdenas (Cornish-Bowden, A. and Cárdenas M.L. (1993) Eur. J. Biochem. 213, 87-92) have suggested that simulation results peviously published by us (Mendes, P., Kell, D.B. and Westerhoff, H.V. (1992) Eur. J. Biochem. 204, 255-266) which had demonstrated that large reductions of intermediate pool sizes could be accompanied by increasing channel flux in a model metabolic pathway, were an artefact of changes in the pathway's overall flux of the order of 0.0075%, or of inappropriate alterations of enzyme activities. They also asserted to prove that the "channelling of an intermediate cannot affect its free concentration at constant net flux". We consider the co-response of the intermediate metabolite concentration ('pool') and the channel flux to changes in kinetic (or thermodynamic) parameters. Both by analytical proofs and by numerical examples we show that this co-response can be positive, negative or null, depending on the parameter change. In particular, we prove that there is always a number of ways of changing parameters such that the intermediate metabolite concentration decreases with increasing channel flux, whether the total flux varies or is constant. We also show that increased stability of the (dynamic) enzyme-intermediate-enzyme complex, as well as a single parameter change that similarly displays no cross-over effects, can lead to decreased intermediate metabolite concentration and increased channel flux at constant total flux. In general, a non-zero co-response of the intermediate metabolite concentration ('pool') and the channel flux to changes in kinetic (or other) parameters is the rule rather than the exception. More specifically: (i) The algebraic analysis ('general proof') given in Cornish-Bowden and Cárdenas (1993) contains the constraint that the elasticities of various steps to the modulation parameters which were used to vary the channel flux at constant net flux were unity. This is an unfortunate and unnecessary

  6. Diets high in resistent starch and arabinoxylan modulate digestion processes and SCFA pool size in the large intestine and faecal microbial composition in pigs

    DEFF Research Database (Denmark)

    Nielsen, Tina Skau; Lærke, Helle Nygaard; Theil, Peter Kappel

    2014-01-01

    The effects of a high level of dietary fibre (DF) either as arabinoxylan (AX) or resistant starch (RS) on digestion processes, SCFA concentration and pool size in various intestinal segments and on the microbial composition in the faeces were studied in a model experiment with pigs. A total...... resulted in a 3- to 5-fold higher pool size of butyrate compared with WSD feeding, with the RSD being intermediate (P microbial composition towards butyrogenic...

  7. [(18)F](2S,4R)4-Fluoroglutamine PET Detects Glutamine Pool Size Changes in Triple-Negative Breast Cancer in Response to Glutaminase Inhibition.

    Science.gov (United States)

    Zhou, Rong; Pantel, Austin R; Li, Shihong; Lieberman, Brian P; Ploessl, Karl; Choi, Hoon; Blankemeyer, Eric; Lee, Hsiaoju; Kung, Hank F; Mach, Robert H; Mankoff, David A

    2017-03-15

    Glutaminolysis is a metabolic pathway adapted by many aggressive cancers, including triple-negative breast cancers (TNBC), to utilize glutamine for survival and growth. In this study, we examined the utility of [(18)F](2S,4R)4-fluoroglutamine ([(18)F]4F-Gln) PET to measure tumor cellular glutamine pool size, whose change might reveal the pharmacodynamic (PD) effect of drugs targeting this cancer-specific metabolic pathway. High glutaminase (GLS) activity in TNBC tumors resulted in low cellular glutamine pool size assayed via high-resolution (1)H magnetic resonance spectroscopy (MRS). GLS inhibition significantly increased glutamine pool size in TNBC tumors. MCF-7 tumors, with inherently low GLS activity compared with TNBC, displayed a larger baseline glutamine pool size that did not change as much in response to GLS inhibition. The tumor-to-blood-activity ratios (T/B) obtained from [(18)F]4F-Gln PET images matched the distinct glutamine pool sizes of both tumor models at baseline. After a short course of GLS inhibitor treatment, the T/B values increased significantly in TNBC, but did not change in MCF-7 tumors. Across both tumor types and after GLS inhibitor or vehicle treatment, we observed a strong positive correlation between T/B values and tumor glutamine pool size measured using MRS (r(2) = 0.71). In conclusion, [(18)F]4F-Gln PET tracked cellular glutamine pool size in breast cancers with differential GLS activity and detected increases in cellular glutamine pool size induced by GLS inhibitors. This study accomplished the first necessary step toward validating [(18)F]4F-Gln PET as a PD marker for GLS-targeting drugs. Cancer Res; 77(6); 1476-84. ©2017 AACR. ©2017 American Association for Cancer Research.

  8. RuP2 pool size indicated by CO2 assimilation following the abrupt loss of light.

    Science.gov (United States)

    Cary, J W; Kleinkopf, G E

    1986-01-01

    Measurement of the changes in CO2 uptake by single leaves following the abrupt onset of darkness were made on sugarbeets (Beta vulgaris L.) and (Phaseolus vulgaris L.) The shape of the CO2 dark response curve was analyzed with respect to the reaction kinetics of CO2, RuP2 and RuP2 carboxylase. It was concluded that the net uptake of CO2 in the dark from a 1% O2 atmosphere can be approximately related to the pool size of the RuP2 substrate in the chloroplasts of C3 plants. This information was combined with CO2 levels and decay rates of the response curves to infer changes in carboxylase activity. Preliminary data are presented showing the relative concentration changes in RuP2 as light intensity decreases and as water stress increases. The method may prove useful in studies of plant response to environmental stresses.

  9. Changes in the Size of the Active Microbial Pool Explain Short-Term Soil Respiratory Responses to Temperature and Moisture.

    Science.gov (United States)

    Salazar-Villegas, Alejandro; Blagodatskaya, Evgenia; Dukes, Jeffrey S

    2016-01-01

    abiotic conditions activated soil microorganisms. We conclude that soil respiratory responses to short-term changes in environmental conditions are better explained by changes in AMB than in TMB. These results suggest that decomposition models that explicitly represent microbial carbon pools should take into account the active microbial pool, and researchers should be cautious in comparing modeled microbial pool sizes with measurements of TMB.

  10. Changes in the size of the active microbial pool explain short-term soil respiratory responses to temperature and moisture

    Directory of Open Access Journals (Sweden)

    Alejandro eSalazar

    2016-04-01

    , indicating that favorable abiotic conditions activated soil microorganisms. We conclude that soil respiratory responses to short-term changes in environmental conditions are better explained by changes in AMB than in TMB. These results suggest that decomposition models that explicitly represent microbial carbon pools should take into account the active microbial pool, and researchers should be cautious in comparing modeled microbial pool sizes with measurements of TMB.

  11. gone early, a novel germline factor, ensures the proper size of the stem cell precursor pool in the Drosophila ovary.

    Directory of Open Access Journals (Sweden)

    Shinya Matsuoka

    Full Text Available In order to sustain lifelong production of gametes, many animals have evolved a stem cell-based gametogenic program. In the Drosophila ovary, germline stem cells (GSCs arise from a pool of primordial germ cells (PGCs that remain undifferentiated even after gametogenesis has initiated. The decision of PGCs to differentiate or remain undifferentiated is regulated by somatic stromal cells: specifically, epidermal growth factor receptor (EGFR signaling activated in the stromal cells determines the fraction of germ cells that remain undifferentiated by shaping a Decapentaplegic (Dpp gradient that represses PGC differentiation. However, little is known about the contribution of germ cells to this process. Here we show that a novel germline factor, Gone early (Goe, limits the fraction of PGCs that initiate gametogenesis. goe encodes a non-peptidase homologue of the Neprilysin family metalloendopeptidases. At the onset of gametogenesis, Goe was localized on the germ cell membrane in the ovary, suggesting that it functions in a peptidase-independent manner in cell-cell communication at the cell surface. Overexpression of Goe in the germline decreased the number of PGCs that enter the gametogenic pathway, thereby increasing the proportion of undifferentiated PGCs. Inversely, depletion of Goe increased the number of PGCs initiating differentiation. Excess PGC differentiation in the goe mutant was augmented by halving the dose of argos, a somatically expressed inhibitor of EGFR signaling. This increase in PGC differentiation resulted in a massive decrease in the number of undifferentiated PGCs, and ultimately led to insufficient formation of GSCs. Thus, acting cooperatively with a somatic regulator of EGFR signaling, the germline factor goe plays a critical role in securing the proper size of the GSC precursor pool. Because goe can suppress EGFR signaling activity and is expressed in EGF-producing cells in various tissues, goe may function by attenuating

  12. Effect of Molten Pool Size on Microstructure and Tensile Properties of Wire Arc Additive Manufacturing of Ti-6Al-4V Alloy.

    Science.gov (United States)

    Wu, Qianru; Lu, Jiping; Liu, Changmeng; Fan, Hongli; Shi, Xuezhi; Fu, Jie; Ma, Shuyuan

    2017-07-04

    Wire arc additive manufacturing (WAAM) technique is a cost-competitive and efficient technology to produce large structure components in industry domains. Mechanical properties are mainly dominated by the microstructure of the components, which is deeply affected by the molten pool size. In this work, to investigate the effect of the molten pool size on microstructure and mechanical properties of the components, a series of Ti-6Al-4V alloy blocks with different width of molten pool (WMP) ranging from 7 mm to 22 mm were deposited by adjusting the wire feed speed (WFS) from 100 cm/min to 500 cm/min. It is interesting to find that the macrostructure changes from columnar grains to equiaxial grains, and then returns to large columnar grains with the increase of WMP, which is mainly caused by the different cooling rates and thermal gradients. Nonetheless, the tensile properties of the components have a tendency to decline with the increase of WMP.

  13. Swimming Pool Safety

    Science.gov (United States)

    ... Prevention Listen Español Text Size Email Print Share Swimming Pool Safety Page Content ​What is the best way to keep my child safe around swimming pools? An adult should actively watch children at ...

  14. Predicting VFA formation by dark fermentation of particulate substrates.

    Science.gov (United States)

    Arudchelvam, Yalini; Perinpanayagam, Malarmagal; Nirmalakhandan, Nagamany

    2010-10-01

    This study presents a mathematical model for predicting volatile fatty acid (VFA) production by dark fermentation of complex particulate substrates of biomass origin. This model is based on the premise that degradable components of such substrates are first hydrolyzed into soluble monomers, which are then fermented to liquid and gaseous end products. The model considered cellulose and hemicellulose as the degradable components of typical biomass-based organic substrates; and volatile fatty acids, hydrogen, and carbon dioxide as the end products. Hydrolysis of the particulate forms of the components is modeled by a surface-limiting rate equation, and the formation of end products is modeled following the guidelines of the anaerobic digestion model (ADM1). The model was calibrated and validated using experimental COD and VFA data from six batch reactors where, cattle manure was tested as a representative biomass-based substrate. The model predictions agreed well with the temporal trend in the experimental data, with overall r(2) of 0.85 for COD, 0.82 for acetic acid, 0.72 for butyric acid, and 0.42 for propionic acid. Copyright 2010 Elsevier Ltd. All rights reserved.

  15. Serum anti-Müllerian hormone levels reflect the size of the primordial follicle pool in mice

    NARCIS (Netherlands)

    M.E. Kevenaar (Maria Elisabeth); M.F. Meerasahib (Mohamed); P. Kramer (Piet); B.M.N. van de Lang-Born (Brigitte M.); F.H. de Jong (Frank); N.P. Groome (Nigel); A.P.N. Themmen (Axel); J.A. Visser (Jenny)

    2006-01-01

    textabstractReproductive aging is the decline of female fertility with age. It is caused by the decrease in the number of growing follicles, resulting from primordial follicle pool depletion. Recently, we have shown that anti-Müllerian hormone (AMH) is produced by growing follicles, and studies in

  16. The radial diffusivity and magnetization transfer pool size ratio are sensitive markers for demyelination in a rat model of type III multiple sclerosis (MS) lesions

    OpenAIRE

    Janve, Vaibhav A.; Zu, Zhongliang; Yao, Song-Yi; Li, Ke; Zhang, Fang Lin; Wilson, Kevin; Ou, Xiawei; Does, Mark D.; Subramaniam, Sriram; Gochberg, Daniel F

    2013-01-01

    Determining biophysical sensitivity and specificity of quantitative magnetic resonance imaging is essential to develop effective imaging metrics of neurodegeneration. Among these metrics apparent pool size ratio (PSR) from quantitative magnetization transfer (qMT) imaging and radial diffusivity (RD) from diffusion tensor imaging (DTI) are both known to relate to histological measure of myelin density and integrity. However their relative sensitivities towards quantitative myelin detection are...

  17. Comparison of VFA titration procedures used for monitoring the biogas process

    DEFF Research Database (Denmark)

    Lützhøft, Hans-Christian Holten; Boe, Kanokwan; Fang, Cheng

    2014-01-01

    titration procedures. Currently, no standardized procedure is used and it is therefore difficult to compare the performance among plants. The aim of this study was to evaluate four titration procedures (for determination of VFA-levels of digested manure samples) and compare results with gas chromatographic...... (GC) analysis. Two of the procedures are commonly used in biogas plants and two are discussed in literature. The results showed that the optimal titration results were obtained when 40mL of four times diluted digested manure was gently stirred (200rpm). Results from samples with different VFA...... concentrations (1-11g/L) showed linear correlation between titration results and GC measurements. However, determination of VFA by titration generally overestimated the VFA contents compared with GC measurements when samples had low VFA concentrations, i.e. around 1g/L. The accuracy of titration increased when...

  18. Synaptic vesicle pool size, release probability and synaptic depression are sensitive to Ca2+ buffering capacity in the developing rat calyx of Held

    Directory of Open Access Journals (Sweden)

    R.M. Leão

    2009-01-01

    Full Text Available The calyx of Held, a specialized synaptic terminal in the medial nucleus of the trapezoid body, undergoes a series of changes during postnatal development that prepares this synapse for reliable high frequency firing. These changes reduce short-term synaptic depression during tetanic stimulation and thereby prevent action potential failures during a stimulus train. We measured presynaptic membrane capacitance changes in calyces from young postnatal day 5-7 (p5-7 or older (p10-12 rat pups to examine the effect of calcium buffer capacity on vesicle pool size and the efficiency of exocytosis. Vesicle pool size was sensitive to the choice and concentration of exogenous Ca2+ buffer, and this sensitivity was much stronger in younger animals. Pool size and exocytosis efficiency in p5-7 calyces were depressed by 0.2 mM EGTA to a greater extent than with 0.05 mM BAPTA, even though BAPTA is a 100-fold faster Ca2+ buffer. However, this was not the case for p10-12 calyces. With 5 mM EGTA, exocytosis efficiency was reduced to a much larger extent in young calyces compared to older calyces. Depression of exocytosis using pairs of 10-ms depolarizations was reduced by 0.2 mM EGTA compared to 0.05 mM BAPTA to a similar extent in both age groups. These results indicate a developmentally regulated heterogeneity in the sensitivity of different vesicle pools to Ca2+ buffer capacity. We propose that, during development, a population of vesicles that are tightly coupled to Ca2+ channels expands at the expense of vesicles more distant from Ca2+ channels.

  19. Metabolic engineering of the purine biosynthetic pathway in Corynebacterium glutamicum results in increased intracellular pool sizes of IMP and hypoxanthine

    Directory of Open Access Journals (Sweden)

    Peifer Susanne

    2012-10-01

    Full Text Available Abstract Background Purine nucleotides exhibit various functions in cellular metabolism. Besides serving as building blocks for nucleic acid synthesis, they participate in signaling pathways and energy metabolism. Further, IMP and GMP represent industrially relevant biotechnological products used as flavor enhancing additives in food industry. Therefore, this work aimed towards the accumulation of IMP applying targeted genetic engineering of Corynebacterium glutamicum. Results Blocking of the degrading reactions towards AMP and GMP lead to a 45-fold increased intracellular IMP pool of 22 μmol gCDW-1. Deletion of the pgi gene encoding glucose 6-phosphate isomerase in combination with the deactivated AMP and GMP generating reactions, however, resulted in significantly decreased IMP pools (13 μmol gCDW-1. Targeted metabolite profiling of the purine biosynthetic pathway further revealed a metabolite shift towards the formation of the corresponding nucleobase hypoxanthine (102 μmol gCDW-1 derived from IMP degradation. Conclusions The purine biosynthetic pathway is strongly interconnected with various parts of the central metabolism and therefore tightly controlled. However, deleting degrading reactions from IMP to AMP and GMP significantly increased intracellular IMP levels. Due to the complexity of this pathway further degradation from IMP to the corresponding nucleobase drastically increased suggesting additional targets for future strain optimization.

  20. A novel in-situ sampling and VFA sensor technique for anaerobic systems

    DEFF Research Database (Denmark)

    Pind, Peter Frode; Angelidaki, Irini; Ahring, Birgitte Kiær

    2002-01-01

    that has made it possible to monitor VFA on-line in one of the most difficult media: animal slurry or manure. A novel in-situ filtration technique has made it possible to perform microfiltration inside the reactor system. This filter enables sampling from closed reactor systems without large scale pumping...... and filtering. Using this filtration technique together with commercially available membrane filters we have constructed a VFA sensor system that can perform automatic analysis on animal slurry at a frequency as high as every 15 minutes. The VFA sensor has been tested for a period of more than 60 days with more...

  1. Diets high in resistant starch and arabinoxylan modulate digestion processes and SCFA pool size in the large intestine and faecal microbial composition in pigs.

    Science.gov (United States)

    Nielsen, Tina S; Lærke, Helle N; Theil, Peter K; Sørensen, Jens F; Saarinen, Markku; Forssten, Sofia; Knudsen, Knud E Bach

    2014-12-14

    The effects of a high level of dietary fibre (DF) either as arabinoxylan (AX) or resistant starch (RS) on digestion processes, SCFA concentration and pool size in various intestinal segments and on the microbial composition in the faeces were studied in a model experiment with pigs. A total of thirty female pigs (body weight 63.1 (sem 4.4) kg) were fed a low-DF, high-fat Western-style control diet (WSD), an AX-rich diet (AXD) or a RS-rich diet (RSD) for 3 weeks. Diet significantly affected the digestibility of DM, protein, fat, NSP and NSP components, and the arabinose:xylose ratio, as well as the disappearance of NSP and AX in the large intestine. RS was mainly digested in the caecum. AX was digested at a slower rate than RS. The digesta from AXD-fed pigs passed from the ileum to the distal colon more than twice as fast as those from WSD-fed pigs, with those from RSD-fed pigs being intermediate (Pdigestion processes compared with the WSD, and the AXD most efficiently shifted the microbial composition towards butyrogenic species in the faeces and increased the large-intestinal butyrate pool size.

  2. Comparison of VFA titration procedures used for monitoring the biogas process.

    Science.gov (United States)

    Lützhøft, Hans-Christian Holten; Boe, Kanokwan; Fang, Cheng; Angelidaki, Irini

    2014-05-01

    Titrimetric determination of volatile fatty acids (VFAs) contents is a common way to monitor a biogas process. However, digested manure from co-digestion biogas plants has a complex matrix with high concentrations of interfering components, resulting in varying results when using different titration procedures. Currently, no standardized procedure is used and it is therefore difficult to compare the performance among plants. The aim of this study was to evaluate four titration procedures (for determination of VFA-levels of digested manure samples) and compare results with gas chromatographic (GC) analysis. Two of the procedures are commonly used in biogas plants and two are discussed in literature. The results showed that the optimal titration results were obtained when 40 mL of four times diluted digested manure was gently stirred (200 rpm). Results from samples with different VFA concentrations (1-11 g/L) showed linear correlation between titration results and GC measurements. However, determination of VFA by titration generally overestimated the VFA contents compared with GC measurements when samples had low VFA concentrations, i.e. around 1 g/L. The accuracy of titration increased when samples had high VFA concentrations, i.e. around 5 g/L. It was further found that the studied ionisable interfering components had lowest effect on titration when the sample had high VFA concentration. In contrast, bicarbonate, phosphate and lactate had significant effect on titration accuracy at low VFA concentration. An extended 5-point titration procedure with pH correction was best to handle interferences from bicarbonate, phosphate and lactate at low VFA concentrations. Contrary, the simplest titration procedure with only two pH end-points showed the highest accuracy among all titration procedures at high VFA concentrations. All in all, if the composition of the digested manure sample is not known, the procedure with only two pH end-points should be the procedure of

  3. Removals of cryptosporidium parvum oocysts and cryptosporidium-sized polystyrene microspheres from swimming pool water by diatomaceous earth filtration and perlite-sand filtration.

    Science.gov (United States)

    Lu, Ping; Amburgey, James E; Hill, Vincent R; Murphy, Jennifer L; Schneeberger, Chandra L; Arrowood, Michael J; Yuan, Tao

    2017-06-01

    Removal of Cryptosporidium-sized microspheres and Cryptosporidium parvum oocysts from swimming pools was investigated using diatomaceous earth (DE) precoat filtration and perlite-sand filtration. In pilot-scale experiments, microsphere removals of up to 2 log were obtained with 0.7 kg·DE/m2 at a filtration rate of 5 m/h. A slightly higher microsphere removal (2.3 log) was obtained for these DE-precoated filters when the filtration rate was 3.6 m/h. Additionally, pilot-scale perlite-sand filters achieved greater than 2 log removal when at least 0.37 kg/m2 of perlite was used compared to 0.1-0.4 log removal without perlite both at a surface loading rate of 37 m/h. Full-scale testing achieved 2.7 log of microspheres and oocysts removal when 0.7 kg·DE/m2 was used at 3.6 m/h. Removals were significantly decreased by a 15-minute interruption of the flow (without any mechanical agitation) to the DE filter in pilot-scale studies, which was not observed in full-scale filters. Microsphere removals were 2.7 log by perlite-sand filtration in a full-scale swimming pool filter operated at 34 m/h with 0.5 kg/m2 of perlite. The results demonstrate that either a DE precoat filter or a perlite-sand filter can improve the efficiency of removal of microspheres and oocysts from swimming pools over a standard sand filter under the conditions studied.

  4. Sensing of inorganic carbon limitation in Synechococcus PCC7942 is correlated with the size of the internal inorganic carbon pool and involves oxygen.

    Science.gov (United States)

    Woodger, Fiona J; Badger, Murray R; Price, G Dean

    2005-12-01

    Freshwater cyanobacteria are subjected to large seasonal fluctuations in the availability of nutrients, including inorganic carbon (Ci). We are interested in the regulation of the CO2-concentrating mechanism (CCM) in the model freshwater cyanobacterium Synechococcus sp. strain PCC7942 in response to Ci limitation; however, the nature of Ci sensing is poorly understood. We monitored the expression of high-affinity Ci-transporter genes and the corresponding induction of a high-affinity CCM in Ci-limited wild-type cells and a number of CCM mutants. These genotypes were subjected to a variety of physiological and pharmacological treatments to assess whether Ci sensing might involve monitoring of fluctuations in the size of the internal Ci pool or, alternatively, the activity of the photorespiratory pathway. These modes of Ci sensing are congruent with previous results. We found that induction of a high-affinity CCM correlates most closely with a depletion of the internal Ci pool, but that full induction of this mechanism also requires some unresolved oxygen-dependent process.

  5. An unusual correlation between ppGpp pool size and rate of ribosome synthesis during partial pyrimidine starvation of Escherichia coli

    DEFF Research Database (Denmark)

    Vogel, Ulla; Pedersen, Steen; Jensen, Kaj Frank

    1991-01-01

    Escherichia coli was exposed to partial pyrimidine starvation by feeding a pyrBI strain orotate as the only pyrimidine source. Subsequently, differential rates of synthesis of rRNA and of a few ribosome-associated proteins as well as the pool sizes of nucleoside triphosphates and ppGpp were...... at slow growth rates. Upshifts in growth rate were made by adding uracil to a culture growingslowly on orotate. Downshifts could be provoked by adding aspartate plus glutamate to a culture growing at a high concentration of orotate. Following the upshift, both the rates of synthesis of the ribosomal...

  6. Selective VFA production potential from organic waste streams: Assessing temperature and pH influence.

    Science.gov (United States)

    Garcia-Aguirre, Jon; Aymerich, Enrique; González-Mtnez de Goñi, Jaime; Esteban-Gutiérrez, Myriam

    2017-11-01

    This study explored the volatile fatty acid (VFA) production potential of seven waste streams from urban and agroindustrial sources. For that purpose, batch assays were performed under acidic (pH 5.5) and alkaline (pH 10) conditions at both mesophilic (35°C) and thermophilic (55°C) temperature. Overall, the VFA yield was influenced by temperature, and it was positively affected by pH, ranging between 220 and 677mgCODg-1CODfed for liquid waste streams and between 127 and 611mgCODg-1CODfed for solid waste streams and urban sludge. The highest VFA concentration and highest VFA/sCOD ratio was obtained during the organic fraction of municipal solid waste (OFMSW) fermentation, with 8,320mgCODL-1 and 94% at alkaline pH and mesophilic temperature. The results of this study suggest that selective VFA production, i.e. via propionic, butyric and acetic acid production, might be feasible for scaling-up purposes with specific waste streams by adjusting the process parameters. Copyright © 2017 Elsevier Ltd. All rights reserved.

  7. Monitoring and control of the biogas process based on propionate concentration using online VFA measurement

    DEFF Research Database (Denmark)

    Boe, Kanokwan; Steyer, J.P.; Angelidaki, Irini

    2008-01-01

    Simple logic control algorithms were tested for automatic control of a lab-scale CSTR manure digester. Using an online VFA monitoring system, propionate concentration in the reactor was used as parameter for control of the biogas process. The propionate concentration was kept below a threshold...... of 10 mM by manipulating the feed flow. Other online parameters such as pH, biogas production, total VFA, and other individual VFA were also measured to examine process performance. The experimental results showed that a simple logic control can successfully prevent the reactor from overload......, but with fluctuations of the propionate level due to the nature of control approach. The fluctuation of propionate concentration could be reduced, by adding a lower feed flow limit into the control algorithm to prevent undershooting of propionate response. It was found that use of the biogas production as a main...

  8. CONTROL PARAMETERS FOR UNDERSTANDING AND PREVENTING PROCESS IMBALANCES IN BIOGAS PLANTS. EMPHAS IS ON VFA DYNAMICS

    DEFF Research Database (Denmark)

    Bangsø Nielsen, Henrik

    H. The experiments were carried out in lab-scale thermophilic continuously stirred tank reactors (CSTR) treating livestock waste. The imbalances included inhibition by long chain fatty acids (LCFA), inhibition by ammonia, organic overloading with proteins and organic overloading with industrial waste, i.e. meat...... and bone meal and lipids. During the main part of the experiments one reactor was connected to an online VFA sensor giving a detailed profile of the VFA dynamics during the process imbalances. Based on the results it was concluded, that propionate was the most reliable single parameter for indication...

  9. The Visiting Forces Agreement (VFA in the Philippines: Insights on Issues of Sovereignty, Security and Foreign Policy

    Directory of Open Access Journals (Sweden)

    Mark Anthony M. Velasco

    2015-11-01

    Full Text Available The study intends to compare the Visiting Forces Agreement (VFA between the Philippines and the United States of America and the VFA between the Philippines and Australia. The research piece is arranged in the following flow of ideas. The first and the second part provides the foundations by highlighting issues on definition, historical background, provisions of the agreement and concerns faced by the agreement of the Visiting Forces Agreement (VFA between the Republic of the Philippines and the United States of America and the Status of the Visiting Forces Agreement (SOVFA between the Republic of the Philippines and Australia. The third part is an analysis of the VFA and the SOVFA under the tutelage of the framework on the non-intervention principle. As a result, the provisions of SOVFA were in consonance with the legal arrangement in the Philippines than the VFA with the United States of America.

  10. Evaluating 5 and 8 pH-point titrations for measuring VFA in full-scale ...

    African Journals Online (AJOL)

    The comparison showed that the VFA concentrations measured with the two titration methods were higher than those obtained via gas chromatography, differing by 9 and 13 mg COD∙ℓ-1 for the hydrolysate and by 5 and 6 mg COD∙ℓ-1 for the ordinary primary settler effluent. No improvement in the accuracy of VFA ...

  11. Exchangeable Zinc Pool Size at Birth in Pakistani SGA and AGA Infants Do Not Differ but are Lower than in US Infants.

    Science.gov (United States)

    Ariff, Shabina; Krebs, Nancy F; Westcott, Jamie E; Hambidge, K Michael; Miller, Leland V; Rizvi, Arjumand; Soofi, Sajid Bashir; Bhutta, Zulfiqar A

    2017-10-13

    Small for gestational age (SGA) infants are more susceptible to infectious morbidity and growth faltering compared to their appropriate for gestational age (AGA) counterparts. Zinc supplementation of SGA infants may be beneficial but the underlying susceptibility to zinc deficiency of SGA infants has not been examined. In a community-based, observational, longitudinal study in a peri-urban settlement of Karachi, Pakistan, we compared the size of the exchangeable zinc pools (EZP) in term SGA and AGA infants at birth and at 6 months of age, hypothesizing that the EZP would be lower in the SGA group. To measure EZP size, a zinc stable isotope was intravenously administered within 48 hours of birth (n = 17 and 22) at 6 months (n = 11 and 14) in SGA and AGA infants, respectively. Isotopic enrichment in urine was used to determine EZP. No significant difference was detected in the mean (± SD) EZP between SGA and AGA infants at birth, with values of 9.8 ± 3.5 and 10.1 ± 4.1 mg/kg, respectively (p = 0.86), or at 6 months. Longitudinal EZP measurements demonstrated a significant decline in EZP relative to body weight in both groups at 6 months (p SGA and AGA Pakistani infants. However, they do suggest lower in utero zinc transfer to the fetus in a setting where poor maternal nutritional status may confer a high susceptibility to postnatal zinc deficiency.

  12. Vernal Pools

    Data.gov (United States)

    California Department of Resources — This is a polygon layer representing existing vernal pool complexes in California's Central Valley, as identified and mapped by Dr. Robert F. Holland. The purpose of...

  13. RIM1 and RIM2 redundantly determine Ca2+ channel density and readily releasable pool size at a large hindbrain synapse.

    Science.gov (United States)

    Han, Yunyun; Babai, Norbert; Kaeser, Pascal; Südhof, Thomas C; Schneggenburger, Ralf

    2015-01-01

    The localization and density of voltage-gated Ca(2+) channels at active zones are essential for the amount and kinetics of transmitter release at synapses. RIM proteins are scaffolding proteins at the active zone that bind to several other presynaptic proteins, including voltage-gated Ca(2+) channel α-subunits. The long isoforms of RIM proteins, which contain NH2-terminal Rab3- and Munc13-interacting domains, as well as a central PDZ domain and two COOH-terminal C2 domains, are encoded by two genes, Rim1 and Rim2. Here, we used the ideal accessibility of the large calyx of Held synapse for direct presynaptic electrophysiology to investigate whether the two Rim genes have redundant, or separate, functions in determining the presynaptic Ca(2+) channel density, and the size of a readily releasable vesicle pool (RRP). Quantitative PCR showed that cochlear nucleus neurons, which include calyx of Held generating neurons, express both RIM1 and RIM2. Conditional genetic inactivation of RIM2 at the calyx of Held led to a subtle reduction in presynaptic Ca(2+) current density, whereas deletion of RIM1 was ineffective. The release efficiency of brief presynaptic Ca(2+) "tail" currents and the RRP were unaffected in conditional single RIM1 and RIM2 knockout (KO) mice, whereas both parameters were strongly reduced in RIM1/2 double KO mice. Thus, despite a somewhat more decisive role for RIM2 in determining presynaptic Ca(2+) channel density, RIM1 and RIM2 can overall replace each other's presynaptic functions at a large relay synapse in the hindbrain, the calyx of Held. Copyright © 2015 the American Physiological Society.

  14. PDA: Pooled DNA analyzer

    Directory of Open Access Journals (Sweden)

    Lin Chin-Yu

    2006-04-01

    Full Text Available Abstract Background Association mapping using abundant single nucleotide polymorphisms is a powerful tool for identifying disease susceptibility genes for complex traits and exploring possible genetic diversity. Genotyping large numbers of SNPs individually is performed routinely but is cost prohibitive for large-scale genetic studies. DNA pooling is a reliable and cost-saving alternative genotyping method. However, no software has been developed for complete pooled-DNA analyses, including data standardization, allele frequency estimation, and single/multipoint DNA pooling association tests. This motivated the development of the software, 'PDA' (Pooled DNA Analyzer, to analyze pooled DNA data. Results We develop the software, PDA, for the analysis of pooled-DNA data. PDA is originally implemented with the MATLAB® language, but it can also be executed on a Windows system without installing the MATLAB®. PDA provides estimates of the coefficient of preferential amplification and allele frequency. PDA considers an extended single-point association test, which can compare allele frequencies between two DNA pools constructed under different experimental conditions. Moreover, PDA also provides novel chromosome-wide multipoint association tests based on p-value combinations and a sliding-window concept. This new multipoint testing procedure overcomes a computational bottleneck of conventional haplotype-oriented multipoint methods in DNA pooling analyses and can handle data sets having a large pool size and/or large numbers of polymorphic markers. All of the PDA functions are illustrated in the four bona fide examples. Conclusion PDA is simple to operate and does not require that users have a strong statistical background. The software is available at http://www.ibms.sinica.edu.tw/%7Ecsjfann/first%20flow/pda.htm.

  15. Pilot-scale application of an online VFA sensor for monitoring and control of a manure digester

    DEFF Research Database (Denmark)

    Boe, Kanokwan; Angelidaki, Irini

    2012-01-01

    A volatile fatty acids (VFA) sensor based on headspace chromatography was tested for online monitoring and control of a pilot-scale manure digester. The sensor showed satisfying results in terms of sensitivity and reliability for monitoring of the digester. The online VFA and biogas production data...... were used for automatic control of the digester based on feed flow manipulation. The control approach was based on optimization of biogas production while using VFA concentration as the alarm threshold. A rule-based supervisory system with a cascade controller was used to optimize the biogas production...

  16. Pilot-scale application of an online VFA sensor for monitoring and control of a manure digester.

    Science.gov (United States)

    Boe, K; Angelidaki, I

    2012-01-01

    A volatile fatty acids (VFA) sensor based on headspace chromatography was tested for online monitoring and control of a pilot-scale manure digester. The sensor showed satisfying results in terms of sensitivity and reliability for monitoring of the digester. The online VFA and biogas production data were used for automatic control of the digester based on feed flow manipulation. The control approach was based on optimization of biogas production while using VFA concentration as the alarm threshold. A rule-based supervisory system with a cascade controller was used to optimize the biogas production from the digester. The alarm state was set at 40 mM total VFA and 10 mM propionate concentration. The control algorithms could successfully maximize the biogas production without overloading the process. However, as the algorithm was based on a fixed biogas yield parameter and only used the biogas parameter for optimization, it could not distinguish between the decreases of biogas production from inhibition and from lower organic content in the substrate, which resulted in undesired decreasing of the control gas setpoint when the substrate was diluted. It was necessary to adjust the yield parameter in order to get this control approach to function properly, which is not suitable for the full-scale biogas plant where the organic content of waste streams can vary. An alternative approach could be a modified rule-based algorithm that includes VFA parameters to help distinguish between different process scenarios.

  17. Strength training increases the size of the satellite cell pool in type I and II fibres of chronically painful trapezius muscle in females

    DEFF Research Database (Denmark)

    Mackey, Abigail; Andersen, Lars L; Frandsen, Ulrik

    2011-01-01

    While strength training has been shown to be effective in mediating hypertrophy and reducing pain in trapezius myalgia, responses at the cellular level have not previously been studied. This study investigated the potential of strength training targeting the affected muscles (SST, n = 18......) and general fitness training (GFT, n = 16) to augment the satellite cell (SC) and macrophage pools in the trapezius muscles of women diagnosed with trapezius myalgia. A group receiving general health information (REF, n = 8) served as a control. Muscle biopsies were collected from the trapezius muscles...... hypertrophy (r = -0.669, P = 0.005). SST also resulted in a 74% enhancement of the trapezius macrophage content (P

  18. Toasting of cereal grains: effects on in vitro rumen gas production and VFA yield

    Directory of Open Access Journals (Sweden)

    Seerp Tamminga

    2010-01-01

    Full Text Available The fermentation properties of the following feeds: pelleted barley (PB, toasted and pelleted barley (TPB, pelleted maize (PM and toasted and pelleted maize (TPM were studied using an in vitro gas production (GP technique. Each feed sample (0.5g was incubated (3 replications, with rumen fluid collected from 3 grazing lactating dairy cows. The kinetics of GP were automatically recorded for 72h. The amounts of DM disappeared (DMd and the volatile fatty acid yields (VFA were measured. On barley, compared to simple pelleting, toasting significantly (P<0.05 reduced DMd (87.5 vs. 86.2%, the asymptotic GP (A, 388 vs. 367ml/g DMd and slightly increased the time of maximum GP rate (TRmax, 2.89 vs. 3.15h. On maize toasting did not affect DMd and A, but significantly reduced T1/2 (9.71 vs. 8.57; P<0.05 and TRmax (5.04 vs. 4.49, P<0.05. Toasting significantly reduced the VFA yields both of barley and maize. These results, in agreement with previous in sacco and in vivo observations, suggest that toasting might reduce the amount of potential fermentable substrate of barley, whereas it might increase the rate of fermentation of maize.

  19. Hawaii ESI: POOLS (Anchialine Pool Points)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set contains sensitive biological resource data for anchialine pools in Hawaii. Anchialine pools are small, relatively shallow coastal ponds that occur...

  20. Strength training increases the size of the satellite cell pool in type I and II fibres of chronically painful trapezius muscle in females.

    Science.gov (United States)

    Mackey, Abigail L; Andersen, Lars L; Frandsen, Ulrik; Sjøgaard, Gisela

    2011-11-15

    While strength training has been shown to be effective in mediating hypertrophy and reducing pain in trapezius myalgia, responses at the cellular level have not previously been studied. This study investigated the potential of strength training targeting the affected muscles (SST, n = 18) and general fitness training (GFT, n = 16) to augment the satellite cell (SC) and macrophage pools in the trapezius muscles of women diagnosed with trapezius myalgia. A group receiving general health information (REF, n = 8) served as a control. Muscle biopsies were collected from the trapezius muscles of the 42 women (age 44 ± 8 years; mean ± SD) before and after the 10 week intervention period and were analysed by immunohistochemistry for SCs, macrophages and myonuclei. The SC content of type I and II fibres was observed to increase significantly from baseline by 65% and 164%, respectively, with SST (P hypertrophy (r = -0.669, P = 0.005). SST also resulted in a 74% enhancement of the trapezius macrophage content (P < 0.01), accompanied by evidence for the presence of an increased number of actively dividing cells (Ki67(+)) post-SST (P < 0.001). GFT resulted in a significant 23% increase in the SC content of type II fibres, when expressed relative to myonuclear number only (P < 0.05). No changes in the number of myonuclei per fibre or myonuclear domain were detected in any group. These findings provide strong support at the cellular level for the potential of SST to induce a strong myogenic response in this population.

  1. Refinement of a viral transmission risk model for blood donations in seroconversion window phase screened by nucleic acid testing in different pool sizes and repeat test algorithms.

    Science.gov (United States)

    Weusten, Jos; Vermeulen, Marion; van Drimmelen, Harry; Lelie, Nico

    2011-01-01

    In minipool nucleic acid test (MP-NAT) screening protocols, the donations implicated in reactive test pools are released for transfusion when they are nonreactive in a repeat test on the individual samples, but in individual-donation (ID)-NAT screening algorithms the release of nonrepeatable reactive (NRR) donations is under discussion. A previously developed window phase (WP) transmission risk model for NAT-screened blood transfusions has been refined to take the effect of repeat tests of initially reactive (IR) MP- or ID-NAT results into account. The model has then been applied to simulate the effect of different screening algorithms with ULTRIO and the new-generation ULTRIO Plus assay (Novartis Diagnostics) on transmission risk for hepatitis B virus (HBV), hepatitis C virus (HCV), and human immunodeficiency virus (HIV). We calculated WP risk-day equivalents for MP16-, MP8-, and ID-NAT with and without duplicate retesting of IR results of 3.1, 2.7, 1.5, and 1.3 days for HCV; 6.3, 5.5, 3.3, and 2.9 days for HIV; and 24.4, 22.2, 15.6, and 14.1 days for HBV, respectively. These latter infectious HBV WPs reduced to 20.4, 18.2, 11.6, and 10.3 days, respectively, with the more sensitive ULTRIO Plus assay. ULTRIO Plus ID-NAT screening reduces the virus transmission risk in the WP by 54% to 58% compared to ULTRIO MP16-NAT, while the incremental risk caused by releasing donations with duplicate ID-NAT NRR results is 5% to 6%. To achieve maximum safety and specificity a similar repeat test algorithm can be applied to ID-NAT as used for serologic assays. © 2010 American Association of Blood Banks.

  2. An Lmx1b-miR135a2 regulatory circuit modulates Wnt1/Wnt signaling and determines the size of the midbrain dopaminergic progenitor pool.

    Directory of Open Access Journals (Sweden)

    Angela Anderegg

    Full Text Available MicroRNAs regulate gene expression in diverse physiological scenarios. Their role in the control of morphogen related signaling pathways has been less studied, particularly in the context of embryonic Central Nervous System (CNS development. Here, we uncover a role for microRNAs in limiting the spatiotemporal range of morphogen expression and function. Wnt1 is a key morphogen in the embryonic midbrain, and directs proliferation, survival, patterning and neurogenesis. We reveal an autoregulatory negative feedback loop between the transcription factor Lmx1b and a newly characterized microRNA, miR135a2, which modulates the extent of Wnt1/Wnt signaling and the size of the dopamine progenitor domain. Conditional gain of function studies reveal that Lmx1b promotes Wnt1/Wnt signaling, and thereby increases midbrain size and dopamine progenitor allocation. Conditional removal of Lmx1b has the opposite effect, in that expansion of the dopamine progenitor domain is severely compromised. Next, we provide evidence that microRNAs are involved in restricting dopamine progenitor allocation. Conditional loss of Dicer1 in embryonic stem cells (ESCs results in expanded Lmx1a/b+ progenitors. In contrast, forced elevation of miR135a2 during an early window in vivo phenocopies the Lmx1b conditional knockout. When En1::Cre, but not Shh::Cre or Nes::Cre, is used for recombination, the expansion of Lmx1a/b+ progenitors is selectively reduced. Bioinformatics and luciferase assay data suggests that miR135a2 targets Lmx1b and many genes in the Wnt signaling pathway, including Ccnd1, Gsk3b, and Tcf7l2. Consistent with this, we demonstrate that this mutant displays reductions in the size of the Lmx1b/Wnt1 domain and range of canonical Wnt signaling. We posit that microRNA modulation of the Lmx1b/Wnt axis in the early midbrain/isthmus could determine midbrain size and allocation of dopamine progenitors. Since canonical Wnt activity has recently been recognized as a key

  3. ECS DAAC Data Pools

    Science.gov (United States)

    Kiebuzinski, A. B.; Bories, C. M.; Kalluri, S.

    2002-12-01

    As part of its Earth Observing System (EOS), NASA supports operations for several satellites including Landsat 7, Terra, and Aqua. ECS (EOSDIS Core System) is a vast archival and distribution system and includes several Distributed Active Archive Centers (DAACs) located around the United States. EOSDIS reached a milestone in February when its data holdings exceeded one petabyte (1,000 terabytes) in size. It has been operational since 1999 and originally was intended to serve a large community of Earth Science researchers studying global climate change. The Synergy Program was initiated in 2000 with the purpose of exploring and expanding the use of remote sensing data beyond the traditional research community to the applications community including natural resource managers, disaster/emergency managers, urban planners and others. This included facilitating data access at the DAACs to enable non-researchers to exploit the data for their specific applications. The combined volume of data archived daily across the DAACs is of the order of three terabytes. These archived data are made available to the research community and to general users of ECS data. Currently, the average data volume distributed daily is two terabytes, which combined with an ever-increasing need for timely access to these data, taxes the ECS processing and archival resources for more real-time use than was previously intended for research purposes. As a result, the delivery of data sets to users was being delayed in many cases, to unacceptable limits. Raytheon, under the auspices of the Synergy Program, investigated methods at making data more accessible at a lower cost of resources (processing and archival) at the DAACs. Large on-line caches (as big as 70 Terabytes) of data were determined to be a solution that would allow users who require contemporary data to access them without having to pull it from the archive. These on-line caches are referred to as "Data Pools." In the Data Pool concept

  4. High efficient ethanol and VFA production from gas fermentation: effect of acetate, gas and inoculum microbial composition

    DEFF Research Database (Denmark)

    El-Gammal, Maie; Abou-Shanab, Reda; Angelidaki, Irini

    2017-01-01

    In bioindustry, syngas fermentation is a promising technology for biofuel production without the use of plant biomass as sugar-based feedstock. The aim of this study was to identify optimal conditions for high efficient ethanol and volatile fatty acids (VFA) production from synthetic gas...... fermentation. Therefore, the effect of different gases (pure CO, H2, and a synthetic syngas mixture), media (acetate medium and acetate-free medium), and biocatalyst (pure and mixed culture) were studied. Acetate was the most dominant product independent on inoculum type. The maximum concentration of volatile...... fatty acids and ethanol was achieved by the pure culture (Clostridium ragsdalei). Depending on the headspace gas composition, VFA concentrations were up to 300% higher after fermentation with Clostridium ragsdalei compared to fermentation with mixed culture. The preferred gas composition with respect...

  5. A hybrid cascade control scheme for the VFA and COD regulation in two-stage anaerobic digestion processes.

    Science.gov (United States)

    Méndez-Acosta, H O; Campos-Rodríguez, A; González-Álvarez, V; García-Sandoval, J P; Snell-Castro, R; Latrille, E

    2016-10-01

    A hybrid (continuous-discrete) cascade control is proposed to regulate both, volatile fatty acids (VFA) and chemical oxygen demand (COD) concentrations in two-stage (acidogenic-methanogenic) anaerobic digestion (TSAD) processes. The outer loop is a discrete controller that regulates the COD concentration of the methanogenic bioreactor by using a daily off-line measurement and that modifies the set-point tracked by inner loop, which manipulates the dilution rate to regulate the VFA concentration of the acidogenic bioreactor, estimated by continuous on-line conductivity measurements, avoiding acidification. The experimental validation was conducted in a TSAD process for the treatment of tequila vinasses during 110days. Results showed that the proposed cascade control scheme was able to achieve the VFA and COD regulation by using conventional measurements under different set-point values in spite of adverse common scenarios in full-scale anaerobic digestion processes. Microbial composition analysis showed that the controller also favors the abundance and diversity toward methane production. Copyright © 2016 Elsevier Ltd. All rights reserved.

  6. The science of pooling

    Energy Technology Data Exchange (ETDEWEB)

    Gilbert, E.

    1995-10-01

    The pooling of data from radon studies is described. Pooling refers to the analysis of original data from several studies, not meta-analysis in which summary measures from published data are analyzed. A main objective for pooling is to reduce uncertainty and to obtain more precise estimates of risk than would be available from any single study.

  7. 13 CFR 120.1704 - Pool Loans eligible for Pooling.

    Science.gov (United States)

    2010-01-01

    ... Loans eligible for Pooling. (a) General Pool Loan eligibility requirements. For a First Lien Position... zoos—712130 (“Zoos and Botanical Gardens”). (b) SBA review of a Pool Loan prior to pool formation. SBA...

  8. Optimization and evaluation of reference region variable flip angle (RR-VFA) B1+ and T1 Mapping in the Prostate at 3T.

    Science.gov (United States)

    Rangwala, Novena A; Dregely, Isabel; Wu, Holden H; Sung, Kyunghyun

    2017-03-01

    To optimize and evaluate the reference region variable flip angle (RR-VFA) technique for simultaneous B1+ and T1 mapping of the prostate at 3 Tesla (T). The fat region surrounding the prostate was first identified using a fractional fat segmentation constant (tF ) and a signal fat-fraction threshold (rF ), and the relative flip angle (FA) was characterized using an effective fat T1 (T1f ) within the fat region. Optimal values of tF , rF , and T1f were chosen by comparing relative FA maps using RR-VFA (ARR-VFA ) with a reference relative FA maps (AREF ) in the surrounding fat and evaluating interpolation errors within the prostate. The optimized RR-VFA was evaluated in volunteers at 3T on a single scanner (n = 10) and across three scanners (n = 4). tF , rF and T1f were optimized as 0.5, 90%, and 320 ms, respectively. Prostate ARR-VFA showed differences of 30% among volunteers on one scanner, with no significant differences between ARR-VFA and AREF (P = 0.41). Prostate T1 after B1+ correction was 1998 ± 113 ms with significantly (P = 0.004) lower standard deviation than T1 before B1+ correction. The average coefficient of variation of prostate T1 across multiple scanners decreased from 15% to 5% after B1+ correction. The optimized RR-VFA can simultaneously measure B1+ and T1 in the prostate without the need for an additional scan and improve T1 consistency within and across MRI scanners at 3T. 3 J. Magn. Reson. Imaging 2017;45:751-760. © 2016 International Society for Magnetic Resonance in Medicine.

  9. Epitope mapping of recombinant Leishmania donovani virulence factor A2 (recLdVFA2 and canine leishmaniasis diagnosis using a derived synthetic bi-epitope.

    Directory of Open Access Journals (Sweden)

    Thais Melo Mendes

    2017-05-01

    Full Text Available Leishmaniasis is one of the most important zoonotic diseases spread in Latin America. Since many species are involved in dog infection with different clinical manifestations, the development of specific diagnostic tests is mandatory for more accurate disease control and vaccine strategies.Seventy-five 15-mer peptides covering the sequence of recombinant Leishmania donovani virulence factor A2 (recLdVFA2 protein were prepared by Spot synthesis. Membrane-bound peptides immunoreactivity with sera from dogs immunized with recLdVFA2 and with a specific anti-recLdVFA2 monoclonal antibody allowed mapping of continuous B-cell epitopes. Five epitopes corresponding to the N-terminal region of recLdVFA2 (MKIRSVRPLVVLLVC, RSVRPLVVLLVCVAA, RPLVVLLVCVAAVLA, VVLLVCVAAVLALSA and LVCVAAVLALSASAE, region 1-28 and one located within the repetitive units (PLSVGPQAVGLSVG, regions 67-81 and 122-135 were identified. A 34-mer recLdVFA2-derived bi-epitope containing the sequence MKIRSVRPLVVLLVC linked to PLSVGPQAVGLSVG by a Gly-Gly spacer was chemically synthesized in its soluble form. The synthetic bi-epitope was used as antigen to coat ELISA plates and assayed with dog sera for in vitro diagnosis of canine visceral leishmaniasis (CVL. The assay proved to be highly sensitive (98% and specific (99%.Our work suggests that synthetic peptide-based ELISA strategy may be useful for the development of a sensitive and highly specific serodiagnosis for CVL or other parasitic diseases.

  10. Performance Study and Dynamic Optimization Design for Thread Pool Systems

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Dongping [Iowa State Univ., Ames, IA (United States)

    2004-12-19

    Thread pools have been widely used by many multithreaded applications. However, the determination of the pool size according to the application behavior still remains problematic. To automate this process, in this thesis we have developed a set of performance metrics for quantitatively analyzing thread pool performance. For our experiments, we built a thread pool system which provides a general framework for thread pool research. Based on this simulation environment, we studied the performance impact brought by the thread pool on different multithreaded applications. Additionally, the correlations between internal characterizations of thread pools and their throughput were also examined. We then proposed and evaluated a heuristic algorithm to dynamically determine the optimal thread pool size. The simulation results show that this approach is effective in improving overall application performance.

  11. Semi-aerobic fermentation as a novel pre-treatment to obtain VFA and increase methane yield from primary sludge.

    Science.gov (United States)

    Peces, M; Astals, S; Clarke, W P; Jensen, P D

    2016-01-01

    There is a growing trend to consider organic wastes as potential sources of renewable energy and value-add products. Fermentation products have emerged as attractive value-add option due to relative easy production and broad application range. However, pre-fermentation and extraction of soluble products may impact down-stream treatment processes, particularly energy recovery by anaerobic digestion. This paper investigates primary sludge pre-fermentation at different temperatures (20, 37, 55, and 70°C), treatment times (12, 24, 48, and 72h), and oxygen availability (semi-aerobic, anaerobic); and its impact on anaerobic digestion. Pre-fermentation at 20 and 37°C succeeded for VFA production with acetate and propionate being major products. Pre-fermentation at 37, 55, and 70°C resulted in higher solubilisation yield but it reduced sludge methane potential by 20%. Under semi-aerobic conditions, pre-fermentation allowed both VFA recovery (43gCODVFAkg(-1)VS) and improved methane potential. The latter phenomenon was linked to fungi that colonised the sludge top layer during pre-fermentation. Copyright © 2015 Elsevier Ltd. All rights reserved.

  12. Vitamin D Pooling Project

    Science.gov (United States)

    The Vitamin D Pooling Project of Rarer Cancers brought together investigators from 10 cohorts to conduct a large prospective epidemiologic study of the association between vitamin D status and seven rarer cancers.

  13. Swimming pool granuloma

    Science.gov (United States)

    Aquarium granuloma; Fish tank granuloma; Mycobacterium marinum infection ... A swimming pool granuloma occurs when water containing Mycobacterium marinum bacteria enter a break in the skin. Signs of a skin infection appear ...

  14. Opportunities and challenges when pooling milk samples using ELISA

    DEFF Research Database (Denmark)

    Græsbøll, Kaare; Andresen, Lars Ole; Hisham Beshara Halasa, Tariq

    2017-01-01

    -positive samples by pooling. To illustrate this, the sensitivity of antibody ELISA on pooled samples of bovine milk for Salmonella Dublin, Mycobacterium avium spp. paratuberculosis, and bovine virus diarrhea was tested. For these milk assays, the analytical sensitivity decreased rapidly with increasing pool sizes......Testing large quantities of samples in order to detect one or more test-positive sample(s) is expensive and time-consuming. It is possible to optimize this process by pooling samples. Two frameworks to produce different hierarchical and non-hierarchical pooling schemes were tested and compared...... to standard pooling. Their efficiency and the potential savings were determined as a function of prevalence and the number of pooled samples. The potential benefit of pooling samples is dependent upon the changes in the analytical sensitivity and specificity of the test used when diluting test...

  15. PENGARUH TEPUNG DAUN GAMAL DAN DAUN KELOR DALAM UREA CASSAVA BLOK (UCB TERHADAP KECERNAAN, KADAR VFA, DAN NH3 IN-VITRO

    Directory of Open Access Journals (Sweden)

    N M. WITARIADI

    2012-09-01

    Full Text Available ABSTRAK Penelitian telah dilakukan dengan tujuan untuk mendapatkan informasi tentang pengaruh tepung daun gamal dan daun kelor sebagai sumber protein dalam urea cassava blok (UCB terhadap kecernaan bahan kering, bahan organik, kadar VFA, dan NH3 cairan rumen pakan jerami padi secara invitro. Penelitian dilaksanakan dengan mempergunakan rancangan acak lengkap (RAL dengan 3 perlakuan dan 5 ulangan. Sehingga secara keseluruhan terdapat 15 unit penelitian. Adapun ketiga perlakuan tersebut adalah: Perlakuan A (jerami padi + UCB yang ditambah tepung daun kelor; B (jerami padi + UCB yang ditambah tepung daun gamal, dan C (jerami padi + UCB yang ditambah tepung daun kelor dan daun gamal. Varibel yang diamati adalah kecernaan bahan kering (KCBK , kecernaan bahan organik (KCBO in-vitro, produksi vollatile fatty acid (VFA, produksi NH3, dan pH supernatan. Hasil penelitian mendapatkan bahwa KCBK, KCBO invitro, VFA, NH3, dan pH supernatan pada ketiga perlakuan berbeda nyata (P<0,05. Penggunaan daun gamal sebagai sumber protein pada UCB menghasilkan KCBK, KCBO, VFA, NH3, tertinggi dibandingkan dengan daun kelor maupun kombinasi antara daun gamal dan daun kelor. EFFECT OF USING GLIRICIDIA (Gliricidia sepium AND MORINGA (Moringa oleifera LEAVES MEALS IN UREA CASSAVA BLOCK (UCB ON DIGESTIBILITY, VOLLATILE FATTY ACID, AND NH3 IN-VITRO. ABSTRACT The experiment has been conducted in order to now the effect of Gliricidia sepium and Moringa oleifera leaves meal a source of protein in urea cassava block (UCB to the digestibility dray matter and organic matter , VFA and ammonia concentration with rice straw diet. The experiment set in completely randomized design using three treatment. The treatment are: A (rise straw + UCB with Moringa; B (rise straw + UCB with Gliricidia sepium, and C (rise straw + UCB with Moringa and Gliricidia sepium. The observed variable are: dry matter, organic matter digestibility, volatile fatty acid, ammonia concentration, and pH rumen juice

  16. Income pooling within families

    DEFF Research Database (Denmark)

    Bonke, Jens; Uldall-Poulsen, Hans

    This paper analyses the phenomenon of income-pooling by applying the Danish household expenditure survey, merged with authoritative register information. Responses to additional questions on income sharing among 1696 couples also allows us to analyses whether the intra-household distribution...... of resources reflects individual preferences, the distribution of power, and pre-marital experiences. The analyses show that most Danish households use some type of income pooling and that the likelihood of income pooling varies considerably according to individual characteristics (age, education, occupation......, past partners, upbringing) and household characteristics (household income, duration of marriage, location of residence and the existence of public goods, including children). However, when all variables are evaluated in a common model, only the duration of marriage and the existence of children...

  17. DNA pooling strategies for categorical (ordinal) traits

    Science.gov (United States)

    Despite reduced genotyping costs in recent years, obtaining genotypes for all individuals in a population may still not be feasible when sample size is large. DNA pooling provides a useful alternative to determining genotype effects. Clustering algorithms allow for grouping of individuals (observati...

  18. Investigation of segmentation based pooling for image quantification

    Science.gov (United States)

    Porter, Reid; Harvey, Neal; Ruggiero, Christy

    2014-03-01

    A key step in many image quantification solutions is feature pooling, where subsets of lower-level features are combined so that higher-level, more invariant predictions can be made. The pooling region, which defines the subsets, often has a fixed spatial size and geometry, but data-adaptive pooling regions have also been used. In this paper we investigate pooling strategies for the data-adaptive case and suggest a new framework for pooling that uses multiple sub-regions instead of a single region. We show that this framework can help represent the shape of the pooling region and also produce useful pairwise features for adjacent pooling regions. We demonstrate the utility of the framework in a number of classification tasks relevant to image quantification in digital microscopy.

  19. Amino acid pool composition of the basidiomycete Coprinus cinereus.

    Science.gov (United States)

    Ulrich, Cynthia E; Gathman, Allen C; Lilly, Walt W

    2007-11-01

    The leaf-litter fungus Coprinus cinereus maintains a pool of free amino acid in its mycelium. When the organism is grown under conditions of high nitrogen availability with 13.2 mmol.L-1 L-asparagine as the nitrogen source, the primary constituents of this pool are glutamine, alanine, and glutamic acid. Together these 3 amino acids comprise approximately 70% of the pool. Nitrogen deprivation reduces the size of the free amino acid pool by 75%, and neither a high concentration of ammonium nor a protein nitrogen source support a similar pool size as L-asparagine. Nitrogen deprivation also reduces the concentration of glutamine to the pool while increasing glutamate. Concomitant with this shift is a marked increase in mycelial ammonium.

  20. Estimating species pools for a single ecological assemblage.

    Science.gov (United States)

    Shen, Tsung-Jen; Chen, Youhua; Chen, You-Fang

    2017-12-22

    The species pool concept was formulated over the past several decades and has since played an important role in explaining multi-scale ecological patterns. Previous statistical methods were developed to identify species pools based on broad-scale species range maps or community similarity computed from data collected from many areas. No statistical method is available for estimating species pools for a single local community (sampling area size may be very small as ≤ 1 km2). In this study, based on limited local abundance information, we developed a simple method to estimate the area size and richness of a species pool for a local ecological community. The method involves two steps. In the first step, parameters from a truncated negative trinomial model characterizing the distributional aggregation of all species (i.e., non-random species distribution) in the local community were estimated. In the second step, we assume that the unseen species in the local community are most likely the rare species, only found in the remaining part of the species pool, and vice versa, if the remaining portion of the pool was surveyed and was contrasted with the sampled area. Therefore, we can estimate the area size of the pool, as long as an abundance threshold for defining rare species is given. Since the size of the pool is dependent on the rarity threshold, to unanimously determine the pool size, we developed an optimal method to delineate the rarity threshold based on the balance of the changing rates of species absence probabilities in the sampled and unsampled areas of the pool. For a 50 ha (0.5 km2) forest plot in the Barro Colorado Island of central Panama, our model predicted that the local, if not regional, species pool for the 0.5 km2 forest plot was nearly the entire island. Accordingly, tree species richness in this pool was estimated as around 360. When the sampling size was smaller, the upper bound of the 95% confidence interval could reach 418, which was very

  1. CERN Electronics Pool presentations

    CERN Multimedia

    2011-01-01

    The CERN Electronics Pool has organised a series of presentations in collaboration with oscilloscope manufacturers. The last one will take place according to the schedule below.   Time will be available at the end of the presentation to discuss your personal needs. The Agilent presentation had to be postponed and will be organised later. -     Lecroy: Thursday, 24 November 2011, in 530-R-030, 14:00 to 16:30.

  2. Stochastic Pooling Networks

    OpenAIRE

    McDonnell, Mark D; Amblard, Pierre-Olivier; Stocks, Nigel G.

    2009-01-01

    We introduce and define the concept of a stochastic pooling network (SPN), as a model for sensor systems where redundancy and two forms of 'noise' -- lossy compression and randomness -- interact in surprising ways. Our approach to analyzing SPNs is information theoretic. We define an SPN as a network with multiple nodes that each produce noisy and compressed measurements of the same information. An SPN must combine all these measurements into a single further compressed network output, in a w...

  3. Benthic assemblages of rock pools in northern Portugal: seasonal and between-pool variability

    Directory of Open Access Journals (Sweden)

    Iacopo Bertocci

    2012-11-01

    Full Text Available We investigated the seasonal (winter vs summer and within season and spatial (between-pool variability of benthic assemblages of rock pools at mid-intertidal level along the shore of Viana do Castelo (North Portugal. Physical traits of rock pools, including size, depth and position along the shore, were also compared between pools. While pools did not differ for any of the examined physical traits, results indicated a clear seasonal difference in the structure of assemblages, including a total of 49 macroalgal and 13 animal taxa. This finding was driven by six taxa that are more abundant in winter (the reef-forming polychaete Sabellaria alveolata, the articulated coralline algae Corallina spp., the brown alga Bifurcaria bifurcata, the encrusting coralline alga Lithophyllum incrustans, the red alga Chondracanthus acicularis and the grazing snails Gibbula spp. and four algal taxa that are more abundant in summer (the invasive brown Sargassum muticum, the green Ulva spp., the kelp Laminaria ochroleuca and the filamentous red Ceramium spp.. These data provide a new contribution to the knowledge of rock pool systems and have potential implications for monitoring programmes aimed at assessing ecological modifications related to natural and anthropogenic disturbances and for identifying processes responsible for the variability of rock pool assemblages.

  4. 13 CFR 120.611 - Pools backing Pool Certificates.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Pools backing Pool Certificates. 120.611 Section 120.611 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS... forth in the Program Guide, each Pool must have: (1) A minimum number of guaranteed portions of loans...

  5. SNR efficiency of combined bipolar gradient echoes: Comparison of three-dimensional FLASH, MPRAGE, and multiparameter mapping with VFA-FLASH and MP2RAGE.

    Science.gov (United States)

    Jutras, Jean-David; Wachowicz, Keith; Gilbert, Guillaume; De Zanche, Nicola

    2017-06-01

    High-bandwidth bipolar multiecho gradient echo sequences are increasingly popular in structural brain imaging because of reduced water-fat shifts, lower susceptibility effects, and improved signal-to-noise ratio (SNR) efficiency. In this study, we investigated the performance of three three-dimensional multiecho sequences (MPRAGE, MP2RAGE, and FLASH) with scan times 3T. We also compared the performance of multiparameter mapping (PD, T1 , and T2*) with bipolar multiecho MP2RAGE versus the variable flip angle technique with multiecho FLASH (VFA-FLASH). Multiecho sequences were optimized to yield equivalent contrast and improved SNR compared with their single-echo counterparts. Theoretical SNR gains were verified with measurements in a multilayered phantom. Robust image processing pipelines extracted PD, T1 , and T2* maps from MP2RAGE or VFA-FLASH, and the corresponding SNR was measured with varying SENSE accelerations (R = 1-5) and number of echoes (N = 1-12). All sequences were tested on four healthy volunteers. Multiecho sequences achieved SNR gains of 1.3-1.6 over single-echo sequences. MP2RAGE yielded comparable T1 -to-noise ratio to VFA-FLASH, but significantly lower SNR (maps. Measured SNR gains agreed with the theoretical predictions for SENSE accelerations ≤3. Multiecho sequences achieve higher SNR efficiency over conventional single-echo sequences, despite three-fold higher sampling bandwidths. VFA-FLASH surpasses MP2RAGE in its ability to map three parameters with high SNR and 1-mm isotropic resolution in a clinically relevant scan time (∼8:30 min), whereas MP2RAGE yields lower intersubject variability in T1 . Magn Reson Med 77:2186-2202, 2017. © 2016 International Society for Magnetic Resonance in Medicine. © 2016 International Society for Magnetic Resonance in Medicine.

  6. Swimming Pools and Molluscum Contagiosum

    Science.gov (United States)

    ... Travelers’ Health: Smallpox & Other Orthopoxvirus-Associated Infections Poxvirus Swimming Pools Recommend on Facebook Tweet Share Compartir The ... often ask if molluscum virus can spread in swimming pools. There is also concern that it can ...

  7. Vernal Pool Complexes - Central Valley, 1989-1998 [ds36

    Data.gov (United States)

    California Department of Resources — This Arc/Info coverage is a polygon layer of vernal pool complexes greater than 40 acres in size for 29 counties throughout the greater Central Valley, and some...

  8. The Productive Ligurian Pool

    CERN Document Server

    Casella, E; Couvelard, X; Caldeira, R M A

    2011-01-01

    In contrast with the behavior of the eddies in the open-ocean, the sub-mesoscale eddies generated in the constricted Ligurian Basin (NW Mediterranean), are unproductive but their combined effect, arranged in a rim-like fashion, contributes to the containment of a Productive Ligurian Pool (PLP). Data de- rived from MODIS satellite sensor showed persistent higher chlorophyll con- centrations in the centre of the basin, concurrent with high EKE values in its surroundings, derived from AVISO altimetry merged products. This sug- gested that this 'productive pool' is maintained by the intense (sub)mesoscale eddy activity in the rim. Numerical realistic experiments, using a Regional Ocean Model System, forced by MERCATOR and by a high-resolution COSMO- l7 atmospheric model, also showed that most of the sub-mesoscale eddies, during 2009 and 2010, are concentrated in the rim surrounding the basin, contributing to the formation of a basin-scale cyclonic gyre. We hypothesized that the interaction between eddies in the r...

  9. Microscopic bubble behaviour in suppression pool during wetwell venting

    Science.gov (United States)

    Zablackaite, G.; Nagasaka, H.; Kikura, H.

    2017-10-01

    During a severe accident PCV failure should be avoided and fission products inside PCV should be confined as much as possible. In order to minimize FPs release, Wetwell venting is conducted by releasing steam-non-condensable gas mixture carrying FPs from the Drywell to Suppression Pool. Steam is condensed by subcooled water in the pool, and most of FPs are retained into water. The removal of FP in the water pool is referred to as “Pool Scrubbing effect”. Hydrodynamic parameters of bubbles have impact on pool scrubbing effect. However, there is only few data available to evaluate quantitatively the bubble behaviour under depressurization and/or thermal stratification conditions. Series of experiments were conducted to evaluate the influence of temperature distribution, non-condensable gas content and pressure in the Wetwell on bubble behaviour. Bubbles were visualized using High Speed Camera and adopting shadowgraphy technique. Applying Particle Tracking Velocimetry, bubble velocity and size distribution were obtained from recorded images. Experimental results show that with increasing suppression pool temperature, bubbles reaching the pool surface decreased in size and traveling velocity became slower. In pressurized wetwell, bubble behaviour was similar to that in the heated up suppression pool case, although bubble parameters were similar to the low temperature case. Higher air content induced water surface movement and bubbles were smaller due to break up.

  10. Item Pool Design for an Operational Variable-Length Computerized Adaptive Test

    Science.gov (United States)

    He, Wei; Reckase, Mark D.

    2014-01-01

    For computerized adaptive tests (CATs) to work well, they must have an item pool with sufficient numbers of good quality items. Many researchers have pointed out that, in developing item pools for CATs, not only is the item pool size important but also the distribution of item parameters and practical considerations such as content distribution…

  11. Convection in arc weld pools

    Energy Technology Data Exchange (ETDEWEB)

    Oreper, G.M.; Eagar, T.W.; Szekely, J.

    1982-11-01

    A mathematical model was developed to account for convection and temperature distributions in stationary arc weld pools driven by buoyancy, electromagnetic and surface tension forces. It is shown that the electromagnetic and surface tension forces dominate the flow behavior. In some cases, these forces produce double circulation loops, which are indirectly confirmed by experimental measurements of segregation in the weld pool. It is also shown that the surface tension driven flows are very effective in dissipating the incident energy flux on the pool surface which, in turn, reduces the vaporization from the weld pool.

  12. Pemberian Pakan Serat Sisa Tanaman Pertanian (Jerami Kacang Tanah, Jerami Jagung, Pucuk Tebu Terhadap Evolusi pH, N-NH3 dan VFA Di dalam Rumen Sapi

    Directory of Open Access Journals (Sweden)

    Yunasri Usman

    2013-10-01

    Full Text Available (Feeding agricultural crop residues (groundnut straw, corn straw, sugarcane straw to the pH evolution, N-NH3 and VFA in the cow rumen ABSTRACT. The goal of this study is to evaluate the condition of fermentation in the rumen of cows by administration of 3 types of feed fiber agricultural crop residues (Groundnut Straw (GS, Corn Straw (CS and Sugarcane Tops (ST. Single feeding wascarried out at 2 Holstein Friesian Crossbred (HFC cows with the age of 4-5 by fistula rumen.This study was conducted 20 days and with a 14-dayadaptation period.At the end of the adaptation period, rumen fluid was collected to measure pH, N-NH3and VFA based on feed treatment percow.Collection of rumen fluid was simultanous conducted for 24 hours at 27 time points decision.The results of the experiment showed that the level of pH for GS, CS and ST was 7.02 + 0.29; 6.54 + 0.16 and 6.54 + 0.14 respectively. The level of N-NH3 was 4.90 + 2.10 mg/100 ml of rumen fluid; 7.36 + 3.10 mg/100 ml of rumen fluid; 2.26 + 0.85 mg/100 ml of rumen fluidfor GS, CS and ST, respectively. Meanwile, the level of VFA was 57.44 + 12.75 mmol/l ml, 64.84 + 10.82 mmol/l and 44.13 + 6.66 mmol/l ml of rumen fluid, respectively.

  13. Quantitative Gd-DOTA uptake from cerebrospinal fluid into rat brain using 3D VFA-SPGR at 9.4T

    DEFF Research Database (Denmark)

    Lee, Hedok; Mortensen, Kristian; Sanggaard, Simon

    2017-01-01

    gadolinium concentration maps are derived. METHODS: We implemented a 3D variable flip angle spoiled gradient echo (VFA-SPGR) longitudinal relaxation time (T1) technique, the accuracy of which was cross-validated by way of inversion recovery rapid acquisition with relaxation enhancement (IR-RARE) using...... phantoms. Normal Wistar rats underwent Gd-DOTA infusion into CSF via the cisterna magna and continuous MRI for approximately 130 min using T1-weighted imaging. Dynamic Gd-DOTA concentration maps were calculated and parenchymal uptake was estimated. RESULTS: In the phantom study, T1 discrepancies between...... states. Magn Reson Med, 2017. © 2017 International Society for Magnetic Resonance in Medicine....

  14. A simplified model of decontamination by BWR steam suppression pools

    Energy Technology Data Exchange (ETDEWEB)

    Powers, D.A.

    1997-05-01

    Phenomena that can decontaminate aerosol-laden gases sparging through steam suppression pools of boiling water reactors during reactor accidents are described. Uncertainties in aerosol properties, aerosol behavior within gas bubbles, and bubble behavior in plumes affect predictions of decontamination by steam suppression pools. Uncertainties in the boundary and initial conditions that are dictated by the progression of severe reactor accidents and that will affect predictions of decontamination by steam suppression pools are discussed. Ten parameters that characterize boundary and initial condition uncertainties, nine parameters that characterize aerosol property and behavior uncertainties, and eleven parameters that characterize uncertainties in the behavior of bubbles in steam suppression pools are identified. Ranges for the values of these parameters and subjective probability distributions for parametric values within the ranges are defined. These uncertain parameters are used in Monte Carlo uncertainty analyses to develop uncertainty distributions for the decontamination that can be achieved by steam suppression pools and the size distribution of aerosols that do emerge from such pools. A simplified model of decontamination by steam suppression pools is developed by correlating features of the uncertainty distributions for total decontamination factor, DF(total), mean size of emerging aerosol particles, d{sub p}, and the standard deviation of the emerging aerosol size distribution, {sigma}, with pool depth, H. Correlations of the median values of the uncertainty distributions are suggested as the best estimate of decontamination by suppression pools. Correlations of the 10 percentile and 90 percentile values of the uncertainty distributions characterize the uncertainty in the best estimates. 295 refs., 121 figs., 113 tabs.

  15. Platelet storage pool deficiency in Jacobsen syndrome.

    Science.gov (United States)

    White, James G

    2007-11-01

    Jacobsen syndrome and Paris-Trousseau Syndrome share similar congenital anomalies, thrombocytopenia, giant platelet alpha granules resulting from fusion of smaller organelles, and an 11q terminal deletion at 11q23.3. Similarities in the two cohorts have suggested that the Paris-Trousseau Syndrome is a variant of Jacobsen syndrome, or the same disorder. The present study has pointed out a significant difference between the two syndromes. Platelets from six patients with Jacobsen syndrome were markedly diminished in serotonin adenine nucleotide rich dense bodies, indicating the presence of platelet storage pool deficiency. Since platelet dense bodies are reported to be normal in size, number and distribution in the Paris-Trousseau Syndrome, the presence of platelet storage pool deficiency in six patients evaluated in the present study may distinguish the two disorders.

  16. ENERGY STAR Certified Pool Pumps

    Data.gov (United States)

    U.S. Environmental Protection Agency — Certified models meet all ENERGY STAR requirements as listed in the Version 1.0 ENERGY STAR Program Requirements for Pool Pumps that are effective as of February 15,...

  17. Grundfoss: Chlorination of Swimming Pools

    DEFF Research Database (Denmark)

    Hjorth, Poul G.; Hogan, John; Andreassen, Viggo

    1998-01-01

    Grundfos asked for a model, describing the problem of mixing chemicals, being dosed into water systems, to be developed. The application of the model should be dedicated to dosing aqueous solution of chlorine into swimming pools.......Grundfos asked for a model, describing the problem of mixing chemicals, being dosed into water systems, to be developed. The application of the model should be dedicated to dosing aqueous solution of chlorine into swimming pools....

  18. Pool scrubbing and hydrodynamic experiment on jet injection regime

    Energy Technology Data Exchange (ETDEWEB)

    Peyres, V.; Espigares, M.M.; Polo, J.; Escudero, M.J.; Herranz, L.E.; Lopez, J.

    1995-07-01

    Plant analyses nave shown that pool scrubbing can play an important role in source term during PWR risk dominant sequences. An examination of boundary conditions governing fission products and aerosols transport through aqueous beds revealed that most of radioactivity is discharged into the pool under jet injection regime. This fact and the lack of experimental data under such conditions pointed the need of setting out an experimental programme which provided reliable experimental data to validate code models. In this report the major results of a pool scrubbing experimental programme carried out in PECA facility are presented. One of the major findings was that a remarkable fraction of particle absorption was not a function of the residence time of bubbles rising through the pool. Such a contribution was assumed to be associated to aerosol removal mechanism acting at the pool entrance. As a consequence. a hydrodynamic experimental plan was launched to examine the gas behaviour during the initial stages in the pool. Size and shape of gas nuclei in the pool were measured and fitted to a lognormal distribution. Particularly, size was found to be quite sensitive to inlet gas flow and at minor extent to gas composition and pool temperature. SPARC90 and BUSCA-AUG92 were used to simulate the retention tests. Whereas SPARC90 showed a pretty good agreement with experimental data, BUSCA-AUG92 results were far away from measurements in all the cases. SPARC90 consistency apparently pointed out the important role of fission products and aerosols retention at the injection zone; nonetheless, a peer examination of pool scrubbing phenomenology at the pool entrance should be carried out to test both hydrodynamic and removal models. Hence, one of the major high lights drawn from this work was the need of further research under representative severe accident conditions (i.e., saturated pools, jet injection regimes, etc.), as well as separate effect tests to validate, improve and

  19. Reserve growth in oil pools of Alberta: Model and forecast

    Science.gov (United States)

    Verma, M.; Cook, T.

    2010-01-01

    Reserve growth is recognized as a major component of additions to reserves in most oil provinces around the world, particularly in mature provinces. It takes place as a result of the discovery of new pools/reservoirs and extensions of known pools within existing fields, improved knowledge of reservoirs over time leading to a change in estimates of original oil-in-place, and improvement in recovery factor through the application of new technology, such as enhanced oil recovery methods, horizontal/multilateral drilling, and 4D seismic. A reserve growth study was conducted on oil pools in Alberta, Canada, with the following objectives: 1) evaluate historical oil reserve data in order to assess the potential for future reserve growth; 2) develop reserve growth models/ functions to help forecast hydrocarbon volumes; 3) study reserve growth sensitivity to various parameters (for example, pool size, porosity, and oil gravity); and 4) compare reserve growth in oil pools and fields in Alberta with those from other large petroleum provinces around the world. The reported known recoverable oil exclusive of Athabasca oil sands in Alberta increased from 4.5 billion barrels of oil (BBO) in 1960 to 17 BBO in 2005. Some of the pools that were included in the existing database were excluded from the present study for lack of adequate data. Therefore, the known recoverable oil increased from 4.2 to 13.9 BBO over the period from 1960 through 2005, with new discoveries contributing 3.7 BBO and reserve growth adding 6 BBO. This reserve growth took place mostly in pools with more than 125,000 barrels of known recoverable oil. Pools with light oil accounted for most of the total known oil volume, therefore reflecting the overall pool growth. Smaller pools, in contrast, shrank in their total recoverable volumes over the years. Pools with heavy oil (gravity less than 20o API) make up only a small share (3.8 percent) of the total recoverable oil; they showed a 23-fold growth compared to

  20. Seismic analysis of large pools

    Energy Technology Data Exchange (ETDEWEB)

    Dong, R.G.; Tokarz, F.J.

    1976-11-17

    Large pools for storing spent, nuclear fuel elements are being proposed to augment present storage capacity. To preserve the ability to isolate portions of these pools, a modularization requirement appears desirable. The purpose of this project was to investigate the effects of modularization on earthquake resistance and to assess the adequacy of current design methods for seismic loads. After determining probable representative pool geometries, three rectangular pool configurations, all 240 x 16 ft and 40 ft deep, were examined. One was unmodularized; two were modularized into 80 x 40 ft cells in one case and 80 x 80 ft cells in the other. Both embedded and above-ground installations for a hard site and embedded installations for an intermediate hard site were studied. It was found that modularization was unfavorable in terms of reducing the total structural load attributable to dynamic effects, principally because one or more cells could be left unfilled. The walls of unfilled cells would be subjected to significantly higher loads than the walls of a filled, unmodularized pool. Generally, embedded installations were preferable to above-ground installations, and the hard site was superior to the intermediate hard site. It was determined that Housner's theory was adequate for calculating hydrodynamic effects on spent fuel storage pools. Current design methods for seismic loads were found to be satisfactory when results from these methods were compared with those from LUSH analyses. As a design method for dynamic soil pressure, we found the Mononobe-Okabe theory, coupled with correction factors as suggested by Seed, to be acceptable. The factors we recommend for spent fuel storage pools are tabulated.

  1. Laser weld process monitoring and control using chromatic filtering of thermal radiation from a weld pool

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Cheol Jung; Kim, Min Suk; Baik, Sung Hoon; Chung, Chin Man

    2000-06-01

    The application of high power Nd: YAG lasers for precision welding in industry has been growing quite fast these days in diverse areas such as the automobile, the electronics and the aerospace industries. These diverse applications also require the new developments for the precise control and the reliable process monitoring. Due to the hostile environment in laser welding, a remote monitoring is required. The present development relates in general to weld process monitoring techniques, and more particularly to improved methods and apparatus for real-time monitoring of thermal radiation of a weld pool to monitor a size variation and a focus shift of the weld pool for weld process control, utilizing the chromatic aberration of focusing lens or lenses. The monitoring technique of the size variation and the focus shift of a weld pool is developed by using the chromatic filtering of the thermal radiation from a weld pool. The monitoring of weld pool size variation can also be used to monitor the weld depth in a laser welding. Furthermore, the monitoring of the size variation of a weld pool is independent of the focus shift of a weld pool and the monitoring of the focus shift of a weld pool is independent of the size variation of a weld pool.

  2. The readily releasable pool of synaptic vesicles.

    Science.gov (United States)

    Kaeser, Pascal S; Regehr, Wade G

    2017-04-01

    Each presynaptic bouton is densely packed with many vesicles, only a small fraction of which are available for immediate release. These vesicles constitute the readily releasable pool (RRP). The RRP size, and the probability of release of each vesicle within the RRP, together determine synaptic strength. Here, we discuss complications and recent advances in determining the size of the physiologically relevant RRP. We consider molecular mechanisms to generate and regulate the RRP, and discuss the relationship between vesicle docking and the RRP. We conclude that many RRP vesicles are docked, that some docked vesicles may not be part of the RRP, and that undocked vesicles can contribute to the RRP by rapid recruitment to unoccupied, molecularly activated ready-to-release sites. Copyright © 2017 Elsevier Ltd. All rights reserved.

  3. Current practice and perspectives in CRO oversight based on a survey performed among members of the German Association of Research-Based Pharmaceutical Companies (vfa).

    Science.gov (United States)

    Hennig, Michael; Hundt, Ferdinand; Busta, Susanne; Mikus, Stefan; Sanden, Per-Holger; Sörgel, Andrea; Ruppert, Thorsten

    2017-01-01

    In recent years, the number and scope of outsourced activities in the pharmaceutical industry have increased heavily. In addition, also the type of outsourcing has changed significantly in that time. This raises the question of whether and how sponsors retain the capability to select and to control the contract research organizations (CROs) involved and what expertise still has to be present in the development department as well as other relevant departments to ensure adequate oversight, also in line with the expectations of regulators and health authorities. In order to answer these questions, a survey was conducted among the German vfa member companies. The survey describes the latest developments and experiences in outsourcing by 18 German vfa member companies. It concentrates on measures how to implement Quality Assurance (QA) when performing outsourced clinical studies. This study shows that the majority of companies apply a full-outsourcing, preferred-provider model of clinical trial services, with the clinical research department playing the major role in this process. A large amount of guiding documents, processes and tools are used to ensure an adequate oversight of the services performed by the CRO(s). Finally the guiding principles for all oversight processes should be transparent communication, a clearly established expectation for quality, a precise definition of accountability and responsibility while avoiding silo mentality, and a comprehensive documentation of the oversight's evidence. For globally acting and outsourcing sponsors, oversight processes need to be aligned with regards to local and global perspectives. This survey shows that the current implementation of oversight processes in the participating companies covers all relevant areas to ensure highest quality and integrity of the data produced by the outsourced clinical trial.

  4. Current practice and perspectives in CRO oversight based on a survey performed among members of the German Association of Research-Based Pharmaceutical Companies (vfa

    Directory of Open Access Journals (Sweden)

    Hennig, Michael

    2017-01-01

    Full Text Available In recent years, the number and scope of outsourced activities in the pharmaceutical industry have increased heavily. In addition, also the type of outsourcing has changed significantly in that time. This raises the question of whether and how sponsors retain the capability to select and to control the contract research organizations (CROs involved and what expertise still has to be present in the development department as well as other relevant departments to ensure adequate oversight, also in line with the expectations of regulators and health authorities. In order to answer these questions, a survey was conducted among the German vfa member companies. The survey describes the latest developments and experiences in outsourcing by 18 German vfa member companies. It concentrates on measures how to implement Quality Assurance (QA when performing outsourced clinical studies.This study shows that the majority of companies apply a full-outsourcing, preferred-provider model of clinical trial services, with the clinical research department playing the major role in this process. A large amount of guiding documents, processes and tools are used to ensure an adequate oversight of the services performed by the CRO(s.Finally the guiding principles for all oversight processes should be transparent communication, a clearly established expectation for quality, a precise definition of accountability and responsibility while avoiding silo mentality, and a comprehensive documentation of the oversight’s evidence. For globally acting and outsourcing sponsors, oversight processes need to be aligned with regards to local and global perspectives. This survey shows that the current implementation of oversight processes in the participating companies covers all relevant areas to ensure highest quality and integrity of the data produced by the outsourced clinical trial.

  5. Current practice and perspectives in CRO oversight based on a survey performed among members of the German Association of Research-Based Pharmaceutical Companies (vfa)

    Science.gov (United States)

    Hennig, Michael; Hundt, Ferdinand; Busta, Susanne; Mikus, Stefan; Sanden, Per-Holger; Sörgel, Andrea; Ruppert, Thorsten

    2017-01-01

    In recent years, the number and scope of outsourced activities in the pharmaceutical industry have increased heavily. In addition, also the type of outsourcing has changed significantly in that time. This raises the question of whether and how sponsors retain the capability to select and to control the contract research organizations (CROs) involved and what expertise still has to be present in the development department as well as other relevant departments to ensure adequate oversight, also in line with the expectations of regulators and health authorities. In order to answer these questions, a survey was conducted among the German vfa member companies. The survey describes the latest developments and experiences in outsourcing by 18 German vfa member companies. It concentrates on measures how to implement Quality Assurance (QA) when performing outsourced clinical studies. This study shows that the majority of companies apply a full-outsourcing, preferred-provider model of clinical trial services, with the clinical research department playing the major role in this process. A large amount of guiding documents, processes and tools are used to ensure an adequate oversight of the services performed by the CRO(s). Finally the guiding principles for all oversight processes should be transparent communication, a clearly established expectation for quality, a precise definition of accountability and responsibility while avoiding silo mentality, and a comprehensive documentation of the oversight’s evidence. For globally acting and outsourcing sponsors, oversight processes need to be aligned with regards to local and global perspectives. This survey shows that the current implementation of oversight processes in the participating companies covers all relevant areas to ensure highest quality and integrity of the data produced by the outsourced clinical trial. PMID:28163667

  6. Effect of Maillard reaction products on ruminal and fecal acid-resistant E. coli, total coliforms, VFA profiles, and pH in steers.

    Science.gov (United States)

    Sindt, J J; Drouillard, J S; Thippareddi, H; Phebus, R K; Coetzer, C M; Kerr, K D; Lambert, D L; Farran, T B; Montgomery, S P; LaBrune, H J

    2004-04-01

    Six ruminally cannulated Angus-cross steers (362 kg) were used in a replicated 3 x 3 Latin square design to determine effects of supplementing Maillard reaction products (MRP) on acid-resistant E. coli and coliform populations. Steers were fed roughage-based diets supplemented (DM basis) with either 10% soybean meal (SBM), 10% nonenzymatically browned SBM (NESBM), or 10% SBM top-dressed with 45 g of a lysine-dextrose Maillard reaction product (LD-MRP). Equal weights of dextrose, lysine hydrochloride, and deionized water were refluxed to produce the LD-MRP. The NESBM was manufactured by treating SBM with invertase enzyme, followed by heating to induce nonenzymatic browning. Steers were allowed slightly less than ad libitum access to diets fed twice daily and were adapted to their respective treatments within 10 d. On d 11, ruminal and fecal samples were collected at 0, 2, 4, 6, 8, and 12 h after feeding from each of the steers and transported to the laboratory for microbial analysis. Ruminal samples and feces were analyzed for pH and VFA, and both ruminal fluid and feces were tested for acid-resistant E. coli and total coliforms by incubating samples in tryptic soy broth adjusted to pH 2, 4, and 7. Ruminal pH and total VFA concentrations did not differ among treatments. The molar proportion of ruminal acetate was higher (P coliforms than steers that received SBM. No differences were observed for ruminal E. coli and total coliforms at pH 2 and 7. Fecal pH was lower (P coliforms at pH 2 and 7 did not differ among treatments. Dietary MRP had limited effectiveness at decreasing acid-resistant coliforms in the rumen and feces of cattle. Acid resistance in coliforms may depend on protein availability.

  7. Swimming Pools. Managing School Facilities, Guide 2.

    Science.gov (United States)

    Department for Education and Employment, London (England). Architects and Building Branch.

    This guide for schools with swimming pools offers advice concerning appropriate training for pool managers, the importance of water quality and testing, safety in the handling of chemicals, maintenance and cleaning requirements, pool security, and health concerns. The guide covers both indoor and outdoor pools, explains some technical terms,…

  8. 47 CFR 13.215 - Question pools.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 1 2010-10-01 2010-10-01 false Question pools. 13.215 Section 13.215... Question pools. The question pool for each written examination element will be composed of questions acceptable to the FCC. Each question pool must contain at least five (5) times the number of questions...

  9. 47 CFR 97.523 - Question pools.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Question pools. 97.523 Section 97.523... SERVICE Qualifying Examination Systems § 97.523 Question pools. All VECs must cooperate in maintaining one question pool for each written examination element. Each question pool must contain at least 10 times the...

  10. Patent pools: Intellectual property rights and competition.

    NARCIS (Netherlands)

    Rodriguez, V.F.

    2010-01-01

    Patent pools do not correct all problems associated with patent thickets. In this respect, patent pools might not stop the outsider problem from striking pools. Moreover, patent pools can be expensive to negotiate, can exclude patent holders with smaller numbers of patents or enable a group of major

  11. Patent pools: Intellectual property rights and competition

    NARCIS (Netherlands)

    Rodriguez, V.

    2010-01-01

    Patent pools do not correct all problems associated with patent thickets. In this respect, patent pools might not stop the outsider problem from striking pools. Moreover, patent pools can be expensive to negotiate, can exclude patent holders with smaller numbers of patents or enable a group of major

  12. 21 CFR 1250.89 - Swimming pools.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Swimming pools. 1250.89 Section 1250.89 Food and... SANITATION Sanitation Facilities and Conditions on Vessels § 1250.89 Swimming pools. (a) Fill and draw swimming pools shall not be installed or used. (b) Swimming pools of the recirculation type shall be...

  13. Sculpting the Barnyard Gene Pool

    Science.gov (United States)

    Childers, Gina; Wolfe, Kim; Dupree, Alan; Young, Sheila; Caver, Jessica; Quintanilla, Ruby; Thornton, Laura

    2016-01-01

    Project-based learning (PBL) takes student engagement to a higher level through reflective collaboration, inquiry, critical thinking, problem solving, and personal relevance. This article explains how six high school teachers developed an interconnected, interdisciplinary STEM-focused PBL called "Sculpting the Barnyard Gene Pool." The…

  14. Rank Pooling for Action Recognition

    NARCIS (Netherlands)

    Fernando, B.; Gavves, E.; Oramas M., J.; Ghodrati, A.; Tuytelaars, T.

    We propose a function-based temporal pooling method that captures the latent structure of the video sequence data - e.g., how frame-level features evolve over time in a video. We show how the parameters of a function that has been fit to the video data can serve as a robust new video representation.

  15. Measurements in large JP-4 pool fires

    Energy Technology Data Exchange (ETDEWEB)

    Keltner, N.R.; Kent, L.A.; Schneider, M.E.

    1987-01-01

    Over the past four years, Sandia National Laboratories has conducted a number of large pool fire tests to evaluate the design of radioactive material (RAM) shipping containers. Some of these tests have been designed to define the thermal environment and some have been used for certification testing. In each test there have been a number of fire diagnostic measurements. The simplest sets of diagnostics have involved measurements of temperature at several elevations on arrays of towers, measurements of hot wall heat flux with small calorimeters suspended from the towers, the average fuel recession rate, and the wind speed and direction. The most complex sets of diagnostics have included the above and in various tests added radiometers in the lower flame zone, centerline velocity measurements at a number of elevations, radiometers and calorimeters at the fuel surface, large cylindrical and flat plate calorimeters, infrared imaging, time resolved fuel recession rates, and a variety of soot particle concentration and size measurements made in the plume with a tethered balloon and an instrumented airplane. All of the large fires have been conducted in a 9.1 m by 18.3 m pool using JP-4 as the fuel. Typical duration is one-half hour. Covering all of the results is beyond the scope of a single paper. Conditionally sampled temperature and velocity measurements from one fire will be presented; for this fire, a 20 cm layer of fuel was floated on 61 cm of water. Pool surface heat flux, fuel recession rate data, and smoke emission data from a second fire are given. Because the wind has a strong effect on the temperature and velocity measurements, conditional sampling has been used to try to obtain data during periods of low winds. 10 refs., 3 figs.

  16. Metal vaporization from weld pools

    Science.gov (United States)

    Block-Bolten, A.; Eagar, T. W.

    1984-09-01

    Experimental studies of alloy vaporization from aluminum and stainless steel weld pools have been made in order to test a vaporization model based on thermodynamic data and the kinetic theory of gases. It is shown that the model can correctly predict the dominant metal vapors that form but that the absolute rate of vaporization is not known due to insufficient knowledge of the surface temperature distribution and subsequent condensation of the vapor in the cooler regions of the metal. Values of the net evaporation rates for different alloys have been measured and are found to vary by two orders of magnitude. Estimated maximum weld pool temperatures based upon the model are in good agreement with previous experimental measurements of electron beam welds.

  17. An interdepartmental, standardized equipment pool.

    Science.gov (United States)

    Fahlstrøm, Elisabeth; Grimnes, Sverre; Johannejen, Nann Helene

    2006-03-01

    To solve problems concerning patient equipment with emphasis on patient care, nursing quality and better nursing management. A monitoring system, designed to follow the patient around in the hospital was discovered. Based on this concept a special, standardized pool system managed by the Clinical Engineering Department was developed. An all-department standardization of monitors and pumps was tried. With pumps it was a success. With monitors, two of 21 departments preferred non-standardized equipment. The equipment pool has successfully been run for 5 years. An evaluation showed that nursing care is better and that only 2% of those asked disapproved of the system. The pool eliminated problems like lack of equipment when needed, the wrong type of equipment found, lack of fitting disposables, the items that could be found being out of order or too dirty to be used. Nurses no longer waste time searching for equipment ready for use. Bedside equipment in working order can always be found in one of the storerooms. As a result, patient safety was greatly enhanced. We also show that this is economically a good system.

  18. An evaluation of different target enrichment methods in pooled sequencing designs for complex disease association studies.

    Directory of Open Access Journals (Sweden)

    Aaron G Day-Williams

    Full Text Available Pooled sequencing can be a cost-effective approach to disease variant discovery, but its applicability in association studies remains unclear. We compare sequence enrichment methods coupled to next-generation sequencing in non-indexed pools of 1, 2, 10, 20 and 50 individuals and assess their ability to discover variants and to estimate their allele frequencies. We find that pooled resequencing is most usefully applied as a variant discovery tool due to limitations in estimating allele frequency with high enough accuracy for association studies, and that in-solution hybrid-capture performs best among the enrichment methods examined regardless of pool size.

  19. 7 CFR 1007.7 - Pool plant.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Pool plant. 1007.7 Section 1007.7 Agriculture... Handling Definitions § 1007.7 Pool plant. Pool plant means a plant specified in paragraphs (a) through (d) of this section, a unit of plants as specified in paragraph (e) of this section, or a plant specified...

  20. 7 CFR 1033.7 - Pool plant.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Pool plant. 1033.7 Section 1033.7 Agriculture... Handling Definitions § 1033.7 Pool plant. Pool plant means a plant, unit of plants, or system of plants as specified in paragraphs (a) through (f) of this section, or a plant specified in paragraph (j) of this...

  1. 7 CFR 1131.7 - Pool plant.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Pool plant. 1131.7 Section 1131.7 Agriculture... Handling Definitions § 1131.7 Pool plant. Pool Plant means a plant or unit of plants specified in paragraphs (a) through (e) of this section, but excluding a plant specified in paragraph (g) of this section...

  2. 7 CFR 1126.7 - Pool plant.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Pool plant. 1126.7 Section 1126.7 Agriculture... Handling Definitions § 1126.7 Pool plant. Pool plant means a plant specified in paragraphs (a) through (d) of this section, a unit of plants as specified in paragraph (e) of this section, or a plant specified...

  3. 7 CFR 1005.7 - Pool plant.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Pool plant. 1005.7 Section 1005.7 Agriculture... Handling Definitions § 1005.7 Pool plant. Pool plant means a plant specified in paragraphs (a) through (d) of this section, a unit of plants as specified in paragraph (e) of this section, or a plant specified...

  4. 7 CFR 1030.7 - Pool plant.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Pool plant. 1030.7 Section 1030.7 Agriculture... Handling Definitions § 1030.7 Pool plant. Pool plant means a plant, unit of plants, or system of plants as specified in paragraphs (a) through (f) of this section, but excluding a plant specified in paragraph (h) of...

  5. 7 CFR 1006.7 - Pool plant.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Pool plant. 1006.7 Section 1006.7 Agriculture... Handling Definitions § 1006.7 Pool plant. Pool plant means a plant specified in paragraphs (a) through (d) of this section, a unit of plants as specified in paragraph (e) of this section, or a plant specified...

  6. 7 CFR 1032.7 - Pool plant.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Pool plant. 1032.7 Section 1032.7 Agriculture... Handling Definitions § 1032.7 Pool plant. Pool plant means a plant, unit of plants, or system of plants as specified in paragraphs (a) through (f) of this section, or a plant specified in paragraph (i) of this...

  7. 7 CFR 1124.7 - Pool plant.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Pool plant. 1124.7 Section 1124.7 Agriculture... Regulating Handling Definitions § 1124.7 Pool plant. Pool plant means a plant, unit of plants, or a system of plants as specified in paragraphs (a) through (f) of this section, but excluding a plant specified in...

  8. 7 CFR 1001.7 - Pool plant.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Pool plant. 1001.7 Section 1001.7 Agriculture... Handling Definitions § 1001.7 Pool plant. Pool plant means a plant, unit of plants, or system of plants as specified in paragraphs (a) through (f) of this section, but excluding a plant described in paragraph (h) of...

  9. An Infraspec VFA-IR spectrometer analysis of Trans-fat content in glazed donuts purchased from supermarkets, convenience stores and bakeries

    Directory of Open Access Journals (Sweden)

    Sharron Jenkins

    2015-05-01

    Full Text Available Most packaged food products must contain trans-fat labelling; however unpackaged snacks such as cookies, donuts, and muffins at supermarkets, gas station convenience stores, and bakeries often do not have or require nutrition fact labels. Hence, consumers are not aware of the trans-fat content in unpackaged food products. It is well-known within the health and scientific community that diets high in trans-fat can lead to a host of health problems, namely coronary heart disease (CHD. The purpose of this study is to conduct a preliminary study of the trans-fat content in unpackaged baked goods, particularly unpackaged glazed donuts. To accomplish our objective, we determined the % trans-fat in oil extracted from glazed donuts obtained from several supermarkets, gas stations and bakeries across Northwest, Indiana. Variable Filter Array (VFA IR spectroscopy was used to assess the trans-fat content of oil extracted from food samples. In this paper, we present our preliminary findings.

  10. Laboratory investigation and simulation of breakthrough curves in karst conduits with pools

    Science.gov (United States)

    Zhao, Xiaoer; Chang, Yong; Wu, Jichun; Peng, Fu

    2017-07-01

    A series of laboratory experiments are performed under various hydrological conditions to analyze the effect of pools in pipes on breakthrough curves (BTCs). The BTCs are generated after instantaneous injections of NaCl tracer solution. In order to test the feasibility of reproducing the BTCs and obtain transport parameters, three modeling approaches have been applied: the equilibrium model, the linear graphical method and the two-region nonequilibrium model. The investigation results show that pools induce tailing of the BTCs, and the shapes of BTCs depend on pool geometries and hydrological conditions. The simulations reveal that the two-region nonequilibrium model yields the best fits to experimental BTCs because the model can describe the transient storage in pools by the partition coefficient and the mass transfer coefficient. The model parameters indicate that pools produce high dispersion. The increased tailing occurs mainly because the partition coefficient decreases, as the number of pools increases. When comparing the tracer BTCs obtained using the two types of pools with the same size, the more appreciable BTC tails that occur for symmetrical pools likely result mainly from the less intense exchange between the water in the pools and the water in the pipe, because the partition coefficients for the two types of pools are virtually identical. Dispersivity values decrease as flow rates increase; however, the trend in dispersion is not clear. The reduced tailing is attributed to a decrease in immobile water with increasing flow rate. It provides evidence for hydrodynamically controlled tailing effects.

  11. 48 CFR 9.703 - Contracting with individual pool members.

    Science.gov (United States)

    2010-10-01

    ... individual pool members. 9.703 Section 9.703 Federal Acquisition Regulations System FEDERAL ACQUISITION... Development Pools 9.703 Contracting with individual pool members. (a) Pool members may submit individual... by a pool member if that pool member participates in a competing offer submitted by the pool. (b) If...

  12. Demographic factors shaped diversity in the two gene pools of wild common bean Phaseolus vulgaris L.

    Science.gov (United States)

    Mamidi, S; Rossi, M; Moghaddam, S M; Annam, D; Lee, R; Papa, R; McClean, P E

    2013-01-01

    Wild common bean (Phaseolus vulgaris L.) is distributed throughout the Americas from Mexico to northern Argentina. Within this range, the species is divided into two gene pools (Andean and Middle American) along a latitudinal gradient. The diversity of 24 wild common bean genotypes from throughout the geographic range of the species was described by using sequence data from 13 loci. An isolation–migration model was evaluated using a coalescent analysis to estimate multiple demographic parameters. Using a Bayesian approach, Andean and Middle American subpopulations with high percentage of parentages were observed. Over all loci, the Middle American gene pool was more diverse than the Andean gene pool (πsil=0.0089 vs 0.0068). The two subpopulations were strongly genetically differentiated over all loci (Fst=0.29). It is estimated that the two current wild gene pools diverged from a common ancestor ∼111 000 years ago. Subsequently, each gene pool underwent a bottleneck immediately after divergence and lasted ∼40 000 years. The Middle American bottleneck population size was ∼46% of the ancestral population size, whereas the Andean was 26%. Continuous asymmetric gene flow was detected between the two gene pools with a larger number of migrants entering Middle American gene pool from the Andean gene pool. These results suggest that because of the complex population structure associated with the ancestral divergence, subsequent bottlenecks in each gene pool, gene pool-specific domestication and intense selection within each gene pool by breeders; association mapping would best be practised within each common bean gene pool. PMID:23169559

  13. Variability and Expansion of the Tropical Ocean Warm Pool

    Science.gov (United States)

    Hoyos, C. D.; Webster, P. J.

    2007-12-01

    doubles in size from the observed values in the 21st century. We explore the changes in the column integrated heating in the different CMIP3 integration scenarios to see if the threshold between columnar heating and cooling changes to higher temperatures and whether there will be linear or nonlinear transitions. Results suggest the existence of important changes in the zonal and meridional circulation in the Atlantic, Pacific and Indian Ocean in association with the expansion of the tropical warm pool. We also show an example of how the expansion of the tropical warm pool not only has effects on the atmospheric general circulations but also in the dynamics and sustainability of the marine biodiversity. Corals for example are highly sensitive to temperature increase and could face extensive bleaching under the expansion of the tropical warm pool.

  14. Large-scale pool fires

    Directory of Open Access Journals (Sweden)

    Steinhaus Thomas

    2007-01-01

    Full Text Available A review of research into the burning behavior of large pool fires and fuel spill fires is presented. The features which distinguish such fires from smaller pool fires are mainly associated with the fire dynamics at low source Froude numbers and the radiative interaction with the fire source. In hydrocarbon fires, higher soot levels at increased diameters result in radiation blockage effects around the perimeter of large fire plumes; this yields lower emissive powers and a drastic reduction in the radiative loss fraction; whilst there are simplifying factors with these phenomena, arising from the fact that soot yield can saturate, there are other complications deriving from the intermittency of the behavior, with luminous regions of efficient combustion appearing randomly in the outer surface of the fire according the turbulent fluctuations in the fire plume. Knowledge of the fluid flow instabilities, which lead to the formation of large eddies, is also key to understanding the behavior of large-scale fires. Here modeling tools can be effectively exploited in order to investigate the fluid flow phenomena, including RANS- and LES-based computational fluid dynamics codes. The latter are well-suited to representation of the turbulent motions, but a number of challenges remain with their practical application. Massively-parallel computational resources are likely to be necessary in order to be able to adequately address the complex coupled phenomena to the level of detail that is necessary.

  15. Renewal of the separate type pool gate

    Energy Technology Data Exchange (ETDEWEB)

    Ohhashi, Nobuyoshi; Izumo, Hironobu; Kameyama, Iwao; Isaka, Masaki; Nakamura, Kiyoshi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Monden, Yoshihiro; Tazura, Akio

    1999-10-01

    As a part of the modification of JRR-4, the pool gate was renewed. The pool gate is separated into two parts with packing on the both contact faces, and holds the pool water by the pressure caused by a difference of the water levels. The structure and the principle are so simple that treatment of the pool gate is easy. However, it is very difficult to secure the watertight performance of this gate type. Because the uneven and meandering easily occurred in the surface of the packing, in the former pool gate leakage of the pool water from the separate parts of the gate often occurred. Besides, the selection width of rubber material to conform was very small. In renewal of the pool gate, the mock-up experiment of the packing parts was performed. Based on the results, the new pool gate was designed and installed. The new seal structure developed for the new gate was confirmed to have a high watertight performance even under the condition of very low pool water level. And the loads which hung on the packing is decreased in the new developed packing structure. High watertight performance of the new pool gate was confirmed by the leak tests after installation. This report gives the development of the new pool gate with high watertight performance and the construction of it. (author)

  16. PRELIMINARY STUDY OF FISH CULTURE IN ABANDONED SAND MINING POOL

    Directory of Open Access Journals (Sweden)

    Bambang Gunadi

    2006-12-01

    Full Text Available One of main problems in freshwater aquaculture development in Indonesia, especially in Java, is unavailability of developing zone. It is important to find an underutilized area that meets for industrial scale freshwater aquaculture, i.e. sufficient water supply, wide area, and located in one area or zone. The abandoned mining (sand, tin, etc. pools distributed along the country might be the potential area for freshwater aquaculture business. For example, there are at least 13 water pools with total surface area of 250 ha at 15 km side of Citarum River in Karawang District (West Java Province. This study was conducted to obtain preliminary data about the prospect and potency of fish culture (tilapia, clariid catfish, and ‘patin’ catfish in abandoned sand-mining pools in Karawang District. Mini floating net cages of 1 x 1 x 1.5 m3 size were used for culturing fish, i.e. patin catfish (Pangasianodon hypophthalmus, nile tilapia (Oreochromis niloticus, and clariid catfish (Clarias gariepinus, separately. Patin catfish were stocked at a size of 2 g with a density of 300 fish per cage, tilapia were stocked at a size of 6 g with a density of 400 fish per cage, while  the clariid catfish were stocked at a size of 1.4 g with a density of 980 fish per cage. A floating commercial feed (30%—32% protein, 3%—5% fat was used at a daily rate of 9% biomass weight at the beginning and reduced gradually to 3% at the final culture period. Observed data showed that patin catfish grew from the initial size of 2.08 g to the final size 299.59 g in 5 months, nile tilapia grew from individual initial size of 5.92 g to the final size of 247.12 g in 14 weeks, and clariid catfish grew from initial size of 1.39 g to the final size of 73.10 g in 8 weeks. These three species were technically prospective for aquaculture development in the abandoned sand-mining pools.

  17. Pool fencing for preventing drowning in children.

    Science.gov (United States)

    Thompson, D C; Rivara, F P

    2000-01-01

    In most industrialized countries, drowning ranks second or third behind motor vehicles and fires as a cause of unintentional injury deaths to children under the age of 15. Death rates from drowning are highest in children less than five years old. Pool fencing is a passive environmental intervention designed to reduce unintended access to swimming pools and thus prevent drowning in the preschool age group. Because of the magnitude of the problem and the potential effectiveness of fencing we decided to evaluate the effect of pool fencing as a drowning prevention strategy for young children. To determine if pool fencing prevents drowning in young children. We used Cochrane Collaboration search strategy of electronic databases, searched reference lists of past reviews and review articles, Cochrane International Register of RCT's, studies from government agencies in the United States and Australia, and contacted colleagues from International Society for Child and Adolescent Injury Prevention, World Injury Network, and CDC funded Injury Control and Research Centers. In order to be selected a study had to be designed to evaluate pool fencing in a defined population and provide relevant and interpretable data which objectively measured the risk of drowning or near drowning or provided rates of these outcomes in fenced and unfenced pools. The completed studies meeting selection criteria employed a case-control design. No randomized controlled studies have been identified. Three published studies met selection criteria. Data were extracted by two reviewers using standard abstract form. Odds ratios with 95% CI, and incidence rates, were calculated for drowning and near-drowning. Attributable Risk percent (AR%) was calculated to report the reduction in drowning due to pool fencing. Case control studies which evaluate pool fencing interventions indicate that pool fencing significantly reduces the risk of drowning. Odds ratio for the risk of drowning or near drowning in a

  18. Large pool LMFBR design. Final report. Volume 1

    Energy Technology Data Exchange (ETDEWEB)

    Wett, J. F.; Churchill, J. R.

    1979-03-01

    The design effort reported is an extension on past design effort and continuous concentration on those parts of the nuclear island unique to a commercial size pool type LMFBR. In particular, the work covers the reactor vessel, deck, rotating plugs, upper and lower internals, internal plenum separator system, IHX, pumps, cold traps, intermediate system layout, containment/confinement system, plot plan, and residual heat removal systems. Preliminary thermal, hydraulic, stress, and system analyses are also presented.

  19. Radioisotope Power System Pool Concept

    Science.gov (United States)

    Rusick, Jeffrey J.; Bolotin, Gary S.

    2015-01-01

    Advanced Radioisotope Power Systems (RPS) for NASA deep space science missions have historically used static thermoelectric-based designs because they are highly reliable, and their radioisotope heat sources can be passively cooled throughout the mission life cycle. Recently, a significant effort to develop a dynamic RPS, the Advanced Stirling Radioisotope Generator (ASRG), was conducted by NASA and the Department of Energy, because Stirling based designs offer energy conversion efficiencies four times higher than heritage thermoelectric designs; and the efficiency would proportionately reduce the amount of radioisotope fuel needed for the same power output. However, the long term reliability of a Stirling based design is a concern compared to thermoelectric designs, because for certain Stirling system architectures the radioisotope heat sources must be actively cooled via the dynamic operation of Stirling converters throughout the mission life cycle. To address this reliability concern, a new dynamic Stirling cycle RPS architecture is proposed called the RPS Pool Concept.

  20. A unified model of coupled arc plasma and weld pool for double electrodes TIG welding

    Science.gov (United States)

    Wang, Xinxin; Fan, Ding; Huang, Jiankang; Huang, Yong

    2014-07-01

    A three-dimensional model containing tungsten electrodes, arc plasma and a weld pool is presented for double electrodes tungsten inert gas welding. The model is validated by available experimental data. The distributions of temperature, velocity and pressure of the coupled arc plasma are investigated. The current density, heat flux and shear stress over the weld pool are highlighted. The weld pool dynamic is described by taking into account buoyance, Lorentz force, surface tension and plasma drag force. The turbulent effect in the weld pool is also considered. It is found that the temperature and velocity distributions of the coupled arc are not rotationally symmetrical. A similar property is also shown by the arc pressure, current density and heat flux at the anode surface. The surface tension gradient is much larger than the plasma drag force and dominates the convective pattern in the weld pool, thus determining the weld penetration. The anodic heat flux and plasma drag force, as well as the surface tension gradient over the weld pool, determine the weld shape and size. In addition, provided the welding current through one electrode increases and that through the other decreases, keeping the total current unchanged, the coupled arc behaviour and weld pool dynamic change significantly, while the weld shape and size show little change. The results demonstrate the necessity of a unified model in the study of the arc plasma and weld pool.

  1. Just like the lottery? Player behaviour and anomalies in the market for football pools.

    Science.gov (United States)

    Forrest, David; Pérez, Levi

    2015-06-01

    Football pools were an antecedent to lotto in providing a long-odds, high-prize gambling opportunity for a mass market in Europe. Even after lotto has become well established, pools games continue to occupy a significant niche in the gaming market in several jurisdictions, most notably Spain. This paper employs 23 years of sales data from the national pools game in Spain to investigate similarities between the behaviour of lotto players and pools players. It observes similar phenomena as have been noted in lotto sales studies, including strong sensitivity of sales to the size of jackpot on offer, significant habit effects, a halo effect whereby there is some short-term persistence in increased sales whenever a high jackpot is offered (even after jackpot size has returned to normal), and a tendency to jackpot fatigue (over time, the size of the jackpot has to be increased to more than before to stimulate the same increase in sales). Notwithstanding that the football pools are marketed as based on knowledge and understanding of sport whereas lotto is a pure numbers game, modelling sales of the pools therefore yields findings very similar to those reported in the literature on lotto. This suggests that both sets of players share common psychological and cognitive traits and economic motivation. Those responsible for promoting pools should therefore be able to draw on findings from the much more extensive literature on lotto when formulating strategy in terms of game design and marketing.

  2. Machine learning approach for pooled DNA sample calibration.

    Science.gov (United States)

    Hellicar, Andrew D; Rahman, Ashfaqur; Smith, Daniel V; Henshall, John M

    2015-07-09

    Despite ongoing reduction in genotyping costs, genomic studies involving large numbers of species with low economic value (such as Black Tiger prawns) remain cost prohibitive. In this scenario DNA pooling is an attractive option to reduce genotyping costs. However, genotyping of pooled samples comprising DNA from many individuals is challenging due to the presence of errors that exceed the allele frequency quantisation size and therefore cannot be simply corrected by clustering techniques. The solution to the calibration problem is a correction to the allele frequency to mitigate errors incurred in the measurement process. We highlight the limitations of the existing calibration solutions such as the fact they impose assumptions on the variation between allele frequencies 0, 0.5, and 1.0, and address a limited set of error types. We propose a novel machine learning method to address the limitations identified. The approach is tested on SNPs genotyped with the Sequenom iPLEX platform and compared to existing state of the art calibration methods. The new method is capable of reducing the mean square error in allele frequency to half that achievable with existing approaches. Furthermore for the first time we demonstrate the importance of carefully considering the choice of training data when using calibration approaches built from pooled data. This paper demonstrates that improvements in pooled allele frequency estimates result if the genotyping platform is characterised at allele frequencies other than the homozygous and heterozygous cases. Techniques capable of incorporating such information are described along with aspects of implementation.

  3. Theoretical assessment of particle generation from sodium pool fires

    Energy Technology Data Exchange (ETDEWEB)

    Garcia, M., E-mail: monica.gmartin@ciemat.es [CIEMAT, Unit of Nuclear Safety Research, Av. Complutense, 40, 28040 Madrid (Spain); Herranz, L.E., E-mail: luisen.herranz@ciemat.es [CIEMAT, Unit of Nuclear Safety Research, Av. Complutense, 40, 28040 Madrid (Spain); Kissane, M.P., E-mail: Martin.KISSANE@oecd.org [Nuclear Safety Technology and Regulation Division, OECD Nuclear Energy Agency (NEA), 46 quai Alphonse Le Gallo, 92100 Boulogne-Billancourt (France)

    2016-12-15

    Highlights: • Development of particle generation model for sodium-oxides aerosol formation. • Development of partially validated numerical simulations to build up maps of saturation ratio. • Nucleation of supersaturated vapours as relevant source of aerosols over sodium pools. • Prediction of high concentrations of primary particles in the combustion zone. - Abstract: Potential sodium discharge in the containment during postulated Beyond Design Basis Accidents (BDBAs) in Sodium-cooled Fast Reactors (SFRs) would have major consequences for accident development in terms of energetics and source term. In the containment, sodium vaporization and subsequent oxidation would result in supersaturated oxide vapours that would undergo rapid nucleation creating toxic aerosols. Therefore, modelling this vapour nucleation is essential to proper source term assessment in SFRs. In the frame of the EU-JASMIN project, a particle generation model to calculate the particle generation rate and their primary size during an in-containment sodium pool fire has been developed. Based on a suite of individual models for sodium vaporization, oxygen natural circulation (3D modelling), sodium-oxygen chemical reactions, sodium-oxides-vapour nucleation and condensation, its consistency has been partially validated by comparing with available experimental data. As an outcome, large temperature and vapour concentration gradients set over the sodium pool have been found which result in large particle concentrations in the close vicinity of the pool.

  4. SAFETY AND MANAGEMENT OF SWIMING POOLS

    OpenAIRE

    Cemal GÜNDOĞDU; EKENCİ, GÜNER; Tekin COLAKOGLU

    2008-01-01

    In this study,it was investigated the situation related to the safety and management of swimming pools belongs to municipality This study was planned to determine the present situation related to the safety and management of open,half-olympic and closed swimming pools which are especially used for sports activities,to find out the deficiencies in practise and to overcome these.Our study included totally 80 open,closed,olympic, half-olympic public swimming pools(the pools that belongs to munic...

  5. The warm pool in the Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Vinayachandran, P.N.; Shetye, S

    is larger and warmer, a peculiarity of the pool in the Indian Ocean is its seasonal variation. The surface area of the pool changes from 24 x 106 km2 in April to 8 x 106 km2 in September due to interaction with the southwest monsoon. The annual cycles of sea...

  6. Shedding Light on Dark Liquidity Pools

    NARCIS (Netherlands)

    Degryse, H.A.; van Achter, M.; Wuyts, G.

    2008-01-01

    This article reviews the recent developments on dark liquidity pools starting from the theoretical and empirical academic literature. The number of dark liquidity pools as well as their trading volume has grown substantially in the last couple of years. We highlight the incentives of providers as

  7. Microbial quality of a marine tidal pool

    CSIR Research Space (South Africa)

    Genthe, Bettina

    1995-01-01

    Full Text Available tidal pool water was compared to South African and other marine water quality guidelines. The microbial quality of a marine tidal pool on South Africa's Atlantic coast was found to be inferior to that of the adjoining seawater (the latter Complying...

  8. The Chemistry of Swimming Pool Maintenance

    Science.gov (United States)

    Salter, Carl; Langhus, David L.

    2007-01-01

    The study of chemistry involved in the maintenance of a swimming pool provides a lot of chemical education to the students, including the demonstration of the importance of pH in water chemistry. The various chemical aspects hidden in the maintenance of the pool are being described.

  9. Sulfur cycling in two Dutch moorland pools

    NARCIS (Netherlands)

    Marnette, E.C.L.

    1993-01-01

    Due to atmospheric acid deposition, the chemistry of many moorland pools has changed, resulting in changes in their fauna and flora. Most moorland pools are sensitive to acid loading because underlying and surrounding soils are low in chemical buffering capacity. Biological processes in the

  10. 13 CFR 120.1708 - Pool Certificates.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Pool Certificates. 120.1708 Section 120.1708 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Establishment... amount of a Pool Certificate cannot be less than a minimum amount as specified in the Guide, and the...

  11. Greenhouse Gas Fluxes from Peatland Pools

    Science.gov (United States)

    Turner, E.; Baird, A. J.; Billett, M. F.; Chapman, P. J.; Dinsmore, K. J.; Holden, J.

    2015-12-01

    Peatlands contain around one third of the global soil carbon (C) stock. Understanding the processes in peatland C cycling, and in particular those involved in the release of the greenhouse gases (GHGs) CO2 and CH4 to the atmosphere, is a current research priority. Natural open-water pools are a common feature of many peatlands, and previous research suggests pools can be strong sources of atmospheric GHGs, particularly CH4, and thus have the potential to play an important role in global radiative forcing. The area of open-water in peatlands is rapidly expanding in a warming Arctic (e.g. Walter et al., 2007) while artificially created pools are becoming more commonplace in the recent drive to restore the hydrological functioning of drained peatlands by blocking ditches. We present the results of >2 years of comprehensive field monitoring from pool complexes in the Flow Country of northern Scotland, the largest expanse (c.4000 km2) of blanket bog in Europe. Concentrations and fluxes of CO2 and CH4 are presented from 12 intensively monitored pools and the adjacent terrestrial surface. We examined both natural (n = 6) and artificial (n = 6) pools, which allowed us to quantify how pools created during restoration compare to undisturbed sites. C and hydrology budgets were determined for the study pools and the adjacent terrestrial surface. Dissolved concentrations of GHGs ranged from 0.08-4.68 mg CO2-C L-1 and 0.01-731 µg CH4-C L-1 in natural pools, and 0.29-10.38 mg CO2-C L-1 and 0.04-239 µg CH4-C L-1 in artificial pools. GHG fluxes from natural pool surfaces ranged between -2.47-653 mg CH4 m-2 d-1 and -31.7-14.8 g CO2 m-2 d-1. Artificial pool GHG fluxes were -8.19-581 mg CH4 m-2 d-1 and -7.66-34.9 g CO2 m-2 d-1. We provide more accurate GHG budgets for peatlands with natural pool complexes by considering their relative importance at the landscape-scale, and outline the potential effect on GHG fluxes when creating artificial pools during peatland restoration

  12. Ripples in a superconducting tidal pool

    CERN Document Server

    Hudson, E

    2003-01-01

    The behaviour of electrons in a metal is often compared to that of water in a pool. An empty pool is like a material that has all of its electrons removed. As electrons are 'poured' into the metal, they first occupy the lowest energies available - the bottom of the pool - and eventually fill up to the Fermi energy, the top of the pool. At this point we no longer discuss electrons but quasiparticles. These are electrons that have modified properties due to their interactions within the material. Waves in a pool can be excited, and their properties will depend on the depth of the water. Similarly in a metal, quasiparticles behave like waves that have a material-dependent dispersion relation between their energy and their wavevector, which specifies their direction and wavelength. This simple analogy also hints at an indirect method of measuring the dispersion relation of a metal, and hence the myriad of properties that depend on it. (U.K.)

  13. pH and VFA

    African Journals Online (AJOL)

    Dr.Choi

    2012-07-10

    Jul 10, 2012 ... 3Department of Companion Animal and Animal Resources Sciences, Joongbu University, Kumsan-gun 312-702, South. Korea. ... The treatments included an untreated control, 100 g of alum ... amendments (P < 0.05) in the litter over time compared with the controls except for NH3 emissions at 1 through 3 ...

  14. Carbon and nitrogen pools in soil aggregates separated by dry and wet sieving methods

    Science.gov (United States)

    Soil aggregation influences conservation and mineralization of C and N but aggregate separation method may influence levels of aggregate size distribution and quantification of C and N pools. Aggregate size distribution and soil organic C (SOC), soil total N (STN), particulate organic C and N (POC a...

  15. The depletion of the human resources pool in South Africa

    Directory of Open Access Journals (Sweden)

    J. Du Preez

    2002-12-01

    Full Text Available The brain drain has become one of the dominant realities within the South African economy. The official emigration statistics from South African sources inadvertently minimizes the seriousness of the threat, but emigration figures received from foreign countries are indicative of the size of the problem. Emigration, however, is not the only cause for the depletion of the human resource pool. Internal migration, pseudo-emigration and the influx of unskilled workers also negatively effect the composition of the human resource provision in the country. Murder, HIV/AIDS and related diseases severely impact industry and will increasingly contribute to the brain drain. A radical reduction of the skilled work force and a dramatic shift in the composition of the human resource pool towards unskilled labour negatively impact on industry and inhibits South Africa's ability to compete effectively in an increasingly global market.

  16. Pool scrubbing models for iodine components

    Energy Technology Data Exchange (ETDEWEB)

    Fischer, K. [Battelle Ingenieurtechnik GmbH, Eschborn (Germany)

    1996-12-01

    Pool scrubbing is an important mechanism to retain radioactive fission products from being carried into the containment atmosphere or into the secondary piping system. A number of models and computer codes has been developed to predict the retention of aerosols and fission product vapours that are released from the core and injected into water pools of BWR and PWR type reactors during severe accidents. Important codes in this field are BUSCA, SPARC and SUPRA. The present paper summarizes the models for scrubbing of gaseous Iodine components in these codes, discusses the experimental validation, and gives an assessment of the state of knowledge reached and the open questions which persist. The retention of gaseous Iodine components is modelled by the various codes in a very heterogeneous manner. Differences show up in the chemical species considered, the treatment of mass transfer boundary layers on the gaseous and liquid sides, the gas-liquid interface geometry, calculation of equilibrium concentrations and numerical procedures. Especially important is the determination of the pool water pH value. This value is affected by basic aerosols deposited in the water, e.g. Cesium and Rubidium compounds. A consistent model requires a mass balance of these compounds in the pool, thus effectively coupling the pool scrubbing phenomena of aerosols and gaseous Iodine species. Since the water pool conditions are also affected by drainage flow of condensate water from different regions in the containment, and desorption of dissolved gases on the pool surface is determined by the gas concentrations above the pool, some basic limitations of specialized pool scrubbing codes are given. The paper draws conclusions about the necessity of coupling between containment thermal-hydraulics and pool scrubbing models, and proposes ways of further simulation model development in order to improve source term predictions. (author) 2 tabs., refs.

  17. Biogenic silicon pools in terrestrial biogeosystems and their significance for silicon cycling

    Science.gov (United States)

    Puppe, Daniel; Höhn, Axel; Kaczorek, Danuta; Ehrmann, Otto; Wanner, Manfred; Sommer, Michael

    2017-04-01

    On a global scale the biogeochemical cycles of silicon (Si) and carbon are connected by weathering processes and fluxes of dissolved Si from terrestrial to aquatic ecosystems. Various pro- and eukaryotic organisms are evolutionarily adapted to synthesize amorphous siliceous structures (biosilicification). In soils these siliceous structures can accumulate and form biogenic Si (BSi) pools, whereat it can be differentiated between phytogenic (BSi synthesized by plants), zoogenic (BSi synthesized by sponges), microbial (BSi synthesized by bacteria and fungi) and protistic (BSi synthesized by unicellular organisms) pools. Accumulation and recycling of BSi in terrestrial biogeosystems influence fluxes of dissolved Si from the continents to the oceans, thus act as a filter in the global Si cycle. As research has primarily been focused on the role of phytogenic Si pools until now there is only little information available on the other BSi pools in soils. In order to fill this knowledge gap we examined different BSi pools in soils of initial and forested terrestrial biogeosystems using modern microscopical methods (laser scanning and scanning electron microscopy). In forested biogeosystems we further analyzed abiotic (e.g. soil pH) and biotic (earthworm biomasses) influencing factors on BSi pool size, while samples of initial biogeosystems were used to analyze spatiotemporal BSi pool dynamics. We found that especially biotic interactions are important factors for protistic BSi pools (represented by testate amoebae) and that phytogenic Si pools are about several 100-times bigger than protistic (testate amoebae) Si pools (0.2-4.7 kg Si ha-1). However, annual biosilicification rates of testate amoebae (up to 80 kg Si ha-1) are comparable to or even can exceed annual silicon uptake by trees. Our studies of initial biogeosystems revealed that BSi pool sizes increased markedly within a relatively short time span (<10 years) of ecosystem development. Differences in quantities

  18. The use of pyr-mutations to modify pyrimidine pools in Lactococci

    DEFF Research Database (Denmark)

    Hansen, Steen Lyders Lerche; Martinussen, Jan; Hammer, Karin

    1999-01-01

    . If pyrimidines are only available through salvage of uracil and/or cytidine, the pools of CTP and UTP can be varied independently by controlling the activities of cytidine-deaminase (cdd) and CTP-synthetase (pyrG). Cytidine-deaminase catalyses the deamination of cytidine leading to uridine and CTP....... By combining the two described mutations, with a cdd mutation, we will be able to construct strains in which pyrimidine pools can be manipulated by adding different pyrimidine-sources at variable concentrations to the growth media. Since nucleotides are central metabolites, many physiological parameters may...... be influenced by the size of the different pyrimidine pools....

  19. Apparatus for draining lower drywell pool water into suppresion pool in boiling water reactor

    Science.gov (United States)

    Gluntz, Douglas M.

    1996-01-01

    An apparatus which mitigates temperature stratification in the suppression pool water caused by hot water drained into the suppression pool from the lower drywell pool. The outlet of a spillover hole formed in the inner bounding wall of the suppression pool is connected to and in flow communication with one end of piping. The inlet end of the piping is above the water level in the suppression pool. The piping is routed down the vertical downcomer duct and through a hole formed in the thin wall separating the downcomer duct from the suppression pool water. The piping discharge end preferably has an elevation at or near the bottom of the suppression pool and has a location in the horizontal plane which is removed from the point where the piping first emerges on the suppression pool side of the inner bounding wall of the suppression pool. This enables water at the surface of the lower drywell pool to flow into and be discharged at the bottom of the suppression pool.

  20. [Chlorine concentrations in the air of indoor swimming pools and their effects on swimming pool workers].

    Science.gov (United States)

    Fernández-Luna, Álvaro; Burillo, Pablo; Felipe, José Luis; Gallardo, Leonor; Tamaral, Francisco Manuel

    2013-01-01

    To describe chlorine levels in the air of indoor swimming pools in Castilla-La Mancha (Spain) and relate them to other chemical parameters in the installation and to the health problems perceived by swimming pool workers. We analyzed 21 pools with chlorine as chemical treatment in Castilla-La Mancha. The iodometry method was applied to measure chlorine concentrations in the air. The concentrations of free and combined chlorine in water, pH and temperature were also evaluated. Health problems were surveyed in 230 swimming pool workers in these facilities. The mean chlorine level in the air of swimming pools was 4.3 ± 2.3mg/m(3). The pH values were within the legal limits. The temperature parameters did not comply with regulations in 17 of the 21 pools analyzed. In the pools where chlorine values in the air were above the legal regulations, a significantly higher percentage of swimming pool workers perceived eye irritation, dryness and irritation of skin, and ear problems. Chlorine values in the air of indoor swimming pools were higher than those reported in similar studies. Most of the facilities (85%) exceeded the concentration of 1.5mg/m(3) established as the limit for the risk of irritating effects. The concentration of chlorine in indoor swimming pool air has a direct effect on the self-perceived health problems of swimming pool workers. Copyright © 2012 SESPAS. Published by Elsevier Espana. All rights reserved.

  1. 10 CFR 36.63 - Pool water purity.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Pool water purity. 36.63 Section 36.63 Energy NUCLEAR... § 36.63 Pool water purity. (a) Pool water purification system must be run sufficiently to maintain the conductivity of the pool water below 20 microsiemens per centimeter under normal circumstances. If pool water...

  2. Southeastern superpave center pooled-fund activities.

    Science.gov (United States)

    2010-02-01

    Much has been learned about materials characteristics, testing procedures, new equipment, mix design, and pavement performance through the many studies conducted as a part of the Southeastern Superpave Center (SSC) pooled-fund program. Lessons learne...

  3. Ingestion of swimming pool water by recreational

    Data.gov (United States)

    U.S. Environmental Protection Agency — Swimming pool water ingestion data. This dataset is associated with the following publication: Dufour, A., L. Wymer, M. Magnuson, T. Behymer, and R. Cantu. Ingestion...

  4. Investigations in Marine Chemistry: Tide Pool Ecology.

    Science.gov (United States)

    Schlenker, Richard M.

    Students investigated the salinity of tide pools at different levels in the intertidal zone. Data are analyzed collectively. Students graphed and discussed data. Included are suggestions for evaluation and further study. (Author)

  5. Analysis of Bitcoin Pooled Mining Reward Systems

    OpenAIRE

    Rosenfeld, Meni

    2011-01-01

    In this paper we describe the various scoring systems used to calculate rewards of participants in Bitcoin pooled mining, explain the problems each were designed to solve and analyze their respective advantages and disadvantages.

  6. AE/VCE Unconfirmed Vernal Pools

    Data.gov (United States)

    Vermont Center for Geographic Information — This dataset is derived from a project by the Vermont Center for Ecostudies(VCE) and Arrowwood Environmental(AE) to map vernal pools throughout the state of Vermont....

  7. Virulent Naegleria fowleri in indoor swimming pool.

    Science.gov (United States)

    Kadlec, V; Skvárová, J; Cerva, L; Nebáznivá, D

    1980-01-01

    Naegleria fowleri was isolated from water during a hygienic inspection of a swimming pool in December 1977. This swimming pool was identified as a source of the infectious agent in the years 1962-1965, when a large outbreak of primary amoebic meningoencephalitis (PAME) occurred. First two strains of N. fowleri, pathogenic for white mice after intracerebral and intranasal inoculation, were isolated from water of outlet troughs, additional strains were then isolated from various places; particularly from a cavity in the damaged wall of the pool. The incubation temperature did not inhibit a simultaneous growth of amoebae of the genera Acanthamoeba, Flabellula, Hartmannella and Vahlkampfia in the primocultures. Epidemiological investigations did not reveal any new case of PAME in relation with the occurrence of pathogenic N. fowleri in the swimming pool.

  8. Spectrum pooling in MnWave Networks

    DEFF Research Database (Denmark)

    Boccardi, Federico; Shokri-Ghadikolaei, Hossein; Fodor, Gabor

    2016-01-01

    Motivated by the specific characteristics of mmWave technologies, we discuss the possibility of an authorization regime that allows spectrum sharing between multiple operators, also referred to as spectrum pooling. In particular, considering user rate as the performance measure, we assess...... the benefit of coordination among networks of different operators, study the impact of beamforming at both base stations and user terminals, and analyze the pooling performance at different frequency carriers. We also discuss the enabling spectrum mechanisms, architectures, and protocols required to make...... spectrum pooling work in real networks. Our initial results show that, from a technical perspective, spectrum pooling at mmWave has the potential to use the resources more efficiently than traditional exclusive spectrum allocation to a single operator. However, further studies are needed in order to reach...

  9. AE/VCE Confirmed Vernal Pools

    Data.gov (United States)

    Vermont Center for Geographic Information — This dataset is derived from a project by the Vermont Center for Ecostudies(VCE) and Arrowwood Environmental(AE) to map vernal pools throughout the state of Vermont....

  10. Pooling strategies for St Petersburg gamblers

    OpenAIRE

    Csörgö, Sandor; Simons, Gordon

    2006-01-01

    Peter offers to play exactly one St Petersburg game with each of [math] players, Paul [math] , [math] , Paul [math] , whose conceivable pooling strategies are described by all possible probability distributions [math] . Comparing infinite expectations, we characterize among all [math] those admissible strategies for which the pooled winnings, each distributed as [math] , yield a finite added value for each and every one of Paul [math] , [math] , Paul [math] in comparison with their individual...

  11. A readily retrievable pool of synaptic vesicles

    OpenAIRE

    Hua, Y; Sinha, R.; Thiel, C.; Schmidt, R.; Hueve, J.; Martens, H.; Hell, S.; Egner, A.; Klingauf, J.

    2011-01-01

    Abstract Although clathrin-mediated endocytosis (CME) is thought to be the predominant mechanism of synaptic vesicle (SV) recycling, it seems to be too slow for fast recycling. Therefore, it was suggested that a pre-sorted and pre-assembled pool of SV proteins on the presynaptic membrane might support a first wave of fast CME. In this study we monitored the temporal dynamics of such a 'readily retrievable pool' of SV proteins in rat hippocampal neurons using a novel probe. Applying...

  12. Pooled genomic indexing of rhesus macaque

    OpenAIRE

    Milosavljevic, Aleksandar; Harris, Ronald A.; Sodergren, Erica J.; Jackson, Andrew R.; Kalafus, Ken J.; Hodgson, Anne; Cree, Andrew; Dai, Weilie; Csuros, Miklos; Zhu, Baoli; de Jong, Pieter J.; Weinstock, George M; Gibbs, Richard A.

    2005-01-01

    Pooled genomic indexing (PGI) is a method for mapping collections of bacterial artificial chromosome (BAC) clones between species by using a combination of clone pooling and DNA sequencing. PGI has been used to map a total of 3858 BAC clones covering ∼24% of the rhesus macaque (Macaca mulatta) genome onto 4178 homologous loci in the human genome. A number of intrachromosomal rearrangements were detected by mapping multiple segments within the individual rhesus BACs onto multiple disjoined loc...

  13. Welding pool measurement using thermal array sensor

    Science.gov (United States)

    Cho, Chia-Hung; Hsieh, Yi-Chen; Chen, Hsin-Yi

    2015-08-01

    Selective laser melting (SLM) is an additive manufacturing (AM) technology that uses a high-power laser beam to melt metal powder in chamber of inert gas. The process starts by slicing the 3D CAD data as a digital information source into layers to create a 2D image of each layer. Melting pool was formed by using laser irradiation on metal powders which then solidified to consolidated structure. In a selective laser melting process, the variation of melt pool affects the yield of a printed three-dimensional product. For three dimensional parts, the border conditions of the conductive heat transport have a very large influence on the melt pool dimensions. Therefore, melting pool is an important behavior that affects the final quality of the 3D object. To meet the temperature and geometry of the melting pool for monitoring in additive manufacturing technology. In this paper, we proposed the temperature sensing system which is composed of infrared photodiode, high speed camera, band-pass filter, dichroic beam splitter and focus lens. Since the infrared photodiode and high speed camera look at the process through the 2D galvanometer scanner and f-theta lens, the temperature sensing system can be used to observe the melting pool at any time, regardless of the movement of the laser spot. In order to obtain a wide temperature detecting range, 500 °C to 2500 °C, the radiation from the melting pool to be measured is filtered into a plurality of radiation portions, and since the intensity ratio distribution of the radiation portions is calculated by using black-body radiation. The experimental result shows that the system is suitable for melting pool to measure temperature.

  14. Cloud clusters and superclusters over the oceanic warm pool

    Science.gov (United States)

    Mapes, Brian E.; Houze, Robert A., Jr.

    1993-01-01

    A study aimed at examining the size distributions of cloud clusters and the temperature distributions within them as functions of location, year, phase of the ISV, and time of day is considered. IR satellite images of tropical convection over the oceanic warm pool were processed to reveal cloud clusters, connected areas with cloud-top temperatures lower than a given threshold value. Results were obtained for a very cold threshold (208 K), corresponding roughly to the radar echo area within Australian monsoon cloud clusters, and for a moderately cold threshold (235 K) frequently used in climatic rainfall estimation.

  15. Comparison of fecal pooling methods and DNA extraction kits for the detection of Mycobacterium avium subspecies paratuberculosis.

    Science.gov (United States)

    Mita, Akiko; Mori, Yasuyuki; Nakagawa, Tetsuo; Tasaki, Tomoko; Utiyama, Katsuo; Mori, Hitomi

    2016-02-01

    The aim of the study was to develop a sensitive method using quantitative real-time polymerase chain reaction (qPCR) with pooled fecal samples for the screening of Johne's disease (JD). Manufacturer-specified and our new pooling method in combination with five commercial kits for DNA extraction and purification were compared. Different volumes of pooled fecal suspensions were tested, and the results were compared for individual samples and three pool sizes (5, 10, and 50 samples); each of the fecal suspensions, which were prepared from healthy dairy and beef cattle was spiked with 0, 10, 100, or 1000 cultured Mycobacterium avium subspecies paratuberculosis (MAP) organisms or was mixed with fecal suspensions from experimentally infected cattle. The MAP DNA detection proportion with our pooling method in combination with Johne-Spin kit (Fasmac, Japan) was 100% for all models and all pool sizes, except for the low shedder model with a pool size of 50. There was no loss of sensitivity in pools of 10 subjects or less by using the new method. These results suggest that new method is a sensitive, practical, and cost-effective screening test for the detection of MAP-infected cattle and the monitoring of JD-free herds. © 2015 The Authors. MicrobiologyOpen published by John Wiley & Sons Ltd.

  16. A Membrane Pool Retrieved via Endocytosis Overshoot at Nerve Terminals: A Study of Its Retrieval Mechanism and Role

    Science.gov (United States)

    Xue, Lei; McNeil, Benjamin D.; Wu, Xin-Sheng; Luo, Fujun; He, Liming; Wu, Ling-Gang

    2012-01-01

    Endocytosis overshoot, which retrieves more membrane than vesicles just being exocytosed, occurs at nerve terminals and non-neuronal secretory cells. The mechanism that retrieves the overshoot membrane pool and the role of this pool remain largely unknown. We addressed this issue at the rat calyx of Held nerve terminal with capacitance measurements. We found that every calyx contained an overshoot pool ~1.8 times the readily releasable pool. Retrieval of this pool required large calcium influx, and was inhibited by blockers of calcium/calmodulin-activated calcineurin and dynamin, suggesting the involvement of calcineurin and dynamin in endocytosis overshoot. Depletion of the overshoot pool slowed down compensatory endocytosis, whereas recovery of the overshoot pool via exocytosis that deposited stranded vesicles to the plasma membrane led to recovery of compensatory endocytosis, suggesting that the overshoot pool enhances endocytosis efficiency. These results suggest that the overshoot pool exists at every nerve terminal, is of limited size arising from vesicles stranded at the plasma membrane, is retrieved via calcium/calmodulin/calcineurin and dynamin signaling pathway, and can enhance endocytosis efficiency. Potential mechanisms for how the endocytosis overshoot pool enhances endocytosis efficiency are discussed. PMID:22399762

  17. Recent advances in probabilistic species pool delineations

    Directory of Open Access Journals (Sweden)

    Dirk Nikolaus Karger

    2016-07-01

    Full Text Available A species pool is the set of species that could potentially colonize and establish within a community. It has been a commonly used concept in biogeography since the early days of MacArthur and Wilson’s work on Island Biogeography. Despite their simple and appealing definition, an operational application of species pools is bundled with a multitude of problems, which have often resulted in arbitrary decisions and workarounds when defining species pools. Two recently published papers address the operational problems of species pool delineations, and show ways of delineating them in a probabilistic fashion. In both papers, species pools were delineated using a process-based, mechanistical approach, which opens the door for a multitude of new applications in biogeography. Such applications include detecting the hidden signature of biotic interactions, disentangling the geographical structure of community assembly processes, and incorporating a temporal extent into species pools. Although similar in their conclusions, both ‘probabilistic approaches’ differ in their implementation and definitions. Here I give a brief overview of the differences and similarities of both approaches, and identify the challenges and advantages in their application.

  18. Disentangling pooled triad genotypes for association studies.

    Science.gov (United States)

    Shi, Min; Umbach, David M; Weinberg, Clarice R

    2014-09-01

    Association studies that genotype affected offspring and their parents (triads) offer robustness to genetic population structure while enabling assessments of maternal effects, parent-of-origin effects, and gene-by-environment interaction. We propose case-parents designs that use pooled DNA specimens to make economical use of limited available specimens. One can markedly reduce the number of genotyping assays required by randomly partitioning the case-parent triads into pooling sets of h triads each and creating three pools from every pooling set, one pool each for mothers, fathers, and offspring. Maximum-likelihood estimation of relative risk parameters proceeds via log-linear modeling using the expectation-maximization algorithm. The approach can assess offspring and maternal genetic effects and accommodate genotyping errors and missing genotypes. We compare the power of our proposed analysis for testing offspring and maternal genetic effects to that based on a difference approach and that of the gold standard based on individual genotypes, under a range of allele frequencies, missing parent proportions, and genotyping error rates. Power calculations show that the pooling strategies cause only modest reductions in power if genotyping errors are low, while reducing genotyping costs and conserving limited specimens. Published 2014. This article is a U.S. Government work and is in the public domain in the USA.

  19. Vernal Pool Distribution - Central Valley, 2005 [ds650

    Data.gov (United States)

    California Department of Resources — "Great Valley Vernal Pool Distribution", originally mapped by Bob Holland, 2005. This dataset contains vernal pool areas mapped over Califorina's Central Valley,...

  20. Simulation of boiling pools with internal heat sources by gas injection. [LMFBR core meltdown

    Energy Technology Data Exchange (ETDEWEB)

    Luk, A.C.H.; Ganguli, A.; Bankoff, S.G.

    1977-07-29

    Heat transfer from the sides and bottom of an open non-boiling liquid pool with spatially uniform internal gas injection was studied experimentally, both in transient and in steady state. The results were compared with experimental data for a boiling pool without permanent gas injection undertaken at Argonne National Laboratory. Typical Nusselt number versus Reynolds number plots showed that heat transfer rates were much higher in the gassy pool due to more efficient circulation. A correction was applied to estimate the surface evaporation effect under boiling conditions. Bubble size and distribution effects controlled the heat transfer rates. Vertical void fraction profiles were inferred from local static pressure measurements. A modified Grashof number, in terms of the average void fraction, was also used to correlate the data for horizontal heat flow. The bottom and side heat loss rates were about equal, which would indicate that the pool might retain its shape as it sinks into the support material.

  1. Instantaneous liquid release from a rail tanker: The influence of noise shields on pool shape and pool size

    NARCIS (Netherlands)

    Rosmuller, N.

    2009-01-01

    In the Netherlands, the Betuweline is a dedicated freight railway. It will, among other things, be used for transportation of all kinds of hazardous materials from the Port of Rotterdam to the German Hinterland and vice versa. The line is approximately 150 km long. Alongside the line, more than 100

  2. Swimming Pool Electrical Injuries: Steps Toward Prevention.

    Science.gov (United States)

    Tashiro, Jun; Burnweit, Cathy A

    2017-01-09

    Electrical injuries in swimming pools are an important pediatric public health concern. We sought to (1) improve our understanding of the clinical presentation and outcomes following and (2) describe the epidemiology of swimming pool electrical injuries in the United States. We reviewed 4 cases of pediatric (public (23.9%) and sports facilities (19.1%). Electrical outlets or receptacles (39.8%) were most commonly implicated, followed by electrical system doors (18.2%), electric wiring systems (17.0%), thermostats (16.3%), hair dryers (4.6%), and radios (4.1%). Pediatric cases represented 48.4% of swimming pool-related electrical injuries reported to NEISS. Electrical injuries occurring in and around swimming pools remain an important source of morbidity and mortality. Although NEISS monitors sentinel events, current efforts at preventing such cases are less than adequate. All electrical outlets near swimming pools should be properly wired with ground fault circuit interrupter devices. Possible approaches to increasing safe electrical device installation are through strengthening public awareness and education of the potential for injury, as well as changes to current inspection regulations.

  3. Assessment of water quality of some swimming pools: a case study in Alexandria, Egypt.

    Science.gov (United States)

    Abd El-Salam, Magda Magdy

    2012-12-01

    In spite of the importance and popularity of swimming pools in summer, they have been identified as posing some public health risks to users due to either chemical or microbiological contamination. This study was carried out aiming at assessing the quality of water for some Alexandria's swimming pools in order to determine its compliance with the Egyptian standards no. 418/1995. Five swimming pools were selected randomly from different districts. Physical and chemical parameters, as well as biological examination of a total of 30 samples, were carried out using standard analytical methods. Water samples were collected from the studied swimming pools monthly over 6 months and pool water monitoring was carried out during afternoon of the weekends when the pools were most heavily used. The results indicated overall poor compliance with the standards. Compliance of the pool water to the microbial parameters, residual chlorine, pH, and turbidity were 56.7% (17 samples), 20% (6 samples), 46.7% (14 samples), and 46.7% (14 samples), respectively. Statistical analysis showed significant association between water contamination with microbial indicators and physical-chemical aspects such as residual chlorine, temperature, turbidity, and load of swimmers. Furthermore, Cryptosporidium oocysts and Giardia lamblia cysts has been found in 10% of samples. It was concluded that there is a need to improve disinfection and cleaning procedures, with consideration given to safety, and size of the pool in relation to bathing load. There is also a need to monitor swimming pool water quality continuously, and to increase bather hygienic practices and awareness of the risks as well as training of governmental inspectors.

  4. The new pooled cohort equations risk calculator

    DEFF Research Database (Denmark)

    Preiss, David; Kristensen, Søren L

    2015-01-01

    total cardiovascular risk score. During development of joint guidelines released in 2013 by the American College of Cardiology (ACC) and American Heart Association (AHA), the decision was taken to develop a new risk score. This resulted in the ACC/AHA Pooled Cohort Equations Risk Calculator. This risk...... disease and any measure of social deprivation. An early criticism of the Pooled Cohort Equations Risk Calculator has been its alleged overestimation of ASCVD risk which, if confirmed in the general population, is likely to result in statin therapy being prescribed to many individuals at lower risk than...

  5. Zooplankton at deep Red Sea brine pools

    KAUST Repository

    Kaartvedt, Stein

    2016-03-02

    The deep-sea anoxic brines of the Red Sea comprise unique, complex and extreme habitats. These environments are too harsh for metazoans, while the brine–seawater interface harbors dense microbial populations. We investigated the adjacent pelagic fauna at two brine pools using net tows, video records from a remotely operated vehicle and submerged echosounders. Waters just above the brine pool of Atlantis II Deep (2000 m depth) appeared depleted of macrofauna. In contrast, the fauna appeared to be enriched at the Kebrit Deep brine–seawater interface (1466 m).

  6. A strategy for optimizing item-pool management

    NARCIS (Netherlands)

    Ariel, A.; van der Linden, Willem J.; Veldkamp, Bernard P.

    2006-01-01

    Item-pool management requires a balancing act between the input of new items into the pool and the output of tests assembled from it. A strategy for optimizing item-pool management is presented that is based on the idea of a periodic update of an optimal blueprint for the item pool to tune item

  7. 47 CFR 90.35 - Industrial/Business Pool.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Industrial/Business Pool. 90.35 Section 90.35... MOBILE RADIO SERVICES Industrial/Business Radio Pool § 90.35 Industrial/Business Pool. (a) Eligibility... Industrial/Business Pool to provide commercial mobile radio service as defined in part 20 of this chapter or...

  8. Impact of a high-speed train of microdrops on a liquid pool

    NARCIS (Netherlands)

    Bouwhuis, W.; Huang, X; Chan, C.U.; Frommhold, P.E.; Ohl, C.D.; Lohse, Detlef; Snoeijer, Jacobus Hendrikus; van der Meer, Roger M.

    2016-01-01

    A train of high-speed microdrops impacting on a liquid pool can create a very deep and narrow cavity, reaching depths more than 1000 times the size of the individual drops. The impact of such a droplet train is studied numerically using boundary integral simulations. In these simulations, we solve

  9. The accumulation of the maternal pool of histone H1A during oogenesis in Xenopus laevis

    NARCIS (Netherlands)

    van Dongen, W. M.; Moorman, A. F.; Destrée, O. H.

    1983-01-01

    The accumulation of the maternal pool of histone H1A in Xenopus laevis oocytes was measured by the use of a semi-quantitative immunoradiographic method. This method implies the size-fractionation of total basic protein extracts from oocytes on a polyacrylamide gel, blotting of the proteins to

  10. The thermal response of generic objects in JP-4 pool fires

    Science.gov (United States)

    Nakos, J. T.; Gill, W.; Keltner, N. R.

    The measured thermal response of generic objects in engulfing pool fires is presented. The objects include cylinders and flat plates of various sizes and materials. A simple radiation/convection model of the heat transfer from the fire to the object is developed and discussed in light of the experimental data.

  11. The thermal response of generic objects in JP-4 pool fires

    Energy Technology Data Exchange (ETDEWEB)

    Nakos, J.T.; Gill, W.; Keltner, N.R.

    1990-01-01

    The measured thermal response of generic objects in engulfing pool fires is presented. The objects include cylinders and flat plates of various sizes and materials. A simple radiation/convection model of the heat transfer from the fire to the object is developed and discussed in light of the experimental data. 11 refs., 20 figs.

  12. Enhanced heat transfer in confined pool boiling

    NARCIS (Netherlands)

    Rops, C.M.; Lindken, R.; Velthuis, J.F.M.; Westerweel, J.

    2009-01-01

    We report the results of an experimental investigation of the heat transfer during nucleate boiling on a spatially confined boiling surface. The heat flux as a function of the boiling surface temperature was measured in pool boiling pots with diameters ranging from 15 mm down to 4.5 mm. It was found

  13. (Teleostei; Clinidae) in intertidal rock pools

    African Journals Online (AJOL)

    Factors affecting species richness and abundance of clinid fish(Fam. Clinidae)in 19 intertidal rock pools near Muizenberg, South Africa, were investigated. Some measure of cover is the most important predictor of clinid species richness, abundance and biomass. Intraspecific partitioning of habitat by Clinus superciliosus ...

  14. CDC Study Finds Fecal Contamination in Pools

    Science.gov (United States)

    ... swimming pools, water parks, hot tubs, interactive fountains, water play areas, lakes, rivers, or oceans. To view the report, please visit www.cdc.gov/mmwr. CDC recommends that all swimmers take the ... out of the water. Do not swim when you have diarrhea. Shower ...

  15. Blood pool images of soft tissue tumors

    Energy Technology Data Exchange (ETDEWEB)

    Matsumoto, Seiichi; Kawaguchi, Noriyoshi; Manabe, Jun; Kuroda, Hiroshi; Shimoji, Takashi; Oyamada, Hiyoshimaru (Japanese Foundation for Cancer Research, Tokyo (Japan). Hospital)

    1994-07-01

    From January 1986 through August 1992, three-phase bone scintigraphy with Tc-99m methylene diphosphonate (MDP) or Tc-99m hydroxy methylene diphosphonate (HMDP) was performed on consecutive 152 patients with pathologically proven soft tissue tumors. The ability of blood pool scintigraphy to delineate tumors was examined in evaluable 149 patients. According to tumor histology, it showed hot spots in 28/29 for malignant fibrous histiocytoma, 16/16 for liposarcoma, 8/8 for periosteal sarcoma, 42/43 for other sarcomas, 10/11 for neurilemoma, 12/14 for desmoid, 1/4 for myxoma, 5/5 for pigmented villonodullar synovitis or giant cell tumor of tendon sheath, 7/7 for angiomas, and 9/12 for other benign tumors. Malignant tumors were shown as hot spots in 98% (94/96) and the entire tumors, including benign ones, in 93% (138/149). Blood pool scintigraphy was inferior in detecting mucous tumors and small nodules. It could not differentiate between degeneration or necrosis and cytoma that were detectable on MRI. Blood pool scintigraphy was superior in determining the outcome of preoperative chemotherapy and/or radiotherapy. In conclusion, blood pool scintigraphy is an essential preoperative method for providing useful information on soft tissue tumors. (N.K.).

  16. Measurements of fluid flow in weld pools

    NARCIS (Netherlands)

    Zhao, C.

    2011-01-01

    Understanding the fluid flow in weld pools contributes significantly toward controlling the heat distribution in the base material and the mass distribution of molten base and additive materials. Currently, most investigations focus primarily on numerical models, due to the experimental difficulties

  17. Pool boiling inversion through bubble induced macroconvection

    Science.gov (United States)

    Jaikumar, A.; Kandlikar, S. G.

    2017-02-01

    While numerous surface geometries have been explored to achieve enhancements in pool boiling critical heat flux and heat transfer coefficient (HTC), their mechanistic contributions towards the characteristics of the pool boiling curve are not clear. Recently reported pool boiling curves in literature have shown a trend where an increase in heat flux leads to a decrease in wall superheat. Consequently, a negative slope in the pool boiling curve accompanied by a sharp increase in HTC, termed here as boiling inversion, is observed. We demonstrate that this inversion is due to vapor stream induced reinforcement of an impinging liquid jet over the non-boiling regions. This behavior is characteristic of surfaces developed using separate liquid-vapor pathways and macroconvection enhancement mechanism resulting in a highly efficient self-sustained boiling configuration. The increased jet impingement velocities lead to higher HTCs with lower wall superheats. The analytical models available in literature are employed to quantitatively explain this trend. Furthermore, a self-adjusting boiling mechanism is seen at play wherein a reduction in nucleation activity due to lowering of wall superheat counters the increase in HTC induced by the macroconvective currents.

  18. 28 CFR 540.64 - Press pools.

    Science.gov (United States)

    2010-07-01

    ... magazines and newspapers; and (4) All media in the local community where the institution is located. If no... PERSONS IN THE COMMUNITY Contact With News Media § 540.64 Press pools. (a) The Warden may establish a... shall notify all news media representatives who have requested interviews or visits that have not been...

  19. Pricing Electricity in Pools With Wind Producers

    DEFF Research Database (Denmark)

    Morales González, Juan Miguel; Conejo, A. J.; Kai Liu

    2012-01-01

    This paper considers an electricity pool that includes a significant number of wind producers and is cleared through a network-constrained auction, one day in advance and on an hourly basis. The hourly auction is formulated as a two-stage stochastic programming problem, where the first stage repr...

  20. Pooling ASR data for closely related languages

    CSIR Research Space (South Africa)

    Van Heerden, C

    2010-05-01

    Full Text Available We describe several experiments that were conducted to assess the viability of data pooling as a means to improve speech-recognition performance for under-resourced languages. Two groups of closely related languages from the Southern Bantu language...

  1. Transferring Goods or Splitting a Resource Pool

    Science.gov (United States)

    Dijkstra, Jacob; Van Assen, Marcel A. L. M.

    2008-01-01

    We investigated the consequences for exchange outcomes of the violation of an assumption underlying most social psychological research on exchange. This assumption is that the negotiated direct exchange of commodities between two actors (pure exchange) can be validly represented as two actors splitting a fixed pool of resources (split pool…

  2. "Teisele poole" Agambeniga ja Agambenita / Ragne Nukk

    Index Scriptorium Estoniae

    Nukk, Ragne, 1984-

    2012-01-01

    Tallinna Fotokuu rahvusvahelise fotonäituse "Teisele poole" ideeliste lähtekohtade tõlgendamisest. Autor kõrvutab Adam Budaki kuraatornäituse aluseks olnud Giorgio Agambeni esseed „Viimne kohtupäev“ näitusel eksponeeritud piltidega

  3. Comprehensive analysis of correlation coefficients estimated from pooling heterogeneous microarray data.

    Science.gov (United States)

    Almeida-de-Macedo, Márcia M; Ransom, Nick; Feng, Yaping; Hurst, Jonathan; Wurtele, Eve Syrkin

    2013-07-04

    The synthesis of information across microarray studies has been performed by combining statistical results of individual studies (as in a mosaic), or by combining data from multiple studies into a large pool to be analyzed as a single data set (as in a melting pot of data). Specific issues relating to data heterogeneity across microarray studies, such as differences within and between labs or differences among experimental conditions, could lead to equivocal results in a melting pot approach. We applied statistical theory to determine the specific effect of different means and heteroskedasticity across 19 groups of microarray data on the sign and magnitude of gene-to-gene Pearson correlation coefficients obtained from the pool of 19 groups. We quantified the biases of the pooled coefficients and compared them to the biases of correlations estimated by an effect-size model. Mean differences across the 19 groups were the main factor determining the magnitude and sign of the pooled coefficients, which showed largest values of bias as they approached ±1. Only heteroskedasticity across the pool of 19 groups resulted in less efficient estimations of correlations than did a classical meta-analysis approach of combining correlation coefficients. These results were corroborated by simulation studies involving either mean differences or heteroskedasticity across a pool of N > 2 groups. The combination of statistical results is best suited for synthesizing the correlation between expression profiles of a gene pair across several microarray studies.

  4. Factors driving semi-aquatic predator occurrence in traditional cattle drinking pools: conservation issues

    Directory of Open Access Journals (Sweden)

    Raoul Manenti

    2016-08-01

    Full Text Available In several cases, human impact on water bodies and on their freshwater communities is detrimental, but in some cases the human activity may favour and enhance the biodiversity of small water bodies, as traditional cattle drinking pools. Despite their small size, small water bodies may constitute hot spot of biodiversity often representing the only lentic aquatic biotope in landscapes where superficial water lacks or flows in lotic environments like creeks and streams. Predators are good indicators of biodiversity in ponds and give information of food chain web complexity. In particular, semi-aquatic predators like amphibians and dragonflies may account for a substantial percentage of energy flow between aquatic and terrestrial ecosystems. In this study, we evaluated the conservation value of traditional cattle drinking pools building by assessing the factors determining the occurrence and distribution of the semi-aquatic predators. From April to August 2015, we investigated 30 distinct pools recording several abiotic and biotic environmental variables. We detected 4 semi-aquatic predators: Salamandra salamandra larvae, Triturus carnifex, Aeshna sp. larvae and Libellula sp. larvae. Abiotic features played a major role in shaping the predator community that resulted linked to stable, with no dryness period, and large drinking pools. Invertebrate prey biomass was not particularly important, while vegetation cover and occurrence of unpalatable tadpoles were the most important biotic features of the pools. Our study provides novel evidence on the importance of cattle drinking pools management to preserve biodiversity especially in areas where traditional pastoral activity is disappearing.

  5. Spinal segment-specific transcutaneous stimulation differentially shapes activation pattern among motor pools in humans.

    Science.gov (United States)

    Sayenko, Dimitry G; Atkinson, Darryn A; Dy, Christine J; Gurley, Katelyn M; Smith, Valerie L; Angeli, Claudia; Harkema, Susan J; Edgerton, V Reggie; Gerasimenko, Yury P

    2015-06-01

    Transcutaneous and epidural electrical spinal cord stimulation techniques are becoming more valuable as electrophysiological and clinical tools. Recently, we observed selective activation of proximal and distal motor pools during epidural spinal stimulation. In the present study, we hypothesized that the characteristics of recruitment curves obtained from leg muscles will reflect a relative preferential activation of proximal and distal motor pools based on their arrangement along the lumbosacral enlargement. The purpose was to describe the electrophysiological responses to transcutaneous stimulation in leg muscles innervated by motoneurons from different segmental levels. Stimulation delivered along the rostrocaudal axis of the lumbosacral enlargement in the supine position resulted in a selective topographical recruitment of proximal and distal leg muscles, as described by threshold intensity, slope of the recruitment curves, and plateau point intensity and magnitude. Relatively selective recruitment of proximal and distal motor pools can be titrated by optimizing the site and intensity level of stimulation to excite a given combination of motor pools. The slope of the recruitment of particular muscles allows characterization of the properties of afferents projecting to specific motoneuron pools, as well as to the type and size of the motoneurons. The location and intensity of transcutaneous spinal electrical stimulation are critical to target particular neural structures across different motor pools in investigation of specific neuromodulatory effects. Finally, the asymmetry in bilateral evoked potentials is inevitable and can be attributed to both anatomical and functional peculiarities of individual muscles or muscle groups. Copyright © 2015 the American Physiological Society.

  6. Changes in amino acid and nucleotide pools of Rhodospirillum rubrum during switch-off of nitrogenase activity initiated by NH4+ or darkness.

    Science.gov (United States)

    Li, J D; Hu, C Z; Yoch, D C

    1987-01-01

    Amino acid and nucleotide pools were measured in nitrogenase-containing Rhodospirillum rubrum cultures during NH4+- or dark-induced inactivation (switch-off) of the Fe protein. A big increase in the glutamine pool size preceded NH4+ switch-off of nitrogenase activity, but the glutamine pool remained unchanged during dark switch-off. Furthermore, methionine sulfoximine had no effect on the rate of dark switch-off, suggesting that glutamine plays no role in this process. In the absence of NH4+ azaserine, an inhibitor of glutamate synthate, raised glutamine pool levels sufficiently to initiate switch-off in vivo. While added NH4+ substantially increased the size of the nucleotide pools in N-limited cells, the kinetics of nucleotide synthesis were all similar and followed (rather than preceded) Fe protein inactivation. Darkness had little effect on nucleotide pool sizes. Glutamate pool sizes were also found to be important in NH4+ switch-off because of the role of this molecule as a glutamine precursor. Much of the diversity reported in the observations on NH4+ switch-off appears to be due to variations in glutamate pool sizes prior to the NH4+ shock. The nitrogen nutritional background is an important factor in determining whether darkness initiates nitrogenase switch-off; however, no link has yet been established between this and NH4+ (glutamine) switch-off.

  7. Suncatcher and cool pool. Project report

    Energy Technology Data Exchange (ETDEWEB)

    Hammond, J.

    1981-03-01

    The Suncatcher is a simple, conical solar concentrating device that captures light entering clerestory windows and directs it onto thermal storage elements at the back of a south facing living space. The cone shape and inclination are designed to capture low angle winter sunlight and to reflect away higher angle summer sunlight. It is found that winter radiation through a Suncatcher window is 40 to 50% higher than through an ordinary window, and that the average solar fraction is 59%. Water-filled steal culvert pipes used for thermal storage are found to undergo less stratification, and thus to be more effective, when located where sunlight strikes the bottom rather than the top. Five Suncatcher buildings are described. Designs are considered for 32/sup 0/, 40/sup 0/ and 48/sup 0/ north latitude, and as the latitude increases, the inclination angle of the cone should be lowered. The Cool Pool is an evaporating, shaded roof pond which thermosiphons cool water into water-filled columns within a building. Preliminary experiments indicate that the best shade design has unimpeded north sky view, good ventilation, complete summer shading, a low architectural profile, and low cost attic vent lowers work. Another series of experiments established the satisfactory performance of the Cool Pool on a test building using four water-filled cylinders, two cylinders, and two cylinders connected to the Cool Pool through a heat exchanger. Although an unshaded pool cools better at night than a shaded one, daytime heat gain far offsets this advantage. A vinyl waterbag heat exchanger was developed for use with the Cool Pool. (LEW)

  8. Empirical Bayes Gaussian likelihood estimation of exposure distributions from pooled samples in human biomonitoring.

    Science.gov (United States)

    Li, Xiang; Kuk, Anthony Y C; Xu, Jinfeng

    2014-12-10

    Human biomonitoring of exposure to environmental chemicals is important. Individual monitoring is not viable because of low individual exposure level or insufficient volume of materials and the prohibitive cost of taking measurements from many subjects. Pooling of samples is an efficient and cost-effective way to collect data. Estimation is, however, complicated as individual values within each pool are not observed but are only known up to their average or weighted average. The distribution of such averages is intractable when the individual measurements are lognormally distributed, which is a common assumption. We propose to replace the intractable distribution of the pool averages by a Gaussian likelihood to obtain parameter estimates. If the pool size is large, this method produces statistically efficient estimates, but regardless of pool size, the method yields consistent estimates as the number of pools increases. An empirical Bayes (EB) Gaussian likelihood approach, as well as its Bayesian analog, is developed to pool information from various demographic groups by using a mixed-effect formulation. We also discuss methods to estimate the underlying mean-variance relationship and to select a good model for the means, which can be incorporated into the proposed EB or Bayes framework. By borrowing strength across groups, the EB estimator is more efficient than the individual group-specific estimator. Simulation results show that the EB Gaussian likelihood estimates outperform a previous method proposed for the National Health and Nutrition Examination Surveys with much smaller bias and better coverage in interval estimation, especially after correction of bias. Copyright © 2014 John Wiley & Sons, Ltd.

  9. On tropical cyclone frequency and the warm pool area

    Directory of Open Access Journals (Sweden)

    R. E. Benestad

    2009-04-01

    Full Text Available The proposition that the rate of tropical cyclogenesis increases with the size of the "warm pool" is tested by comparing the seasonal variation of the warm pool area with the seasonality of the number of tropical cyclones. An analysis based on empirical data from the Northern Hemisphere is presented, where the warm pool associated with tropical cyclone activity is defined as the area, A, enclosed by the 26.5°C SST isotherm. Similar analysis was applied to the temperature weighted area AT with similar results.

    An intriguing non-linear relationship of high statistical significance was found between the temperature weighted area in the North Atlantic and the North-West Pacific on the one hand and the number of cyclones, N, in the same ocean basin on the other, but this pattern was not found over the North Indian Ocean. A simple statistical model was developed, based on the historical relationship between N and A. The simple model was then validated against independent inter-annual variations in the seasonal cyclone counts in the North Atlantic, but the correlation was not statistically significant in the North-West Pacific. No correlation, however, was found between N and A in the North Indian Ocean.

    A non-linear relationship between the cyclone number and temperature weighted area may in some ocean basins explain both why there has not been any linear trend in the number of cyclones over time as well as the recent upturn in the number of Atlantic hurricanes. The results also suggest that the notion of the number of tropical cyclones being insensitive to the area A is a misconception.

  10. Phosphorylation of Synaptojanin Differentially Regulates Endocytosis of Functionally Distinct Synaptic Vesicle Pools.

    Science.gov (United States)

    Geng, Junhua; Wang, Liping; Lee, Joo Yeun; Chen, Chun-Kan; Chang, Karen T

    2016-08-24

    The rapid replenishment of synaptic vesicles through endocytosis is crucial for sustaining synaptic transmission during intense neuronal activity. Synaptojanin (Synj), a phosphoinositide phosphatase, is known to play an important role in vesicle recycling by promoting the uncoating of clathrin following synaptic vesicle uptake. Synj has been shown to be a substrate of the minibrain (Mnb) kinase, a fly homolog of the dual-specificity tyrosine phosphorylation-regulated kinase 1A (DYRK1A); however, the functional impacts of Synj phosphorylation by Mnb are not well understood. Here we identify that Mnb phosphorylates Synj at S1029 in Drosophila We find that phosphorylation of Synj at S1029 enhances Synj phosphatase activity, alters interaction between Synj and endophilin, and promotes efficient endocytosis of the active cycling vesicle pool (also referred to as exo-endo cycling pool) at the expense of reserve pool vesicle endocytosis. Dephosphorylated Synj, on the other hand, is deficient in the endocytosis of the active recycling pool vesicles but maintains reserve pool vesicle endocytosis to restore total vesicle pool size and sustain synaptic transmission. Together, our findings reveal a novel role for Synj in modulating reserve pool vesicle endocytosis and further indicate that dynamic phosphorylation and dephosphorylation of Synj differentially maintain endocytosis of distinct functional synaptic vesicle pools. Synaptic vesicle endocytosis sustains communication between neurons during a wide range of neuronal activities by recycling used vesicle membrane and protein components. Here we identify that Synaptojanin, a protein with a known role in synaptic vesicle endocytosis, is phosphorylated at S1029 in vivo by the Minibrain kinase. We further demonstrate that the phosphorylation status of Synaptojanin at S1029 differentially regulates its participation in the recycling of distinct synaptic vesicle pools. Our results reveal a new role for Synaptojanin in

  11. Behavior of Free Aromatic Amino Acid Pools in Rosmarinic Acid-Producing Cell Cultures of Anchusa officinalis L. 1

    Science.gov (United States)

    De-Eknamkul, Wanchai; Ellis, Brian E.

    1989-01-01

    The pool sizes of free l-phenylalanine and l-tyrosine, the precursors of rosmarinic acid in Anchusa officinalis L. cell suspension cultures, fluctuated during the culture cycle. The major increase in pool sizes was preceded by a peak of prephenate aminotransferase activity, while the subsequent decrease coincided with the presence of high activities of phenylalanine ammonia-lyase and tyrosine aminotransferase, the two entrypoint enzymes of the rosmarinic acid biosynthesis pathway. Timecourse feeding studies with linear growth stage cells revealed that the tyrosine pool turned over rapidly, consistent with direct participation in rosmarinic acid synthesis. Since externally applied l-tyrosine was rapidly incorporated into rosmarinic acid with little evidence of radioactively labeled intermediates, it is suggested that there exists a close coupling between the l-tyrosine pool and the rosmarinic acid biosynthetic pathway, which may involve the channelling of intermediates both into and within the pathway. PMID:16666560

  12. Talent Management - Case Study on Determining the Collective Pool of Talent

    Directory of Open Access Journals (Sweden)

    Mirabela-Constanta MATEI

    2012-11-01

    Full Text Available Our paper focuses on the importance of attracting and retaining talent in a company. Attracting talent refers not only to the selection of talented employees from outside the company, but also to their identification among existing employees by determining and developing the collective pool of talent. The aim of our paper is to get a better view on how companies understand, attract and retain talent. To achieve this aim, we first reviewed the literature in the field of interest and then conducted a case study on determining the collective pool of talent within a medium size company from Bihor County. Results are discussed.

  13. Phytolith-Occluded Carbon Pools and Fluxes: New Estimates

    Science.gov (United States)

    Reyerson, P. E.; Alexandre, A. E.; Santos, G.

    2015-12-01

    Phytoliths are microscopic grains of silica (SiO2•nH2O) formed within plants. The biomineralization process typically encapsulates small quantities of carbon termed phytC. Upon decomposition, phytoliths are released from biomass and into soils. Recent research has suggested that phytC may be a large sink of atmospheric CO2 in soils. Important steps, therefore, are to quantify phytC cycling across ecosystems and to measure it's importance relative to the organic C cycle as a whole. Thus, information regarding phytC pool sizes and flux rates are needed. To an extent this has been performed. PhytC quantities can be easily estimated as long as 1) phytolith quantities and 2) the amount of C present in phytoliths are known. The quantity of C within phytoliths is still a subject of debate, but recent work has found quantities of less than 0.22%. Older studies, which rely on extraction methods which are now known to incompletely remove surface organic residues, have found phytC quantities from 1% to 20%. Hence, studies of phytC cycling using outdated methods may lead to overestimates. In order to re-estimate phytC dynamics, we compiled an extensive list of published works which document phytolith pools in above-ground biomass and soils, as well as flux rates. From these data phytC quantities were calculated using revised estimates of phytolith C percentages. PhytC quantities were also compared to total organic C (TOC) pools and fluxes. These calculations were then extrapolated to biome and global scales. At the biome scale, our results indicate that phytC within living biomass and soil pools as well as fluxes are one to two orders of magnitude smaller than previously estimated. PhytC is generally less than 0.01% of biomass TOC, and less than 1% of soil TOC. Annual phytC fluxes are less than 0.01% of TOC fluxes. At the global scale, annual phytC production is approximately 0.01% to 0.10% of gross C production. The findings of the present study suggest that direct C

  14. Review and assessment of pool scrubbing models

    Energy Technology Data Exchange (ETDEWEB)

    Herranz, L.E.; Escudero, M.J.; Peyres, V.; Polo, J.; Lopez, J.

    1996-07-01

    Decontamination of fission products bearing bubbles as they pass through aqueous pools becomes a crucial phenomenon for source term evaluation of hypothetical risk dominant sequences of Light Water Reactors. In the present report a peer review and assessment of models encapsulated in SPARC and BUSCA codes is presented. Several aspects of pool scrubbing have been addressed: particle removal, fission product vapour retention and bubble hydrodynamics. Particular emphasis has been given to the close link between retention and hydrodynamics, from both modelling and experimental point of view. In addition, RHR and SGTR sequences were simulated with SPARC90 and BUSCA-AUG92 codes, and their results were compared with those obtained with MAAP 3.0B. As a result of this work, model capabilities and shortcomings have been assessed and some areas susceptible of further research have been identified. (Author) 73 refs.

  15. Unveiling the Black Markets of Pooled Assets

    Directory of Open Access Journals (Sweden)

    Maura Atapattu

    2015-07-01

    Full Text Available Presence of black markets is not common for every industry but is a unique phenomenon in the industries such as asset pooling and leasing services. The unique business models and the asset flows that we see in such industries are susceptible for such threats and reveals the nature and extent of extent of industry-specific threats. This paper employs agility lens (Overby et al. 2006; Roberts and Grover 2012 to understand how such firms could address the issue of black market threats with the help of network structure. Through a case study of a global asset pooling and leasing company, we reveal the criticality of network structures, the difficulties, inadequacies and impracticalities of current tracking technologies that challenge firms in minimizing such threats.

  16. Strategies for chemically healthy public swimming pools

    DEFF Research Database (Denmark)

    Hansen, Kamilla Marie Speht

    spreading of pathogens between swimmers because of its residual disinfection effect. In addition to potential contamination of pathogenic microorganisms, swimming pool water is polluted by organic matter deposited from the bathers such as saliva, urine, sweat, hair and personal care products. Since chlorine...... avoided. Hair and skin cells are precursors for DBPs so good filtration with fast removal of particles could also be an option to obtain lower DBPs formation. Another way to remove precursors is to ozonate the pool water, since ozonation of the precursors leads to organic compound which is less reactive...... affected the investigated groups of DBPs differently. An analogue consisting of the main component in urine and sweat and particles consisting of skin cells and hair were used as precursor material and in both cases the formation of THMs decreased with decreasing pH while HAN formation increased...

  17. Poole-frenkel piezoconductive element and sensor

    Science.gov (United States)

    Habermehl, Scott D.

    2004-08-03

    A new class of highly sensitive piezoconductive strain sensor elements and sensors has been invented. The new elements function under conditions such that electrical conductivity is dominated by Poole-Frenkel transport. A substantial piezoconductive effect appears in this regime, allowing the new sensors to exhibit sensitivity to applied strain as much as two orders of magnitude in excess of prior art sensors based on doped silicon.

  18. Spikes and memory in (Nord Pool) electricity price spot prices

    DEFF Research Database (Denmark)

    Proietti, Tomasso; Haldrup, Niels; Knapik, Oskar

    Electricity spot prices are subject to transitory sharp movements commonly referred to as spikes. The paper aims at assessing their effects on model based inferences and predictions, with reference to the Nord Pool power exchange. We identify a spike as a price value which deviates substantially...... the spikes, i.e. shrinking an observation deviating substantially from the normal price towards the one-step-ahead prediction. Our empirical application illustrates the effects of the spikes on the estimates of the parameters governing the persistence of the series; moreover, a real time rolling forecasting...... from the normal price, where the latter is defined as the expectation arising from a model accounting for long memory at the zero and at the weekly seasonal frequencies, given the knowledge of the past realizations. Hence, a spike is associated to a time series innovation with size larger than...

  19. Source pool geometry and the assembly of continental avifaunas

    DEFF Research Database (Denmark)

    Graves, Gary R; Rahbek, Carsten

    2005-01-01

    on the assembly of avian communities with an analysis of assemblage dispersion fields, which can be visualized by overlaying the geographic ranges of all species that occur in an assemblage. Contours of species richness surrounding focal quadrats illustrate the decay rate of assemblage similarity with distance...... of magnitude across the continent. Because abundance generally correlates with geographic range size within taxonomic groups, the number of individuals per species in avifaunal source pools must also vary by an order of magnitude. Most significantly, dispersion field geometry was surprisingly asymmetrical......Classical niche-assembly models propose that the composition of biotic communities in continental landscapes is determined chiefly by the autecology of species, interspecific competition, and the diversity of resources and habitats within a region. In contrast, stochastic models propose...

  20. Vesicle Pools: Lessons from Adrenal Chromaffin Cells

    Directory of Open Access Journals (Sweden)

    David R Stevens

    2011-02-01

    Full Text Available The adrenal chromaffin cell serves as a model system to study fast Ca2+-dependent exocytosis. Membrane capacitance measurements in combination with Ca2+ uncaging offers a temporal resolution in the millisecond range and reveals that catecholamine release occurs in three distinct phases. Release of a readily releasable (RRP and a slowly releasable (SRP pool are followed by sustained release, due to maturation and release of vesicles which were not release-ready at the start of the stimulus. Trains of depolarizations, a more physiological stimulus, induce release from a small immediately releasable pool of vesicles residing adjacent to calcium channels, as well as from the RRP. The SRP is poorly activated by depolarization. A sequential model, in which non-releasable docked vesicles are primed to a slowly releasable state, and then further mature to the readily releasable state, has been proposed. The docked state, dependent on membrane proximity, requires SNAP-25, synaptotagmin and syntaxin. The ablation or modification of SNAP-25 and syntaxin, components of the SNARE complex, as well as of synaptotagmin, the calcium sensor, and modulators such complexins and Snapin alter the properties and/or magnitudes of different phases of release, and in particular can ablate the RRP. These results indicate that the composition of the SNARE complex and its interaction with modulatory molecules drives priming and provides a molecular basis for different pools of releasable vesicles.

  1. Condensation of vapor bubble in subcooled pool

    Science.gov (United States)

    Horiuchi, K.; Koiwa, Y.; Kaneko, T.; Ueno, I.

    2017-02-01

    We focus on condensation process of vapor bubble exposed to a pooled liquid of subcooled conditions. Two different geometries are employed in the present research; one is the evaporation on the heated surface, that is, subcooled pool boiling, and the other the injection of vapor into the subcooled pool. The test fluid is water, and all series of the experiments are conducted under the atmospheric pressure condition. The degree of subcooling is ranged from 10 to 40 K. Through the boiling experiment, unique phenomenon known as microbubble emission boiling (MEB) is introduced; this phenomenon realizes heat flux about 10 times higher than the critical heat flux. Condensation of the vapor bubble is the key phenomenon to supply ambient cold liquid to the heated surface. In order to understand the condensing process in the MEB, we prepare vapor in the vapor generator instead of the evaporation on the heated surface, and inject the vapor to expose the vapor bubble to the subcooled liquid. Special attention is paid to the dynamics of the vapor bubble detected by the high-speed video camera, and on the enhancement of the heat transfer due to the variation of interface area driven by the condensation.

  2. Biophysical interactions control the size and abundance of large phytoplankton chains at the Ushant tidal front.

    Directory of Open Access Journals (Sweden)

    José M Landeira

    Full Text Available Phytoplankton blooms are usually dominated by chain-forming diatom species that can alter food pathways from primary producers to predators by reducing the interactions between intermediate trophic levels. The food-web modifications are determined by the length of the chains; however, the estimation is biased because traditional sampling strategies damage the chains and, therefore, change the phytoplankton size structure. Sedimentological studies around oceanic fronts have shown high concentrations of giant diatom mats (>1 cm in length, suggesting that the size of diatom chains is underestimated in the pelagic realm. Here, we investigate the variability in size and abundance of phytoplankton chains at the Ushant tidal front (NW France using the Video Fluorescence Analyzer (VFA, a novel and non-invasive system. CTD and Scanfish profiling characterized a strong temperature and chlorophyll front, separating mixed coastal waters from the oceanic-stratified domain. In order to elucidate spring-neap variations in the front, vertical microstructure profiler was used to estimate the turbulence and vertical nitrate flux. Key findings were: (1 the VFA system recorded large diatom chains up to 10.7 mm in length; (2 chains were mainly distributed in the frontal region, with maximum values above the pycnocline in coincidence with the maximum chlorophyll; (3 the diapycnal fluxes of nitrate enabled the maintenance of the bloom in the frontal area throughout the spring-neap tidal cycle; (4 from spring to neap tide the chains length was significantly reduced; (5 during neap tide, the less intense vertical diffusion of nutrients, as well as the lower turbulence around the chains, intensified nutrient-depleted conditions and, thus, very large chains became disadvantageous. To explain this pattern, we suggest that size plasticity is an important ecological trait driving phytoplankton species competition. Although this plasticity behavior is well known from

  3. The Phoenix series large scale LNG pool fire experiments.

    Energy Technology Data Exchange (ETDEWEB)

    Simpson, Richard B.; Jensen, Richard Pearson; Demosthenous, Byron; Luketa, Anay Josephine; Ricks, Allen Joseph; Hightower, Marion Michael; Blanchat, Thomas K.; Helmick, Paul H.; Tieszen, Sheldon Robert; Deola, Regina Anne; Mercier, Jeffrey Alan; Suo-Anttila, Jill Marie; Miller, Timothy J.

    2010-12-01

    The increasing demand for natural gas could increase the number and frequency of Liquefied Natural Gas (LNG) tanker deliveries to ports across the United States. Because of the increasing number of shipments and the number of possible new facilities, concerns about the potential safety of the public and property from an accidental, and even more importantly intentional spills, have increased. While improvements have been made over the past decade in assessing hazards from LNG spills, the existing experimental data is much smaller in size and scale than many postulated large accidental and intentional spills. Since the physics and hazards from a fire change with fire size, there are concerns about the adequacy of current hazard prediction techniques for large LNG spills and fires. To address these concerns, Congress funded the Department of Energy (DOE) in 2008 to conduct a series of laboratory and large-scale LNG pool fire experiments at Sandia National Laboratories (Sandia) in Albuquerque, New Mexico. This report presents the test data and results of both sets of fire experiments. A series of five reduced-scale (gas burner) tests (yielding 27 sets of data) were conducted in 2007 and 2008 at Sandia's Thermal Test Complex (TTC) to assess flame height to fire diameter ratios as a function of nondimensional heat release rates for extrapolation to large-scale LNG fires. The large-scale LNG pool fire experiments were conducted in a 120 m diameter pond specially designed and constructed in Sandia's Area III large-scale test complex. Two fire tests of LNG spills of 21 and 81 m in diameter were conducted in 2009 to improve the understanding of flame height, smoke production, and burn rate and therefore the physics and hazards of large LNG spills and fires.

  4. Size matter!

    DEFF Research Database (Denmark)

    Hansen, Pelle Guldborg; Jespersen, Andreas Maaløe; Skov, Laurits Rhoden

    2015-01-01

    trash bags according to size of plates and weighed in bulk. Results Those eating from smaller plates (n=145) left significantly less food to waste (aver. 14,8g) than participants eating from standard plates (n=75) (aver. 20g) amounting to a reduction of 25,8%. Conclusions Our field experiment tests...

  5. UMRS LTRMP 2010/11 LCU Mapping -- Pool 18

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Aerial photographs for Pools 1-13 Upper Mississippi River System and Pools, Alton-Marseilles, Illinois River were collected in color infrared (CIR) in August of 2010...

  6. UMRS LTRMP 2010/11 LCU Mapping -- Pool 8

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Aerial photographs for Pools 1-13 Upper Mississippi River System and Pools, Alton-Marseilles, Illinois River were collected in color infrared (CIR) in August of 2010...

  7. UMRS LTRMP 2010/11 LCU Mapping -- Pool 4

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Aerial photographs for Pools 1-13 Upper Mississippi River System and Pools, Alton-Marseilles, Illinois River were collected in color infrared (CIR) in August of 2010...

  8. UMRS LTRMP 2010/11 LCU Mapping -- Pool 13

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Aerial photographs for Pools 1-13 Upper Mississippi River System and Pools, Alton-Marseilles, Illinois River were collected in color infrared (CIR) in August of 2010...

  9. UMRS LTRMP 2010/11 LCU Mapping -- Pool 6

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Aerial photographs for Pools 1-13 Upper Mississippi River System and Pools, Alton-Marseilles, Illinois River were collected in color infrared (CIR) in August of 2010...

  10. UMRS LTRMP 2010/11 LCU Mapping -- Pool 20

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Aerial photographs for Pools 1-13 Upper Mississippi River System and Pools, Alton-Marseilles, Illinois River were collected in color infrared (CIR) in August of 2010...

  11. UMRS LTRMP 2010/11 LCU Mapping -- Pool 21

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Aerial photographs for Pools 1-13 Upper Mississippi River System and Pools, Alton-Marseilles, Illinois River were collected in color infrared (CIR) in August of 2010...

  12. UMRS LTRMP 2010/11 LCU Mapping -- Pool 19

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Aerial photographs for Pools 1-13 Upper Mississippi River System and Pools, Alton-Marseilles, Illinois River were collected in color infrared (CIR) in August of 2010...

  13. UMRS LTRMP 2010/11 LCU Mapping -- Pool 24

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Aerial photographs for Pools 1-13 Upper Mississippi River System and Pools, Alton-Marseilles, Illinois River were collected in color infrared (CIR) in August of 2010...

  14. UMRS LTRMP 2010/11 LCU Mapping -- Pool 26

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Aerial photographs for Pools 1-13 Upper Mississippi River System and Pools, Alton-Marseilles, Illinois River were collected in color infrared (CIR) in August of 2010...

  15. UMRS LTRMP 2010/11 LCU Mapping -- Pool 14

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Aerial photographs for Pools 1-13 Upper Mississippi River System and Pools, Alton-Marseilles, Illinois River were collected in color infrared (CIR) in August of 2010...

  16. 47 CFR 52.20 - Thousands-block number pooling.

    Science.gov (United States)

    2010-10-01

    ... 52.20 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES... number pooling as a mandatory nationwide numbering resource optimization strategy, all carriers, except... implemented and in accordance with the national thousands-block number pooling framework and implementation...

  17. [Tiit Hennoste loengusarjast 'Hüpped modernismi poole'] / Hasso Krull

    Index Scriptorium Estoniae

    Krull, Hasso, 1964-

    1997-01-01

    Tiit Hennoste loengusarjast 'Hüpped modernismi poole : Eesti 20. sajandi kirjandusest Euroopa modernismi taustal' (1993, nr. 10 - 1997, nr. 10/11).Vastukaja: Hüpped modernismi poole: kajad ja vastukajad // Vikerkaar (1998) nr. 6, lk. 99-111

  18. UMRS LTRMP 2010/11 LCU Mapping -- Pool 09

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Aerial photographs for Pools 1-13 Upper Mississippi River System and Pools, Alton-Marseilles, Illinois River were collected in color infrared (CIR) in August of 2010...

  19. UMRS LTRMP 2010/11 LCU Mapping -- Pool 3

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Aerial photographs for Pools 1-13 Upper Mississippi River System and Pools, Alton-Marseilles, Illinois River were collected in color infrared (CIR) in August of 2010...

  20. UMRS LTRMP 2010/11 LCU Mapping -- Pool 25

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Aerial photographs for Pools 1-13 Upper Mississippi River System and Pools, Alton-Marseilles, Illinois River were collected in color infrared (CIR) in August of 2010...

  1. UMRS LTRMP 2010/11 LCU Mapping -- Pool 7

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Aerial photographs for Pools 1-13 Upper Mississippi River System and Pools, Alton-Marseilles, Illinois River were collected in color infrared (CIR) in August of 2010...

  2. UMRS LTRMP 2010/11 LCU Mapping -- Pool 5

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Aerial photographs for Pools 1-13 Upper Mississippi River System and Pools, Alton-Marseilles, Illinois River were collected in color infrared (CIR) in August of 2010...

  3. UMRS LTRMP 2010/11 LCU Mapping -- Pool 10

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Aerial photographs for Pools 1-13 Upper Mississippi River System and Pools, Alton-Marseilles, Illinois River were collected in color infrared (CIR) in August of 2010...

  4. UMRS LTRMP 2010/11 LCU Mapping -- Pool 22

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Aerial photographs for Pools 1-13 Upper Mississippi River System and Pools, Alton-Marseilles, Illinois River were collected in color infrared (CIR) in August of 2010...

  5. UMRS LTRMP 2010/11 LCU Mapping -- Pool 5a

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Aerial photographs for Pools 1-13 Upper Mississippi River System and Pools, Alton-Marseilles, Illinois River were collected in color infrared (CIR) in August of 2010...

  6. Hydrology of vernal pools at three sites, southern Sacramento Valley

    Science.gov (United States)

    2005-04-01

    The subsurface hydrology of vernal pools at three vernal pool complexes was investigated during three wet seasons in 2002- : 2004. The complexes were at Gridley Ranch, Valensin Ranch, and the Mather Field in northern California. The selected : comple...

  7. UMRS LTRMP 2010/11 LCU Mapping -- Pool 12

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Aerial photographs for Pools 1-13 Upper Mississippi River System and Pools, Alton-Marseilles, Illinois River were collected in color infrared (CIR) in August of 2010...

  8. A new pooling strategy for high-throughput screening: the Shifted Transversal Design

    Directory of Open Access Journals (Sweden)

    Thierry-Mieg Nicolas

    2006-01-01

    Full Text Available Abstract Background In binary high-throughput screening projects where the goal is the identification of low-frequency events, beyond the obvious issue of efficiency, false positives and false negatives are a major concern. Pooling constitutes a natural solution: it reduces the number of tests, while providing critical duplication of the individual experiments, thereby correcting for experimental noise. The main difficulty consists in designing the pools in a manner that is both efficient and robust: few pools should be necessary to correct the errors and identify the positives, yet the experiment should not be too vulnerable to biological shakiness. For example, some information should still be obtained even if there are slightly more positives or errors than expected. This is known as the group testing problem, or pooling problem. Results In this paper, we present a new non-adaptive combinatorial pooling design: the "shifted transversal design" (STD. It relies on arithmetics, and rests on two intuitive ideas: minimizing the co-occurrence of objects, and constructing pools of constant-sized intersections. We prove that it allows unambiguous decoding of noisy experimental observations. This design is highly flexible, and can be tailored to function robustly in a wide range of experimental settings (i.e., numbers of objects, fractions of positives, and expected error-rates. Furthermore, we show that our design compares favorably, in terms of efficiency, to the previously described non-adaptive combinatorial pooling designs. Conclusion This method is currently being validated by field-testing in the context of yeast-two-hybrid interactome mapping, in collaboration with Marc Vidal's lab at the Dana Farber Cancer Institute. Many similar projects could benefit from using the Shifted Transversal Design.

  9. The efficacy of detecting variants with small effects on the Affymetrix 6.0 platform using pooled DNA.

    Science.gov (United States)

    Chiang, Charleston W K; Gajdos, Zofia K Z; Korn, Joshua M; Butler, Johannah L; Hackett, Rachel; Guiducci, Candace; Nguyen, Thutrang T; Wilks, Rainford; Forrester, Terrence; Henderson, Katherine D; Le Marchand, Loic; Henderson, Brian E; Haiman, Christopher A; Cooper, Richard S; Lyon, Helen N; Zhu, Xiaofeng; McKenzie, Colin A; Palmert, Mark R; Hirschhorn, Joel N

    2011-11-01

    Genome-wide genotyping of a cohort using pools rather than individual samples has long been proposed as a cost-saving alternative for performing genome-wide association (GWA) studies. However, successful disease gene mapping using pooled genotyping has thus far been limited to detecting common variants with large effect sizes, which tend not to exist for many complex common diseases or traits. Therefore, for DNA pooling to be a viable strategy for conducting GWA studies, it is important to determine whether commonly used genome-wide SNP array platforms such as the Affymetrix 6.0 array can reliably detect common variants of small effect sizes using pooled DNA. Taking obesity and age at menarche as examples of human complex traits, we assessed the feasibility of genome-wide genotyping of pooled DNA as a single-stage design for phenotype association. By individually genotyping the top associations identified by pooling, we obtained a 14- to 16-fold enrichment of SNPs nominally associated with the phenotype, but we likely missed the top true associations. In addition, we assessed whether genotyping pooled DNA can serve as an inexpensive screen as the second stage of a multi-stage design with a large number of samples by comparing the most cost-effective 3-stage designs with 80% power to detect common variants with genotypic relative risk of 1.1, with and without pooling. Given the current state of the specific technology we employed and the associated genotyping costs, we showed through simulation that a design involving pooling would be 1.07 times more expensive than a design without pooling. Thus, while a significant amount of information exists within the data from pooled DNA, our analysis does not support genotyping pooled DNA as a means to efficiently identify common variants contributing small effects to phenotypes of interest. While our conclusions were based on the specific technology and study design we employed, the approach presented here will be useful for

  10. Estimating haplotype frequencies by combining data from large DNA pools with database information.

    Science.gov (United States)

    Gasbarra, Dario; Kulathinal, Sangita; Pirinen, Matti; Sillanpää, Mikko J

    2011-01-01

    We assume that allele frequency data have been extracted from several large DNA pools, each containing genetic material of up to hundreds of sampled individuals. Our goal is to estimate the haplotype frequencies among the sampled individuals by combining the pooled allele frequency data with prior knowledge about the set of possible haplotypes. Such prior information can be obtained, for example, from a database such as HapMap. We present a Bayesian haplotyping method for pooled DNA based on a continuous approximation of the multinomial distribution. The proposed method is applicable when the sizes of the DNA pools and/or the number of considered loci exceed the limits of several earlier methods. In the example analyses, the proposed model clearly outperforms a deterministic greedy algorithm on real data from the HapMap database. With a small number of loci, the performance of the proposed method is similar to that of an EM-algorithm, which uses a multinormal approximation for the pooled allele frequencies, but which does not utilize prior information about the haplotypes. The method has been implemented using Matlab and the code is available upon request from the authors.

  11. Exploring the Efficacy of Pooled Stools in Fecal Microbiota Transplantation for Microbiota-Associated Chronic Diseases.

    Directory of Open Access Journals (Sweden)

    Abbas Kazerouni

    Full Text Available Fecal microbiota transplantation is being assessed as a treatment for chronic microbiota-related diseases such as ulcerative colitis. Results from an initial randomized trial suggest that remission rates depend on unobservable features of the fecal donors and observable features of the patients. We use mathematical modeling to assess the efficacy of pooling stools from different donors during multiple rounds of treatment. In the model, there are two types of patients and two types of donors, where the patient type is observable and the donor type (effective or not effective is not observable. In the model, clinical outcomes from earlier rounds of treatment are used to estimate the current likelihood that each donor is effective, and then each patient in each round is treated by a pool of donors that are currently deemed to be the most effective. Relative to the no-pooling case, pools of size two or three significantly increase the proportion of patients in remission during the first several rounds of treatment. Although based on data from a single randomized trial, our modeling suggests that pooling of stools - via daily cycling of encapsulated stool from several different donors - may be beneficial in fecal microbiota transplantation for chronic microbiota-related diseases.

  12. Mercury concentrations and pools in four adjacent coniferous and deciduous upland forests in Beijing, China

    Science.gov (United States)

    Zhou, Jun; Wang, Zhangwei; Zhang, Xiaoshan; Gao, Yu

    2017-05-01

    Understanding of forest mercury (Hg) pools is important for quantifying the global atmospheric Hg removal. We studied gaseous elemental Hg (GEM) concentrations, litterfall Hg depositions, and pool sizes in four adjacent stands at Mount Dongling to assess Hg dynamics in the forested catchment and the potential of Hg release during wildfires. The average GEM concentration was 2.5 ± 0.5 ng m-3, about 1.5 times of the background levels in the Northern Hemisphere. In all four stands, Hg concentrations increase in the following order: bole wood biomass were comparable in the forests of larch, oak, and Chinese pine, which were much greater than that of mixed broadleaf stands due to lower biomass. The total Hg pools in ecosystems were similar in the four stands, because of the comparable Hg pool in the soil horizons (0-40 cm), which accounted for over 97% of the total ecosystem Hg storage in the four stands. Although Hg pools of the forest ecosystem in north China were comparable to North America and North Europe, Hg storage in forests constituted a high threat for large Hg emission pulses to the atmosphere by wildfires. The potential Hg emissions from the combustion at the four stands were ranged from 0.675 to 1.696 mg m-2.

  13. Heat transfer characteristics of a non-boiling pool with spatially uniform gas injection. [LMFBR

    Energy Technology Data Exchange (ETDEWEB)

    Ganguli, A.; Luk, A.; Bankoff, S.G.

    1978-12-01

    It is possible to encounter molten fuel pools in the course of events during a hypothetical Liquid Metal Fast Breeder Reactor accident. In such cases it may be important to estimate correctly the rate of melting of the pool walls and bottom, which are governed by the rate of heat transfer to those materials. The heat transfer characteristics of internally heated two-phase pools are thus of interest. Heat transfer measurements were made in the horizontal and downward directions both in transient and in steady state. The transient study involved slow cooling or heating of the pool liquid, while in the steady state case heat was provided by electrical immersion heaters. A permanent gas was injected from a distributed hypodermic tubing network with two hole sizes. Void fraction measurements were also made by static pressure probes. The data is reported as plots of Nusselts number versus Reynolds number and surface evaporation and entrainment effects for a boiling pool were estimated for comparison purposes.

  14. Exploring the Efficacy of Pooled Stools in Fecal Microbiota Transplantation for Microbiota-Associated Chronic Diseases.

    Science.gov (United States)

    Kazerouni, Abbas; Wein, Lawrence M

    2017-01-01

    Fecal microbiota transplantation is being assessed as a treatment for chronic microbiota-related diseases such as ulcerative colitis. Results from an initial randomized trial suggest that remission rates depend on unobservable features of the fecal donors and observable features of the patients. We use mathematical modeling to assess the efficacy of pooling stools from different donors during multiple rounds of treatment. In the model, there are two types of patients and two types of donors, where the patient type is observable and the donor type (effective or not effective) is not observable. In the model, clinical outcomes from earlier rounds of treatment are used to estimate the current likelihood that each donor is effective, and then each patient in each round is treated by a pool of donors that are currently deemed to be the most effective. Relative to the no-pooling case, pools of size two or three significantly increase the proportion of patients in remission during the first several rounds of treatment. Although based on data from a single randomized trial, our modeling suggests that pooling of stools - via daily cycling of encapsulated stool from several different donors - may be beneficial in fecal microbiota transplantation for chronic microbiota-related diseases.

  15. Technical bases and user's manual for the prototype of a Suppression Pool Aerosol Removal Code (SPARC)

    Energy Technology Data Exchange (ETDEWEB)

    Owczarski, P.C.; Schreck, R.I.; Postma, A.K.

    1985-05-01

    This code was written to calculate the capture of aerosol particles in the pressure suppression pool (wet well) of a boiling water reactor under hypothetical accident conditions. The code incorporates five aerosol scrubbing models and two thermal-hydraulic models. The scrubbing models describe (1) steam condensation, (2) soluble particle growth in a humid atmosphere, (3) gravitational settling, (4) inertial deposition, (5) diffusional deposition. Mechanical entrainment of pool liquid by breaking of bubbles at the surface was also considered. An optional model for equilibrium pool temperature and a model for steam evaporation are the two thermal-hydraulic models used in the code. Steam evaporation was found to significantly retard deposition processes in pools near the boiling point. The code user supplies the values of several controlling variables in the code input. The SPARC output can include the decontamination factors (DF) of twenty different particle size groups, an overall DF for the whole particle distribution, particle log normal distribution parameters, and mass flow rates of particles (wet and dry) leaving the pool.

  16. Well-characterized open pool experiment data and analysis for model validation and development.

    Energy Technology Data Exchange (ETDEWEB)

    Sundberg, David W.; Brown, Alexander L.; Blanchat, Thomas K.

    2006-12-01

    Four Well-Characterized Open Pool fires were conducted by Fire Science and Technology Department. The focus of the Well-Characterized Open Pool fire series was to provide environmental information for open pool fires on a physics first principal basis. The experiments measured the burning rate of liquid fuel in an open pool and the resultant heat flux to a weapon-sized object and the surrounding environment with well-characterized boundary and initial conditions. Results presented in this report include a general description of test observation (pre- and post-test), wind measurements, fire plume topology, average fuel recession and heat release rates, and incident heat flux to the pool and to the calorimeters. As expected, results of the experiments show a strong correlation between wind conditions, fuel vaporization (mass loss) rate, and incident heat flux to the fuel and ground surface and calorimeters. Numerical fire simulations using both temporally- and spatially-dependant wind boundary conditions were performed using the Vulcan fire code. Comparisons of data to simulation predictions showed similar trends; however, simulation-predicted incident heat fluxes were lower than measured.

  17. Mitigating the impact of swimming pools on domestic water demand ...

    African Journals Online (AJOL)

    ... the impact that swimming pools have on domestic water demand. The results support the contention that properties with swimming pools use significantly more water than those without. This study estimated the additional demand resulting from swimming pools at between 2.2–2.4 kℓ/month or 7–8% of total water demand.

  18. Using "residual depths" to monitor pool depths independently of discharge

    Science.gov (United States)

    Thomas E. Lisle

    1987-01-01

    As vital components of habitat for stream fishes, pools are often monitored to follow the effects of enhancement projects and natural stream processes. Variations of water depth with discharge, however, can complicate monitoring changes in the depth and volume of pools. To subtract the effect of discharge on depth in pools, residual depths can be measured. Residual...

  19. NACUBO's Guide to Unitizing Investment Pools. Second Edition

    Science.gov (United States)

    Wheeler, Mary S.

    2011-01-01

    The National Association of College and University Business Officers' (NACUBO's) "Guide to Unitizing Investment Pools" addresses the principles and concepts for administering a consolidated investment pool. Unitization is the mechanism by which investment funds are pooled to maximize investment efficiencies and provide information for donors,…

  20. 17 CFR 4.22 - Reporting to pool participants.

    Science.gov (United States)

    2010-04-01

    ..., the financial statements are not required to include consolidated information for all series. (7) For... event that the International Financial Reporting Standards require consolidated financial statements for... reporting pool's consolidated financial statements. (ii) The commodity pool operator of a pool that meets...

  1. Pool boiling visualization on open microchannel surfaces

    Directory of Open Access Journals (Sweden)

    Kaniowski Robert

    2017-01-01

    Full Text Available The paper presents visualization investigations into pool boiling heat transfer for open minichannel surfaces. The experiments were carried out wih saturated water at atmospheric pressure. Parallel microchannels fabricated by machining were about 0.3 mm wide and 0.2 to 0.4 mm deep. High-speed videos were used as an aid to understanding the heat transfer mechanism. The visualization study aimed at identifying nucleation sites of the departing bubbles and determining their diameters and frequency at various superheats.

  2. Validation of test portion pooling for Salmonella spp. detection in foods.

    Science.gov (United States)

    Tomás Fornés, David; McMahon, Wendy; Moulin, Julie; Klijn, Adrianne

    2017-03-20

    Pathogen monitoring programs play a crucial role in the verification of the effectiveness of implemented hygiene control measures. Sampling and testing procedures included in pathogen monitoring involve the analysis of multiple test portions where all samples must be negative for the presence of pathogens for a certain test portion size. Many food safety programs require increased testing due to the risks that a pathogen may be present. Analyzing more than one test portion could prove to be expensive and labor intensive. When more than one test portion for a specified food item is to be tested, the test portions could be combined to form a pooled test portion to reduce laboratory workload, costs of reagents and further confirmatory steps, but only when evidence is available that pooling does not affect on the number of false negative results for different matrices. This study has been performed to demonstrate the equivalence of test portion pooling for Salmonella detection with five different methods using cultural, ELISA and Real Time PCR technologies. Twenty-three (23) different food items including confectionary products, meal components, infant formula, pet food and powdered beverages were validated. Other complementary parameters like impact of minimum and maximum incubation time for pre-enrichment, temperature profile, pH and Salmonella concentration after the pre-enrichment and background flora have also been considered in the study. The results showed that pooling test portions up to 375g for Salmonella detection is valid for the methods that were tested. Relative level of detection (RLOD50) values for 22 of the food items tested were acceptable (i.e. lower than 2.5) when comparing the reference sample size (25g) against the alternative pooled sample size (375g), provided the enrichment broth was pre-warmed and maximum incubation time is respected. Copyright © 2017 Elsevier B.V. All rights reserved.

  3. Rapidly exchangeable pool study of zinc in free-living or institutionalized elderly women.

    Science.gov (United States)

    Faure, Patrice; Ducros, Véronique; Couzy, François; Favier, Alain; Ferry, Monique

    2005-01-01

    We evaluated the effect of age and institutionalization on zinc metabolism by using a stable isotope technique. This was a randomized case-control study. Three groups were recruited: nine young women (group 1, ages 36+/-1 y) as controls, nine free-living elderly women (group 2, ages 72+/-2 y), and nine institutionalized women (group 3, ages 73+/-2 y). Only women were recruited to obtain homogeneous groups. The study was set in a Valence hospital (France) in the geriatric department (headed by Dr. Ferry). The experimental design of the study was reviewed and approved by the local ethical committee, and all participants signed a consent form. No subject dropped out of the study. A zinc stable isotope label (0.73 mg of (70)Zn) was injected intravenously into patients and measured by inductively coupled plasma mass spectrometry. Decay curves of the plasma (70)Zn followed a one-compartment kinetic leading to the determination of one pool. The size of this pool suggested that it corresponded to the liver compartment. The size of this pool was significantly smaller in elderly people. (70)Zn plasma resident time was significantly longer in elderly individuals, and shorter in institutionalized than in free-living elderly subjects. These data suggest that the zinc metabolism of elderly women is related to lifestyle or its consequences and to age. Moreover, we have demonstrated that kinetic studies using stable isotopes of zinc can provide novel information on exchangeable zinc pools in clinical situations.

  4. Are Fast Food “Trans-Fat” Claims True? An Infraspec VFA-IR Spectrometer Analysis of Trans-fat content in select food items purchased from Long John Silver’s

    Directory of Open Access Journals (Sweden)

    Sharron Jenkins

    2014-10-01

    Full Text Available Studies linking high trans-fat diets to coronary heart disease (CHD have prompted the need to regulate, limit, or completely ban trans-fat from all commercial food products, including fast foods. Many U.S. fast food chains now claim that their food items, particularly French fries, have "no trans-fat". In a previous study, our lab tested the validity of trans-fat claims made by several popular fast food restaurants by experimentally determining the %trans-fat in oil extracted from fast food French fries. In some cases, the trans-fat content was nearly twice as high as the amount reported by the restaurant in their literature. Long John Silver's, for example, reported a trans-fat content of 25% for their French fries, while our lab actually found over 40% trans-fat. The purpose of this study is to broaden our study of Long John Silver's trans-fat claims by analyzing a variety of their food items and comparing our findings with the %trans-fat reported by the restaurant literature (nutrition fact tables. Variable Filter Array (VFA IR spectroscopy was used to assess the trans-fat content of oil extracted from food samples. Our preliminary findings suggest that nearly every food item under study contained considerably more trans-fat than the amount reported in the restaurant’s literature.

  5. Hardening Stratum, the Bitcoin Pool Mining Protocol

    Directory of Open Access Journals (Sweden)

    Recabarren Ruben

    2017-07-01

    Full Text Available Stratum, the de-facto mining communication protocol used by blockchain based cryptocurrency systems, enables miners to reliably and efficiently fetch jobs from mining pool servers. In this paper we exploit Stratum’s lack of encryption to develop passive and active attacks on Bitcoin’s mining protocol, with important implications on the privacy, security and even safety of mining equipment owners. We introduce StraTap and ISP Log attacks, that infer miner earnings if given access to miner communications, or even their logs. We develop BiteCoin, an active attack that hijacks shares submitted by miners, and their associated payouts. We build BiteCoin on WireGhost, a tool we developed to hijack and surreptitiously maintain Stratum connections. Our attacks reveal that securing Stratum through pervasive encryption is not only undesirable (due to large overheads, but also ineffective: an adversary can predict miner earnings even when given access to only packet timestamps. Instead, we devise Bedrock, a minimalistic Stratum extension that protects the privacy and security of mining participants. We introduce and leverage the mining cookie concept, a secret that each miner shares with the pool and includes in its puzzle computations, and that prevents attackers from reconstructing or hijacking the puzzles.

  6. Reduction of the pool-top radiation level in HANARO

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Choong-Sung; Park, Sang-Jun; Kim, Heonil; Park, Yong-Chul; Choi, Young-San [HANARO Center, Korea Atomic Energy Research Institute, Taejon (Korea)

    1999-08-01

    HANARO is an open-tank-in-pool type reactor. Pool water is the only shielding to minimize the pool top radiation level. During the power ascension test of HANARO, the measured pool top radiation level was higher than the design value because some of the activation products in the coolant reached the pool surface. In order to suppress this rising coolant, the hot water layer system (HWL) was designed and installed to maintain l.2 meter-deep hot water layer whose temperature is 5degC higher than that of the underneath pool surface. After the installation of the HWL system, however, the radiation level of the pool-top did not satisfy the design value. The operation modes of the hot water layer system and the other systems in the reactor pool, which had an effect on the formation of the hot water layer, were changed to reduce pool-top radiation level. After the above efforts, the temperature and the radioactivity distribution in the pool was measured to confirm whether this system blocked the rising coolant. The radiation level at the pool-top was significantly reduced below one tenth of that before installing the HWL and satisfied the design value. It was also confirmed by calculation that this hot water layer system would significantly reduce the release of fission gases to the reactor hall and the environment during the hypothetical accident as well. (author)

  7. Plant diversity associated with pools in natural and restored peatlands

    Directory of Open Access Journals (Sweden)

    N. Fontaine

    2007-06-01

    Full Text Available This study describes plant assemblages associated with the edges of peatland pools. We conducted inventories in six natural peatlands in the province of Québec (Canada in order to measure the contribution of pools to species diversity in climatic regions where peatlands are used for peat extraction. We also carried out vegetation surveys in a peatland that has been restored after peat extraction/harvesting to determine whether pool vegetation establishes along the edges of created pools when dry surface restoration techniques only are used. Pools enhanced plant species richness in natural peatlands. Around created pools, species associated with natural pools were still absent, and non-bog species were present, six years after restoration. On this basis, we emphasise the importance of preserving natural peatlands with pools. In order to restore fully the plant diversity associated with peatlands at harvested sites, it may be necessary to modify pool excavation techniques so that created pools resemble more closely those in natural peatlands. Active introduction of the plant species or communities associated with natural pools may also be needed; candidate species for North America include Andromeda glaucophylla, Cladopodiella fluitans, Carex limosa, Eriophorum virginicum, Rhynchospora alba and Sphagnum cuspidatum.

  8. Investigation of the condition of spent-fuel pool components

    Energy Technology Data Exchange (ETDEWEB)

    Kustas, F.M.; Bates, S.O.; Opitz, B.E.; Johnson, A.B. Jr.; Perez, J.M. Jr.; Farnsworth, R.K.

    1981-09-01

    It is currently projected that spent nuclear fuel, which is discharged from the reactor and then stored in water pools, may remain in those pools for several decades. Other studies have addressed the expected integrity of the spent fuel during extended water storage; this study assesses the integrity of metallic spent fuel pool components. Results from metallurgical examinations of specimens taken from stainless steel and aluminum components exposed in spent fuel pools are presented. Licensee Event Reports (LERs) relating to problems with spent fuel components were assessed and are summarized to define the types of operational problems that have occurred. The major conclusions of this study are: aluminum and stainless steel spent fuel pool components have a good history of performance in both deionized and borated water pools. Although some operational problems involving pool components have occurred, these problems have had minimal impacts.

  9. Design of inventory pools in spare part support operation systems

    Science.gov (United States)

    Mo, Daniel Y.; Tseng, Mitchell M.; Cheung, Raymond K.

    2014-06-01

    The objective of a spare part support operation is to fulfill the part request order with different service contracts in the agreed response time. With this objective to achieve different service targets for multiple service contracts and the considerations of inventory investment, it is not only important to determine the inventory policy but also to design the structure of inventory pools and the order fulfilment strategies. In this research, we focused on two types of inventory pools: multiple inventory pool (MIP) and consolidated inventory pool (CIP). The idea of MIP is to maintain separated inventory pools based on the types of service contract, while CIP solely maintains a single inventory pool regardless of service contract. Our research aims to design the inventory pool analytically and propose reserve strategies to manage the order fulfilment risks in CIP. Mathematical models and simulation experiments would be applied for analysis and evaluation.

  10. The La Hague pools; Les piscines de La Hague

    Energy Technology Data Exchange (ETDEWEB)

    Zerbib, Jean-Claude; Quetel, Ghislain; Guillemette, Andre

    2011-12-08

    As the Fukushima accident highlighted the possibility of an unforeseen event, and the difficulties to manage at the same time the cooling of the core cooling and of the pool in which used fuel is stored during one or two years, this report addresses the safety issues for storage pools such as those present on the AREVA site in La Hague. The authors recall and discuss some design aspects, notably those regarding seismic resistance and the existence of a breach. They describe and comment how these pools are managed as far as fuel assembly downloading, pool water contamination, thermal exchange between irradiated fuels and pool waters, and pool content evolution are concerned. Then, they focus on pool seismic resistance, on water supply capacities, on other safety criteria, and on risk management. They finally draw some lessons from the Fukushima accident

  11. GWAlpha: genome-wide estimation of additive effects (alpha) based on trait quantile distribution from pool-sequencing experiments.

    Science.gov (United States)

    Fournier-Level, Alexandre; Robin, Charles; Balding, David J

    2017-04-15

    Sequencing pools of individuals (Pool-Seq) is a cost-effective way to gain insight into the genetics of complex traits, but as yet no parametric method has been developed to both test for genetic effects and estimate their magnitude. Here, we propose GWAlpha, a flexible method to obtain parametric estimates of genetic effects genome-wide from Pool-Seq experiments. We showed that GWAlpha powerfully replicates the results of Genome-Wide Association Studies (GWAS) from model organisms. We perform simulation studies that illustrate the effect on power of sample size and number of pools and test the method on different experimental data. GWAlpha is implemented in python, designed to run on Linux operating system and tested on Mac OS. It is freely available at https://github.com/aflevel/GWAlpha . afournier@unimelb.edu.au. Supplementary data are available at Bioinformatics online.

  12. Realization of standard synergy in the pool; Regelsynergie im Pool verwirklicht

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    2012-04-15

    The supply of balancing energy can be profitable for operators of biogas plants. The necessary know-how for the marketing at the stock market and the technical interconnection to a virtual power plant pool is a challenge that can be implemented with a service provider.

  13. Expanding the live kidney donor pool: ethical considerations regarding altruistic donors, paired and pooled programs.

    Science.gov (United States)

    Patel, Shaneel Rajendra; Chadha, Priyanka; Papalois, Vassilios

    2011-06-01

    In renal transplant, there is a well-known deficiency in organ supply relative to demand. Live donation provides superior results when compared with deceased donation including a better rate of graft success and fewer immunologic complications. This deficiency in organs leads to significant morbidity and mortality rates. Alternative avenues have been extensively explored that may expand the live donor pool. They include altruistic donation as well as paired and pooled exchange programs. Altruistic donation is a truly selfless act from a donor unknown to the recipient. Kidney paired donation involves 2 incompatible donor-recipient pairs swapping donors to produce compatibility. Pooled donation involves at least 2 pairs, and can take the form of domino chains in which altruistic input sets up a chain of transplants, in which each recipient's incompatible donor makes a donation for the next recipient. Despite application of these various methods, there lie extensive ethical issues surrounding them. Misconceptions frequently occur; for instance, the perceived benefit that donating an organ to a loved one is greater for a related donor than for an altruistic one. Additionally, it is frequently believed that immunologic incompatibility offers coerced donors liberation from surgery, and that overcoming these barriers by introducing exchange programs provides vulnerable donors less protection. This article explores these and other complex ethical issues surrounding the various methods of expanding the donor pool. The authors offer opinions that challenge the ethical issues and attempt to overcome those views that hinder progress in the field.

  14. Rhizosphere size

    Science.gov (United States)

    Kuzyakov, Yakov; Razavi, Bahar

    2017-04-01

    Estimation of the soil volume affected by roots - the rhizosphere - is crucial to assess the effects of plants on properties and processes in soils and dynamics of nutrients, water, microorganisms and soil organic matter. The challenges to assess the rhizosphere size are: 1) the continuum of properties between the root surface and root-free soil, 2) differences in the distributions of various properties (carbon, microorganisms and their activities, various nutrients, enzymes, etc.) along and across the roots, 3) temporal changes of properties and processes. Thus, to describe the rhizosphere size and root effects, a holistic approach is necessary. We collected literature and own data on the rhizosphere gradients of a broad range of physico-chemical and biological properties: pH, CO2, oxygen, redox potential, water uptake, various nutrients (C, N, P, K, Ca, Mg, Mn and Fe), organic compounds (glucose, carboxylic acids, amino acids), activities of enzymes of C, N, P and S cycles. The collected data were obtained based on the destructive approaches (thin layer slicing), rhizotron studies and in situ visualization techniques: optodes, zymography, sensitive gels, 14C and neutron imaging. The root effects were pronounced from less than 0.5 mm (nutrients with slow diffusion) up to more than 50 mm (for gases). However, the most common effects were between 1 - 10 mm. Sharp gradients (e.g. for P, carboxylic acids, enzyme activities) allowed to calculate clear rhizosphere boundaries and so, the soil volume affected by roots. The first analyses were done to assess the effects of soil texture and moisture as well as root system and age on these gradients. The most properties can be described by two curve types: exponential saturation and S curve, each with increasing and decreasing concentration profiles from the root surface. The gradient based distribution functions were calculated and used to extrapolate on the whole soil depending on the root density and rooting intensity. We

  15. Overlooked Mountain Rock Pools in Deserts Are Critical Local Hotspots of Biodiversity

    OpenAIRE

    Vale, C?ndida Gomes; Pimm, Stuart L.; Brito, Jos? Carlos

    2015-01-01

    Background The world is undergoing exceptional biodiversity loss. Most conservation efforts target biodiversity hotspots at large scales. Such approach overlooks small-sized local hotspots, which may be rich in endemic and highly threatened species. We explore the importance of mountain rock pools (gueltas) as local biodiversity hotspots in the Sahara-Sahel. Specifically, we considered how many vertebrates (total and endemics) use gueltas, what factors predict species richness, and which guel...

  16. ViPAR: a software platform for the Virtual Pooling and Analysis of Research Data.

    Science.gov (United States)

    Carter, Kim W; Francis, Richard W; Carter, K W; Francis, R W; Bresnahan, M; Gissler, M; Grønborg, T K; Gross, R; Gunnes, N; Hammond, G; Hornig, M; Hultman, C M; Huttunen, J; Langridge, A; Leonard, H; Newman, S; Parner, E T; Petersson, G; Reichenberg, A; Sandin, S; Schendel, D E; Schalkwyk, L; Sourander, A; Steadman, C; Stoltenberg, C; Suominen, A; Surén, P; Susser, E; Sylvester Vethanayagam, A; Yusof, Z

    2015-10-08

    Research studies exploring the determinants of disease require sufficient statistical power to detect meaningful effects. Sample size is often increased through centralized pooling of disparately located datasets, though ethical, privacy and data ownership issues can often hamper this process. Methods that facilitate the sharing of research data that are sympathetic with these issues and which allow flexible and detailed statistical analyses are therefore in critical need. We have created a software platform for the Virtual Pooling and Analysis of Research data (ViPAR), which employs free and open source methods to provide researchers with a web-based platform to analyse datasets housed in disparate locations. Database federation permits controlled access to remotely located datasets from a central location. The Secure Shell protocol allows data to be securely exchanged between devices over an insecure network. ViPAR combines these free technologies into a solution that facilitates 'virtual pooling' where data can be temporarily pooled into computer memory and made available for analysis without the need for permanent central storage. Within the ViPAR infrastructure, remote sites manage their own harmonized research dataset in a database hosted at their site, while a central server hosts the data federation component and a secure analysis portal. When an analysis is initiated, requested data are retrieved from each remote site and virtually pooled at the central site. The data are then analysed by statistical software and, on completion, results of the analysis are returned to the user and the virtually pooled data are removed from memory. ViPAR is a secure, flexible and powerful analysis platform built on open source technology that is currently in use by large international consortia, and is made publicly available at [http://bioinformatics.childhealthresearch.org.au/software/vipar/]. © The Author 2015. Published by Oxford University Press on behalf of the

  17. Assessment of skewed exposure in case-control studies with pooling.

    Science.gov (United States)

    Whitcomb, Brian W; Perkins, Neil J; Zhang, Zhiwei; Ye, Aijun; Lyles, Robert H

    2012-09-28

    Pooling-based strategies that combine samples from multiple participants for laboratory assays have been proposed for epidemiologic investigations of biomarkers to address issues including cost, efficiency, detection, and when minimal sample volume is available. A modification of the standard logistic regression model has been previously described to allow use with pooled data; however, this model makes assumptions regarding exposure distribution and logit-linearity of risk (i.e., constant odds ratio) that can be violated in practice. We were motivated by a nested case-control study of miscarriage and inflammatory factors with highly skewed distributions to develop a more flexible model for analysis of pooled data. Using characteristics of the gamma distribution and the relation between models of binary outcome conditional on exposure and of exposure conditional on outcome, we use a modified logistic regression to accommodate nonlinearity because of unequal shape parameters in gamma distributed exposure for cases and controls. Using simulations, we compare our approach with existing methods for logistic regression for pooled data considering: (1) constant and dose-dependent effects; (2) gamma and log-normal distributed exposure; (3) effect size; and (4) the proportions of biospecimens pooled. We show that our approach allows estimation of odds ratios that vary with exposure level, yet has minimal loss of efficiency compared with existing approaches when exposure effects are dose-invariant. Our model performed similarly to a maximum likelihood estimation approach in terms of bias and efficiency, and provides an easily implemented approach for estimation with pooled biomarker data when effects may not be constant across exposure. Copyright © 2012 John Wiley & Sons, Ltd.

  18. Technical Facilities Management, Loan Pool, and Calibration

    Science.gov (United States)

    Smith, Jacob

    2011-01-01

    My work at JPL for the SURF program began on June 11, 2012 with the Technical Facilities Management group (TFM). As well as TFM, I worked with Loan Pool and Metrology to help them out with various tasks. Unlike a lot of other interns, I did not have a specific project rather many different tasks to be completed over the course of the 10 weeks.The first task to be completed was to sort through old certification reports in 6 different boxes to locate reports that needed to be archived into a digital database. There were no reports within these boxes that needed to be archived but rather were to be shredded. The reports went back to the early 1980's and up to the early 2000's. I was looking for reports dated from 2002 to 2012

  19. Drop Impact on to Moving Liquid Pools

    Science.gov (United States)

    Muñoz-Sánchez, Beatriz Natividad; Castrejón-Pita, José Rafael; Castrejón-Pita, Alfonso Arturo; Hutchings, Ian M.

    2014-11-01

    The deposition of droplets on to moving liquid substrates is an omnipresent situation both in nature and industry. A diverse spectrum of phenomena emerges from this simple process. In this work we present a parametric experimental study that discerns the dynamics of the impact in terms of the physical properties of the fluid and the relative velocity between the impacting drop and the moving liquid pool. The behaviour ranges from smooth coalescence (characterized by little mixing) to violent splashing (generation of multiple satellite droplets and interfacial vorticity). In addition, transitional regimes such as bouncing and surfing are also found. We classify the system dynamics and show a parametric diagram for the conditions of each regime. This work was supported by the EPSRC (Grant EP/H018913/1), the Royal Society, Becas Santander Universidades and the International Relationships Office of the University of Extremadura.

  20. One knowledge base or many knowledge pools?

    DEFF Research Database (Denmark)

    Lundvall, Bengt-Åke

    It is increasingly realized that knowledge is the most important resource and that learning is the most important process in the economy. Sometimes this is expressed by coining the current era as characterised by a ‘knowledge based economy'. But this concept might be misleading by indicating...... that there is one common knowledge base on which economic activities can be built. In this paper we argue that it is more appropriate to see the economy as connecting to different ‘pools of knowledge'. The argument is built upon a conceptual framework where we make distinctions between private/public, local....../global, individual/collective and tacit/codified knowledge. The purpose is both ‘academic' and practical. Our analysis demonstrates the limits of a narrowly economic perspective on knowledge and we show that these distinctions have important implications both for innovation policy and for management of innovation....

  1. Soil carbon pools in different pasture systems

    Directory of Open Access Journals (Sweden)

    Francisco M. Cardozo, Jr.

    2016-03-01

    Full Text Available The aim of this study was to assess the carbon pools of a tropical soil where the native forest was replaced with different pasture systems. We studied five pasture production systems, including four monoculture systems with forage grasses such as Andropogon, Brachiaria, Panicum, and Cynodon, and an agroforestry system as well as a native vegetation plot. Greater availability of fulvic acid was detected in the agroforestry system as compared with that in the other systems. Higher lability of C was detected in the Andropogon system during the dry and rainy seasons and during the dry season in Cynodon. During the dry season, all pastures systems showed deficits in the net removal of atmospheric CO2. The structure and practices of the agroforestry system enables more carbon to be sequestered in the soil as compared with the monoculture pasture, suggesting that it is an important practice to mitigate climatic change and to improve soil quality.

  2. Pooling birth cohorts in allergy and asthma

    DEFF Research Database (Denmark)

    Bousquet, Jean; Anto, Josep; Sunyer, Jordi

    2013-01-01

    in the world over the past 30 years. Since 2004, several research initiatives funded under the EU Framework Program for Research and Technological Development FP6-FP7 have attempted to identify, compare, and evaluate pooling data from existing European birth cohorts (GA(2)LEN: Global Allergy and European...... Network, FP6; ENRIECO: Environmental Health Risks in European Birth Cohorts, FP7; CHICOS: Developing a Child Cohort Research Strategy for Europe, FP7; MeDALL: Mechanisms of the Development of ALLergy, FP7). However, there is a general lack of knowledge about these initiatives and their potentials. The aim...... of this paper is to review current and past EU-funded projects in order to make a summary of their goals and achievements and to suggest future research needs of these European birth cohort networks....

  3. Statistical implications of pooling RNA samples for microarray experiments

    Directory of Open Access Journals (Sweden)

    Landfield Philip W

    2003-06-01

    Full Text Available Abstract Background Microarray technology has become a very important tool for studying gene expression profiles under various conditions. Biologists often pool RNA samples extracted from different subjects onto a single microarray chip to help defray the cost of microarray experiments as well as to correct for the technical difficulty in getting sufficient RNA from a single subject. However, the statistical, technical and financial implications of pooling have not been explicitly investigated. Results Modeling the resulting gene expression from sample pooling as a mixture of individual responses, we derived expressions for the experimental error and provided both upper and lower bounds for its value in terms of the variability among individuals and the number of RNA samples pooled. Using "virtual" pooling of data from real experiments and computer simulations, we investigated the statistical properties of RNA sample pooling. Our study reveals that pooling biological samples appropriately is statistically valid and efficient for microarray experiments. Furthermore, optimal pooling design(s can be found to meet statistical requirements while minimizing total cost. Conclusions Appropriate RNA pooling can provide equivalent power and improve efficiency and cost-effectiveness for microarray experiments with a modest increase in total number of subjects. Pooling schemes in terms of replicates of subjects and arrays can be compared before experiments are conducted.

  4. Blood-pool contrast agent for pre-clinical computed tomography

    Science.gov (United States)

    Cruje, Charmainne; Tse, Justin J.; Holdsworth, David W.; Gillies, Elizabeth R.; Drangova, Maria

    2017-03-01

    Advances in nanotechnology have led to the development of blood-pool contrast agents for micro-computed tomography (micro-CT). Although long-circulating nanoparticle-based agents exist for micro-CT, they are predominantly based on iodine, which has a low atomic number. Micro-CT contrast increases when using elements with higher atomic numbers (i.e. lanthanides), particularly at higher energies. The purpose of our work was to develop and evaluate a lanthanide-based blood-pool contrast agent that is suitable for in vivo micro-CT. We synthesized a contrast agent in the form of polymer-encapsulated Gd nanoparticles and evaluated its stability in vitro. The synthesized nanoparticles were shown to have an average diameter of 127 +/- 6 nm, with good size dispersity. Particle size distribution - evaluated by dynamic light scattering over the period of two days - demonstrated no change in size of the contrast agent in water and saline. Additionally, our contrast agent was stable in a mouse serum mimic for up to 30 minutes. CT images of the synthesized contrast agent (containing 27 mg/mL of Gd) demonstrated an attenuation of over 1000 Hounsfield Units. This approach to synthesizing a Gd-based blood-pool contrast agent promises to enhance the capabilities of micro-CT imaging.

  5. Active accumulation of internal DIC pools reduces transport limitation in large colonies of Nostoc pruniforme

    DEFF Research Database (Denmark)

    Raun, Ane-Marie Løvendahl; Borum, Jens; Jensen, Kaj Sand

    2009-01-01

    specifically examined how N. pruniforme copes with the acquisition of dissolved inorganic carbon (DIC) for photosynthesis. The results showed that N. pruniforme elevates its functional SA/V considerably by locating the cyanobacterial trichomes primarily in the outer shell, while the inner mucus...... of polysaccharides contains declining densities of trichomes with increasing colony size. N. pruniforme is a very efficient bicarbonate (HCO3-) user and, in addition, actively accumulates large pools of DIC that can support net photosynthesis for >22 h without a supply of external DIC. Both the efficient HCO3......- utilization and the large internal DIC pools greatly reduce N. pruniforme dependence on the immediate availability and species of external DIC. The location of the trichomes in the shell, the HCO3- utilization and the internal DIC pools mean that colony size only has a minor effect on photosynthetic rates...

  6. Sharing as risk pooling in a social dilemma experiment

    Directory of Open Access Journals (Sweden)

    Todd L. Cherry

    2015-03-01

    Full Text Available In rural economies with missing or incomplete markets, idiosyncratic risk is frequently pooled through informal networks. Idiosyncratic shocks, however, are not limited to private goods but can also restrict an individual from partaking in or benefiting from a collective activity. In these situations, a group must decide whether to provide insurance to the affected member. We describe results of a laboratory experiment designed to test whether a simple sharing institution can sustain risk pooling in a social dilemma with idiosyncratic risk. We tested whether risk could be pooled without a commitment device and, separately, whether effective risk pooling induced greater cooperation in the social dilemma. We found that even in the absence of a commitment device or reputational considerations, subjects voluntarily pooled risk, thereby reducing variance in individual earnings. In spite of effective risk pooling, however, cooperation in the social dilemma was unaffected.

  7. Dehumidification by heat pump in indoor swimming pools

    Energy Technology Data Exchange (ETDEWEB)

    Eymery, J.C. (Electricite de France, 75 - Paris)

    1982-10-01

    The values of the quantity of water evaporated in an indoor swimming pool are determined and technical alternatives for dehumidification are discussed; standard process by air replacement; new process by heat pump, with recovery of the latent heat of the moist air in the swimming pool hall. The author offers an example of the dimensioning of the heat pump and gives energy balances (fuel and electricity comsumption) of existing swimming pools equipped subsequently.

  8. Evaluation of clinical trials by Ethics Committees in Germany – results and a comparison of two surveys performed among members of the German Association of Research-Based Pharmaceutical Companies (vfa

    Directory of Open Access Journals (Sweden)

    Russ, Hagen

    2015-01-01

    Full Text Available [english] Objective: The objective of this project was to evaluate the quality and quantity of initial applications for a clinical trial according to § 7 of the German Good Clinical Practice (GCP ordinance (German: GCP-Verordnung, GCP-V, the quality of evaluations of those applications by Ethics Committees (ECs/Investigational Review Boards (IRBs in Germany as well as the pattern of EC objections in their reasoned opinions (vote. In order to identify a change over time, the results of the present survey were also compared with a survey performed in 2008.Methods: Based on reasoned opinions issued by the respective EC in charge of the coordinating principle investigator (coordinating EC in 2011, a written survey among members of the German Association of Research-Based Pharmaceutical Companies (vfa was conducted in 2012. The answers to the questionnaire were analyzed descriptively. Since the data set collected in 2011 was structurally identical with the data set gained in 2007 both surveys were compared.Results: Of the 24 companies represented on the vfa Clinical Research/Quality Assurance Subcommittee, 75% (18 took part in the survey. Survey evaluation was based on a total of 251 applications of these 18 companies submitted to 43 ECs. These account for about 21% of 1,214 applications for authorization of commercial and non-commercial phase I–IV clinical trials submitted to the regulatory authorities (BfArM and PEI in 2011.In comparison to 2007, a lower amount of applications (n=251 in 2011 vs. n=288 in 2007 was submitted to a slightly higher number of ECs (43 in 2011 vs. 40 in 2007. The amount of objections increased by 21% from 1,299 (2007 to 1,574 (2011 resulting in an average of 4.5 (2007 vs. 6.3 (2011 objections per application. Overall, the analysis of both formal and content related objections revealed almost the same pattern as in the previous survey. In total, the most frequent objections applied to the patient information and consent

  9. Evaluation of clinical trials by Ethics Committees in Germany: Experience of applicants with the review of requests for opinion of the Ethics Committees - results of a survey among members of the German Association of Research-Based Pharmaceutical Companies (VFA

    Directory of Open Access Journals (Sweden)

    Russ, Hagen

    2009-07-01

    Full Text Available The review of requests for a positive opinion of the ethics committees (application procedure as a requirement to start a clinical trial in Germany has been completely redesigned with the transposition of EU Directive 2001/20/EC in the 12th Amendment of the German Medicines Act in August 2004. The experience of applicants (sponsors, legal representatives of sponsors in the EU and persons or organizations authorized by the sponsors to make the application, respectively in terms of interactions with the ethics committees in Germany has been positive overall, especially with respect to ethics committee adherence to the statutory timelines applicable for review of requests. However, inconsistencies between ethics committees exist in terms of the form and content of the requirements for application documents and their evaluation.With the objective of further improving both the quality of applications and the evaluation of those applications by ethics committees, a survey among members of the German Association of Research-Based Pharmaceutical Companies (VFA was conducted from January to April 2008. Based on reasoned opinions issued by the respective ethics committee in charge of the coordinating principal investigator (coordinating ethics committee, the type and frequency of formal and content-related objections to applications according to § 7 of the German Good Clinical Practice (GCP Regulation were systematically documented, and qualitative and quantitative analyses performed. 21 out of 44 members of the VFA participated in the survey. 288 applications for Phase I–IV studies submitted between January and December 2007 to 40 ethics committees were evaluated.This survey shows that about one in six applications is incomplete and has formal and/or content objections, respectively, especially those that pertain to documents demonstrating the qualification of the investigator and/or suitability of the facilities. These objections are attributable to

  10. Folate intake and risk of pancreatic cancer: pooled analysis of prospective cohort studies.

    Science.gov (United States)

    Bao, Ying; Michaud, Dominique S; Spiegelman, Donna; Albanes, Demetrius; Anderson, Kristin E; Bernstein, Leslie; van den Brandt, Piet A; English, Dallas R; Freudenheim, Jo L; Fuchs, Charles S; Giles, Graham G; Giovannucci, Edward; Goldbohm, R Alexandra; Håkansson, Niclas; Horn-Ross, Pamela L; Jacobs, Eric J; Kitahara, Cari M; Marshall, James R; Miller, Anthony B; Robien, Kim; Rohan, Thomas E; Schatzkin, Arthur; Stevens, Victoria L; Stolzenberg-Solomon, Rachael Z; Virtamo, Jarmo; Wolk, Alicja; Ziegler, Regina G; Smith-Warner, Stephanie A

    2011-12-21

    Epidemiological studies evaluating the association between folate intake and risk of pancreatic cancer have produced inconsistent results. The statistical power to examine this association has been limited in previous studies partly because of small sample size and limited range of folate intake in some studies. We analyzed primary data from 14 prospective cohort studies that included 319,716 men and 542,948 women to assess the association between folate intake and risk of pancreatic cancer. Folate intake was assessed through a validated food-frequency questionnaire at baseline in each study. Study-specific relative risks (RRs) and 95% confidence intervals (CIs) were estimated using Cox proportional hazards models and then pooled using a random effects model. All statistical tests were two-sided. During 7-20 years of follow-up across studies, 2195 pancreatic cancers were identified. No association was observed between folate intake and risk of pancreatic cancer in men and women (highest vs lowest quintile: dietary folate intake, pooled multivariable RR = 1.06, 95% CI = 0.90 to 1.25, P(trend) = .47; total folate intake [dietary folate and supplemental folic acid], pooled multivariable RR = 0.96, 95% CI = 0.80 to 1.16, P(trend) = .90). No between-study heterogeneity was observed (for dietary folate, P(heterogeneity) = .15; for total folate, P(heterogeneity) = .22). Folate intake was not associated with overall risk of pancreatic cancer in this large pooled analysis.

  11. The influence of labor market changes on first-time medical school applicant pools.

    Science.gov (United States)

    Cort, David A; Morrison, Emory

    2014-12-01

    To explore whether the number and composition of first-time applicants to U.S. MD-granting medical schools, which have fluctuated over the past 30 years, are related to changes in labor market strength, specifically the unemployment rate and wages. The authors merged time series data from 1980 through 2010 (inclusive) from five sources and used multivariate time series models to determine whether changes in labor market strength (and several other macro-level factors) were related to the number of the medical school applicants as reported by the American Medical College Application Service. Analyses were replicated across specific sex and race/ethnicity applicant pools. Two results surfaced in the analyses. First, the strength of the labor market was not influential in explaining changes in applicant pool sizes for all applicants, but was strongly influential in explaining changes for black and Hispanic males. Increases of $1,000 in prevailing median wages produced a 1.6% decrease in the white male applicant pool, while 1% increases in the unemployment rate were associated with 4.5% and 3.1% increases in, respectively, the black and Hispanic male applicant pools. Second, labor market strength was a more important determinant in applications from males than in applications from females. Although stakeholders cannot directly influence the overall economic market, they can plan and prepare for fewer applications from males, especially those who are black and Hispanic, when the labor market is strong.

  12. A Double Evolutionary Pool Memetic Algorithm for Examination Timetabling Problems

    Directory of Open Access Journals (Sweden)

    Yu Lei

    2014-01-01

    Full Text Available A double evolutionary pool memetic algorithm is proposed to solve the examination timetabling problem. To improve the performance of the proposed algorithm, two evolutionary pools, that is, the main evolutionary pool and the secondary evolutionary pool, are employed. The genetic operators have been specially designed to fit the examination timetabling problem. A simplified version of the simulated annealing strategy is designed to speed the convergence of the algorithm. A clonal mechanism is introduced to preserve population diversity. Extensive experiments carried out on 12 benchmark examination timetabling instances show that the proposed algorithm is able to produce promising results for the uncapacitated examination timetabling problem.

  13. Automated management of engineering infrastructure of pools of different purpose

    Directory of Open Access Journals (Sweden)

    Shirokov Lev Alekseevich

    2016-10-01

    Full Text Available Pools play an important role in people’s life. They answer people’s demand in rest and improve their health. At the same time pools are rather important for industrial use, for example in construction industry. In order to solve different construction problems it is essential to investigate the influence of microclimatic parameters on construction materials and structures. For this aim pools are in demand as special test sites for construction materials and structures in different environmental conditions including the case of a direct water impact. The efficient use of pools presupposes the necessity of constant hydroclimatic contro: air humidity and temperature, water temperature, chemical composition of water and air. Classification of pools of different purposes is presented in the article. The author considers the main problems of operation of pools as objects with complicated air-and-water environment. The questions of maintaining optimal microclimatic parameters in a pool are considered. The necessity of use of the control system of a microclimate, its efficiency, profitability and social effect of its implementation is described. A mathematical model of the thermal mode of a pool area is constructed. The process of indoor temperature regulation in the pool is considered.

  14. Exchangeable Phosphorus Pools and Equilibrium Characteristics for River Sediment as a Function of Particle Size

    Science.gov (United States)

    2010-10-01

    P), sodium hydroxide-extractable P (i.e., aluminum-bound P), and hydrochloric acid -extractable P (i.e., calcium-bound P). A subsample of the sodium ...digestion with nitric and hydrochloric acid (American Public Health Association 2005). Aliquots (~500 mg L-1 dry weight equivalent to simulate...1988), and Nürnberg (1988) to determine ammonium-chloride- extractable P (i.e., loosely-bound P), bicarbonate dithionite-extractable P (i.e., iron-bound

  15. A Pooled Genome-Wide Association Study of Asperger Syndrome.

    Directory of Open Access Journals (Sweden)

    Varun Warrier

    Full Text Available Asperger Syndrome (AS is a neurodevelopmental condition characterized by impairments in social interaction and communication, alongside the presence of unusually repetitive, restricted interests and stereotyped behaviour. Individuals with AS have no delay in cognitive and language development. It is a subset of Autism Spectrum Conditions (ASC, which are highly heritable and has a population prevalence of approximately 1%. Few studies have investigated the genetic basis of AS. To address this gap in the literature, we performed a genome-wide pooled DNA association study to identify candidate loci in 612 individuals (294 cases and 318 controls of Caucasian ancestry, using the Affymetrix GeneChip Human Mapping version 6.0 array. We identified 11 SNPs that had a p-value below 1x10-5. These SNPs were independently genotyped in the same sample. Three of the SNPs (rs1268055, rs7785891 and rs2782448 were nominally significant, though none remained significant after Bonferroni correction. Two of our top three SNPs (rs7785891 and rs2782448 lie in loci previously implicated in ASC. However, investigation of the three SNPs in the ASC genome-wide association dataset from the Psychiatric Genomics Consortium indicated that these three SNPs were not significantly associated with ASC. The effect sizes of the variants were modest, indicating that our study was not sufficiently powered to identify causal variants with precision.

  16. A Pooled Genome-Wide Association Study of Asperger Syndrome.

    Science.gov (United States)

    Warrier, Varun; Chakrabarti, Bhismadev; Murphy, Laura; Chan, Allen; Craig, Ian; Mallya, Uma; Lakatošová, Silvia; Rehnstrom, Karola; Peltonen, Leena; Wheelwright, Sally; Allison, Carrie; Fisher, Simon E; Baron-Cohen, Simon

    2015-01-01

    Asperger Syndrome (AS) is a neurodevelopmental condition characterized by impairments in social interaction and communication, alongside the presence of unusually repetitive, restricted interests and stereotyped behaviour. Individuals with AS have no delay in cognitive and language development. It is a subset of Autism Spectrum Conditions (ASC), which are highly heritable and has a population prevalence of approximately 1%. Few studies have investigated the genetic basis of AS. To address this gap in the literature, we performed a genome-wide pooled DNA association study to identify candidate loci in 612 individuals (294 cases and 318 controls) of Caucasian ancestry, using the Affymetrix GeneChip Human Mapping version 6.0 array. We identified 11 SNPs that had a p-value below 1x10-5. These SNPs were independently genotyped in the same sample. Three of the SNPs (rs1268055, rs7785891 and rs2782448) were nominally significant, though none remained significant after Bonferroni correction. Two of our top three SNPs (rs7785891 and rs2782448) lie in loci previously implicated in ASC. However, investigation of the three SNPs in the ASC genome-wide association dataset from the Psychiatric Genomics Consortium indicated that these three SNPs were not significantly associated with ASC. The effect sizes of the variants were modest, indicating that our study was not sufficiently powered to identify causal variants with precision.

  17. Steady State Vapor Bubble in Pool Boiling.

    Science.gov (United States)

    Zou, An; Chanana, Ashish; Agrawal, Amit; Wayner, Peter C; Maroo, Shalabh C

    2016-02-03

    Boiling, a dynamic and multiscale process, has been studied for several decades; however, a comprehensive understanding of the process is still lacking. The bubble ebullition cycle, which occurs over millisecond time-span, makes it extremely challenging to study near-surface interfacial characteristics of a single bubble. Here, we create a steady-state vapor bubble that can remain stable for hours in a pool of sub-cooled water using a femtosecond laser source. The stability of the bubble allows us to measure the contact-angle and perform in-situ imaging of the contact-line region and the microlayer, on hydrophilic and hydrophobic surfaces and in both degassed and regular (with dissolved air) water. The early growth stage of vapor bubble in degassed water shows a completely wetted bubble base with the microlayer, and the bubble does not depart from the surface due to reduced liquid pressure in the microlayer. Using experimental data and numerical simulations, we obtain permissible range of maximum heat transfer coefficient possible in nucleate boiling and the width of the evaporating layer in the contact-line region. This technique of creating and measuring fundamental characteristics of a stable vapor bubble will facilitate rational design of nanostructures for boiling enhancement and advance thermal management in electronics.

  18. Compartment-specific metabolomics for CHO reveals that ATP pools in mitochondria are much lower than in cytosol.

    Science.gov (United States)

    Matuszczyk, Jens-Christoph; Teleki, Attila; Pfizenmaier, Jennifer; Takors, Ralf

    2015-10-01

    Mammalian cells show a compartmented metabolism. Getting access to subcellular metabolite pools is of high interest to understand the cells' metabolomic state. Therefore a protocol is developed and applied for monitoring compartment-specific metabolite and nucleotide pool sizes in Chinese hamster ovary (CHO) cells. The approach consists of a subtracting filtering method separating cytosolic components from physically intact mitochondrial compartments. The internal standards glucose-6-phosphate and cis-aconitate were chosen to quantify cytosolic secession and mitochondrial membrane integrity. Extracts of related fractions were studied by liquid chromatography-isotope dilution mass spectrometry for the absolute quantification of a subset of glycolytic and tricarboxylic acid cycle intermediates together with the adenylate nucleotides ATP, ADP and AMP. The application of the protocol revealed highly dynamic changes in the related pool sizes as a function of distinct cultivation periods of IgG1 producing CHO cells. Mitochondrial and cytosolic pool dynamics were in agreement with anticipated metabolite pools of independent studies. The analysis of adenosine phosphate levels unraveled significantly higher ATP levels in the cytosol leading to the hypothesis that mitochondria predominantly serve for fueling ATP into the cytosol where it is tightly controlled at physiological adenylate energy charges about 0.9. Copyright © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  19. Gene pool of less widely spread fruit tree species

    Directory of Open Access Journals (Sweden)

    Vojtěch Řezníček

    2004-01-01

    Full Text Available Within the gene pool collected at the Department of Breeding and Propagation of Garden Plants of the Faculty of Horticulture, Mendel University of Agriculture and Forestry in Brno, in Lednice we established experimental plots with some selected less known tree species - quince (Cydonia oblonga Mill., sea buckthorn (Hippophäe rhamnoides L., Cornelian cherry (Cornus mas L. and honeysuckle (Lonicera caerulea subsp. edulis Turcy. ex Freyn.. The experimental plots were established in successive steps according to the availability of planting material and using conventional methods of cultivation. Evaluations are focused on selected growth parameters, phenology and commercial use of the fruit.The evaluations of the crown of quince showed differences in the size and shape. The variety Hemus had the largest crown volume (5.70 m3; the variety Blanár gave the highest harvest yields. The sea buckthorn varieties Polmix, Dar Katuni and Novosť Altaja produced the longest increments. The average weight of the fruit of the variety Leicora was 0.74 g. The varieties of Cornelian cherry also differed in the growth parameters; the highest shrubs were those of the variety Vyšegorodskij, which also produced the largest fruit – the average weight of the fruit was 4.85 g. The initial growth of selected varieties and genotypes of honeysuckle is different when compared to the fruit-bearing shrubs. Harvest data are in direct proportion to the size of the shrub. Fruit harvest began in mid-May and vegetation ended on 15 October.

  20. Improvement of sampling plans for Salmonella detection in pooled table eggs by use of real-time PCR.

    Science.gov (United States)

    Pasquali, Frédérique; De Cesare, Alessandra; Valero, Antonio; Olsen, John Emerdhal; Manfreda, Gerardo

    2014-08-01

    Eggs and egg products have been described as the most critical food vehicles of salmonellosis. The prevalence and level of contamination of Salmonella on table eggs are low, which severely affects the sensitivity of sampling plans applied voluntarily in some European countries, where one to five pools of 10 eggs are tested by the culture based reference method ISO 6579:2004. In the current study we have compared the testing-sensitivity of the reference culture method ISO 6579:2004 and an alternative real-time PCR method on Salmonella contaminated egg-pool of different sizes (4-9 uninfected eggs mixed with one contaminated egg) and contamination levels (10°-10(1), 10(1)-10(2), 10(2)-10(3)CFU/eggshell). Two hundred and seventy samples corresponding to 15 replicates per pool size and inoculum level were tested. At the lowest contamination level real-time PCR detected Salmonella in 40% of contaminated pools vs 12% using ISO 6579. The results were used to estimate the lowest number of sample units needed to be tested in order to have a 95% certainty not falsely to accept a contaminated lot by Monte Carlo simulation. According to this simulation, at least 16 pools of 10 eggs each are needed to be tested by ISO 6579 in order to obtain this confidence level, while the minimum number of pools to be tested was reduced to 8 pools of 9 eggs each, when real-time PCR was applied as analytical method. This result underlines the importance of including analytical methods with higher sensitivity in order to improve the efficiency of sampling and reduce the number of samples to be tested. Copyright © 2013 Elsevier B.V. All rights reserved.

  1. Oligonucleotide based magnetic bead capture of Onchocerca volvulus DNA for PCR pool screening of vector black flies.

    Directory of Open Access Journals (Sweden)

    Hemavathi Gopal

    Full Text Available Entomological surveys of Simulium vectors are an important component in the criteria used to determine if Onchocerca volvulus transmission has been interrupted and if focal elimination of the parasite has been achieved. However, because infection in the vector population is quite rare in areas where control has succeeded, large numbers of flies need to be examined to certify transmission interruption. Currently, this is accomplished through PCR pool screening of large numbers of flies. The efficiency of this process is limited by the size of the pools that may be screened, which is in turn determined by the constraints imposed by the biochemistry of the assay. The current method of DNA purification from pools of vector black flies relies upon silica adsorption. This method can be applied to screen pools containing a maximum of 50 individuals (from the Latin American vectors or 100 individuals (from the African vectors.We have evaluated an alternative method of DNA purification for pool screening of black flies which relies upon oligonucleotide capture of Onchocerca volvulus genomic DNA from homogenates prepared from pools of Latin American and African vectors. The oligonucleotide capture assay was shown to reliably detect one O. volvulus infective larva in pools containing 200 African or Latin American flies, representing a two-four fold improvement over the conventional assay. The capture assay requires an equivalent amount of technical time to conduct as the conventional assay, resulting in a two-four fold reduction in labor costs per insect assayed and reduces reagent costs to $3.81 per pool of 200 flies, or less than $0.02 per insect assayed.The oligonucleotide capture assay represents a substantial improvement in the procedure used to detect parasite prevalence in the vector population, a major metric employed in the process of certifying the elimination of onchocerciasis.

  2. Oligonucleotide based magnetic bead capture of Onchocerca volvulus DNA for PCR pool screening of vector black flies.

    Science.gov (United States)

    Gopal, Hemavathi; Hassan, Hassan K; Rodríguez-Pérez, Mario A; Toé, Laurent D; Lustigman, Sara; Unnasch, Thomas R

    2012-01-01

    Entomological surveys of Simulium vectors are an important component in the criteria used to determine if Onchocerca volvulus transmission has been interrupted and if focal elimination of the parasite has been achieved. However, because infection in the vector population is quite rare in areas where control has succeeded, large numbers of flies need to be examined to certify transmission interruption. Currently, this is accomplished through PCR pool screening of large numbers of flies. The efficiency of this process is limited by the size of the pools that may be screened, which is in turn determined by the constraints imposed by the biochemistry of the assay. The current method of DNA purification from pools of vector black flies relies upon silica adsorption. This method can be applied to screen pools containing a maximum of 50 individuals (from the Latin American vectors) or 100 individuals (from the African vectors). We have evaluated an alternative method of DNA purification for pool screening of black flies which relies upon oligonucleotide capture of Onchocerca volvulus genomic DNA from homogenates prepared from pools of Latin American and African vectors. The oligonucleotide capture assay was shown to reliably detect one O. volvulus infective larva in pools containing 200 African or Latin American flies, representing a two-four fold improvement over the conventional assay. The capture assay requires an equivalent amount of technical time to conduct as the conventional assay, resulting in a two-four fold reduction in labor costs per insect assayed and reduces reagent costs to $3.81 per pool of 200 flies, or less than $0.02 per insect assayed. The oligonucleotide capture assay represents a substantial improvement in the procedure used to detect parasite prevalence in the vector population, a major metric employed in the process of certifying the elimination of onchocerciasis.

  3. 17 CFR 275.206(4)-8 - Pooled investment vehicles.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Pooled investment vehicles... COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT ADVISERS ACT OF 1940 § 275.206(4)-8 Pooled investment vehicles. (a) Prohibition. It shall constitute a fraudulent, deceptive, or manipulative act...

  4. The Solitude of Relevant Documents in the Pool

    NARCIS (Netherlands)

    Lipani, A.; Lupu, M.; Kanoulas, E.; Hanbury, A.

    2016-01-01

    Pool bias is a well understood problem of test-collection based benchmarking in information retrieval. The pooling method itself is designed to identify all relevant documents. In practice, 'all' translates to `as many as possible given some budgetary constraints' and the problem persists, albeit

  5. Governance and Management of Common Pool Resources in Viet ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Governance and Management of Common Pool Resources in Viet Nam. This grant will allow Hue University of Agriculture and Forestry to examine issues related to common pool resource management and poverty in the context of decentralization in central Viet Nam. The project will take place on two sites. Tam Giang ...

  6. Mathematical-programming approaches to test item pool design

    NARCIS (Netherlands)

    Veldkamp, Bernard P.; van der Linden, Willem J.; Ariel, A.

    2002-01-01

    This paper presents an approach to item pool design that has the potential to improve on the quality of current item pools in educational and psychological testing andhence to increase both measurement precision and validity. The approach consists of the application of mathematical programming

  7. 48 CFR 9.702 - Contracting with pools.

    Science.gov (United States)

    2010-10-01

    ... PLANNING CONTRACTOR QUALIFICATIONS Defense Production Pools and Research and Development Pools 9.702... of a power of attorney identifying the agent authorized to sign the offer or contract on that member's behalf. The contracting officer shall attach a copy of each power of attorney to each signed copy...

  8. 13 CFR 120.1709 - Transfers of Pool Certificates.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Transfers of Pool Certificates. 120.1709 Section 120.1709 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS... reflect the transfer on its records. (c) Contents of letter of transmittal for Pool Certificate. A letter...

  9. Towards the car-pooling; Le covoiturage a la cle

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-07-01

    This booklet, published by the french ministry of the environment and the national development, gives the advantages of the car-pooling and proposes examples to help the communities to install and succeed a car-pooling policy: the context, the tools of information, the national development, the strategy bonded to the public. (A.L.B.)

  10. Governance and Management of Common Pool Resources in Viet ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Governance and Management of Common Pool Resources in Viet Nam. This grant will allow Hue University of Agriculture and Forestry to examine issues related to common pool resource management and poverty in the context of decentralization in central Viet Nam. ... Les chaînes de valeur comme leviers stratégiques.

  11. Odonata (Insecta at a wadi Pool near Nizwa, northern Oman

    Directory of Open Access Journals (Sweden)

    Elaine M. Cowan

    2015-07-01

    Full Text Available Fourteen damselfly and dragonfly species were recorded in 68 visits to a wadi pool in northern Oman, March 2012 to June 2014.  All identifications were based on photographs.  Apparently the pool has a core community of eight resident species.  Paragomphus sinaiticus, globally Near Threatened, was regularly  recorded. 

  12. Branchipodopsis species — specialists of ephemeral rock pools ...

    African Journals Online (AJOL)

    The anostracan Branchipodopsis genus is widespread throughout southern Africa and is the second most speciose anostracan taxon in this sub-continent. Branchipodopsis species are particularly dominant in small short-lived and clear rock pools, to the vagaries of which they are extremely well adapted. Such rock pools ...

  13. Sanitary Conditions of Public Swimming Pools in Amman, Jordan

    Directory of Open Access Journals (Sweden)

    Ashraf Abu Aqoulah

    2008-09-01

    Full Text Available This study was carried out in the summer of 2005 and investigated all of active public swimming pools (85 out of 93 in Amman, the capital of Jordan. The aim of this study was to find out if these swimming pools are in compliance with Jordanian Standards for Swimming Pools Water (JS 1562/2004. The pools were surveyed against the water microbial quality and other physicochemical parameters indicated in the standards. Two samples from each pool were collected for microbial analysis and pools monitoring were carried out during the afternoon of the weekends when the pools are most heavily used. The results indicated overall poor compliance with the standards. Compliance of the pools water to the microbial parameters was 56.5%, for residual chlorine 49.4%, for pH 87.7%, water temperature 48.8%, and bathing load 70.6%. The results also indicated that water microbial quality deteriorated with time. Multivariate analysis showed significant association of water contamination with time of sample collection, residual chlorine, water temperature and load of swimmers. The poor compliance was attributed to lack of proper disinfection, staff training, proper maintenance, and timely inspection.

  14. Soil carbon pools and fluxes in urban ecosystems

    Science.gov (United States)

    R. Pouyat; P. Groffman; I Yesilonis; L. Hernandez

    2002-01-01

    The transformation of landscapes from non-urban to urban land use has the potential to greatly modify soil carbon (C) pools and fluxes. For urban ecosystems, very little data exists to assess whether urbanization leads to an increase or decrease in soil C pools. We analyzed three data sets to assess the potential for urbanization to affect soil organic C. These...

  15. 41 CFR 101-25.109-2 - Equipment pools.

    Science.gov (United States)

    2010-07-01

    .... Pooling operations should begin expeditiously, within 120 days, if feasible, following decisions regarding... transportation and handling costs, limited personnel resources, or limited space, pooling may be accomplished by means of equipment listings. Consideration should be given to the establishment of a laboratory advisory...

  16. A highly efficient design strategy for regression with outcome pooling.

    Science.gov (United States)

    Mitchell, Emily M; Lyles, Robert H; Manatunga, Amita K; Perkins, Neil J; Schisterman, Enrique F

    2014-12-10

    The potential for research involving biospecimens can be hindered by the prohibitive cost of performing laboratory assays on individual samples. To mitigate this cost, strategies such as randomly selecting a portion of specimens for analysis or randomly pooling specimens prior to performing laboratory assays may be employed. These techniques, while effective in reducing cost, are often accompanied by a considerable loss of statistical efficiency. We propose a novel pooling strategy based on the k-means clustering algorithm to reduce laboratory costs while maintaining a high level of statistical efficiency when predictor variables are measured on all subjects, but the outcome of interest is assessed in pools. We perform simulations motivated by the BioCycle study to compare this k-means pooling strategy with current pooling and selection techniques under simple and multiple linear regression models. While all of the methods considered produce unbiased estimates and confidence intervals with appropriate coverage, pooling under k-means clustering provides the most precise estimates, closely approximating results from the full data and losing minimal precision as the total number of pools decreases. The benefits of k-means clustering evident in the simulation study are then applied to an analysis of the BioCycle dataset. In conclusion, when the number of lab tests is limited by budget, pooling specimens based on k-means clustering prior to performing lab assays can be an effective way to save money with minimal information loss in a regression setting. Copyright © 2014 John Wiley & Sons, Ltd.

  17. Diagnosis of enzootic bovine leucosis in single and pooled samples.

    Science.gov (United States)

    Hoff-Jørgensen, R

    1990-12-01

    Diagnosis of enzootic bovine leucosis is based on detection of antibodies against bovine leukemia virus, BLV. Some ELISA modifications have proved sensitive enough for use in the examination of pooled blood samples from slaughterhouses, milk and pooled milk samples. Suggestions for the standardisation of different ELISA modifications using a common reference serum are presented.

  18. 41 CFR 109-27.5106 - Precious metals pool.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Precious metals pool. 109-27.5106 Section 109-27.5106 Public Contracts and Property Management Federal Property Management...-INVENTORY MANAGEMENT 27.51-Management of Precious Metals § 109-27.5106 Precious metals pool. ...

  19. The Ineffectiveness of Manual Treatment of Swimming Pools NNAJI ...

    African Journals Online (AJOL)

    Michael Horsfall

    Swimmers are usually endangered when they swallow contaminated pool water, inhale toxic disinfection by products such as trihalomethane (Nickmilder and Bernard, 2007) or by skin adsorption (Villanueva et al, 2007). The chance of infection through swallowing of pool water increases with the amount of water swallowed ...

  20. On the relative importance of pool morphology and woody debris to distributions of shrimp in a Puerto Rican headwater stream

    Science.gov (United States)

    Pyron, M.; Covich, A.P.; Black, R.W.

    1999-01-01

    In this paper, we report the sizes and distributional orientation of woody debris in a headwater rainforest stream in the Luquillo Experimental Forest (LEF), Puerto Rico. We also provide results of a 4-month study of a wood addition experiment designed to increase cover for benthic macroinvertebrates (freshwater shrimp). We added branch-sized woody debris to 20 pools in three streams. We trapped four species of freshwater shrimp (two species of benthic detritivores and two predatory shrimp species) during each of the 4 months following wood additions. An analysis of pool morphology (maximum depth, surface area and volume) provided a useful predictor of shrimp abundances. In general, numbers of shrimps increased with sizes of stream pools. A repeated measures ANOVA demonstrated no effect of woody debris additions on total numbers of shrimp per pool area. Two detritivore species (Atya lanipes, a filter feeder and Xiphocaris elongata, a shredder) decreased in abundance with increased woody debris and there was no statistical relationship between woody debris additions and predators (Macrobrachium carcinus and M. crenulatum). Small woody debris additions may have altered flow velocities that were important to filter-feeding Atya at the microhabitat scale, although the overall velocities within pools were not altered by wood additions. Lower numbers of Atya and Xiphocaris in two of the three streams may result from the occurrence of two predaceous fishes (American eel and mountain mullet) and more predatory Macrobrachium in these streams. One likely interpretation of the results of this study is that the stream pools in these study reaches had sufficient habitat structure provided by numerous rock crevices (among large rocks and boulders) to provide refuge from predators. Addition of woody debris did not add significantly to the existing structure. These results may not apply to stream channels with sand and gravel substrata where crevices and undercut banks are lacking

  1. Irrigation systems as common-pool resources

    Directory of Open Access Journals (Sweden)

    Giangiacomo Bravo

    2009-03-01

    Full Text Available Les ressources communes sont des ressources naturelles ou artificielles partagées par différents utilisateurs ; l’exploitation de ces ressources crée une rivalité, souvent (mais pas nécessairement à l’origine de leur dégradation, voire de leur destruction. Cet article présente brièvement la théorie des ressources communes développée ces vingt dernières années par Elinor Ostrom et ses collègues, et l’illustre par plusieurs études de cas de systèmes d’irrigation du nord de l’Italie (Lombardie et Vallée d’Aoste. Il démontre que différents mécanismes sociaux, tels que les valeurs partagées et le réseau social existant au sein de la communauté d’utilisateurs, influent sensiblement sur l’efficacité des systèmes institutionnels de gestion des ressources communes.Common-pool resources are natural or man-made resources shared among different users, a condition that produces a competition for their utilization leading often (although not necessarily to their degradation or even to their destruction. This paper shortly discusses the "theory of the commons", as developed in the last 20 years by Elinor Ostrom and her colleagues, and illustrates it by mean of case studies regarding a number of irrigation systems in Northern Italy (Lombardy and Aosta Valley. We show that that different social mechanisms, like the shared values e the social network existing inside the community of users, play a significant role in influencing the outcomes of the institutional schemes for the commons management.

  2. Chemical precipitation structures formed by drops impacting on a deep pool

    Science.gov (United States)

    Kaminker, V.; Maselko, J.; Pantaleone, J.

    2012-11-01

    The experiments described here are at the intersection of two dynamical systems with long pedigrees for forming interesting patterns: liquid droplet impacts and precipitation membranes. Drops of calcium chloride solution have been allowed to impact on a deep pool of sodium silicate solution. The precipitation structures produced by this method, and how these structures subsequently evolve, have been observed. Many interesting patterns can be formed from this process. It is observed that the precipitation patterns produced are sensitive to the shape of the drop when it impacts the pool's surface. Also, at large drop heights, we determine two critical Weber numbers: one for forming a skirt around the structures and the other for breakup of the structures. On longer time scales, open tubes grow from the closed precipitation shell produced at lower drop heights. These tubes can appear in large numbers with nearly identical sizes and diameters as small as 50 μm.

  3. Experimental Study on the Burning Behavior of Pool Fires in Rooms with Different Wall Linings

    DEFF Research Database (Denmark)

    Poulsen, Annemarie; Jomaas, Grunde

    2011-01-01

    An experimental test series, comprising 10 experiments with varying pool sizes, lining materials and amounts of liquid burning, was conducted under free burn and room burn conditions. The thermal feedback from the enclosure (ISO 9705 Room Corner Test facility) enhanced the burning rate of the pools...... and resulted in a thermal runaway in some of the runs. The onset of the thermal runaway, which can be associated with flashover, varied with all the input parameters. The lining with the lowest thermal inertia lead to the fastest increase in the heat release rate (HRR) in the enclosure and caused flashover...... in the shortest time. Given the profound difference between the enclosure tests and the free burn tests and also between enclosure tests with different linings, it is recommended to show great caution if free burn tests are to be used in design fire scenarios....

  4. A formação da confiança: um estudo no pool da UNIBRASPE. THE FORMATION OF TRUST: A STUDY IN THE UNIBRASPE'S POOL

    Directory of Open Access Journals (Sweden)

    Cleverson Renan da Cunha

    2010-12-01

    Full Text Available O tema de estudo deste trabalho é a formação da Confiança no pool da UNIBRASPE. O objetivo foi identificar a estrutura e a evolução dos relacionamentos interorganizacionais. A evolução da confiança foi detectada por meio de observações, entrevistas semiestruturadas e questionários. Esta pesquisa caracteriza-se como um estudo de caso descritivo-analítico. A partir dos resultados obtidos, concluiu-se que a estrutura da rede é um condicionante para o bom relacionamento entre seus pares, permitindo que normas formais e informais contribuam para a gestão do pool. Além disso, foi possível reconhecer que a evolução da confiança é estabelecida pelo conhecimento prévio dos atores estudados e que resulta em um relacionamento mais estreito entre essas organizações. Normal 0 21 false false false PT-BR X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabela normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} The theme of this work is the formation of Trust in the UNIBRASPE's pool. The objective of this assignment was to identify the structure and evolution of interorganisational relationships. The evolution of trust was detected through observation, semi-structured interviews and questionaires characterizing this survey as a descriptive-analitical case study. We can conclude that the structure of the network is a condition for good relationships between its

  5. Anthropogenic impact on amorphous silica pools in temperate soils

    Directory of Open Access Journals (Sweden)

    W. Clymans

    2011-08-01

    Full Text Available Human land use changes perturb biogeochemical silica (Si cycling in terrestrial ecosystems. This directly affects Si mobilisation and Si storage and influences Si export from the continents, although the magnitude of the impact is unknown. A major reason for our lack of understanding is that very little information exists on how land use affects amorphous silica (ASi storage in soils. We have quantified and compared total alkali-extracted (PSia and easily soluble (PSie Si pools at four sites along a gradient of anthropogenic disturbance in southern Sweden. Land use clearly affects ASi pools and their distribution. Total PSia and PSie for a continuous forested site at Siggaboda Nature Reserve (66 900 ± 22 800 kg SiO2 ha−1 and 952 ± 16 kg SiO2 ha−1 are significantly higher than disturbed land use types from the Råshult Culture Reserve including arable land (28 800 ± 7200 kg SiO2 ha−1 and 239 ± 91 kg SiO2 ha−1, pasture sites (27 300 ± 5980 kg SiO2 ha−1 and 370 ± 129 kg SiO2 ha−1 and grazed forest (23 600 ± 6370 kg SiO2 ha−1 and 346 ± 123 kg SiO2 ha−1. Vertical PSia and PSie profiles show significant (p < 0.05 variation among the sites. These differences in size and distribution are interpreted as the long-term effect of reduced ASi replenishment, as well as changes in ecosystem specific pedogenic processes and increased mobilisation of the PSia in disturbed soils. We have also made a first, though rough, estimate of the magnitude of change in temperate continental ASi pools due to human disturbance. Assuming that our data are representative, we estimate that total ASi storage in soils has declined by ca. 10 % since the onset of agricultural development (3000 BCE

  6. poolHiTS: A Shifted Transversal Design based pooling strategy for high-throughput drug screening

    Directory of Open Access Journals (Sweden)

    Woolf Peter J

    2008-05-01

    Full Text Available Abstract Background A key goal of drug discovery is to increase the throughput of small molecule screens without sacrificing screening accuracy. High-throughput screening (HTS in drug discovery involves testing a large number of compounds in a biological assay to identify active compounds. Normally, molecules from a large compound library are tested individually to identify the activity of each molecule. Usually a small number of compounds are found to be active, however the presence of false positive and negative testing errors suggests that this one-drug one-assay screening strategy can be significantly improved. Pooling designs are testing schemes that test mixtures of compounds in each assay, thereby generating a screen of the whole compound library in fewer tests. By repeatedly testing compounds in different combinations, pooling designs also allow for error-correction. These pooled designs, for specific experiment parameters, can be simply and efficiently created using the Shifted Transversal Design (STD pooling algorithm. However, drug screening contains a number of key constraints that require specific modifications if this pooling approach is to be useful for practical screen designs. Results In this paper, we introduce a pooling strategy called poolHiTS (Pooled High-Throughput Screening which is based on the STD algorithm. In poolHiTS, we implement a limit on the number of compounds that can be mixed in a single assay. In addition, we show that the STD-based pooling strategy is limited in the error-correction that it can achieve. Due to the mixing constraint, we show that it is more efficient to split a large library into smaller blocks of compounds, which are then tested using an optimized strategy repeated for each block. We package the optimal block selection algorithm into poolHiTS. The MATLAB codes for the poolHiTS algorithm and the corresponding decoding strategy are also provided. Conclusion We have produced a practical version

  7. Swimming pool deck as environmental reservoir of Fusarium.

    Science.gov (United States)

    Buot, G; Toutous-Trellu, L; Hennequin, C

    2010-08-01

    While investigations on fungal contamination of swimming pools usually focus on dermatophytes, data on other potentially pathogenic molds are scarce. Here, we report the investigation of fungal colonization of the deck surrounding a hospital physical therapy swimming pool. Five series of samples from 8 sites were collected over one year from the pool surroundings. Concomitantly, 58 patients using the swimming pool were examined and samples obtained from those with suspected onychomycosis. All surface samples were positive for fungi, with Fusarium the most frequently recovered from 22 of 27 samples of sites surrounding the pool. Among the outpatients evaluated, two presented with a mixed onychomycosis from which Fusarium and Trichophyton rubrum were isolated. The questions of possible acquisition from the swimming pool area must be considered in both cases as the ungual lesions had developed within the previous three months. This warrants further studies to better understand the epidemiology of potentially pathogenic molds in areas surrounding pools in order to adopt appropriate measures to avoid contamination. This is of particular importance within medical institutions, considering the potential role of Fusarium onychomycosis as a starting point for disseminated infections in immunocompromised patients.

  8. Study on water evaporation rate from indoor swimming pools

    Directory of Open Access Journals (Sweden)

    Rzeźnik Ilona

    2017-01-01

    Full Text Available The air relative humidity in closed spaces of indoor swimming pools influences significantly on users thermal comfort and the stability of the building structure, so its preservation on suitable level is very important. For this purpose, buildings are equipped with HVAC systems which provide adequate level of humidity. The selection of devices and their technical parameters is made using the mathematical models of water evaporation rate in the unoccupied and occupied indoor swimming pool. In the literature, there are many papers describing this phenomena but the results differ from each other. The aim of the study was the experimental verification of published models of evaporation rate in the pool. The tests carried out on a laboratory scale, using model of indoor swimming pool, measuring 99cm/68cm/22cm. The model was equipped with water spray installation with six nozzles to simulate conditions during the use of the swimming pool. The measurements were made for conditions of sports pools (water temperature 24°C and recreational swimming pool (water temperature 34°C. According to the recommendations the air temperature was about 2°C higher than water temperature, and the relative humidity ranged from 40% to 55%. Models Shah and Biasin & Krumm were characterized by the best fit to the results of measurements on a laboratory scale.

  9. Study on water evaporation rate from indoor swimming pools

    Science.gov (United States)

    Rzeźnik, Ilona

    2017-11-01

    The air relative humidity in closed spaces of indoor swimming pools influences significantly on users thermal comfort and the stability of the building structure, so its preservation on suitable level is very important. For this purpose, buildings are equipped with HVAC systems which provide adequate level of humidity. The selection of devices and their technical parameters is made using the mathematical models of water evaporation rate in the unoccupied and occupied indoor swimming pool. In the literature, there are many papers describing this phenomena but the results differ from each other. The aim of the study was the experimental verification of published models of evaporation rate in the pool. The tests carried out on a laboratory scale, using model of indoor swimming pool, measuring 99cm/68cm/22cm. The model was equipped with water spray installation with six nozzles to simulate conditions during the use of the swimming pool. The measurements were made for conditions of sports pools (water temperature 24°C) and recreational swimming pool (water temperature 34°C). According to the recommendations the air temperature was about 2°C higher than water temperature, and the relative humidity ranged from 40% to 55%. Models Shah and Biasin & Krumm were characterized by the best fit to the results of measurements on a laboratory scale.

  10. Adenine nucleotide pool variations in intact Nitrobacter winogradskyi cells.

    Science.gov (United States)

    Eigener, U

    1975-03-10

    1. The ATP pool in Nitrobacter winogradskyi cells was determined by means of the luciferin-luciferase enzyme system and the ADP and AMP pools were measured after enzymatic conversion into ATP. 2. In the first 10 min after addition of nitrite to endogenously respiring cells, which had stood for 5--16 days after completion of the nitrite oxidation, the ATP pool dropped about 60%. 3. During the log phase the ATP pool was approx. 20--40 pmoles/5 mug cell-N. During growth it increased exponentially by 3--4 times the amount until the nitrite had been used up. Subsquently the ATP pool decreased at first rapidly and then more slowly without sinking to 0 in the first 2 months after nitrification. 4. Nitrite oxidizing cells had an energy charge of 0.37 during the log-phase. After approx. 90% of the substrate had been used up the energy charge had reached 0.57. 5. If the CO2 assimilation was inhibited in growing cultures by increased oxygen partial pressure, nitrite oxidation continued but the ATP pool increased. 6. The ATP pool and the activity of the endogenous respiration decreased by more than 50% during the first hours after the substrate had been used up.

  11. Incorporating incorporating economic models into seasonal pool conservation planning

    Science.gov (United States)

    Freeman, Robert C.; Bell, Kathleen P.; Calhoun, Aram J.K.; Loftin, Cyndy

    2012-01-01

    Massachusetts, New Jersey, Connecticut, and Maine have adopted regulatory zones around seasonal (vernal) pools to conserve terrestrial habitat for pool-breeding amphibians. Most amphibians require access to distinct seasonal habitats in both terrestrial and aquatic ecosystems because of their complex life histories. These habitat requirements make them particularly vulnerable to land uses that destroy habitat or limit connectivity (or permeability) among habitats. Regulatory efforts focusing on breeding pools without consideration of terrestrial habitat needs will not ensure the persistence of pool-breeding amphibians. We used GIS to combine a discrete-choice, parcel-scale economic model of land conversion with a landscape permeability model based on known habitat requirements of wood frogs (Lithobates sylvaticus) in Maine (USA) to examine permeability among habitat elements for alternative future scenarios. The economic model predicts future landscapes under different subdivision open space and vernal pool regulatory requirements. Our model showed that even “no build” permit zones extending 76 m (250 ft) outward from the pool edge were insufficient to assure permeability among required habitat elements. Furthermore, effectiveness of permit zones may be inconsistent due to interactions with other growth management policies, highlighting the need for local and state planning for the long-term persistence of pool-breeding amphibians in developing landscapes.

  12. Characterization of microbial populations associated with natural swimming pools.

    Science.gov (United States)

    Casanovas-Massana, Arnau; Blanch, Anicet R

    2013-03-01

    Natural swimming pools are artificially created bodies of water that are intended for human recreational bathing and have no chemical disinfection treatment. The microbial populations in four private natural swimming pools were analysed to assess the typical microbiological parameters, establish the origin of faecal contamination in the water, and predict the behaviour of larger systems that are open to the public. For this purpose, faecal coliforms, E. coli, enterococci, aerobic heterotrophic bacteria and Pseudomonas aeruginosa were enumerated in summer and winter. Moreover, faecal coliforms and enterococci populations were biochemically phenotyped with the Phene-Plate System, the diversity and similarity indexes were calculated and the isolates were identified. Three of the four natural pools exceeded the E. coli or enterococci limits stated in the recommendations for natural swimming pools. The concentrations of P. aeruginosa and aerobic heterotrophic bacteria were acceptable. The results suggest that wildlife was an important source of faecal pollution in the pools. Since there is a lack of regulations on these systems, and the health risks are higher than in conventional swimming pools, further research is needed to establish the parameters for ensuring safe bathing in private and public natural swimming pools. Copyright © 2012 Elsevier GmbH. All rights reserved.

  13. Pooled DNA genotyping on Affymetrix SNP genotyping arrays

    Directory of Open Access Journals (Sweden)

    Owen Michael J

    2006-02-01

    Full Text Available Abstract Background Genotyping technology has advanced such that genome-wide association studies of complex diseases based upon dense marker maps are now technically feasible. However, the cost of such projects remains high. Pooled DNA genotyping offers the possibility of applying the same technologies at a fraction of the cost, and there is some evidence that certain ultra-high throughput platforms also perform with an acceptable accuracy. However, thus far, this conclusion is based upon published data concerning only a small number of SNPs. Results In the current study we prepared DNA pools from the parents and from the offspring of 30 parent-child trios that have been extensively genotyped by the HapMap project. We analysed the two pools with Affymetrix 10 K Xba 142 2.0 Arrays. The availability of the HapMap data allowed us to validate the performance of 6843 SNPs for which we had both complete individual and pooled genotyping data. Pooled analyses averaged over 5–6 microarrays resulted in highly reproducible results. Moreover, the accuracy of estimating differences in allele frequency between pools using this ultra-high throughput system was comparable with previous reports of pooling based upon lower throughput platforms, with an average error for the predicted allelic frequencies differences between the two pools of 1.37% and with 95% of SNPs showing an error of Conclusion Genotyping thousands of SNPs with DNA pooling using Affymetrix microarrays produces highly accurate results and can be used for genome-wide association studies.

  14. Macroinvertebrate community assembly in pools created during peatland restoration

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Lee E., E-mail: l.brown@leeds.ac.uk; Ramchunder, Sorain J.; Beadle, Jeannie M.; Holden, Joseph

    2016-11-01

    Many degraded ecosystems are subject to restoration attempts, providing new opportunities to unravel the processes of ecological community assembly. Restoration of previously drained northern peatlands, primarily to promote peat and carbon accumulation, has created hundreds of thousands of new open water pools. We assessed the potential benefits of this wetland restoration for aquatic biodiversity, and how communities reassemble, by comparing pool ecosystems in regions of the UK Pennines on intact (never drained) versus restored (blocked drainage-ditches) peatland. We also evaluated the conceptual idea that comparing reference ecosystems in terms of their compositional similarity to null assemblages (and thus the relative importance of stochastic versus deterministic assembly) can guide evaluations of restoration success better than analyses of community composition or diversity. Community composition data highlighted some differences in the macroinvertebrate composition of restored pools compared to undisturbed peatland pools, which could be used to suggest that alternative end-points to restoration were influenced by stochastic processes. However, widely used diversity metrics indicated no differences between undisturbed and restored pools. Novel evaluations of restoration using null models confirmed the similarity of deterministic assembly processes from the national species pool across all pools. Stochastic elements were important drivers of between-pool differences at the regional-scale but the scale of these effects was also similar across most of the pools studied. The amalgamation of assembly theory into ecosystem restoration monitoring allows us to conclude with more certainty that restoration has been successful from an ecological perspective in these systems. Evaluation of these UK findings compared to those from peatlands across Europe and North America further suggests that restoring peatland pools delivers significant benefits for aquatic fauna by

  15. Energy conservation in outdoor swimming pools. Pt. 2

    Energy Technology Data Exchange (ETDEWEB)

    Roskam, F.

    1987-11-01

    Part two of the report discusses the energy characteristics of three more BMFT/EC-supported demonstration plants (outdoor and indoor swimming pools) intended to investigate into low-cost energy supplies. Photographs, schematic sketches, tables, and figures facilitate access to the solar systems (collector surfaces, heat exchangers, water supply), the coverings (plastic foils), heat recovery systems recovering heat from the outgoing air (indoor swimming pools) and from filter backwash water as well as to other important aspects (swimming pool structures, site selection, climatic conditions). Water treatment and water heating systems are shown in a function diagram. (HWJ).

  16. Reducing political risk in EU pooling and sharing

    NARCIS (Netherlands)

    Kuijpers, D.; Faleg (ed), G.

    2014-01-01

    Can states share political accountability by allowing common defence capability development, training of troops, or procurement of military equipment? Is the defence industry ready for Pooling and Sharing (PS)?

  17. Pool Onistarist kuulub kütusefirma omanikele / Sirje Niitra

    Index Scriptorium Estoniae

    Niitra, Sirje, 1948-

    2001-01-01

    Alkoholikontserni Onistar kiiret tõusu Eesti alkoholiturul toetavad Vene rahvusest ärimeestele kuuluvate kütusefirmade Infast Oil ja Saurix Petroleum omanikud, kellele kuulub pool Eesti viinaturu liidri aktsiatest

  18. 7 CFR 985.57 - Reserve pool requirements.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE MARKETING ORDER REGULATING THE... commercial trade practices. The Committee shall designate a Committee employee as reserve pool manager. (b...

  19. Allegheny County Public Swimming Pool, Hot Tub, and Spa Inspections

    Data.gov (United States)

    Allegheny County / City of Pittsburgh / Western PA Regional Data Center — Public swimming pool, hot tub, and spa facilities are licensed and inspected once each year to assure proper water quality, sanitation, lifeguard coverage and...

  20. schwimmbad: A uniform interface to parallel processing pools in Python

    Science.gov (United States)

    Price-Whelan, Adrian M.; Foreman-Mackey, Daniel

    2017-09-01

    Many scientific and computing problems require doing some calculation on all elements of some data set. If the calculations can be executed in parallel (i.e. without any communication between calculations), these problems are said to be perfectly parallel. On computers with multiple processing cores, these tasks can be distributed and executed in parallel to greatly improve performance. A common paradigm for handling these distributed computing problems is to use a processing "pool": the "tasks" (the data) are passed in bulk to the pool, and the pool handles distributing the tasks to a number of worker processes when available. schwimmbad provides a uniform interface to parallel processing pools and enables switching easily between local development (e.g., serial processing or with multiprocessing) and deployment on a cluster or supercomputer (via, e.g., MPI or JobLib).

  1. Waterfowl Count over Pool 9 Erie National Wildlife Refuge 1970

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This presents the observations of waterfowl flying over Pool 9 at Erie National Wildlife Refuge from late-August through early October, 1970.

  2. vipR: variant identification in pooled DNA using R

    National Research Council Canada - National Science Library

    Altmann, Andre; Weber, Peter; Quast, Carina; Rex-Haffner, Monika; Binder, Elisabeth B; Müller-Myhsok, Bertram

    2011-01-01

    .... Thus, recently, screens for rare sequence variants were carried out in samples of pooled DNA, in which equimolar amounts of DNA from multiple individuals are mixed prior to sequencing with HTS...

  3. LCG Persistency Framework (POOL, CORAL, COOL) - Status and Outlook

    CERN Multimedia

    CERN. Geneva

    2012-01-01

    The LCG Persistency Framework consists of three software packages (POOL, CORAL and COOL) that address the data access requirements of the LHC experiments in several different areas. The project is the result of the collaboration between the CERN IT Department and the three experiments (ATLAS, CMS and LHCb) that are using some or all of the Persistency Framework components to access their data. The POOL package is a hybrid technology store for C++ objects, using a mixture of streaming and relational technologies to implement both object persistency and object metadata catalogs and collections. POOL provides generic components that can be used by the experiments to store both their event data and their conditions data. The CORAL package is an abstraction layer with an SQL-free API for accessing data stored using relational database technologies. It is used directly by experiment-specific applications and internally by both COOL and POOL. The COOL package provides specific software components and tools for the h...

  4. Virulent Naegleria fowleri in an indoor swimming pool.

    Science.gov (United States)

    Kadlec, V; Cerva, L; Skvárová, J

    1978-09-15

    A reservoir of pathogenic Naegleria fowleri has been located in the cracked wall of a swimming pool where repeated outbreaks of primary amoebic meningoencephalitis were observed between 1962 and 1965.

  5. Environmental assessment, K Pool fish rearing, Hanford Site, Richland, Washington

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-01

    The US Department of Energy (DOE) has a need to respond to a request to lease facilities at the Hanford Site 100-KE and 100-KW filter plant pools (K Pools) for fish rearing activities. These fish rearing activities would be: (1) business ventures with public and private funds and (2) long-term enhancement and supplementation programs for game fish populations in the Columbia River Basin. The proposed action is to enter into a use permit or lease agreement with the YIN or other parties who would rear fish in the 100-K Area Pools. The proposed action would include necessary piping, pump, and electrical upgrades of the facility; cleaning and preparation of the pools; water withdrawal from the Columbia River, and any necessary water or wastewater treatment; and introduction, rearing and release of fish. Future commercial operations may be included.

  6. Cumulative Permitted Vernal Pool Losses - Mitigation Sites [ds652

    Data.gov (United States)

    California Department of Resources — This shapefile represents mitigation areas included in the Vernal Pool Clean Water Act Permit Database, developed by AECOM for the Placer Land Trust. The permit...

  7. Stable hyper-pooling and query expansion for event detection

    OpenAIRE

    Douze, Matthijs; Revaud, Jerome; Schmid, Cordelia; Jegou, Herve

    2013-01-01

    International audience; This paper makes two complementary contributions to event retrieval in large collections of videos. First, we propose hyper-pooling strategies that encode the frame descriptors into a representation of the video sequence in a stable manner. Our best choices compare favorably with regular pooling techniques based on k-means quantization. Second, we introduce a technique to improve the ranking. It can be interpreted either as a query expansion method or as a similarity a...

  8. Learnable pooling with Context Gating for video classification

    OpenAIRE

    Miech, Antoine; Laptev, Ivan; Sivic, Josef

    2017-01-01

    Common video representations often deploy an average or maximum pooling of pre-extracted frame features over time. Such an approach provides a simple means to encode feature distributions, but is likely to be suboptimal. As an alternative, we here explore combinations of learnable pooling techniques such as Soft Bag-of-words, Fisher Vectors , NetVLAD, GRU and LSTM to aggregate video features over time. We also introduce a learnable non-linear network unit, named Context Gating, aiming at mode...

  9. A Highly Efficient Design Strategy for Regression with Outcome Pooling

    OpenAIRE

    Mitchell, Emily M.; Lyles, Robert H.; Manatunga, Amita K.; Perkins, Neil J.; Schisterman, Enrique F.

    2014-01-01

    The potential for research involving biospecimens can be hindered by the prohibitive cost of performing laboratory assays on individual samples. To mitigate this cost, strategies such as randomly selecting a portion of specimens for analysis or randomly pooling specimens prior to performing laboratory assays may be employed. These techniques, while effective in reducing cost, are often accompanied by a considerable loss of statistical efficiency. We propose a novel pooling stra...

  10. Improved Energy Pooling Efficiency Through Inhibited Spontaneous Emission

    OpenAIRE

    LaCount, Michael D.; Lusk, Mark T.

    2017-01-01

    The radiative lifetime of molecules or atoms can be increased by placing them within a tuned conductive cavity that inhibits spontaneous emission. This was examined as a possible means of enhancing three-body, singlet-based upconversion, known as energy pooling. Achieving efficient upconversion of light has potential applications in the fields of photovoltaics, biofuels, and medicine. The affect of the photonically constrained environment on pooling efficiency was quantified using a kinetic m...

  11. Accuracy of allele frequency estimation using pooled RNA-Seq.

    Science.gov (United States)

    Konczal, M; Koteja, P; Stuglik, M T; Radwan, J; Babik, W

    2014-03-01

    For nonmodel organisms, genome-wide information that describes functionally relevant variation may be obtained by RNA-Seq following de novo transcriptome assembly. While sequencing has become relatively inexpensive, the preparation of a large number of sequencing libraries remains prohibitively expensive for population genetic analyses of nonmodel species. Pooling samples may be then an attractive alternative. To test whether pooled RNA-Seq accurately predicts true allele frequencies, we analysed the liver transcriptomes of 10 bank voles. Each sample was sequenced both as an individually barcoded library and as a part of a pool. Equal amounts of total RNA from each vole were pooled prior to mRNA selection and library construction. Reads were mapped onto the de novo assembled reference transcriptome. High-quality genotypes for individual voles, determined for 23,682 SNPs, provided information on 'true' allele frequencies; allele frequencies estimated from the pool were then compared with these values. 'True' frequencies and those estimated from the pool were highly correlated. Mean relative estimation error was 21% and did not depend on expression level. However, we also observed a minor effect of interindividual variation in gene expression and allele-specific gene expression influencing allele frequency estimation accuracy. Moreover, we observed strong negative relationship between minor allele frequency and relative estimation error. Our results indicate that pooled RNA-Seq exhibits accuracy comparable with pooled genome resequencing, but variation in expression level between individuals should be assessed and accounted for. This should help in taking account the difference in accuracy between conservatively expressed transcripts and these which are variable in expression level. © 2013 John Wiley & Sons Ltd.

  12. Interfacial energies of aqueous mixtures and porous coverings for enhancing pool boiling heat transfer

    Energy Technology Data Exchange (ETDEWEB)

    Melendez, Elva [CIICAp, Universidad Autonoma del Estado de Morelos, 62210 (Mexico); Reyes, Rene [Departamento de Ingenieria Quimica y Alimentos, Universidad de las Americas Puebla, Santa Catarina Martir Cholula, Puebla 72820 (Mexico)

    2006-08-15

    The interfacial energies effects on pool boiling were measured for combinations of aqueous ethanol mixtures and cationic surfactants. The mixture with 16% ethanol by weight had the lowest contact angle (associated to the highest wettability) and produced the highest convective heat transfer coefficient, h, among the aqueous ethanol mixtures. The surfactant sodium-lauryl-sulfate added at 100 ppm (its calculated critical micelle concentration CMC) to the 16% ethanol aqueous mixture produced an additional increment of the wettability of the mixture and of the h values; other concentrations of the surfactant reduced de contact angle and h values. The effect of these interfacial energies represents a mass-transfer contribution to pool boiling and the proposal of mixture effects both as increased spreadability and as micelle states. Several randomly constructed porous coverings, contributing to the breakage of vapor slugs around the heater, were tested; produced the highest h values for average pore diameters of 0.5 mm, and covering thickness of 0.972 mm. The synergistic effect on h of the interfacial energies of mixtures at their critical micelle concentration, and porous coverings was measured. Therefore, the independent driving forces combined in this study for increasing pool boiling heat transfer are (a) spreadability of the liquid on the solid; (b) the bubble's size reduction, achieved by micelle states; and (c) the bubble's breakage, induced by the porous coverings, for vapor flow not under pressure drop control. (author)

  13. Study of pool boiling of distilled water on SiO2 nanoparticle-coated wire

    Science.gov (United States)

    Pryazhnikov, M. I.; Minakov, A. V.

    2017-11-01

    Experimental results of pool boiling of distilled water on bare nichrome wire and SiO2 nanoparticle-coated wire are presented. Nano-coated wires were obtained by first boiling them in SiO2-water nanofluid. The nanofluid was prepared based on distilled water and SiO2 nanoparticles. The average size of the nanoparticles was 100 nm. The volume concentration of particles was equal 2%. Boiling curves of distilled water were obtained on bare nichrome wire and SiO2 nanoparticles coated wire. The coating increased the critical heat flux during boiling of water.

  14. On the relation between water pools and water holding capacity in cod muscle

    DEFF Research Database (Denmark)

    Andersen, Charlotte Møller; Jørgensen, Bo

    2004-01-01

    Low-field 1H nuclear magnetic resonance (NMR) relaxations were measured on muscle, minced muscle and centrifuged mince from cod that had been treated under various frozen and chill storage conditions. By using multi-way chemometrics, uni-exponential profiles were obtained, from which the transver...... to the samples used for measuring WHC. The two WHC quantities were also correlated to the waler distribution itself as measured by the relative pool sizes. © 2004 by The Haworth Press, Inc. All rights reserved....

  15. Seasonal variation in Chironomid emergence from coastal pools

    Directory of Open Access Journals (Sweden)

    Alexander T. Egan

    2015-07-01

    Full Text Available Understanding the phenology of emergences can be useful in determining seasonal chironomid life cycle patterns, which are often influenced by ice cover and temperature in cold climates. Lake Superior is the largest lake in North America and with a mean surface temperature of 3.9 °C influences regional climate. Coastal pools at Isle Royale, a wilderness archipelago in the northern part of the lake, occur in dense patches on low-gradient volcanic bedrock between the lakeshore and forest, creating variable microhabitats for Chironomidae. Four sites were sampled monthly from April to October, 2010. Surface-floating pupal exuviae were collected from a series of pools in two zones: a lower zone near the lake influenced by wave splash, and an upper zone near the forest and influenced by upland runoff. We used Jaccard’s and Whittaker’s diversity indexes to test community similarity across months. Temperature loggers in pools collected hourly readings for most of the study. Assemblage emergences were stable in upper pools, with significant similarity across late spring and summer months. Assemblages were seasonally variable in lower pools, with significant dissimilarity across spring, summer, and fall months. Few species in either zone were unique to spring or fall months. However, many summer species in the splash zone had a narrow emergence period occurring during calm weather following distinct increases in mean water temperature. Regardless of input of cold lake water to the lower zone, pools from both zones generally had corresponding temperature trends.

  16. Test Area North Pool Stabilization Project: Environmental assessment

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-05-01

    The Test Area North (TAN) Pool is located within the fenced TAN facility boundaries on the Idaho National Engineering Laboratory (INEL). The TAN pool stores 344 canisters of core debris from the March, 1979, Three Mile Island (TMI) Unit 2 reactor accident; fuel assemblies from Loss-of-Fluid Tests (LOFT); and Government-owned commercial fuel rods and assemblies. The LOFT and government owned commercial fuel rods and assemblies are hereafter referred to collectively as {open_quotes}commercial fuels{close_quotes} except where distinction between the two is important to the analysis. DOE proposes to remove the canisters of TMI core debris and commercial fuels from the TAN Pool and transfer them to the Idaho Chemical Processing Plant (ICPP) for interim dry storage until an alternate storage location other than at the INEL, or a permanent federal spent nuclear fuel (SNF) repository is available. The TAN Pool would be drained and placed in an industrially and radiologically safe condition for refurbishment or eventual decommissioning. This environmental assessment (EA) identifies and evaluates environmental impacts associated with (1) constructing an Interim Storage System (ISS) at ICPP; (2) removing the TMI and commercial fuels from the pool and transporting them to ICPP for placement in an ISS, and (3) draining and stabilizing the TAN Pool. Miscellaneous hardware would be removed and decontaminated or disposed of in the INEL Radioactive Waste Management Complex (RWMC). This EA also describes the environmental consequences of the no action alternative.

  17. Pooling breast cancer datasets has a synergetic effect on classification performance and improves signature stability

    Directory of Open Access Journals (Sweden)

    van de Vijver Marc J

    2008-08-01

    Full Text Available Abstract Background Michiels et al. (Lancet 2005; 365: 488–92 employed a resampling strategy to show that the genes identified as predictors of prognosis from resamplings of a single gene expression dataset are highly variable. The genes most frequently identified in the separate resamplings were put forward as a 'gold standard'. On a higher level, breast cancer datasets collected by different institutions can be considered as resamplings from the underlying breast cancer population. The limited overlap between published prognostic signatures confirms the trend of signature instability identified by the resampling strategy. Six breast cancer datasets, totaling 947 samples, all measured on the Affymetrix platform, are currently available. This provides a unique opportunity to employ a substantial dataset to investigate the effects of pooling datasets on classifier accuracy, signature stability and enrichment of functional categories. Results We show that the resampling strategy produces a suboptimal ranking of genes, which can not be considered to be a 'gold standard'. When pooling breast cancer datasets, we observed a synergetic effect on the classification performance in 73% of the cases. We also observe a significant positive correlation between the number of datasets that is pooled, the validation performance, the number of genes selected, and the enrichment of specific functional categories. In addition, we have evaluated the support for five explanations that have been postulated for the limited overlap of signatures. Conclusion The limited overlap of current signature genes can be attributed to small sample size. Pooling datasets results in more accurate classification and a convergence of signature genes. We therefore advocate the analysis of new data within the context of a compendium, rather than analysis in isolation.

  18. Large woody debris and flow resistance in step-pool channels, Cascade Range, Washington

    Science.gov (United States)

    Curran, Janet H.; Wohl, Ellen E.

    2003-01-01

    Total flow resistance, measured as Darcy-Weisbach f, in 20 step-pool channels with large woody debris (LWD) in Washington, ranged from 5 to 380 during summer low flows. Step risers in the study streams consist of either (1) large and relatively immobile woody debris, bedrock, or roots that form fixed, or “forced,” steps, or (2) smaller and relatively mobile wood or clasts, or a mixture of both, arranged across the channel by the stream. Flow resistance in step-pool channels may be partitioned into grain, form, and spill resistance. Grain resistance is calculated as a function of particle size, and form resistance is calculated as large woody debris drag. Combined, grain and form resistance account for less than 10% of the total flow resistance. We initially assumed that the substantial remaining portion is spill resistance attributable to steps. However, measured step characteristics could not explain between-reach variations in flow resistance. This suggests that other factors may be significant; the coefficient of variation of the hydraulic radius explained 43% of the variation in friction factors between streams, for example. Large woody debris generates form resistance on step treads and spill resistance at step risers. Because the form resistance of step-pool channels is relatively minor compared to spill resistance and because wood in steps accentuates spill resistance by increasing step height, we suggest that wood in step risers influences channel hydraulics more than wood elsewhere in the channel. Hence, the distribution and function, not just abundance, of large woody debris is critical in steep, step-pool channels.

  19. 454 sequencing of pooled BAC clones on chromosome 3H of barley

    Directory of Open Access Journals (Sweden)

    Yamaji Nami

    2011-05-01

    Full Text Available Abstract Background Genome sequencing of barley has been delayed due to its large genome size (ca. 5,000Mbp. Among the fast sequencing systems, 454 liquid phase pyrosequencing provides the longest reads and is the most promising method for BAC clones. Here we report the results of pooled sequencing of BAC clones selected with ESTs genetically mapped to chromosome 3H. Results We sequenced pooled barley BAC clones using a 454 parallel genome sequencer. A PCR screening system based on primer sets derived from genetically mapped ESTs on chromosome 3H was used for clone selection in a BAC library developed from cultivar "Haruna Nijo". The DNA samples of 10 or 20 BAC clones were pooled and used for shotgun library development. The homology between contig sequences generated in each pooled library and mapped EST sequences was studied. The number of contigs assigned on chromosome 3H was 372. Their lengths ranged from 1,230 bp to 58,322 bp with an average 14,891 bp. Of these contigs, 240 showed homology and colinearity with the genome sequence of rice chromosome 1. A contig annotation browser supplemented with query search by unique sequence or genetic map position was developed. The identified contigs can be annotated with barley cDNAs and reference sequences on the browser. Homology analysis of these contigs with rice genes indicated that 1,239 rice genes can be assigned to barley contigs by the simple comparison of sequence lengths in both species. Of these genes, 492 are assigned to rice chromosome 1. Conclusions We demonstrate the efficiency of sequencing gene rich regions from barley chromosome 3H, with special reference to syntenic relationships with rice chromosome 1.

  20. Carbon Accumulation and Nitrogen Pool Recovery during Transitions from Savanna to Forest in Central Brazil

    Science.gov (United States)

    Pellegrini, A.; Hoffmann, W. A.; Franco, A. C.

    2014-12-01

    The expansion of tropical forest into savanna may potentially be a large carbon sink, but little is known about the patterns of carbon sequestration during transitional forest formation. Moreover, it is unclear how nutrient limitation, due to extended exposure to firedriven nutrient losses, may constrain carbon accumulation. Here, we sampled plots that spanned a woody biomass gradient from savanna to transitional forest in response to differential fire protection in central Brazil. These plots were used to investigate how the process of transitional forest formation affects the size and distribution of carbon (C) and nitrogen (N) pools. This was paired with a detailed analysis of the nitrogen cycle to explore possible connections between carbon accumulation and nitrogen limitation. An analysis of carbon pools in the vegetation, upper soil, and litter shows that the transition from savanna to transitional forest can result in a fourfold increase in total carbon (from 43 to 179 Mg C/ha) with a doubling of carbon stocks in the litter and soil layers. Total nitrogen in the litter and soil layers increased with forest development in both the bulk (+68%) and plant-available (+150%) pools, with the most pronounced changes occurring in the upper layers. However, the analyses of nitrate concentrations, nitrate : ammonium ratios, plant stoichiometry of carbon and nitrogen, and soil and foliar nitrogen isotope ratios suggest that a conservative nitrogen cycle persists throughout forest development, indicating that nitrogen remains in low supply relative to demand. Furthermore, the lack of variation in underlying soil type (>20 cm depth) suggests that the biogeochemical trends across the gradient are driven by vegetation. Our results provide evidence for high carbon sequestration potential with forest encroachment on savanna, but nitrogen limitation may play a large and persistent role in governing carbon sequestration in savannas or other equally fire-disturbed tropical

  1. Tests of Selection in Pooled Case-Control Data: An Empirical Study

    Directory of Open Access Journals (Sweden)

    Nitin eUdpa

    2011-11-01

    Full Text Available For smaller organisms with faster breeding cycles, artificial selection can be used to create sub-populations with different phenotypic traits. Genetic tests can be employed to identify the causal markers for the phenotypes, as a precursor to engineering strains with a combination of traits. Traditional approaches involve analyzing crosses of inbred strains to test for co-segregation with genetic markers. Here we take advantage of cheaper next generation sequencing techniques to identifygenetic signatures of adaptation to the selection constraints. Obtaining individual sequencing data is often unrealistic due to cost and sample issues, so we focus on pooled genomic data.In this paper, we explore a series of statistical tests for selection using pooled case (under selection and control populations. Extensive simulations are used to show that these approaches work well for a wide range of population divergence times and strong selective pressures. We show that pooling does not have a significant impact on statistical power. The tests are also robust to reasonable variations in several different parameters, including window size, base-calling error rate, and sequencing coverage. We then demonstrate the viability (and the challenges of one of these methods in two independent Drosophila populations (Drosophila melanogaster bred under selectionfor hypoxia and accelerated development, respectively. Testing for extreme hypoxia tolerance showed clear signals of selection, pointing to loci that are important for hypoxia adaptation.Overall, we outline a strategy for finding regions under selection using pooled sequences, then devise optimal tests for that strategy. The approaches show promise for detecting selection, even several generations after fixation of the beneficial allele has occurred.

  2. Swimming pools and health-related behaviours: results of an Italian multicentre study on showering habits among pool users.

    Science.gov (United States)

    Pasquarella, C; Veronesi, L; Napoli, C; Castaldi, S; Pasquarella, M L; Saccani, E; Colucci, M E; Auxilia, F; Gallè, F; Di Onofrio, V; Tafuri, S; Signorelli, C; Liguori, G

    2013-07-01

    Showering before entering a swimming pool is highly recommended to reduce the risk of biological and chemical contamination. This study evaluated the behaviour of indoor swimming pool users; analysed the variables associated with lack of showering; and assessed awareness of the importance of showering. Cross-sectional study. A self-administered questionnaire was used to collect data about users of swimming pools located in five different Italian cities. The association between specific variables and the lack of showering was assessed. P swim showering was 'to wash oneself' (50.5%); or 'to get used to the temperature of the water' (44.3%); and 5.2% answered 'for both reasons'. Risk factors significantly associated with lack of showering were: female sex (odds ratio (OR) 1.37, 95% confidence interval (CI) 1.2-1.59), age 14-17 years (OR 5.09, 95% CI 3.40-7.64); not reading the swimming pool rules (OR 1.24, 95% CI 1.10-1.41); living in Central Italy (OR 3.3, 95% CI 2.65-4.1) or Southern Italy (OR 1.35, 95% CI 1.18-1.55); and previous/current attendance of a swimming course (OR 1.7, 95% CI 1.48-1.97). The results revealed low compliance with the rule of showering before entering a swimming pool, and little awareness of the preventive role of showering in the hygienic management of swimming pools. There is a need for targeted educational interventions to inform swimming pool users of the reasons for the importance of showering before entering a pool. Copyright © 2013 The Royal Society for Public Health. Published by Elsevier Ltd. All rights reserved.

  3. Assessing Actual and Potential Organic Carbon Pools in Southern Taiga and Forest-Steppe Ecosystems of Russia

    Science.gov (United States)

    Chernova, Olga; Ryzhova, Irina; Podvezennaya, Marina

    2014-05-01

    Recent debates on climate changes showed the importance of maintaining natural cycles of nutrients and preserving extensive areas of natural ecosystems to ensure sustainability of the biosphere. The size and distribution of nutrient pools within ecosystems are the key characteristics of the biological cycle reflecting changes in the functioning of natural systems. Carbon pools assessed in similar land-use types by different researchers are often poorly comparable due to various calculation algorithms, sampling techniques and sets of field data used. Model-based assessments often yield results that significantly depart from calculations based on actual field data. We estimated the actual and potential natural carbon pools using potential natural vegetation maps, soil maps, up-to-date statistics and results of regional studies. Organic carbon pools in biomass, forest litter, peat and soil were calculated for most typical natural (ecosystems, which experienced the least effect of historic land use) and modern ecosystems for two administrative regions of Russia: 1. Kursk region characterized by high productive natural steppe vegetation with predominance of chernozems - the country's most fertile soils, which were extensively transformed by agricultural activity; 2. Kostroma region, sparsely populated area with still abundant southern taiga forests. The average characteristics of vegetation productivity for natural and some human-modified ecosystems such as coniferous (pine, spruce) and noble broadleaf (oak, linden) forests, swamps, bogs, steppes, bottomland meadows, secondary forests, hayfields, pastures were calculated using the Database on the Productivity of Ecosystems in North Eurasia. The biological productivity of present-day forests and carbon pools in biomass were calculated using the program for assessing forest carbon budget (ROBUL model). Similar characteristics were used for agricultural areas. They were averaged according to crop rotations and recalculated

  4. Effects of surface shape on the geometry and surface topography of the melt pool in low-power density laser melting

    KAUST Repository

    Kim, Youngdeuk

    2011-04-15

    The quantitative correlations between workpiece volume and melt pool geometry, as well as the flow and thermal features of the melt pool are established. Thermocapillary convections in melt pool with a deformable free surface are investigated with respect to surface shape and laser intensity. When the contact angle between the tangent to the top surface and the vertical wall at the hot center is acute, the free surface flattens, compared with that of the initial free surface. Otherwise, the free surface forms a bowl-like shape with a deep crater and a low peripheral rim when the contact angle at the hot center is obtuse. Increasing the workpiece volume at a fixed laser intensity and a negative radial height gradient cause linear decreases in the geometric size and magnitude of flow and temperature of the melt pool. Conversely, linear increases are observed with a positive radial height gradient. © 2011 American Institute of Chemical Engineers (AIChE).

  5. UPDG: Utilities package for data analysis of Pooled DNA GWAS

    Directory of Open Access Journals (Sweden)

    Ho Daniel WH

    2012-01-01

    Full Text Available Abstract Background Despite being a well-established strategy for cost reduction in disease gene mapping, pooled DNA association study is much less popular than the individual DNA approach. This situation is especially true for pooled DNA genomewide association study (GWAS, for which very few computer resources have been developed for its data analysis. This motivates the development of UPDG (Utilities package for data analysis of Pooled DNA GWAS. Results UPDG represents a generalized framework for data analysis of pooled DNA GWAS with the integration of Unix/Linux shell operations, Perl programs and R scripts. With the input of raw intensity data from GWAS, UPDG performs the following tasks in a stepwise manner: raw data manipulation, correction for allelic preferential amplification, normalization, nested analysis of variance for genetic association testing, and summarization of analysis results. Detailed instructions, procedures and commands are provided in the comprehensive user manual describing the whole process from preliminary preparation of software installation to final outcome acquisition. An example dataset (input files and sample output files is also included in the package so that users can easily familiarize themselves with the data file formats, working procedures and expected output. Therefore, UPDG is especially useful for users with some computer knowledge, but without a sophisticated programming background. Conclusions UPDG provides a free, simple and platform-independent one-stop service to scientists working on pooled DNA GWAS data analysis, but with less advanced programming knowledge. It is our vision and mission to reduce the hindrance for performing data analysis of pooled DNA GWAS through our contribution of UPDG. More importantly, we hope to promote the popularity of pooled DNA GWAS, which is a very useful research strategy.

  6. Mercury concentrations and pools in four Sierra Nevada forest sites, and relationships to organic carbon and nitrogen

    Directory of Open Access Journals (Sweden)

    D. Obrist

    2009-05-01

    Full Text Available This study presents data on mercury (Hg concentrations, stochiometric relations to carbon (C and nitrogen (N, and Hg pool sizes in four Sierra Nevada forest sites of similar exposure and precipitation regimes, and hence similar atmospheric deposition, to evaluate how ecosystem parameters control Hg retention in ecosystems. In all four sites, the largest amounts of Hg reside in soils which account for 94–98% of ecosystem pools. Hg concentrations and Hg/C ratios increase in the following order: Green Needles/Leavesr2=0.58 and N and C (r2=0.64 in decomposing litter, but a positive correlation between litter Hg and N (r2=0.70. These inverse relations may reflect preferential retention of N and Hg over C during decomposition, or may be due to older age of decomposed litter layers which are exposed to longer-term atmospheric Hg deposition in the field. The results indicate that litter Hg levels depend on decomposition stage and may not follow generally observed positive relationships between Hg and organic C.

    Mineral soil layers show strong positive correlations of Hg to C across all sites and soil horizons (r2=0.83, but Hg concentrations are even more closely related to N with a similar slope to that observed in litter (r2=0.92. Soil N levels alone explain over 90% of Hg pool sizes across the four Sierra Nevada forest sites. This suggests that soil organic N and C groups provide sorption sites for Hg to retain atmospheric deposition. However, the patterns could be due to indirect relationships where high soil N and C levels reflect high ecosystem productivity which leads to corresponding high atmospheric Hg deposition inputs via leaf litterfall and plant senescence. Our results also show that two of the sites previously affected by

  7. Mapping Above- and Below-Ground Carbon Pools in Boreal Forests: The Case for Airborne Lidar.

    Science.gov (United States)

    Kristensen, Terje; Næsset, Erik; Ohlson, Mikael; Bolstad, Paul V; Kolka, Randall

    2015-01-01

    A large and growing body of evidence has demonstrated that airborne scanning light detection and ranging (lidar) systems can be an effective tool in measuring and monitoring above-ground forest tree biomass. However, the potential of lidar as an all-round tool for assisting in assessment of carbon (C) stocks in soil and non-tree vegetation components of the forest ecosystem has been given much less attention. Here we combine the use airborne small footprint scanning lidar with fine-scale spatial C data relating to vegetation and the soil surface to describe and contrast the size and spatial distribution of C pools within and among multilayered Norway spruce (Picea abies) stands. Predictor variables from lidar derived metrics delivered precise models of above- and below-ground tree C, which comprised the largest C pool in our study stands. We also found evidence that lidar canopy data correlated well with the variation in field layer C stock, consisting mainly of ericaceous dwarf shrubs and herbaceous plants. However, lidar metrics derived directly from understory echoes did not yield significant models. Furthermore, our results indicate that the variation in both the mosses and soil organic layer C stock plots appears less influenced by differences in stand structure properties than topographical gradients. By using topographical models from lidar ground returns we were able to establish a strong correlation between lidar data and the organic layer C stock at a stand level. Increasing the topographical resolution from plot averages (~2000 m2) towards individual grid cells (1 m2) did not yield consistent models. Our study demonstrates a connection between the size and distribution of different forest C pools and models derived from airborne lidar data, providing a foundation for future research concerning the use of lidar for assessing and monitoring boreal forest C.

  8. Mapping Above- and Below-Ground Carbon Pools in Boreal Forests: The Case for Airborne Lidar.

    Directory of Open Access Journals (Sweden)

    Terje Kristensen

    Full Text Available A large and growing body of evidence has demonstrated that airborne scanning light detection and ranging (lidar systems can be an effective tool in measuring and monitoring above-ground forest tree biomass. However, the potential of lidar as an all-round tool for assisting in assessment of carbon (C stocks in soil and non-tree vegetation components of the forest ecosystem has been given much less attention. Here we combine the use airborne small footprint scanning lidar with fine-scale spatial C data relating to vegetation and the soil surface to describe and contrast the size and spatial distribution of C pools within and among multilayered Norway spruce (Picea abies stands. Predictor variables from lidar derived metrics delivered precise models of above- and below-ground tree C, which comprised the largest C pool in our study stands. We also found evidence that lidar canopy data correlated well with the variation in field layer C stock, consisting mainly of ericaceous dwarf shrubs and herbaceous plants. However, lidar metrics derived directly from understory echoes did not yield significant models. Furthermore, our results indicate that the variation in both the mosses and soil organic layer C stock plots appears less influenced by differences in stand structure properties than topographical gradients. By using topographical models from lidar ground returns we were able to establish a strong correlation between lidar data and the organic layer C stock at a stand level. Increasing the topographical resolution from plot averages (~2000 m2 towards individual grid cells (1 m2 did not yield consistent models. Our study demonstrates a connection between the size and distribution of different forest C pools and models derived from airborne lidar data, providing a foundation for future research concerning the use of lidar for assessing and monitoring boreal forest C.

  9. Assessing Water Temperature Zones in Idealized Holding Pools for Chinook Salmon: A Hypothetical Study Based on the Regulated Lower San Joaquin River

    Science.gov (United States)

    Sivakumaran, K.; Villamizar, S. R.; Pai, H.; Aguilar, A.; Harmon, T. C.

    2014-12-01

    In regulated rivers such as the Lower San Joaquin River (LSJR) in California, environmental policy requires releasing adequate flows to maintain habitat quality for flora and fauna. The prescribed reservoir releases on the LSJR are tied to water year classifications in order to help satisfy competing water demands in dry years. The question remains as to whether relatively low releases will be adequate to maintain habitat quality for key aquatic species under current and projected climate conditions. This work examines one critical determinant of anadromous fish habitat suitability, water temperature, as a function of reservoir release conditions. More specifically, we study idealized pools subject to the conditions of the LSJR using an established 2D (longitudinal and vertical) flow and heat transport model (CE-QUAL-W2). We assessed the releases in the context of the spring run Chinook salmon (Onchorhynchus tshawytscha) life cycle (the key species in an ongoing restoration effort), focusing on summer holding conditions. Our objective was to determine the conditions under which pools provide sufficiently cool havens for the holding salmon under current and projected climate conditions. Using river bathymetry from measured cross-sections and a high-resolution DEM lidar product, we created a range of ideal pool size representative of LSJR conditions. After calibrating hydraulic and heat transfer parameters using available temperature profiles, we simulated temperature profiles in the pools for scheduled flow releases, at different downstream locations from the reservoir. Results include modeled temperature profiles in holding pools, and derived estimates of suitable holding capacity under a range of pool, releases and climate conditions. Potential engineering modifications are explored as potential mitigation strategies, such as modified flow schedules, riparian shading, pool sizes and pool relocations.

  10. Reverse energy pooling in a K-Na mixture

    Energy Technology Data Exchange (ETDEWEB)

    De Filippo, G.; Guldberg-Kjaer, S.; Milosevic, S.; Pedersen, J.O. [Niels Bohr Institute, O/rsted Laboratory, Universitetsparken 5, DK-2100 Copenhagen O/ (Denmark); Allegrini, M. [Istituto Nazionale per la Fisica della Materia, Dipartimento di Fisica, Universita di Pisa, Piazza Torricelli 2, I-56126, Pisa (Italy)]|[Dipartimento di Fisica della Materia e Tecnologie Fisiche Avanzate, Universita di Messina, Salita Sperone 31, I-98166, SantAgata-Messina (Italy)

    1998-01-01

    We report experimental rate coefficients for the reverse heteronuclear energy-pooling collisions K(5D)+Na(3S){r_arrow}K(4P)+Na(3P) and K(7S)+Na(3S){r_arrow}K(4P)+Na(3P) at thermal energies. Both reactions are exothermic and very high rates were observed showing that reverse exothermic energy-pooling is an order of magnitude more efficient than the corresponding forward endothermic energy-pooling reactions. This is in accordance with the general behavior of the exothermic and endothermic energy-pooling rate coefficients in alkali-metal atoms. In the experiment the potassium atoms were excited in two steps to either the 5D or 7S state via the 4P level using two broadband cw dye lasers. A double-modulation technique has been used to select the fluorescence contributions at the Na(3P{sub J}) exit channels due only to the above reactions. The ground-state sodium and potassium atom densities were measured by the absorption of lines from a K-Na hollow-cathode lamp. The measured densities and fluorescence intensities have been used to obtain absolute reverse energy-pooling rate coefficients. The contribution to the rate coefficients from other processes are discussed. {copyright} {ital 1998} {ital The American Physical Society}

  11. Water inventory management in condenser pool of boiling water reactor

    Science.gov (United States)

    Gluntz, Douglas M.

    1996-01-01

    An improved system for managing the water inventory in the condenser pool of a boiling water reactor has means for raising the level of the upper surface of the condenser pool water without adding water to the isolation pool. A tank filled with water is installed in a chamber of the condenser pool. The water-filled tank contains one or more holes or openings at its lowermost periphery and is connected via piping and a passive-type valve (e.g., squib valve) to a high-pressure gas-charged pneumatic tank of appropriate volume. The valve is normally closed, but can be opened at an appropriate time following a loss-of-coolant accident. When the valve opens, high-pressure gas inside the pneumatic tank is released to flow passively through the piping to pressurize the interior of the water-filled tank. In so doing, the initial water contents of the tank are expelled through the openings, causing the water level in the condenser pool to rise. This increases the volume of water available to be boiled off by heat conducted from the passive containment cooling heat exchangers. 4 figs.

  12. [ATP pool and bioluminescence in psychrophilic bacteria Photobacterium phosphoreum].

    Science.gov (United States)

    Alekserova, L É; Alenina, K A; Efremenko, E N; Mazhul', M M; Piskunova, N F; Ismailov, A D

    2014-01-01

    Bioluminescence activity and ATP pool were investigated in the culture of psychrophilic bacteria Photobacterium phosphoreum collected-from the exponential and stationary growth phases, as well as immobilized in polyvinyl alcohol (PVA) cryogel. In liquid culture, ATP pool remained at an almost a constant level throughout the luminescence cycle (over 100 h). The ATP pool in the stationary-phase and PVA-immobilizedl cells remained constant throughout their incubation in the medium (over 200 h) and in 3% NaCl solution (over 100 h): Quantitative assessment of integral photon yield and ATP pool indicated that bioluminescence decay in growing or stationary cells was not caused by limitation by the energy substrates of the luciferase reaction. Kinetic and quantitative parameters of emission activity and ATP pool excluded the possibility of formation of the aldehyde substrate for luciferase via reduction of the relevant fatty acids in NADPH and ATP-dependent reductase reaction and its oxidation in the monooxygenase reaction. Our results indicate that the aliphatic aldehyde is not utilized in the process of light emission.

  13. Health impact of disinfection by-products in swimming pools

    Directory of Open Access Journals (Sweden)

    Cristina M. Villanueva

    2012-12-01

    Full Text Available This article is focused on the epidemiological evidence on the health impacts related to disinfection by-products (DBPs in swimming pools, which is a chemical hazard generated as an undesired consequence to reduce the microbial pathogens. Specific DBPs are carcinogenic, fetotoxic and/or irritant to the airways according to experimental studies. Epidemiological evidence shows that swimming in pools during pregnancy is not associated with an increased risk of reproductive outcomes. An epidemiological study suggested an increased risk of bladder cancer with swimming pool attendance, although evidence is inconclusive. A higher prevalence of respiratory symptoms including asthma is found among swimming pool workers and elite swimmers, although the causality of this association is unclear. The body of evidence in children indicates that asthma is not increased by swimming pool attendance. Overall, the available knowledge suggests that the health benefits of swimming outweigh the potential health risks of chemical contamination. However, the positive effects of swimming should be enhanced by minimising potential risks.

  14. Large hydrocarbon fuel pool fires: Physical characteristics and thermal emission variations with height

    Energy Technology Data Exchange (ETDEWEB)

    Raj, Phani K. [Technology and Management Systems Inc., 102 Drake Road, Burlington, MA 01803 (United States)]. E-mail: tmsinc1981@verizon.net

    2007-02-09

    In a recent paper [P.K. Raj, Large LNG fire thermal radiation-modeling issues and hazard criteria revisited, Process Safety Progr., 24 (3) (2005)] it was shown that large, turbulent fires on hydrocarbon liquid pools display several characteristics including, pulsating burning, production of smoke, and reduced thermal radiation, with increasing size. In this paper, a semi-empirical mathematical model is proposed which considers several of these important fire characteristics. Also included in this paper are the experimental results for the variation of the fire radiance from bottom to top of the fire (and their statistical distribution) from the largest land spill LNG pool fire test conducted to date. The purpose of the model described in this paper is to predict the variation of thermal radiation output along the fire plume and to estimate the overall thermal emission from the fire as a function its size taking into consideration the smoke effects. The model utilizes experimentally measured data for different parameters and uses correlations developed from laboratory and field tests with different fuels. The fire dynamics and combustion of the fuel are modeled using known entrainment and combustion efficiency parameter values. The mean emissive power data from field tests are compared with model predictions. Model results for the average emissive powers of large, hypothetical LNG fires are indicated.

  15. Clustering statistics, roughness feedbacks, and randomness in experimental step-pool morphodynamics

    Science.gov (United States)

    Johnson, Joel P. L.

    2017-04-01

    Step pools are a common bed morphology in boulder-rich gravel streams, but predicting how mountainous landscapes will respond to environmental perturbations such as climate-related hydrological changes requires a better understanding of channel morphodynamics and factors that influence bed stability. Flume experiments exploring bed stabilization demonstrate feedbacks among surface roughness, coarse grain clustering, and surface grain size. Clustering is quantified by using a novel normalization of Ripley's K statistic designed for use in power law functions. At 95% confidence, many but not all beds stabilized with coarse grains becoming more clustered than complete spatial randomness. The clustering statistic predicts hydraulic roughness better than D84 does (the diameter at which 84% of grains are smaller), suggesting that the spatial organization of the bed can be a stronger control than grain size on flow hydraulics. Initial conditions affect the degree of clustering at stability, indicating sensitivity to history.

  16. Modeling corium jet breakup in water pool and application to ex-vessel fuel–coolant interaction analyses

    Energy Technology Data Exchange (ETDEWEB)

    Bang, Kwang-Hyun, E-mail: khbang@hhu.ac.kr; Kumar, Rohit; Kim, Hyoung-Tak

    2014-09-15

    Highlights: • Kelvin–Helmholtz Instability on melt–steam–water interfaces was solved numerically. • Corium jet breakup model was developed for FCI codes based on the KHI solutions. • Ex-vessel steam explosions in reactor cavity were calculated using TRACER-II code. - Abstract: In light water reactor core melt accidents, the molten fuel can be brought into contact with coolant water in the course of the melt relocation in-vessel and ex-vessel as well as in an accident mitigation action of water addition. For the last several decades, the potential risk of energetic molten fuel coolant interactions (FCIs, steam explosions) has drawn substantial attention in the safety analysis of reactor severe accidents. In this paper, an improved melt jet breakup model is presented and analyses of an energetic fuel–coolant interaction in a PWR cavity (1) partially filled (4 m deep) and (2) completely filled (7 m deep) with water are presented. The TRACER-II code was used in the analyses. For jet breakup model, the full dispersion equation of Kelvin–Helmholtz instability for the melt jet–vapor film–water was solved numerically and the solutions were correlated for use in the TRACER-II code. The new jet breakup model was benchmarked using FARO L28 test data. In reactor calculations the mixing calculations showed that the average melt drop size was much smaller in 4 m deep pool with 3 m free-fall than in 7 m deep pool. The explosion calculations showed that the peak pressure at the center of mixture was ∼90 MPa in 4 m deep pool, ∼25 MPa in 7 m deep pool. It also showed that the maximum impulse at the cavity wall was found at the lower wall in both cases and it was 50 kPa s in 4 m deep pool and 150 kPa s in 7 m deep pool.

  17. Effect of plant cover on distribution of soil organic matter pools

    Science.gov (United States)

    Gunina, Anna; Kuzyakov, Yakov; Ryzhova, Irina

    2013-04-01

    Numerous studies reported that quality and quantity of primary production and also the rate of litter decomposition determine the carbon (C) content and its distribution in soils. Our objective was to examine how the type of plant cover affects C sequestration in the following pools: unprotected, spatial inaccessible, interacting with silt and clay, and biochemically protected SOM. The large lysimeters of Moscow State University allowed quantification of C stocks under broadleaf forest (Acer platanoides and Quercus robur), coniferous forest (Picea abies) and agricultural crops (9-field rotation), while other soil forming factors affecting SOC content were identical. In 1965 the lysimeters (S=9 m2, depth=1.5 m) were filled with carbonate free clay loam taken in Moscow region, originated from the Valday glaciation, and plant communities listed above were planted. We collected soil samples from the mineral horizons, from 0-5 cm depth, in spring 2012. The soils were physically separated by combination of the particle size and density fractionations (8 fractions in total), and C and N contents were analyzed. The total C and N contents in non-fractionated soil were higher under broadleaf forest (66 and 3.1 g kg-1), than under coniferous forest (34.5 and 1.23 g kg-1) and agricultural crops (13.7 and 0.9 g kg-1). Under forests 45-50% of Ctotal and 30% of Ntotal were in the unprotected pool, in agricultural soil these percentages were in 3 times less. The greatest portions of protected C were in spatial inaccessible pool: 28, 32 and 40% of the Ctotal for broadleaf forest, coniferous forest and agricultural crops, respectively. However, the total C amount in this pool under agricultural crops was in 3 times less, than under forests. This is indicative for the loss of C-rich macroaggregates and an increase of C-depleted microaggregates in agricultural soils due to the plowing. The amounts of C, stabilized by interactions with silt and clay, were nearly the same (3-6 g kg-1

  18. Evaluation of Total Coliform, Fecal Coliform and Residual Chlorine in Swimming Pools in Kermanshah on the Season, the type of Pool, Disinfection System and Source of Water Supply in the during of three years (2010-2012

    Directory of Open Access Journals (Sweden)

    K SHarafi

    2014-11-01

    From the results , although the pools of water quality parameters has been studied in almost ideal But in summer, especially on a female pools and pools with wells water supply source than other pools , to be more oversight .

  19. Bathing birds bias beta-diversity: frequent dispersal by gulls homogenizes fauna in a rock-pool metacommunity.

    Science.gov (United States)

    Simonis, Joseph L; Ellis, Julie C

    2014-06-01

    Metacommunity theory generally predicts that regional dispersal of organisms among local habitat patches should influence spatial patterns of species diversity. In particular, increased dispersal rates are generally expected to increase local (alpha) diversity, yet homogenize local communities across the region (decreasing beta-diversity), resulting in no change in regional (gamma) diversity. Although the effect of dispersal on alpha-diversity has garnered much experimental attention, the influence of dispersal rates on diversity at larger spatial scales (beta and gamma) is poorly understood. Furthermore, these theoretical predictions are not well tested in the field, where other environmental factors (e.g., habitat size, resource density) likely also influence species diversity. Here, we used a system of freshwater rock pools on Appledore Island, Maine, USA, to test the effects of dispersal rate on species diversity in metacommunities. The pools exist in clusters (metacommunities) that experience different levels of dispersal imposed by gulls (Larus spp.), which we show to be frequent passive dispersers of rock-pool invertebrates. Although previous research has suggested that waterbirds may disperse aquatic invertebrates, our study is the first to quantify the rate at which such dispersal occurs and determine its effects on species diversity. In accordance with theory, we found that metacommunities experiencing higher dispersal rates had significantly more homogeneous local communities (reduced beta-diversity) and that gamma-diversity was not influenced by dispersal rate. Contrary to theoretical predictions, however, alpha-diversity in the rock pools was not significantly influenced by dispersal. Rather, local diversity was significantly positively related to local habitat size, and both alpha- and gamma-diversity were influenced by the physicochemical environment of the pools. These results provide an important field test of metacommunity theory, highlighting how

  20. Safety analysis of a pool Genesis II irradiator

    Energy Technology Data Exchange (ETDEWEB)

    Rodrigues Junior, Ary de A. [Universidade Estadual de Maringa, PR (Brazil). Dept. de Fisica

    2011-07-01

    The Genesis II Irradiator manufactured by GRAT{sup *}STAR Inc. (USA) is a category III gamma irradiator in which the sealed source is contained in a water filled storage pool and is shielded permanently, i.e. the material has to move down to the source. Even though the pool is 5.6 m deep, what would happen if the water level lowered? There are a series of safety devices that will avoid this situation and calculations show that the water level has to be very low in order to deliver a significant dose; moreover, only in case a person remains at the border of the pool for a long time this would be risky. In conclusion, it is practically impossible for someone to be exposed to radiation from a Genesis II Irradiator source. (author)

  1. Nanoparticle Deposition During Cu-Water Nanofluid Pool Boiling

    Science.gov (United States)

    Doretti, L.; Longo, G. A.; Mancin, S.; Righetti, G.; Weibel, J. A.

    2017-11-01

    The present research activity aims to rigorously investigate nanofluid pool boiling in order to definitively assess this as a technique for controlled nanoparticle coating of surfaces, which can enhance the nucleate boiling performance. This paper presents preliminary nanoparticle deposition results obtained during Cu-water (0.13 wt%) nanofluid pool boiling on a smooth copper surface. The tests were run in an experimental setup designed expressly to study water and nanofluid pool boiling. The square test sample block (27.2 mm × 27.2 mm) is equipped with a rake of four calibrated T-type thermocouples each located in a 13.6-mm deep holes drilled every 5 mm from 1 mm below the top surface. The imposed heat flux and wall superheat can be estimated from measurement of the temperature gradient along the four thermocouples. The samples are characterized by scanning electron microscopy (SEM) to analyse the morphological characteristics of the obtained thin, Cu nanoparticle coating.

  2. Inferring local ecological processes amid species pool influences

    DEFF Research Database (Denmark)

    Lessard, Jean-Philippe; Belmaker, Jonathan; Myers, Jonathan A.

    2012-01-01

    studies, null models of community structure, and ecologically explicit definitions of the species pool as a means to compare predominant ecological processes among regions. By uniting concepts and tools from community ecology and macroecology, this approach might facilitate synthesis and resolve many......Resolving contingencies in community ecology requires comparative studies of local communities along broad-scale environmental gradients and in different biogeographic regions. However, comparisons of local ecological processes among regions require a synthetic understanding of how the species pool...... of potential community members influences the structure of ecological communities. Here, we outline an integrative approach for quantifying local ecological processes while explicitly accounting for species pool influences. Specifically, we highlight the utility of combining geographically replicated local...

  3. Insertion sequences enrichment in extreme Red sea brine pool vent

    KAUST Repository

    Elbehery, Ali H. A.

    2016-12-03

    Mobile genetic elements are major agents of genome diversification and evolution. Limited studies addressed their characteristics, including abundance, and role in extreme habitats. One of the rare natural habitats exposed to multiple-extreme conditions, including high temperature, salinity and concentration of heavy metals, are the Red Sea brine pools. We assessed the abundance and distribution of different mobile genetic elements in four Red Sea brine pools including the world’s largest known multiple-extreme deep-sea environment, the Red Sea Atlantis II Deep. We report a gradient in the abundance of mobile genetic elements, dramatically increasing in the harshest environment of the pool. Additionally, we identified a strong association between the abundance of insertion sequences and extreme conditions, being highest in the harshest and deepest layer of the Red Sea Atlantis II Deep. Our comparative analyses of mobile genetic elements in secluded, extreme and relatively non-extreme environments, suggest that insertion sequences predominantly contribute to polyextremophiles genome plasticity.

  4. Models for Pooled Time-Series Cross-Section Data

    Directory of Open Access Journals (Sweden)

    Lawrence E Raffalovich

    2015-07-01

    Full Text Available Several models are available for the analysis of pooled time-series cross-section (TSCS data, defined as “repeated observations on fixed units” (Beck and Katz 1995. In this paper, we run the following models: (1 a completely pooled model, (2 fixed effects models, and (3 multi-level/hierarchical linear models. To illustrate these models, we use a Generalized Least Squares (GLS estimator with cross-section weights and panel-corrected standard errors (with EViews 8 on the cross-national homicide trends data of forty countries from 1950 to 2005, which we source from published research (Messner et al. 2011. We describe and discuss the similarities and differences between the models, and what information each can contribute to help answer substantive research questions. We conclude with a discussion of how the models we present may help to mitigate validity threats inherent in pooled time-series cross-section data analysis.

  5. The spatial variability of water chemistry and DOC in bog pools: the importance of slope position, diurnal turnover and pool type

    Science.gov (United States)

    Holden, Joseph; Turner, Ed; Baird, Andy; Beadle, Jeannie; Billett, Mike; Brown, Lee; Chapman, Pippa; Dinsmore, Kerry; Dooling, Gemma; Grayson, Richard; Moody, Catherine; Gee, Clare

    2017-04-01

    We have previously shown that marine influence is an important factor controlling regional variability of pool water chemistry in blanket peatlands. Here we examine within-site controls on pool water chemistry. We surveyed natural and artificial (restoration sites) bog pools at blanket peatland sites in northern Scotland and Sweden. DOC, pH, conductivity, dissolved oxygen, temperature, cations, anions and absorbance spectra from 220-750nm were sampled. We sampled changes over time but also conducted intensive spatial surveys within individual pools and between pools on the same sampling days at individual study sites. Artificial pools had significantly greater DOC concentrations and different spectral absorbance characteristics when compared to natural pools at all sites studied. Within-pool variability in water chemistry tended to be small, even for very large pools ( 400 m2), except where pools had a layer of loose, mobile detritus on their beds. In these instances rapid changes took place between the overlying water column and the mobile sediment layer wherein dissolved oxygen concentrations dropped from values of around 12-10 mg/L to values less than 0.5 mg/L over just 2-3 cm of the depth profile. Such strong contrasts were not observed for pools which had a hard peat floor and which lacked a significant detritus layer. Strong diurnal turnover occurred within the pools on summer days, including within small, shallow pools (e.g. control on several pool water chemistry variables including pH and DOC concentration with accumulation (higher concentrations) in pools that were located further downslope in both natural and artificial pool systems. These processes have important implications for our interpretation of water chemistry and gas flux data from pool systems, how we design our sampling strategies and how we upscale results.

  6. The pool chlorine hypothesis and asthma among boys.

    LENUS (Irish Health Repository)

    Cotter, A

    2012-01-31

    Swimming pool sanitation has largely been concerned with the microbiological quality of pool water, which is normally treated using a number of chlorine products. Recent studies have pointed to the potential hazards of chlorine by-products to the respiratory epithelium, particularly in indoor, poorly ventilated, pools. The aim of our study was to elucidate whether chronic exposure to indoor chlorinated swimming pools was associated with an increased likelihood of the development of asthma in boys. METHODS: The subjects were boys aged between 6 and 12 years. Data was collected by means of parental responses to a standardized asthma questionnaire (ISAAC: International Study of Asthma and Allergies in Childhood), supplemented with additional questions regarding frequency of attendance, number of years attendance, whether the child is a swimming team member. The questionnaire return rate was 71\\/% (n = 121). 23 boys were excluded on the basis that they had asthma before they started swimming (n = 97). There was a significant association between number of years a boy had been swimming and the likelihood of wheezing in the last 12 months (p = 0.009; OR = 1.351; 95% CI = 1.077-1.693) and diagnosed asthma (p = 0.046; OR = 1.299; 95% CI = 1.004-1.506). The greater the number the number of years a boy had been attending an indoor, chlorinated pool, the greater the likelihood of wheezing in the last 12 months or "had asthma". Age, parental smoking habits and being a swimming team member had no association with any of the asthma variables examined. Swimming pool attendance may be a risk factor in asthma in boys.

  7. The central equipment pool, an opportunity for improved technology management.

    Science.gov (United States)

    Gentles, W M

    2000-01-01

    A model for a central equipment pool managed by a clinical engineering department has been presented. The advantages to patient care and to the clinical engineering department are many. The distribution of portable technology that has been traditionally managed by the materials management function is a logical match to the expanding role of clinical engineering departments in technology management. Accurate asset management tools have allowed us to provide reliable measures of infusion pump utilization, permitting us to predict future needs as programs expand. Thus we are more actively involved in strategic technology planning. The central equipment pool is an excellent opportunity for the clinical engineering department to increase its technology management activities.

  8. The CERN Electronics Pool moves to Building 13

    CERN Multimedia

    PH Department

    2010-01-01

    After 32 years in Building 4 R‐050, the CERN Electronics Pool will re‐open in Building 13 R009 on Monday 13 December at 10:00 As of this date, you will be able to come and choose the instruments you want: oscilloscopes and other measurement instruments, low and high voltage power supplies, modular instrumentation, etc. Please do not hesitate to consult the catalogue and give us any input you may have. The CERN Electronics Pool operates on a self-service basis (with a CERN budget code) and is available for any help you may need.

  9. Cryptosporidium and Giardia in Swimming Pools, Atlanta, Georgia

    Centers for Disease Control (CDC) Podcasts

    2008-05-29

    In this podcast, Dan Rutz speaks with Dr. Joan Shields, a guest researcher with the Healthy Swimming Program at CDC, about an article in June 2008 issue of Emerging Infectious Diseases reporting on the results of a test of swimming pools in the greater Atlanta, Georgia area. Dr. Shields tested 160 pools in metro Atlanta last year for Cryptosporidium and Giardia. These germs cause most recreational water associated outbreaks.  Created: 5/29/2008 by Emerging Infectious Diseases.   Date Released: 5/29/2008.

  10. Pool sajandit geenilugu, pikk tee veel käia / Tiit Kändler

    Index Scriptorium Estoniae

    Kändler, Tiit, 1948-

    2003-01-01

    Vt. ka Koit 22. apr., lk. 7 pealkirja all: Tänavu täitub pool sajandit geenilugu. Võrumaa Teataja 26. apr., lk. 7 pealkirja all: Pool sajandit geeniuuringuid. Inimese genoom on lõplikult järjestatud. Vooremaa 29. apr., lk. 5 pealkirja all: Pool sajandit geenilugu. Virumaa Teataja 23. juuli, lk. 7 pealkirja all: Pool sajandit geenilugu

  11. Direct and Inverse Problems of Item Pool Design for Computerized Adaptive Testing

    Science.gov (United States)

    Belov, Dmitry I.; Armstrong, Ronald D.

    2009-01-01

    The recent literature on computerized adaptive testing (CAT) has developed methods for creating CAT item pools from a large master pool. Each CAT pool is designed as a set of nonoverlapping forms reflecting the skill levels of an assumed population of test takers. This article presents a Monte Carlo method to obtain these CAT pools and discusses…

  12. 76 FR 7975 - Commodity Pool Operators and Commodity Trading Advisors: Amendments to Compliance Obligations

    Science.gov (United States)

    2011-02-11

    ... financial regulators tasked with overseeing the financial integrity of the economy. Through the collection... implications. Finally, the Commission is proposing to collect information regarding a pool's subscriptions and...-level information, pool performance, pool subscriptions and redemptions, and the market value of pool...

  13. Measure Guideline. Replacing Single-Speed Pool Pumps with Variable Speed Pumps for Energy Savings

    Energy Technology Data Exchange (ETDEWEB)

    Hunt, A. [Building Media and the Building America Retrofit Alliance (BARA), Wilmington, DE (United States); Easley, S. [Building Media and the Building America Retrofit Alliance (BARA), Wilmington, DE (United States)

    2012-05-01

    This measure guideline evaluates potential energy savings by replacing traditional single-speed pool pumps with variable speed pool pumps, and provides a basic cost comparison between continued uses of traditional pumps verses new pumps. A simple step-by-step process for inspecting the pool area and installing a new pool pump follows.

  14. Measure Guideline: Replacing Single-Speed Pool Pumps with Variable Speed Pumps for Energy Savings

    Energy Technology Data Exchange (ETDEWEB)

    Hunt, A.; Easley, S.

    2012-05-01

    The report evaluates potential energy savings by replacing traditional single-speed pool pumps with variable speed pool pumps, and provide a basic cost comparison between continued uses of traditional pumps verses new pumps. A simple step-by-step process for inspecting the pool area and installing a new pool pump follows.

  15. The impact of urbanization on water and sediment chemistry of ephemeral forest pools

    Science.gov (United States)

    Robert T. Brooks; Suzanne D. Miller; John Newsted

    2002-01-01

    We compared the water and sediment composition of two ephemeral pools located in forested settings in a developed suburban area with two similar pools located in extensive forest in Massachusetts. We also compared the macroinvertebrate communities. The sediments of the forest pools were 100% organic material, while those of the urban pools were predominantly silt. The...

  16. Examination of homogeneity of selected Irish pooling groups

    Science.gov (United States)

    Das, S.; Cunnane, C.

    2010-07-01

    In regional flood frequency estimation, a homogeneous pooling group of sites leads to a reduction in the error of quantile estimators which is the main aim of a regional flood frequency analysis. Examination of the homogeneity of regions/pooling groups is usually based on a statistic that relates to the formulation of a frequency distribution model, e.g. the coefficient of variation (Wiltshire, 1986; Fill and Stedinger, 1995) and/or skew coefficient, their L-moment equivalents (Chowdhury et al., 1991; Hosking and Wallis, 1997) or of dimensionless quantiles such as the 10-yr event (Dalrymple, 1960; Lu and Stedinger, 1992). Hosking andWallis (1993, 1997) proposed homogeneity tests based on L-moment ratios such as L-CV alone (H1) and L-CV & L-skewness jointly (H2) which were also recently investigated by Viglione et al. (2007). In this paper a study, based on annual maximum series obtained from 85 Irish gauging stations, examines how successful a common method of identifying pooling group membership is in selecting groups that actually are homogeneous. Each station has its own unique pooling group selected by use of a Euclidean distance measure in catchment descriptor space, commonly denoted dij and with a minimum of 500 station years of data in the pooling group, which satisfies the 5T rule (FEH, 1999, 3, p. 169) for the 100 yr quantile. It was found that dij could be effectively defined in terms of catchment area, mean rainfall and baseflow index. The sampling distribution of L-CV (t2) in each pooling group and the 95% confidence limits about the pooled estimate of t2 are obtained by simulation. The t2 values of the selected group members are compared with these confidence limits both graphically and numerically. Of the 85 stations, only 1 station's pooling group members have all their t2 values within the confidence limits, while 7, 33 and 44 of them have 1, 2 or 3 or more, t2 values outside the confidence limits. The outcomes are also compared with the

  17. Fuel-reduction management alters plant composition, carbon and nitrogen pools, and soil thaw in Alaskan boreal forest

    Science.gov (United States)

    Melvin, April M.; Celis, Gerardo; Johnstone, Jill F.; McGuire, A. David; Genet, Helene; Schuur, Edward A.G.; Rupp, T. Scott; Mack, Michelle C.

    2018-01-01

    Increasing wildfire activity in Alaska's boreal forests has led to greater fuel-reduction management. Management has been implemented to reduce wildfire spread, but the ecological impacts of these practices are poorly known. We quantified the effects of hand-thinning and shearblading on above- and belowground stand characteristics, plant species composition, carbon (C) and nitrogen (N) pools, and soil thaw across 19 black spruce (Picea mariana) dominated sites in interior Alaska treated 2-12 years prior to sampling. The density of deciduous tree seedlings was significantly higher in shearbladed areas compared to unmanaged forest (6.4 vs. 0.1 stems m−2), and unmanaged stands exhibited the highest mean density of conifer seedlings and layers (1.4 stems m−2). Understory plant community composition was most similar between unmanaged and thinned stands. Shearblading resulted in a near complete loss of aboveground tree biomass C pools while thinning approximately halved the C pool size (1.2 kg C m−2 compared to 3.1 kg C m−2 in unmanaged forest). Significantly smaller soil organic layer (SOL) C and N pools were observed in shearbladed stands (3.2 kg C m−2 and 116.8 g N m−2) relative to thinned (6.0 kg C m−2 and 192.2 g N m−2) and unmanaged (5.9 kg C m−2 and 178.7 g N m−2) stands. No difference in C and N pool sizes in the uppermost 10 cm of mineral soil was observed among stand types. Total C stocks for measured pools was 2.6 kg C m−2 smaller in thinned stands and 5.8 kg C m−2smaller in shearbladed stands when compared to unmanaged forest. Soil thaw depth averaged 13 cm deeper in thinned areas and 46 cm deeper in shearbladed areas relative to adjacent unmanaged stands, although variability was high across sites. Deeper soil thaw was linked to shallower SOL depth for unmanaged stands and both management types, however for any given SOL depth, thaw tended to be deeper in shearbladed areas compared to unmanaged forest. These findings indicate

  18. Fuel-reduction management alters plant composition, carbon and nitrogen pools, and soil thaw in Alaskan boreal forest.

    Science.gov (United States)

    Melvin, April M; Celis, Gerardo; Johnstone, Jill F; McGuire, A David; Genet, Helene; Schuur, Edward A G; Rupp, T Scott; Mack, Michelle C

    2018-01-01

    Increasing wildfire activity in Alaska's boreal forests has led to greater fuel-reduction management. Management has been implemented to reduce wildfire spread, but the ecological impacts of these practices are poorly known. We quantified the effects of hand-thinning and shearblading on above- and belowground stand characteristics, plant species composition, carbon (C) and nitrogen (N) pools, and soil thaw across 19 sites dominated by black spruce (Picea mariana) in interior Alaska treated 2-12 years prior to sampling. The density of deciduous tree seedlings was significantly higher in shearbladed areas compared to unmanaged forest (6.4 vs. 0.1 stems/m2 ), and unmanaged stands exhibited the highest mean density of conifer seedlings and layers (1.4 stems/m2 ). Understory plant community composition was most similar between unmanaged and thinned stands. Shearblading resulted in a near complete loss of aboveground tree biomass C pools while thinning approximately halved the C pool size (1.2 kg C/m2 compared to 3.1 kg C/m2 in unmanaged forest). Significantly smaller soil organic layer (SOL) C and N pools were observed in shearbladed stands (3.2 kg C/m2 and 116.8 g N/m2 ) relative to thinned (6.0 kg C/m2 and 192.2 g N/m2 ) and unmanaged (5.9 kg C/m2 and 178.7 g N/m2 ) stands. No difference in C and N pool sizes in the uppermost 10 cm of mineral soil was observed among stand types. Total C stocks for measured pools was 2.6 kg C/m2 smaller in thinned stands and 5.8 kg C/m2 smaller in shearbladed stands when compared to unmanaged forest. Soil thaw depth averaged 13 cm deeper in thinned areas and 46 cm deeper in shearbladed areas relative to adjacent unmanaged stands, although variability was high across sites. Deeper soil thaw was linked to shallower SOL depth for unmanaged stands and both management types, however for any given SOL depth, thaw tended to be deeper in shearbladed areas compared to unmanaged forest. These findings indicate that fuel

  19. Species richness at the guild level: effects of species pool and local environmental conditions on stream macroinvertebrate communities.

    Science.gov (United States)

    Grönroos, Mira; Heino, Jani

    2012-05-01

    1. A fundamental question in ecology is which factors determine species richness. Here, we studied the relative importance of regional species pool and local environmental characteristics in determining local species richness (LSR). Typically, this question has been studied using whole communities or a certain taxonomic group, although including species with widely varying biological traits in the same analysis may hinder the detection of ecologically meaningful patterns. 2. We studied the question above for whole stream macroinvertebrate community and within functional feeding guilds. We defined the local scale as a riffle site and the regional scale (i.e. representing the regional species pool) as a stream. Such intermediate-sized regional scale is rarely studied in this context. 3. We sampled altogether 100 sites, ten riffles (local scale) in each of ten streams (regional scale). We used the local-regional richness regression plots to study the overall effect of regional species pool on LSR. Variation partitioning was used to determine the relative importance of regional species pool and local environmental conditions for species richness. 4. The local-regional richness relationship was mainly linear, suggesting strong species pool effects. Only one guild showed some signs of curvilinearity. However, variation partitioning showed that local environmental characteristics accounted for a larger fraction of variance in LSR than regional species pool. Also, the relative importance of the fractions differed between the whole community and guilds, as well as among guilds. 5. This study indicates that the importance of the local and regional processes may vary depending on feeding guild and trophic level. We conclude that both the size of the regional species pool and local habitat characteristics are important in determining LSR of stream macroinvertebrates. Our results are in agreement with recent large-scale studies conducted in highly different study

  20. Pushing HTCondor and glideinWMS to 200K+ Jobs in a Global Pool for CMS before Run 2

    Energy Technology Data Exchange (ETDEWEB)

    Balcas, J. [Vilnius U.; Belforte, S. [Trieste U.; Bockelman, B. [Nebraska U.; Gutsche, O. [Fermilab; Khan, F. [Quaid-i-Azam U.; Larson, K. [Fermilab; Letts, J. [UC, San Diego; Mascheroni, M. [Milan Bicocca U.; Mason, D. [Fermilab; McCrea, A. [UC, San Diego; Saiz-Santos, M. [UC, San Diego; Sfiligoi, I. [UC, San Diego

    2015-12-23

    The CMS experiment at the LHC relies on HTCondor and glideinWMS as its primary batch and pilot-based Grid provisioning system. So far we have been running several independent resource pools, but we are working on unifying them all to reduce the operational load and more effectively share resources between various activities in CMS. The major challenge of this unification activity is scale. The combined pool size is expected to reach 200K job slots, which is significantly bigger than any other multi-user HTCondor based system currently in production. To get there we have studied scaling limitations in our existing pools, the biggest of which tops out at about 70K slots, providing valuable feedback to the development communities, who have responded by delivering improvements which have helped us reach higher and higher scales with more stability. We have also worked on improving the organization and support model for this critical service during Run 2 of the LHC. This contribution will present the results of the scale testing and experiences from the first months of running the Global Pool.

  1. Effects of Nominal Maximum Aggregate Size on the Performance of Stone Matrix Asphalt

    Directory of Open Access Journals (Sweden)

    Hongying Liu

    2017-01-01

    Full Text Available It is well known that the performance of hot mix asphalt (HMA in service life is closely related to a proper aggregate gradation. A laboratory study was conducted to investigate the effects of nominal maximum aggregate size (NMAS on the performance of stone matrix asphalt (SMA. The volumetric characteristics and performance properties obtained from wheel tracking tests, permeability test, beam bending test, contabro test are compared for SMA mixes with different NMAS. The results indicated that voids in mineral aggregate (VMA and voids filled with asphalt (VFA of SMA mixtures increased with a decrease of aggregate size in aggregate gradation. SMA30 had the lowest optimum asphalt content among all the mixtures. Increase of NMAS contributed to improvement of the rutting resistance of SMA mixtures. However, a decrease of NMAS showed better cracking and raveling resistance. Permeability rate of SMA was primarily affected by the air voids (AV and break point sieve, but was also sensitive to aggregate gradation to some extent, with reduced NMAS corresponding to less permeability rate. Based on the test results, SMA5 and SMA13 are suggested to be used as a water-proof layer in bridge deck pavement, and SMA20 and SMA30 are suggested to be used as binder course in asphalt pavement, which needs to possess superior rutting resistance at high temperature.

  2. Detection of Chlamydia trachomatis infections by polymerase chain reaction in asymptomatic pregnant women with special reference to the utility of the pooling of urine specimens

    Directory of Open Access Journals (Sweden)

    Sunil Sethi

    2017-01-01

    Interpretation & conclusions: Our study detected C. trachomatis infection in 1.6 per cent asymptomatic pregnant women, and pooling of FVU specimens for PCR testing was found to be a cost-saving strategy in comparison to testing individual samples. Further evaluation and studies on the bigger sample size are warranted to validate these results.

  3. Melt pool vorticity in deep penetration laser material welding

    Indian Academy of Sciences (India)

    In the present study, the vorticity of melt motion in the keyhole and weld pool has been evaluated in case of high power CO2 laser beam welding. The circulation of vorticity is obtained as a function of Reynolds number for a given keyhole volume which is linked to Mach number variation. The shear stress and thermal fluxes ...

  4. Melt pool vorticity in deep penetration laser material welding

    Indian Academy of Sciences (India)

    Abstract. In the present study, the vorticity of melt motion in the keyhole and weld pool has been evaluated in case of high power CO2 laser beam welding. The circulation of vorticity is obtained as a function of Reynolds number for a given keyhole volume which is linked to Mach number variation. The shear stress and ther-.

  5. Managing multiple fishery pools: property right regimes and market structures

    NARCIS (Netherlands)

    Halsema, A.N.

    2008-01-01

    Well-defined and enforceable property rights are usually seen as a prerequisite for optimal resource management. However, the interaction effects between different renewable resource pools with different ownership structures are often not well recognized. In this paper we introduce these interaction

  6. How to improve hygienic behaviour in holiday park swimming pools

    NARCIS (Netherlands)

    Stronks, I.; Keuten, M.G.A.

    2016-01-01

    Previous studies on contamination of swimming pool water showed that the hygienic behaviour of swimmers is the most important factor. The suggested hygienic behaviour is; having a pre-swim shower and using the toilet when nature calls. Knowing the importance of hygienic behaviour is one thing,

  7. Imported malaria in pregnant women: A retrospective pooled analysis

    NARCIS (Netherlands)

    Käser, Annina K.; Arguin, Paul M.; Chiodini, Peter L.; Smith, Valerie; Delmont, Jean; Jiménez, Beatriz C.; Färnert, Anna; Kimura, Mikio; Ramharter, Michael; Grobusch, Martin P.; Schlagenhauf, Patricia

    2015-01-01

    Data on imported malaria in pregnant women are scarce. A retrospective, descriptive study of pooled data on imported malaria in pregnancy was done using data from 1991 to 2014 from 8 different collaborators in Europe, the United States and Japan. National malaria reference centres as well as

  8. Pronksist Theodor Pool ilmestab kooli aulat / Silvia Paluoja

    Index Scriptorium Estoniae

    Paluoja, Silvia, 1956-

    2006-01-01

    Pärnu Kuninga Tänava Põhikooli aulas avasid põllumajandusteadlase ja Eesti esimese põllutööministri tütar Mall Pool ja põllumajandusminister Ester Tuiksoo Theodor Pooli pronksbüsti, mille autoriks on skulptor Mare Mikof

  9. Poole-Frenkel (PF) effect high field saturation

    OpenAIRE

    Ongaro, R.; Pillonnet, A.

    1989-01-01

    An improved Poole Frenkel (PF) effect, based upon a rigorous methodological approach, is proposed. The chosen model is stated precisely, emphasis being made explicitly on the subtending hypotheses. A systematic reference to Fermi-Dirac function, allows to establish quantitatively the concept of PF saturation. The resulting general theory integrates, as particular applications, the previous one-dimensional PF theories.

  10. The Redox Potential of the Plastoquinone Pool of the Cyanobacterium

    NARCIS (Netherlands)

    Schuurmans, R.M.; Schuurmans, J.M.; Bekker, M.; Kromkamp, J.C.; Matthijs, H.C.P.; Hellingwerf, K.J.

    2014-01-01

    A method is presented for rapid extraction of the total plastoquinone (PQ) pool from Synechocystis sp. strain PCC 6803 cells that preserves the in vivo plastoquinol (PQH(2)) to -PQ ratio. Cells were rapidly transferred into ice-cold organic solvent for instantaneous extraction of the cellular PQ

  11. Delinquent mortgages, neglected swimming pools, and West Nile virus, California.

    Science.gov (United States)

    Reisen, William K; Takahashi, Richard M; Carroll, Brian D; Quiring, Rob

    2008-11-01

    Adjustable rate mortgages and the downturn in the California housing market caused a 300% increase in notices of delinquency in Bakersfield, Kern County. This led to large numbers of neglected swimming pools, which were associated with a 276% increase in the number of human West Nile virus cases during the summer of 2007.

  12. Sourcing and maintaining a pool of suitably skilled interpreters for ...

    African Journals Online (AJOL)

    For a relatively small campus, given the low numbers of simultaneous interpreters generally available, establishing and maintaining an interpreting service of this magnitude posed a serious challenge. This article (in a case study format) describes, firstly, the recruitment and selection, and secondly, the training of a pool of ...

  13. Quantification of continual anthropogenic pollutant release in swimming pools (poster)

    NARCIS (Netherlands)

    Peters, M.C.F.M.; Keuten, M.G.A.; Daanen, H.; De Kreuk, M.K.; Rietveld, L.C.; Van Loosdrecht, M.C.M.; Dijk, H.

    2013-01-01

    The amount of pollutants brought into the swimming pool water by swimmers is called anthropogenic pollutant release. The continual pollutant release is the amount of pollutants which is released during the submerged swimming period. The actual level of the continual pollutant release has not been

  14. Can Human Subject Pool Participation Benefit Sociology Students?

    Science.gov (United States)

    Chin, Lynn Gencianeo; Gibbs Stayte, Patricia

    2015-01-01

    Instructors at non-research institutions are less able to expose their students to research firsthand. Utilizing human subject pools (HSPs) in class may be a solution. Given that HSPs tend to be used in introduction to psychology classes at research institutions, we examine a community college HSP to answer three questions: (1) Do community…

  15. On some aspects of Indian Ocean warm pool

    Digital Repository Service at National Institute of Oceanography (India)

    Saji, P.K.; Balchand, A.N; RameshKumar, M.R.

    Annual and interannual variation of Indian Ocean Warm Pool (IOWP) was studied using satellite and in situ ocean temperature data IOWP surface area undergoes a strong annual cycle attaining a maximum of 24x106km2 during April...

  16. Vene maagaasi hind kerkis poole võrra / Katre Pilvinski

    Index Scriptorium Estoniae

    Pilvinski, Katre

    2008-01-01

    Ilmunud ka: Delovõje Vedomosti 2. juuli lk. 4. Venemaa Euroopasse müüdava maagaasi hind tõuseb sel aastal 2007. aastaga võrreldes ligi poole võrra, 410 dollarini tuhande kuupmeetri eest. Kommenteerib Sirje Riivald

  17. Overview of pool hydraulic design of Indian prototype fast breeder ...

    Indian Academy of Sciences (India)

    Computational Fluid Dynamics (CFD) plays a critical role in the design of pool type reactors and becomes an increasingly popular tool, thanks to the advancements in computing technology. In this paper, thermal hydraulic characteristics of a fast breeder reactor, design limits and challenging thermal hydraulic investigations ...

  18. Afterlife of a Drop Impacting a Liquid Pool

    Science.gov (United States)

    Saha, Abhishek; Wei, Yanju; Tang, Xiaoyu; Law, Chung K.

    2017-11-01

    Drop impact on liquid pool is ubiquitous in industrial processes, such as inkjet printing and spray coating. While merging of drop with the impacted liquid surface is essential to facilitate the printing and coating processes, it is the afterlife of this merged drop and associated mixing which control the quality of the printed or coated surface. In this talk we will report an experimental study on the structural evolution of the merged droplet inside the liquid pool. First, we will analyze the depth of the crater created on the pool surface by the impacted drop for a range of impact inertia, and we will derive a scaling relation and the associated characteristic time-scale. Next, we will focus on the toroidal vortex formed by the moving drop inside the liquid pool and assess the characteristic time and length scales of the penetration process. The geometry of the vortex structure which qualitatively indicates the degree of mixedness will also be discussed. Finally, we will present the results from experiments with various viscosities to demonstrate the role of viscous dissipation on the geometry and structure formed by the drop. This work is supported by the Army Research Office and the Xerox Corporation.

  19. Orographic control of the Bay of Bengal cold pool rainfall

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science; Volume 126; Issue 8. Orographic control of the Bay of Bengal cold pool ... More interestingly in the absence of WG mountains, the BoB-CP shows a rainfall maxima in the boreal summer similar to that over its surrounding oceans. The WG also impacts the climate over the ...

  20. 17 CFR 229.1105 - (Item 1105) Static pool information.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false (Item 1105) Static pool information. 229.1105 Section 229.1105 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... ENERGY POLICY AND CONSERVATION ACT OF 1975-REGULATION S-K Asset-Backed Securities (Regulation AB) § 229...

  1. Accounting Considerations in Public Sector Risk Management Pools.

    Science.gov (United States)

    Commons, Harriet V.

    1987-01-01

    The Government Accounting Standards Board's Insurance Issues Project has issued an invitation to comment on two issues: (1) whether governmental risk pools should follow the same accounting principles as commercial insurance companies and (2) financial statement disclosures required of entities with public accountability (MLF)

  2. Risk factors for oligodendroglial tumors: a pooled international study

    DEFF Research Database (Denmark)

    McCarthy, Bridget J; Rankin, Kristin M; Aldape, Ken

    2011-01-01

    possible risk factors for oligodendroglial tumors (including oligodendroglioma, anaplastic oligodendroglioma, and mixed glioma). Data from 7 case-control studies (5 US and 2 Scandinavian) were pooled. Unconditional logistic regression was used to calculate odds ratios (ORs) and 95% confidence intervals...

  3. Common-pool resources: Theoretical approaches for the analysis

    Directory of Open Access Journals (Sweden)

    María del Pilar Trujillo Cabrera

    2016-01-01

    Full Text Available This article presents a bibliographic review of the main trends of thought that have proposed models for the management of common-pool resources – CPR. It describes three generations of researchers; first, the conservative ideas of Garret Hardin, Mancur Olson and Albert W. Tucker, referring to the application of state regulation and privatization of property rights as the only solutions for the management of common pool resources; second, the liberal proposal of Elinor Ostrom and her colleagues, which call for the strengthening of local capacities and self-management, to reach successful models of common pool resources use; and finally, as a research agenda of third generation, the article presents the questioning of Eduardo Araral to the generalization of the policy prescriptions proposed by both currents. The usefulness of these theoretical approaches is visible for regions like the Colombian Amazon, where collective (public and private property rights prevail, and there is a current debate about the way as common pool resources should be administrated to guarantee the welfare of present and future generations. The analysis of these theoretical approaches is important, because it allows to improve the understanding of the dilemmas faced by local citizens and policy makers. In this sense, the comprehension of these approaches contributes to the regional debate about the models of natural resource management that should be adopted, in order to achieve their sustainable, efficient and equitable use.

  4. A NOVEL APPROACH TO SPENT FUEL POOL DECOMMISSIONING

    Energy Technology Data Exchange (ETDEWEB)

    R. L. Demmer

    2011-04-01

    The Idaho National Laboratory (INL) has been at the forefront of developing methods to reduce the cost and schedule of deactivating spent fuel pools (SFP). Several pools have been deactivated at the INL using an underwater approach with divers. These projects provided a basis for the INL cooperation with the Dresden Nuclear Power Station Unit 1 SFP (Exelon Generation Company) deactivation. It represents the first time that a commercial nuclear power plant (NPP) SFP was decommissioned using this underwater coating process. This approach has advantages in many aspects, particularly in reducing airborne contamination and allowing safer, more cost effective deactivation. The INL pioneered underwater coating process was used to decommission three SFPs with a total combined pool volume of over 900,000 gallons. INL provided engineering support and shared project plans to successfully initiate the Dresden project. This report outlines the steps taken by INL and Exelon to decommission SFPs using the underwater coating process. The rationale used to select the underwater coating process and the advantages and disadvantages are described. Special circumstances are also discussed, such as the use of a remotely-operated underwater vehicle to visually and radiologically map the pool areas that were not readily accessible. A larger project, the INTEC-603 SFP in-situ (grouting) deactivation, is reviewed. Several specific areas where special equipment was employed are discussed and a Lessons Learned evaluation is included.

  5. Solidification microstructures in single-crystal stainless steel melt pools

    Energy Technology Data Exchange (ETDEWEB)

    Sipf, J.B.; Boatner, L.A.; David, S.A.

    1994-03-01

    Development of microstructure of stationary melt pools of oriented stainless steel single crystals (70%Fe-15%Ni-15%Cr was analyzed. Stationary melt pools were formed by electron-beam and gas-tungsten-arc heating on (001), (011), and (111) oriented planes of the austenitic, fcc-alloy crystals. Characterization and analysis of resulting microstructure was carried out for each crystallographic plane and welding method. Results showed that crystallography which favors ``easy growth`` along the <100> family of directions is a controlling factor in the microstructural formation along with the melt-pool shape. The microstructure was found to depend on the melting method, since each method forms a unique melt-pool shape. These results are used in making a three-dimensional reconstruction of the microstructure for each plane and melting method employed. This investigation also suggests avenues for future research into the microstructural properties of electron-beam welds as well as providing an experimental basis for mathematical models for the prediction of solidification microstructures.

  6. Mitigating the impact of swimming pools on domestic water demand

    African Journals Online (AJOL)

    Keywords: urban water management, swimming pools, water demand management ... need to implement desalination schemes by ensuring water is ... significant saving of potable water and delay the need to invest in further water supply infrastructure such as dams and desali- nation plants. Such a ban would need to be ...

  7. Transportation library connectivity and development pooled fund study, final report.

    Science.gov (United States)

    2015-12-01

    This report is a record of the major activities and accomplishments of the Transportation Library : Connectivity and Development pooled fund study, TPF-5(237), from its approval by FHWA in : 2010 through its fifth and final annual meeting in August 2...

  8. Transportation library connectivity pooled fund study, TPF-5(105).

    Science.gov (United States)

    2010-10-01

    This report is a record of the formation, major activities and accomplishments of the Transportation Library Connectivity : pooled fund study, TPF-5(105), from its approval by FHWA in 2005 through its fifth and final annual meeting in September : 201...

  9. Isolation of Fungi in Swimming pools in Enugu, Nigeria | Mbata ...

    African Journals Online (AJOL)

    Results: The most common fungi recovered were as follows: Cladosporium spp 74%, Penicillium spp 38%, Aspergillus spp 35%, Rhizopus spp 6% and ... have with the water and aerosol, there should be proper monitoring and sanitation for successful control and management of swimming pool related fungal infections.

  10. 75 FR 76975 - 2015 Resource Pool-Sierra Nevada Region

    Science.gov (United States)

    2010-12-10

    ... (Western), a Federal power marketing administration of DOE, announces the Final 2015 Resource Pool allocations pursuant to its 2004 Power Marketing Plan (Marketing Plan) for the Sierra Nevada Customer Service... effective on January 10, 2011. FOR FURTHER INFORMATION CONTACT: Ms. Sonja Anderson, Power Marketing Manager...

  11. Acanthamoeba species in Swimming Pools of Cairo, Egypt.

    Directory of Open Access Journals (Sweden)

    Ahmad Al-Herrawy

    2014-06-01

    Full Text Available The free-living amoebae Acanthamoeba spp. have been recognized as etiologic agents of amoebic encephalitis, keratitis, otitis, lung lesions and other skin infections mainly in immuno-compromised individuals. The purpose of this study is to detect the presence of Acanthamoeba in swimming pools in Egypt using a polymerase chain reaction (PCR method.Water samples were collected from 10 different swimming pools in Cairo, Egypt. Samples were cultured on non-nutrient agar for the detection of Acanthamoeba isolates that were confirmed by PCR amplification using genus specific primers. The molecularly confirmed Acanthamoeba isolates were morphologically identified to the species level.Members of genus Acanthamoeba were detected in 49.2% of the examined swimming-pool water samples. Morphologically, six Acanthamoeba species were isolated from the examined swimming pool water namely A. polyphaga, A.castellanii, A. rhysodes, A. mauritaniensis, A. royreba and A. triangularis. All the identified species of Acanthamoeba were molecularly confirmed to be related to the genus Acanthamoeba.The isolated species of Acanthamoeba could provoke variable degrees of infections to the swimmers. The culture method is cheaper and easier than PCR techniques that are faster for the detection of free-living amoebae.

  12. Investigating the feasibility of municipal risk pooling as an ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Investigating the feasibility of municipal risk pooling as an adaptation finance measure. Climate change-related insurance products have been commonly used to manage the risks from climate hazards over the last few years. However, traditional insurance has not been effective for low-frequency, high-severity events.

  13. Quantitative trait locus mapping in dairy cattle by means of selective milk DNA pooling using dinucleotide microsatellite markers: analysis of milk protein percentage.

    Science.gov (United States)

    Lipkin, E; Mosig, M O; Darvasi, A; Ezra, E; Shalom, A; Friedmann, A; Soller, M

    1998-07-01

    "Selective DNA pooling" accomplishes quantitative trait locus (QTL) mapping through densitometric estimates of marker allele frequencies in pooled DNA samples of phenotypically extreme individuals. With poly(TG) microsatellites, such estimates are confounded by "shadow" ("stutter") bands. A correction procedure was developed on the basis of an observed linear regression between shadow band intensity and allele TG repeat number. Using this procedure, a selective DNA pooling study with respect to milk protein percentage was implemented in Israel-Holstein dairy cattle. Pools were prepared from milk samples of high and low daughters of each of seven sires and genotyped with respect to 11 markers. Highly significant associations with milk protein percentage were found for 5 of the markers; 4 of these markers confirmed previous reports. Selective DNA pooling accessed 80.6 and 48.3%, respectively, of the information that would have been available through individual selective genotyping or total population genotyping. In effect, the statistical power of 45,600 individual genotypings was obtained from 328 pool genotypings. This methodology can make genome-wide mapping of QTL accessible to moderately sized breeding organizations.

  14. Update on use of mine pool water for power generation.

    Energy Technology Data Exchange (ETDEWEB)

    Veil, J. A.; Puder, M. G.; Environmental Science Division

    2006-09-30

    In 2004, nearly 90 percent of the country's electricity was generated at power plants using steam-based systems (EIA 2005). Electricity generation at steam electric plants requires a cooling system to condense the steam. With the exception of a few plants using air-cooled condensers, most U.S. steam electric power plants use water for cooling. Water usage occurs through once-through cooling or as make-up water in a closed-cycle system (generally involving one or more cooling towers). According to a U.S. Geological Survey report, the steam electric power industry withdrew about 136 billion gallons per day of fresh water in 2000 (USGS 2005). This is almost the identical volume withdrawn for irrigation purposes. In addition to fresh water withdrawals, the steam electric power industry withdrew about 60 billion gallons per day of saline water. Many parts of the United States are facing fresh water shortages. Even areas that traditionally have had adequate water supplies are reaching capacity limits. New or expanded steam electric power plants frequently need to turn to non-traditional alternate sources of water for cooling. This report examines one type of alternate water source-groundwater collected in underground pools associated with coal mines (referred to as mine pool water in this report). In 2003, the U.S. Department of Energy's (DOE's) National Energy Technology Laboratory (NETL) funded Argonne National Laboratory (Argonne) to evaluate the feasibility of using mine pool water in Pennsylvania and West Virginia. That report (Veil et al. 2003) identified six small power plants in northeastern Pennsylvania (the Anthracite region) that had been using mine pool water for over a decade. It also reported on a pilot study underway at Exelon's Limerick Generating Station in southeastern Pennsylvania that involved release of water from a mine located about 70 miles upstream from the plant. The water flowed down the Schuylkill River and augmented the

  15. ALOS2-Indonesia REDD+ Experiment (AIREX): Soil Pool Carbon Application

    Science.gov (United States)

    Raimadoya, M.; Kristijono, A.; Sudiana, N.; Sumawinata, B.; Suwardi; Santoso, E.; Mahargo, D.; Sudarman, S.; Mattikainen, M.

    2015-04-01

    The bilateral REDD+ agreement between Indonesia and Norway [1] has scheduled that performance based result phase will be started in 2014. Therefore, a transparent and reliable Monitoring, Reporting and V erification (MRV) system for the following carbon pools: (1) biomass, (2) dead organic matter (DOM), and (3) soil, is required to be ready prior to the performance based phase. While the biomass pool could be acquired by space-borne radar (SAR) application i.e. SAR Interferometry (In-SAR) and Polarimetric SAR Interferometry (Pol-InSAR), the method for soil pool is still needed to be developed.A study was implemented in a test site located in the pulp plantation concession of Teluk Meranti Estate, Riau Andalan Pulp and Paper (RAPP), Pelalawan District, Riau Province, Indonesia. The study was intended to evaluate the possibility to estimate soil pool carbon with radar technology. For this purpose, a combination of spaceborne SAR (ALOS/PALSAR) and Ground Penetrating Radar (200 MHz IDS 200 MHz IDS GPR) were used in this exercise.The initial result this study provides a promising outcome for improved soil pool carbon estimation in tropical peat forest condition. The volume estimation of peat soil could be measured from the combination of spaceborne SAR and GPR. Based on this volume, total carbon content can be generated. However, the application of this approach has several limitation such as: (1) GPR survey can only be implemented during the dry season, (2) Rugged Terrain Antenna (RTA) type of GPR should be used for smooth GPR survey in the surface of peat soil which covered by DOM, and (3) the map of peat soil extent by spaceborne SAR need to be improved.

  16. Physician Assistant Applicant Pool: The First 50 Years.

    Science.gov (United States)

    McDaniel, M Jane; Ruback, Ted J

    2017-10-01

    The physician assistant (PA) profession's first attempt to characterize the applicant pool for PA education began with publication of the first Annual Report on Physician Assistant Educational Programs in the United States in 1985. The methodology used in the report was limited, however, in identifying the number of unique applicants to PA programs. Collecting accurate and reliable data on the profession's applicant pool was the primary motivator leading to initiation of the Central Application Service for Physician Assistants (CASPA) in 2001. In the past 15 years, CASPA has provided increasingly valuable data on the profession's applicant pool, allowing for accurate tracking and analysis of trends in the growth and changing demographics of those applying to PA educational programs. This special report presents a unique analysis of CASPA data that relates the competitiveness of entry into PA programs with that experienced by our colleagues in medicine, for both Doctor of Medicine (MD) and Doctor or Osteopathic Medicine (DO) schools. We present data reflecting the most notable changing demographics of the profession's applicant and matriculant pools in sex, age, grade point average, and health care experience. We use aggregate data of self-identified race descriptors to compare the contributions of PA, medical, and osteopathic medicine schools to the improvement of diversity within the health professions. To date, the applicant pool of PA programs seems to have kept pace with the expansion of existing programs and the development of new programs. This article poses serious questions for the profession to ponder, as the demographics of those entering PA education change and the number of PA graduates continues to grow.

  17. Improvement of sampling plans for Salmonella detection in pooled table eggs by use of real-time PCR

    DEFF Research Database (Denmark)

    Pasquali, Frédérique; De Cesare, Alessandra; Valero, Antonio

    2014-01-01

    pools of 10 eggs are tested by the culture based reference method ISO 6579:2004. In the current study we have compared the testing-sensitivity of the reference culture method ISO 6579:2004 and an alternative real-time PCR method on Salmonella contaminated egg-pool of different sizes (4-9 uninfected eggs...... mixed with one contaminated egg) and contamination levels (10°-10(1), 10(1)-10(2), 10(2)-10(3)CFU/eggshell). Two hundred and seventy samples corresponding to 15 replicates per pool size and inoculum level were tested. At the lowest contamination level real-time PCR detected Salmonella in 40......% of contaminated pools vs 12% using ISO 6579. The results were used to estimate the lowest number of sample units needed to be tested in order to have a 95% certainty not falsely to accept a contaminated lot by Monte Carlo simulation. According to this simulation, at least 16 pools of 10 eggs each are needed...

  18. Energy Pooling Upconversion in Free Space and Optical Cavities

    Science.gov (United States)

    LaCount, Michael D.

    The ability to efficiently convert the wavelength of light has value in a wide range of disciplines that include the fields of photovoltaics, plant growth, optics and medicine. The processes by which such transformations are carried out are known as upconversions and downconversions. There are several ways to up/down convert light, each with its own attributes, issues, and competing mechanisms. Most are associated with one-body or two-body processes. Three-body dynamics are also possible though, going by the names of quantum cutting (downconversion) and energy pooling (upconversion). These use virtual excited electronic states to mediate conversions as has been experimentally realized using lanthanide ions embedded in wide bandgap materials. The use of lanthanides to convert light is not ideal due to their relative scarcity, toxicity, and the limited range of light frequencies that can be absorbed and emitted. Organic molecules, on the other hand, are typically non-toxic, are made up of abundant elements, and can be designed with tailored spectral properties. At issue is whether or not they can be used to carry out efficient energy pooling, the central question to be answered in this thesis. The research presented here draws on a perturbative quantum electrodynamics framework previously established for generic energy pooling. It was used to develop a computational methodology for determining the rate of energy pooling and its competing processes. This, in turn, draws on a combination of time-dependent density functional theory, quantum electrodynamics, and perturbation theory to generate the requisite material property data. This computational model was applied to two test systems consisting of stilbene-fluorescein and hexabenzocoronene-oligothiophene. The stilbene-fluorescein system was found to have a maximum energy pooling rate efficiency (as compared to competing processes) of 17% and the hexabenzocoronene-oligothiophene system was found to have a maximum

  19. Enhancement of pool boiling heat transfer in water using sintered copper microporous coatings

    Energy Technology Data Exchange (ETDEWEB)

    Jun, Seong Chul; KIm, Jin Sub; You, Seung M. [Dept. of Mechanical Engineering, The University of Texas at Dallas, Richardson (United States); Son, Dong Gun; KIm, Hwan Yeol [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2016-08-15

    Pool boiling heat transfer of water saturated at atmospheric pressure was investigated experimentally on Cu surfaces with high-temperature, thermally-conductive, microporous coatings (HTCMC). The coatings were created by sintering Cu powders on Cu surfaces in a nitrogen gas environment. A parametric study of the effects of particle size and coating thickness was conducted using three average particle sizes (APSs) of 10 μm, 25 μm, and 67 μm and various coating thicknesses. It was found that nucleate boiling heat transfer (NBHT) and critical heat flux (CHF) were enhanced significantly for sintered microporous coatings. This is believed to have resulted from the random porous structures that appear to include reentrant type cavities. The maximum NBHT coefficient was measured to be approximately 400 kW/m2k with APS 67 μm and 296 μm coating thicknesses. This value is approximately eight times higher than that of a plain Cu surface. The maximum CHF observed was 2.1 MW/m2 at APS 67 μm and 428 μm coating thicknesses, which is approximately double the CHF of a plain Cu surface. The enhancement of NBHT and CHF appeared to increase as the particle size increased in the tested range. However, two larger particle sizes (25 μm and 67 μm) showed a similar level of enhancement.

  20. Lace-Espana experimental programme on the retention of aerosols in water pools

    Energy Technology Data Exchange (ETDEWEB)

    Marcos, M. J.; Gomez, F. J.; Melches, I.; Martin, M.; Lopez, M.

    1994-07-01

    A matrix of eleven experiments on aerosol retention behaviour in submerged beds and suppression pools in water- cooled reactors under severe accident conditions has been performed, for these experiments, an intermediate scales, multi-purpose facility was set up at CIEMAT (Madrid). The facility includes various systems: aerosol generation (Csl), mixing section, injection line and pool-vessel (8 m{sup 3} ), as well as the corresponding aerosol instrumentation and a process control and data acquisition system. Some parameters have been varied in order to study their influence in the DF: steam/noncondensable ratio in the accidental mixture (0.1 to 0.9), particle size, flow rate (two regimes: bubble and jet) and injector geometry (mono orifice and multi orifice). On the other hand, some parameters have been kept constant along the experiments; pool geometry (diameter, water level), water temperature, pressure in the atmosphere above the water, submergence, injection temperature and injection time. A rapid decrease in the DF is observed as the proportion of particles measuring less than 1 {mu}m increases. Retention decreases in the case of smaller particles and considerably higher in the case of larger particles. It has been also possible to observe the influence of the injected steam fraction. Experiments with greater fraction than the saturation fraction have greater DF than those ones with smaller fractions. The jet regime with horizontal injection and the multi orifice geometry would appear to show a somewhat higher capacity of retention than those in the bubble regime under similar conditions. It would be necessary to confirm this greater capacity for retention by means of additional experimental data. This work, performed by the LACE-Espana Consortium, has been carried out in the frame of the European Commissions Shared Cost Action Programme on Reactor Safety 1988-91 on a contractual basis. (Author)18 refs.

  1. Computationally feasible estimation of haplotype frequencies from pooled DNA with and without Hardy-Weinberg equilibrium.

    Science.gov (United States)

    Kuk, Anthony Y C; Zhang, Han; Yang, Yaning

    2009-02-01

    Pooling large number of DNA samples is a common practice in association study, especially for initial screening. However, the use of expectation-maximization (EM)-type algorithms in estimating haplotype distributions for even moderate pool sizes is hampered by the computational complexity involved. A novel constrained EM algorithm called PoooL has been proposed recently to bypass the difficulty via the use of asymptotic normality of the pooled allele frequencies. The resulting estimates are, however, not maximum likelihood estimates and hence not optimal. Furthermore, the assumption of Hardy-Weinberg equilibrium (HWE) made may not be realistic in practice. Rather than carrying out constrained maximization as in PoooL, we revert to the usual EM algorithm but make it computationally feasible by using normal approximations. The resulting algorithm is much simpler to implement than PoooL because there is no need to invoke sophisticated iterative scaling methods as in PoooL. We also develop an estimating equation analogue of the EM algorithm for the case of Hardy-Weinberg disequilibrium (HWD) by conditioning on the haplotypes of both chromosomes of the same individual. Incorporated into the method is a way of estimating the inbreeding coefficient by relating it to overdispersion. Simulation study assuming HWE shows that our simplified implementation of the EM algorithm leads to estimates with substantially smaller SDs than PoooL estimates. Further simulations show that ignoring HWD will induce biases in the estimates. Our extended method with estimation of inbreeding coefficient incorporated is able to reduce the bias leading to estimates with substantially smaller mean square errors. We also present results to suggest that our method can cope with a certain degree of locus-specific inbreeding as well as additional overdispersion not caused by inbreeding. http://staff.ustc.edu.cn/ approximately ynyang/aem-aes

  2. Sodium reflux pool-boiler solar receiver on-sun test results

    Energy Technology Data Exchange (ETDEWEB)

    Andraka, C E; Moreno, J B; Diver, R B; Moss, T A [Oak Ridge National Lab., TN (United States)

    1992-06-01

    The efficient operation of a Stirling engine requires the application of a high heat flux to the relatively small area occupied by the heater head tubes. Previous attempts to couple solar energy to Stirling engines generally involved directly illuminating the heater head tubes with concentrated sunlight. In this study, operation of a 75-kW{sub t} sodium reflux pool-boiler solar receiver has been demonstrated and its performance characterized on Sandia's nominal 75-kW{sub t} parabolic-dish concentrator, using a cold-water gas-gap calorimeter to simulate Stirling engine operation. The pool boiler (and more generally liquid-metal reflux receivers) supplies heat to the engine in the form of latent heat released from condensation of the metal vapor on the heater head tubes. The advantages of the pool boiler include uniform tube temperature, leading to longer life and higher temperature available to the engine, and decoupling of the design of the solar absorber from the engine heater head. The two-phase system allows high input thermal flux, reducing the receiver size and losses, therefore improving system efficiency. The receiver thermal efficiency was about 90% when operated at full power and 800{degree}C. Stable sodium boiling was promoted by the addition of 35 equally spaced artificial cavities in the wetted absorber surface. High incipient boiling superheats following cloud transients were suppressed passively by the addition of small amounts of xenon gas to the receiver volume. Stable boiling without excessive incipient boiling superheats was observed under all operating conditions. The receiver developed a leak during performance evaluation, terminating the testing after accumulating about 50 hours on sun. The receiver design is reported here along with test results including transient operations, steady-state performance evaluation, operation at various temperatures, infrared thermography, x-ray studies of the boiling behavior, and a postmortem analysis.

  3. Detection of Chlamydia trachomatis infections by polymerase chain reaction in asymptomatic pregnant women with special reference to the utility of the pooling of urine specimens.

    Science.gov (United States)

    Sethi, Sunil; Roy, Amit; Garg, Shubha; Venkatesan, Lakshmi Sree; Bagga, Rashmi

    2017-07-01

    Genital Chlamydia trachomatis (CT) infections are one of the most prevalent sexually transmitted infections across the world. In pregnant women, if not detected and treated early, these may result in poor pregnancy outcomes and complications. The present study was aimed to screen CT infections from first void urine (FVU) samples of asymptomatic pregnant women using molecular methods. The secondary objective was to evaluate cost-effectiveness in pooling FVU samples for their diagnostic application. FVU samples were collected from 1000 asymptomatic pregnant women over a period of three years. Pooling was done by including five specimens in one pool in the amount of 10 μl and subjected to polymerase chain reaction (PCR) and further confirmed by direct fluorescent antibody assay (DFA). The age of study participants ranged from 18 to 43 yr with the median±standard deviation of 26±3.84 yr. Majority of positive participants were younger than 25 years. A total of 200 pools were prepared and 20 of these were PCR positive. When individual specimen in 20 positive pools was tested, 20 PCR-positive specimens were identified from 19 pools, of which 16 were positive by DFA. Thus, CT was detected in 1.6 per cent asymptomatic pregnant women in India and pooling strategy resulted in 70 per cent reduction in a number of tests performed. Our study detected C. trachomatis infection in 1.6 per cent asymptomatic pregnant women, and pooling of FVU specimens for PCR testing was found to be a cost-saving strategy in comparison to testing individual samples. Further evaluation and studies on the bigger sample size are warranted to validate these results.

  4. Methods for pooling results of epidemiologic studies: The pooling project of prospective studies of diet and cancer

    NARCIS (Netherlands)

    Smith-Warner, S.A.; Spiegelman, D.; Ritz, J.; Albanes, D.; Beeson, W.L.; Bernstein, L.; Berrino, F.; Brandt, P.A. van den; Buring, J.E.; Cho, E.; Colditz, G.A.; Folsom, A.R.; Freudenheim, J.L.; Giovannucci, E.; Goldbohm, R.A.; Graham, S.; Harnack, L.; Horn-Ross, P.L.; Krogh, V.; Leitzmann, M.F.; McCullough, M.L.; Miller, A.B.; Rodriguez, C.; Rohan, T.E.; Schatzkin, A.; Shore, R.; Virtanen, M.; Willett, W.C.; Wolk, A.; Zeleniuch-Jacquotte, A.; Zhang, S.M.; Hunter, D.J.

    2006-01-01

    With the growing number of epidemiologic publications on the relation between dietary factors and cancer risk, pooled analyses that summarize results from multiple studies are becoming more common. Here, the authors describe the methods being used to summarize data on diet-cancer associations within

  5. Are large carbon-reserve pools beneficial for trees under drought?

    Science.gov (United States)

    Hoch, Guenter; Moesch, Anna; Buehler, Severin

    2014-05-01

    All plants store parts of the assimilated carbon (C) as non-structural C reserves (mainly starch, sugars and lipids) that can be re-allocated to growth or metabolism during times when the demand of C-sinks exceeds the current C-assimilation. It is generally assumed that the size of the C-reserve pool of a plant is indicative of its net C-balance. In contrast, it has been recently hypothesized that the often observed increase of C-reserve concentrations in trees exposed to climatic stress like drought or cold, are not caused by the overabundance of photoassimilates following the stress-induced cessation of growth, but might be intrinsic reactions to anticipate potential C-limitation under stressful situations (Wiley and Helliker 2012, New Phytologist 195). Within two experiments, we (1) tested the responsiveness of non-structural carbohydrates (NSC) in seedlings of three deciduous tree species (Carpinus, Fagus, Quercus) to C-shortage and -surplus, and (2) assessed the significance of the size of C-reserve stores to survive drought stress. We quantified the changes of NSC concentrations in seedlings that were exposed to different C-supplies for the first three month of the growing season (April to June), by exposing them to either different light regimes (100 %, 30 %, 3 % of full sunlight) or different atmospheric CO2 concentrations (200 ppm, 400 ppm, 600 ppm CO2). In all species, the concentrations of NSC reacted very strongly to the different treatments, with seedlings growing under low C-supply showing a significant depletion (especially starch), thereby corroborating the principal responsiveness of C-reserve pools to C-source-sink imbalances. Following this preconditioning, half of the seedlings from each light and CO2 treatment were exposed to moderate drought situations that led to the death of most of the seedlings by the end of the growing season (October). Differences in the drying-out rates between the light and CO2 treatments were compensated by selective

  6. Improving management of small natural features on private lands by negotiating the science-policy boundary for Maine vernal pools.

    Science.gov (United States)

    Calhoun, Aram J K; Jansujwicz, Jessica S; Bell, Kathleen P; Hunter, Malcolm L

    2014-07-29

    Vernal pools are far more important for providing ecosystem services than one would predict based on their small size. However, prevailing resource-management strategies are not effectively conserving pools and other small natural features on private lands. Solutions are complicated by tensions between private property and societal rights, uncertainties over resource location and function, diverse stakeholders, and fragmented regulatory authority. The development and testing of new conservation approaches that link scientific knowledge, stakeholder decision-making, and conservation outcomes are important responses to this conservation dilemma. Drawing from a 15-y history of vernal pool conservation efforts in Maine, we describe the coevolution of pool conservation and research approaches, focusing on how research-based knowledge was produced and used in support of management decisions. As management shifted from reactive, top-down approaches to proactive and flexible approaches, research shifted from an ecology-focused program to an interdisciplinary program based on social-ecological systems. The most effective strategies for linking scientific knowledge with action changed as the decision-makers, knowledge needs, and context for vernal pool management advanced. Interactions among stakeholders increased the extent to which knowledge was coproduced and shifted the objective of stakeholder engagement from outreach to research collaboration and development of innovative conservation approaches. New conservation strategies were possible because of the flexible, solutions-oriented collaborations and trust between scientists and decision-makers (fostered over 15 y) and interdisciplinary, engaged research. Solutions to the dilemma of conserving small natural features on private lands, and analogous sustainability science challenges, will benefit from repeated negotiations of the science-policy boundary.

  7. Improving management of small natural features on private lands by negotiating the science–policy boundary for Maine vernal pools

    Science.gov (United States)

    Calhoun, Aram J. K.; Jansujwicz, Jessica S.; Bell, Kathleen P.; Hunter, Malcolm L.

    2014-01-01

    Vernal pools are far more important for providing ecosystem services than one would predict based on their small size. However, prevailing resource-management strategies are not effectively conserving pools and other small natural features on private lands. Solutions are complicated by tensions between private property and societal rights, uncertainties over resource location and function, diverse stakeholders, and fragmented regulatory authority. The development and testing of new conservation approaches that link scientific knowledge, stakeholder decision-making, and conservation outcomes are important responses to this conservation dilemma. Drawing from a 15-y history of vernal pool conservation efforts in Maine, we describe the coevolution of pool conservation and research approaches, focusing on how research-based knowledge was produced and used in support of management decisions. As management shifted from reactive, top-down approaches to proactive and flexible approaches, research shifted from an ecology-focused program to an interdisciplinary program based on social–ecological systems. The most effective strategies for linking scientific knowledge with action changed as the decision-makers, knowledge needs, and context for vernal pool management advanced. Interactions among stakeholders increased the extent to which knowledge was coproduced and shifted the objective of stakeholder engagement from outreach to research collaboration and development of innovative conservation approaches. New conservation strategies were possible because of the flexible, solutions-oriented collaborations and trust between scientists and decision-makers (fostered over 15 y) and interdisciplinary, engaged research. Solutions to the dilemma of conserving small natural features on private lands, and analogous sustainability science challenges, will benefit from repeated negotiations of the science–policy boundary. PMID:25002496

  8. Spray drying of shark liver oil pool: Effects on physical-chemical properties and antioxidant capacity

    Directory of Open Access Journals (Sweden)

    Caridad M. García

    2018-02-01

    Full Text Available Context: Spray-drying is a technique used to produce encapsulated products, thus improving the stability of components as well as their organoleptic characteristics. Aims: To evaluate the effect of microencapsulation of shark liver oil pool by spray drying on its physical-chemical properties and antioxidant capacity. Methods: A mix design was created with a constant load of oil, made possible by controlling the proportion between chitosan acetate and maltodextrin. Loss on drying, encapsulation efficiency and yield were determined for the microcapsules. Reversed-phase HPLC analysis was used in order to determine the vitamin A content in microencapsulated and non-microencapsulated oil, as well as its delivery from the dried product. Vitamin A was the active compound used as a chemical marker. The following parameters were also evaluated: organoleptic characteristics, moisture content, particle size, surface morphology and antioxidant capacity. Results: The encapsulation efficiency of microencapsulated oil increased slightly as the concentration of chitosan acetate increased. In order to achieve a greater encapsulation efficiency and a lower moisture content in microencapsulated oil, the proportion between chitosan acetate and maltodextrin should be maintained at 35% and 35% each, according to established manufacturing conditions. Both polymers prevent oil from leaving the droplet. This is a very important factor in storage stability of vitamins and fatty acids, which are subject to oxidative deterioration. Conclusions: Spray-drying microencapsulation of pool oil does not affect vitamin A content or delivery; fatty acid content and antioxidant capacity are also not affected.

  9. Influence of Pools and Riffles on Chironomidae Diversity in Headwater Streams of the Atlantic Forest.

    Science.gov (United States)

    Silveira, L S; Rosa, B F J V; Gonçalves, E A; Alves, R G

    2015-10-01

    Studies on mesohabitat scale have been used to shed light on the ecology and distribution of chironomid larvae in small streams. Thus, the objective of the present study was to examine the diversity and distribution of the Chironomidae assemblage on the mesohabitat scale in three streams located in different preserved areas of southeastern Brazil. In each stream, litter samples were obtained in the dry season of 2010 in ten pools and ten riffles with a Surber sampler (area 0.04 m(2); mesh size 0.21 mm). The abundance was similar among streams and between mesohabitats, while the estimated richness was highest in riffles. There was a difference in the composition of the Chironomidae assemblages between the mesohabitats, although the litter composition was similar between them, indicating the importance of current speed on the distribution of the taxa. The dispersion of the sample units (β-diversity) of riffles and pools was similar, although it was different among the three streams. The results of this study provide further evidence of the importance of habitat heterogeneity within streams as a generator of diversity for Chironomidae in tropical lotic systems.

  10. Evaluation of a rapid analyte measurement platform and real-time reverse-transcriptase polymerase chain reaction assay West Nile virus detection system in mosquito pools.

    Science.gov (United States)

    Burkhalter, Kristen L; Horiuchi, Kalanthe; Biggerstaff, Brad J; Savage, Harry M; Nasci, Roger S

    2014-03-01

    We evaluated the commercially available Rapid Analyte Measurement Platform (RAMP) West Nile virus (WNV) antigen detection test for sensitivity and consistency with real-time reverse transcriptase polymerase chain reaction (RT-PCR) confirmation testing. Panels of samples consisting of WNV-spiked mosquito pools and negative control pools were sent to 20 mosquito abatement districts (MADs) that processed the pools using the RAMP assay. The samples were then sent to the reference laboratories used by the MADs for confirmation by real-time RT-PCR. Positive pools with virus titers of roughly 1-3 log10 PFU/ml had RAMP scores above the RAMP test positive cutoff score of 30 RAMP units, but these virus-positive samples could not be reliably confirmed by real-time RT-PCR testing. Pools with virus titers > or =4 log10 PFU/ml scored > or =50 RAMP units. Real-time RT-PCR results varied among the confirmation laboratories. With few exceptions, pools returning a RAMP score of > or =100 were confirmed with real-time RT-PCR, while pools returning a RAMP score of 50-99 appeared to be at the limit of real-time RT-PCR detection. Therefore, we recommend using a positive cutoff of 50 RAMP units with no real-time RT-PCR confirmation to maximize speed, efficiency, and economy of the RAMP assay. A more conservative approach would be to implement a "gray zone" range of 50-100 RAMP units. Pools scoring within the gray zone could be submitted for real-time RT-PCR confirmation with the understanding that positive pools may not confirm due to the inhibitory effect of the RAMP buffer on the real-time RT-PCR assay. We also conducted a series of experiments using laboratory-prepared mosquito pools spiked with WNV to compare mosquito homogenization buffers, pool sizes, and grinding methods in order to determine how these variables affect the RAMP and real-time RT-PCR assay results.

  11. Removal of haloacetic acids from swimming pool water by reverse osmosis and nanofiltration.

    Science.gov (United States)

    Yang, Linyan; She, Qianhong; Wan, Man Pun; Wang, Rong; Chang, Victor W-C; Tang, Chuyang Y

    2017-06-01

    Recent studies report high concentrations of haloacetic acids (HAAs), a prevalent class of toxic disinfection by-products, in swimming pool water (SPW). We investigated the removal of 9 HAAs by four commercial reverse osmosis (RO) and nanofiltration (NF) membranes. Under typical SPW conditions (pH 7.5 and 50 mM ionic strength), HAA rejections were >60% for NF270 with molecular weight cut-off (MWCO) equal to 266 Da and equal or higher than 90% for XLE, NF90 and SB50 with MWCOs of 96, 118 and 152 Da, respectively, as a result of the combined effects of size exclusion and charge repulsion. We further included 7 neutral hydrophilic surrogates as molecular probes to resolve the rejection mechanisms. In the absence of strong electrostatic interaction (e.g., pH 3.5), the rejection data of HAAs and surrogates by various membranes fall onto an identical size-exclusion (SE) curve when plotted against the relative-size parameter, i.e., the ratio of molecular radius over membrane pore radius. The independence of this SE curve on molecular structures and membrane properties reveals that the relative-size parameter is a more fundamental SE descriptor compared to molecular weight. An effective molecular size with the Stokes radius accounting for size exclusion and the Debye length accounting for electrostatic interaction was further used to evaluate the rejection. The current study provides valuable insights on the rejection of trace contaminants by RO/NF membranes. Copyright © 2017. Published by Elsevier Ltd.

  12. Size and Political Participation

    DEFF Research Database (Denmark)

    Lassen, David Dreyer; Serritzlew, Søren

    This paper uses a novel research design to re-examine the causal effect of jurisdiction size on political participation. Two waves of municipal consolidation in Denmark, in 1970 and in 2005, provide exogenous variation in jurisdiction size.......This paper uses a novel research design to re-examine the causal effect of jurisdiction size on political participation. Two waves of municipal consolidation in Denmark, in 1970 and in 2005, provide exogenous variation in jurisdiction size....

  13. Bra sizing and fit

    NARCIS (Netherlands)

    Daanen, H.A.M.

    2007-01-01

    It is often reported that 70% or more of the women wear the wrong-sized bra. A fact is that many women complain about bra fit even though the number of available sizes varies from 20 to 100. Sizing of bras is based on under bust circumference and its difference with circumference over the bust (cup

  14. Chronic early life lead (Pb2+) exposure alters presynaptic vesicle pools in hippocampal synapses.

    Science.gov (United States)

    Guariglia, Sara Rose; Stansfield, Kirstie H; McGlothan, Jennifer; Guilarte, Tomas R

    2016-11-02

    Lead (Pb2+) exposure has been shown to impair presynaptic neurotransmitter release in both in vivo and in vitro model systems. The mechanism by which Pb2+ impairs neurotransmitter release has not been fully elucidated. In previous work, we have shown that Pb2+ exposure inhibits vesicular release and reduces the number of fast-releasing sites in cultured hippocampal neurons. We have also shown that Pb2+ exposure inhibits vesicular release and alters the distribution of presynaptic vesicles in Shaffer Collateral - CA1 synapses of rodents chronically exposed to Pb2+ during development. In the present study, we used transmission electron microscopy to examine presynaptic vesicle pools in Mossy Fiber-CA3 synapses and in Perforant Path-Dentate Gyrus synapses of rats to determine if in vivo Pb2+ exposure altered presynaptic vesicle distribution in these hippocampal regions. Data were analyzed using T-test for each experimental endpoint. We found that Pb2+ exposure significantly reduced the number of vesicles in the readily releasable pool and recycling pool in Mossy Fiber-CA3 terminals. In both Mossy Fiber-CA3 terminals and in Perforant Path-Dentate Gyrus terminals, Pb2+ exposure significantly increased vesicle nearest neighbor distance in all vesicular pools (Rapidly Releasable, Recycling and Resting). We also found a reduction in the size of the postsynaptic densities of CA3 dendrites in the Pb2+ exposed group. In our previous work, we have demonstrated that Pb2+ exposure impairs vesicular release in Shaffer Collateral - CA1 terminals of the hippocampus and that the number of docked vesicles in the presynaptic active zone was reduced. Our current data shows that Pb2+ exposure reduces the number of vesicles that are in proximity to release sites in Mossy Fiber- CA3 terminals. Furthermore, Pb2+ exposure causes presynaptic vesicles to be further from one another, in both Mossy Fiber- CA3 terminals and in Perforant Pathway - Dentate Gyrus terminals, which may interfere with

  15. Dynamically Induced Displacements of a Persistent Cold-Air Pool

    Science.gov (United States)

    Lareau, Neil P.; Horel, John D.

    2015-02-01

    We examine the influence of a passing weather system on a persistent cold-air pool (CAP) during the Persistent Cold-Air Pool Study in the Salt Lake Valley, Utah, USA. The CAP experiences a sequence of along-valley displacements that temporarily and partially remove the cold air in response to increasing along-valley winds aloft. The displacements are due to the formation of a mountain wave over the upstream topography as well as adjustments to the regional horizontal pressure gradient and wind-stress divergence acting on the CAP. These processes appear to help establish a balance wherein the depth of the CAP increases to the north. When that balance is disrupted, the CAP tilt collapses, which sends a gravity current of cold air travelling upstream and thereby restores CAP conditions throughout the valley. Intra-valley mixing of momentum, heat, and pollution within the CAP by Kelvin-Helmholtz waves and seiching is also examined.

  16. Species pool versus site limitations of macrophytes in urban waters

    DEFF Research Database (Denmark)

    Vermonden, K.; Leuven, R.S.E.W.; van der Velde, G.

    2010-01-01

    Biodiversity in urban areas is affected by a multitude of stressors. In addition to physico-chemical stress factors, the native regional species pool can be greatly reduced in highly urbanized landscapes due to area loss and fragmentation. In this study, we investigated how macrophyte composition...... and diversity in urban water systems are limited by the regional species pool and local environmental conditions. Canonical correspondence analysis of the macrophyte species composition revealed that urban and semi-natural water systems differed and differences could be related to local abiotic variables...... such as pH and iron concentrations. Macrophytes in the semi-natural area were typical for slightly acid and oligotrophic conditions. In urban water systems, exotic species characteristic of eutrophic conditions were present. In the semi-natural areas, the number of macrophyte species exceeded the number...

  17. Biofouling on austenitic stainless steels in spent nuclear fuel pools

    Energy Technology Data Exchange (ETDEWEB)

    Sarro, M.I.; Moreno, D.A.; Chicote, E.; Lorenzo, P.I.; Garcia, A.M. [Universidad Politecnica de Madrid, Departamento de Ingenieria y Ciencia de los Materiales, Escuela Tecnica Superior de Ingenieros Industriales, Jose Gutierrez Abascal, 2, E-28006 Madrid (Spain); Montero, F. [Iberdrola Generacion, S.A., y C.M.D.S., Centro de Tecnologia de Materiales, Paseo de la Virgen del Puerto, 53, E-28005 Madrid (Spain)

    2003-07-01

    The objective of this study was to investigate the biofilm formation on three different types of austenitic stainless steel (UNS S30400, S30466 and S31600) submerged in a spent nuclear fuel pool. The presence of microorganisms in coupons was characterised using standard culture microbiological methods, microscopic techniques (epifluorescence microscopy and scanning electron microscopy), and molecular biology techniques (denaturing gradient gel electrophoresis and sequencing fragments of 16S rDNA). The microscopy techniques showed signs of colonisation of stainless steels in spite of these extreme conditions. Based on sequencing of cultured microorganisms, different bacteria belonging to {alpha}, {beta}, {gamma}-Proteobacteria, Bacilli, and Actinobacteria classes have been identified. The biofilm radioactivity was measured using gamma-ray spectrometry and, according to the data gathered, the radionuclides present in the water pool were entrapped in the biofilm increasing the amount of radiation at the surface of the different materials. (Abstract Copyright [2003], Wiley Periodicals, Inc.)

  18. Conjugative plasmids: Vessels of the communal gene pool

    DEFF Research Database (Denmark)

    Norman, Anders; Hansen, Lars H.; Sørensen, Søren Johannes

    2009-01-01

    Comparative whole-genome analyses have demonstrated that horizontal gene transfer (HGT) provides a significant contribution to prokaryotic genome innovation. The evolution of specific prokaryotes is therefore tightly linked to the environment in which they live and the communal pool of genes...... available within that environment. Here we use the term supergenome to describe the set of all genes that a prokaryotic ‘individual' can draw on within a particular environmental setting. Conjugative plasmids can be considered particularly successful entities within the communal pool, which have enabled HGT...... over large taxonomic distances. These plasmids are collections of discrete regions of genes that function as ‘backbone modules' to undertake different aspects of overall plasmid maintenance and propagation. Conjugative plasmids often carry suites of ‘accessory elements' that contribute adaptive traits...

  19. A common-pool resource experiment in acequia communities

    Directory of Open Access Journals (Sweden)

    Nejem Raheem

    2015-03-01

    Full Text Available Farmers and rural advocates in New Mexico assert that traditional irrigators are better adapted to water scarcity and variability than other communities. Data to actually test this are often scarce, but such information could be useful for planning the state’s water future, especially as climate change predictions tend toward less reliable supplies. This paper reports results from a common pool resource (CPR experiment that simulates irrigating behavior using two groups: rural irrigators and undergraduate students. Despite predictions to the opposite, there was no significant difference between mean withdrawals or predictions of other players’ behavior. On average, both groups withdrew above the social optimum but below the Nash equilibrium. This work appears to be the first example of a common pool resource experiment conducted with traditional New Mexican irrigators.

  20. Streaming Pool: reuse, combine and create reactive streams with pleasure

    CERN Multimedia

    CERN. Geneva

    2017-01-01

    When connecting together heterogeneous and complex systems, it is not easy to exchange data between components. Streams of data are successfully used in industry in order to overcome this problem, especially in the case of "live" data. Streams are a specialization of the Observer design pattern and they provide asynchronous and non-blocking data flow. The ongoing effort of the ReactiveX initiative is one example that demonstrates how demanding this technology is even for big companies. Bridging the discrepancies of different technologies with common interfaces is already done by the Reactive Streams initiative and, in the JVM world, via reactive-streams-jvm interfaces. Streaming Pool is a framework for providing and discovering reactive streams. Through the mechanism of dependency injection provided by the Spring Framework, Streaming Pool provides a so called Discovery Service. This object can discover and chain streams of data that are technologically agnostic, through the use of Stream IDs. The stream to ...

  1. Energy conservation in outdoor swimming pools. Pt. 1

    Energy Technology Data Exchange (ETDEWEB)

    Roskam, F.

    1987-09-01

    The paper reports about several EC- and BMFT-supported demonstration programs aiming at reducing the operating costs of outdoor and indoor swimming pools with the help of solar energy and additional measures such as energy conservation and heat recovery. Presenting a number of relevant characteristics an illustrated survey sums up the results available after an operating period of several years. Apart from referring to the basic findings the paper informs about organizational aspects. The measures and systems applied comprise solar water heating systems, coverings to reduce heat losses, and heat recovery systems recovering heat from filter backwash water, showers and the outgoing air. Details are given on how the different systems were realized in three demonstration swimming pools. (HWJ).

  2. The POOL Data Storage, Cache and Conversion Mechanism

    CERN Document Server

    Frank, Markus

    2003-01-01

    The POOL data storage mechanism is intended to satisfy the needs of the LHC experiments to store and analyze the data from the detector response of particle collisions at the LHC proton-proton collider. Both the data rate and the data volumes will largely differ from the past experience. The POOL data storage mechanism is intended to be able to cope with the experiment’s requirements applying a flexible multi technology data persistency mechanism. The developed technology independent approach is flexible enough to adopt new technologies, take advantage of existing schema evolution mechanisms and allows users to access data in a technology independent way. The framework consists of several components, which can be individually adopted and integrated into existing experiment frameworks.

  3. Detection of Onchocerca volvulus in Latin American black flies for pool screening PCR using high-throughput automated DNA isolation for transmission surveillance.

    Science.gov (United States)

    Rodríguez-Pérez, Mario A; Gopal, Hemavathi; Adeleke, Monsuru Adebayo; De Luna-Santillana, Erick Jesús; Gurrola-Reyes, J Natividad; Guo, Xianwu

    2013-11-01

    The posttreatment entomological surveillance (ES) of onchocerciasis in Latin America requires quite large numbers of flies to be examined for parasite infection to prove that the control strategies have worked and that the infection is on the path of elimination. Here, we report a high-throughput automated DNA isolation of Onchocerca volvulus for PCR using a major Latin American black fly vector of onchocerciasis. The sensitivity and relative effectiveness of silica-coated paramagnetic beads was evaluated in comparison with phenol chloroform (PC) method which is known as the gold standard of DNA extraction for ES in Latin America. The automated method was optimized in the laboratory and validated in the field to detect parasite DNA in Simulium ochraceum sensu lato flies in comparison with PC. The optimization of the automated method showed that it is sensitive to detect O. volvulus with a pool size of 100 flies as compared with PC which utilizes 50 flies pool size. The validation of the automated method in comparison with PC in an endemic community showed that 5/67 and 3/134 heads pools were positive for the two methods, respectively. There was no statistical variation (P < 0.05) in the estimation of transmission indices generated by automated method when compared with PC method. The fact that the automated method is sensitive to pool size up to 100 confers advantage over PC method and can, therefore, be employed in large-scale ES of onchocerciasis transmission in endemic areas of Latin America.

  4. Mangrove litter production and organic carbon pools in the ...

    African Journals Online (AJOL)

    Pools of organic carbon were identified and measured in non-harvested areas of the forest so that the effect of future (mangrove) harvesting on organic carbon production could be determined. Litter production was higher in summer (2.4 ± 0.2gm–2 d–1) than in winter (0.3 ± 0.1gm–2 d–1). Leaf litter on the forest floor was ...

  5. Detecting information pooling : evidence from earnings forecasts after brokerage mergers

    OpenAIRE

    Ng, Serena; Shum, Matt

    2007-01-01

    Forecast improvements can be expected if the two partners involved in a brokerage merger pool information and expertise. We examine four large mergers of brokerage firms in the last decade to study the incidence of and explanations for forecast improvements after the mergers. At the brokerage-level, we find that for two of the four mergers, forecast improvements appear more pronounced in subsamples of stocks for which both of the pre-merger analysts were retained in the merged brokerage. At t...

  6. Thermal Cooling Limits of Sbotaged Spent Fuel Pools

    Energy Technology Data Exchange (ETDEWEB)

    Dr. Thomas G. Hughes; Dr. Thomas F. Lin

    2010-09-10

    To develop the understanding and predictive measures of the post “loss of water inventory” hazardous conditions as a result of the natural and/or terrorist acts to the spent fuel pool of a nuclear plant. This includes the thermal cooling limits to the spent fuel assembly (before the onset of the zircaloy ignition and combustion), and the ignition, combustion, and the subsequent propagation of zircaloy fire from one fuel assembly to others

  7. Flexible automation and the loss of pooling synergy

    OpenAIRE

    Slomp, Jannes; Zee, Durk-Jouke van der

    2001-01-01

    This paper focuses on the effects of flexible automation on the performance of a job shop. Flexible automated machines may significantly improve the delivery performance and the flow time of jobs. The insertion of a flexible automated system in a job shop, however, also has a counter effect on the manufacturing performance. This is caused by the reduction of pooling synergy due to the dedication implied by flexible automated machines. This paper investigates by means of a simulation study to ...

  8. A Simple Hierarchical Pooling Data Structure for Loop Closure

    Science.gov (United States)

    2016-10-16

    quantized SIFT descriptors using a 1M vocabulary . INRIA Holidays 3 contains 500 image groups (1491 total), each of which represents a distinct scene...There are no filters, and no learning other than the trivial pooling of local descriptors. Motivated by this intuition, we propose a new hierarchical...and then use an inverted index. FAB-MAP [6] extends the basic setup by learning a generative model of the visual words using a Chow-Liu tree to model

  9. A high-fidelity approach towards simulation of pool boiling

    Science.gov (United States)

    Yazdani, Miad; Radcliff, Thomas; Soteriou, Marios; Alahyari, Abbas A.

    2016-01-01

    A novel numerical approach is developed to simulate the multiscale problem of pool-boiling phase change. The particular focus is to develop a simulation technique that is capable of predicting the heat transfer and hydrodynamic characteristics of nucleate boiling and the transition to critical heat flux on surfaces of arbitrary shape and roughness distribution addressing a critical need to design enhanced boiling heat transfer surfaces. The macro-scale of the phase change and bubble dynamics is addressed through employing off-the-shelf Computational Fluid Dynamics (CFD) methods for interface tracking and interphase mass and energy transfer. The micro-scale of the microlayer, which forms at early stage of bubble nucleation near the wall, is resolved through asymptotic approximation of the thin-film theory which provides a closed-form solution for the distribution of the micro-layer and its influence on the evaporation process. In addition, the sub-grid surface roughness is represented stochastically through probabilistic density functions and its role in bubble nucleation and growth is then represented based on the thermodynamics of nucleation process. This combination of deterministic CFD, local approximation, and stochastic representation allows the simulation of pool boiling on any surface with known roughness and enhancement characteristics. The numerical model is validated for dynamics and hydrothermal characteristics of a single nucleated bubble on a flat surface against available literature data. In addition, the prediction of pool-boiling heat transfer coefficient is verified against experimental measurements as well as reputable correlations for various roughness distributions and different surface orientations. Finally, the model is employed to demonstrate pool-boiling phenomenon on enhanced structures with reentrance cavities and to explore the effect of enhancement feature design on thermal and hydrodynamic characteristics of these surfaces.

  10. Readily releasable pool of synaptic vesicles measured at single synaptic contacts.

    Science.gov (United States)

    Trigo, Federico F; Sakaba, Takeshi; Ogden, David; Marty, Alain

    2012-10-30

    To distinguish between different models of vesicular release in brain synapses, it is necessary to know the number of vesicles of transmitter that can be released immediately at individual synapses by a high-calcium stimulus, the readily releasable pool (RRP). We used direct stimulation by calcium uncaging at identified, single-site inhibitory synapses to investigate the statistics of vesicular release and the size of the RRP. Vesicular release, detected as quantal responses in the postsynaptic neuron, showed an unexpected stochastic variation in the number of quanta from stimulus to stimulus at high intracellular calcium, with a mean of 1.9 per stimulus and a maximum of three or four. The results provide direct measurement of the RRP at single synaptic sites. They are consistent with models in which release proceeds from a small number of vesicle docking sites with an average occupancy around 0.7.

  11. Micro-bubble morphologies following drop impacts onto a pool surface

    KAUST Repository

    Thoroddsen, Sigurdur T.

    2012-10-01

    When a drop impacts at low velocity onto a pool surface, a hemispheric air layer cushions and can delay direct contact. Herein we use ultra-high-speed video to study the rupture of this layer, to explain the resulting variety of observed distribution of bubbles. The size and distribution of micro-bubbles is determined by the number and location of the primary punctures. Isolated holes lead to the formation of bubble necklaces when the edges of two growing holes meet, whereas bubble nets are produced by regular shedding of micro-bubbles from a sawtooth edge instability. For the most viscous liquids the air film contracts more rapidly than the capillary-viscous velocity through repeated spontaneous ruptures of the edge. From the speed of hole opening and the total volume of micro-bubbles we conclude that the air sheet ruptures when its thickness approaches ?100.

  12. Mathematic modelling of the process of thermal destruction of oil pools

    Energy Technology Data Exchange (ETDEWEB)

    Malamed, V.G.; Reverdatto, V.V.

    1980-08-01

    By means of mathematic modelling, the dynamics of thermal destruction of the oil pool are investigated in the vicinity of a thick bedded intrusive body of basalt magma. Heat conductivity of oil-bearing rocks was estimated as effective with account for liquid convection in porous medium. Calculated are the maximum sizes of exocontact area, where contact metamorphism of porous rocks brought about destructive transformations of oil. The problem is solved in four variants, with various endothermal heat effects of chemical reactions in oil and different ways of input of heat conductivity. For a basalt sill of some 100-meter thickness, the width of the zone of contact oil transformation must not exceed 80 meters. The results obtained can be applied in cases with intrusive bodies of any thickness.

  13. Prognostic factors for relapse in stage I seminoma managed by surveillance: a pooled analysis

    DEFF Research Database (Denmark)

    Warde, Padraig; Specht, Lena; Horwich, Alan

    2002-01-01

    PURPOSE: Several management options are available to patients with stage I seminoma, including adjuvant radiotherapy, surveillance, and adjuvant chemotherapy. We performed a pooled analysis of patients from the four largest surveillance studies to better delineate prognostic factors associated...... with disease progression. PATIENTS AND METHODS: Individual patient data were obtained from each center (Princess Margaret Hospital, Danish Testicular Cancer Study Group, Royal Marsden Hospital, and Royal London Hospital) for 638 patients. Tumor characteristics (size, histologic subtype, invasion of rete testis......, and tumor invasion into small vessels [SVI]) as well as age at diagnosis were analyzed for prognostic importance for relapse. RESULTS: With a median follow-up of 7.0 years (range, 0.02 to 17.5 years), 121 relapses were observed for an actuarial 5-year relapse-free rate (RFR) of 82.3%. On univariate analysis...

  14. Direct Numerical Simulation and Visualization of Subcooled Pool Boiling

    Directory of Open Access Journals (Sweden)

    Tomoaki Kunugi

    2014-01-01

    Full Text Available A direct numerical simulation of the boiling phenomena is one of the promising approaches in order to clarify their heat transfer characteristics and discuss the mechanism. During these decades, many DNS procedures have been developed according to the recent high performance computers and computational technologies. In this paper, the state of the art of direct numerical simulation of the pool boiling phenomena during mostly two decades is briefly summarized at first, and then the nonempirical boiling and condensation model proposed by the authors is introduced into the MARS (MultiInterface Advection and Reconstruction Solver developed by the authors. On the other hand, in order to clarify the boiling bubble behaviors under the subcooled conditions, the subcooled pool boiling experiments are also performed by using a high speed and high spatial resolution camera with a highly magnified telescope. Resulting from the numerical simulations of the subcooled pool boiling phenomena, the numerical results obtained by the MARS are validated by being compared to the experimental ones and the existing analytical solutions. The numerical results regarding the time evolution of the boiling bubble departure process under the subcooled conditions show a very good agreement with the experimental results. In conclusion, it can be said that the proposed nonempirical boiling and condensation model combined with the MARS has been validated.

  15. Genotyping common and rare variation using overlapping pool sequencing

    Directory of Open Access Journals (Sweden)

    Pasaniuc Bogdan

    2011-07-01

    Full Text Available Abstract Background Recent advances in sequencing technologies set the stage for large, population based studies, in which the ANA or RNA of thousands of individuals will be sequenced. Currently, however, such studies are still infeasible using a straightforward sequencing approach; as a result, recently a few multiplexing schemes have been suggested, in which a small number of ANA pools are sequenced, and the results are then deconvoluted using compressed sensing or similar approaches. These methods, however, are limited to the detection of rare variants. Results In this paper we provide a new algorithm for the deconvolution of DNA pools multiplexing schemes. The presented algorithm utilizes a likelihood model and linear programming. The approach allows for the addition of external data, particularly imputation data, resulting in a flexible environment that is suitable for different applications. Conclusions Particularly, we demonstrate that both low and high allele frequency SNPs can be accurately genotyped when the DNA pooling scheme is performed in conjunction with microarray genotyping and imputation. Additionally, we demonstrate the use of our framework for the detection of cancer fusion genes from RNA sequences.

  16. Silicon pools in human impacted soils of temperate zones

    Science.gov (United States)

    Vandevenne, F. I.; Barão, L.; Ronchi, B.; Govers, G.; Meire, P.; Kelly, E. F.; Struyf, E.

    2015-09-01

    Besides well-known effects of climate and parent material on silicate weathering the role of land use change as a driver in the global silicon cycle is not well known. Changes in vegetation cover have altered reservoirs of silicon and carbon in plants and soils. This has potential consequences for plant-Si availability, agricultural yields, and coastal eutrophication, as Si is a beneficial element for many crop plants and an essential nutrient for diatom growth. We here examined the role of sustained and intensive land use and human disturbance on silicon (Si) pool distribution in soils with similar climatological and bulk mineralogical characteristics. We show that land use impacts both biogenic and nonbiogenic Si pools. While biogenic Si strongly decreases along the land use change gradient (from forest to croplands), pedogenic silica fractions (e.g. pedogenic clays) increase in topsoils with a long duration of cultivation and soil disturbance. Our results suggest that nonbiogenic Si pools might compensate for the loss of reactive biogenic silicon in temperate zones.

  17. High-resolution optimal quantization for stochastic pooling networks

    Science.gov (United States)

    McDonnell, Mark D.; Amblard, Pierre-Olivier; Stocks, Nigel G.; Zozor, Steeve; Abbott, Derek

    2007-01-01

    Pooling networks of noisy threshold devices are good models for natural networks (e.g. neural networks in some parts of sensory pathways in vertebrates, networks of mossy fibers in the hippothalamus, . . . ) as well as for artificial networks (e.g. digital beamformers for sonar arrays, flash analog-to-digital converters, rate-constrained distributed sensor networks, . . . ). Such pooling networks exhibit the curious effect of suprathreshold stochastic resonance, which means that an optimal stochastic control of the network exists. Recently, some progress has been made in understanding pooling networks of identical, but independently noisy, threshold devices. One aspect concerns the behavior of information processing in the asymptotic limit of large networks, which is a limit of high relevance for neuroscience applications. The mutual information between the input and the output of the network has been evaluated, and its extremization has been performed. The aim of the present work is to extend these asymptotic results to study the more general case when the threshold values are no longer identical. In this situation, the values of thresholds can be described by a density, rather than by exact locations. We present a derivation of Shannon's mutual information between the input and output of these networks. The result is an approximation that relies a weak version of the law of large numbers, and a version of the central limit theorem. Optimization of the mutual information is then discussed.

  18. An Approach to Quantum State Pooling from Quantum Conditional Independence

    Science.gov (United States)

    Leifer, Matthew

    2008-03-01

    In approaches to quantum theory in which the quantum state is taken to represent an agent's belief, knowledge or information about a physical system, it is legitimate for different agents to assign different states to one and the same physical system. The question then arises of what state they should assign if they get together and share their information about the system. This is the problem of quantum state pooling. The classical counterpart of this problem for probability distributions only has a unique solution under additional assumptions about how the data are collected, such as conditional independence constraints. Recently, Spekkens and Wiseman found a quantum pooling rule analogous to the classical one, which is valid if the differing state assignments arise from making indirect measurements on special classes of tripartite quantum state. We show that this pooling rule applies to a much wider class of tripartite states, and that its validity rests on quantum analogs of conditional independence recently studied by one of the authors, as well as a generalization of the notion of a sufficient statistic to the quantum case. Work done in collaboration with Robert Spekkens, University of Cambridge.

  19. Vortical structures in pool fires: Observation, speculation, and simulation

    Energy Technology Data Exchange (ETDEWEB)

    Tieszen, S.R.; Nicolette, V.F.; Gritzo, L.A.; Moya, J.L. [Sandia National Labs., Albuquerque, NM (United States); Holen, J.K. [SINTEF/NTH, Trondheim (Norway). Div. Thermodynamics; Murray, D. [Naval Air Warfare Center, China Lake, CA (United States)

    1996-11-01

    While all fires are complex and involve many phenomena, this report is limited to large, turbulent liquid-hydrocarbon pool fires. Large, liquid-hydrocarbon pool fires present a risk in petrochemical storage and processing facilities and transportation systems that contain large amounts of liquid hydrocarbons. This report describes observations, speculations, and numerical simulations of vortical structures in pool fires. Vortical structures are observed in fires with length scales ranging from those that bend millimeter-thick flame zones to those that entrain air many meters from the edge of the fire to its centerline. The authors propose that baroclinic vorticity generation is primarily responsible for production of rotational motion at small scale and that amalgamation is responsible for the production of large-scale rotational structures from the myriad of small-scale structures. Numerical simulations show that vortical structures having time-mean definitions can be resolved with a Reynolds-Average Navier-Stokes (RANS) approach. However, for vortical structures without time-mean definition, RANS is inappropriate, and another technique, such as Large Eddy Simulation (LES), should be employed. 39 refs., 52 figs., 3 tabs.

  20. Pedestrian Detection with Spatially Pooled Features and Structured Ensemble Learning.

    Science.gov (United States)

    Paisitkriangkrai, Sakrapee; Shen, Chunhua; Hengel, Anton van den

    2016-06-01

    Many typical applications of object detection operate within a prescribed false-positive range. In this situation the performance of a detector should be assessed on the basis of the area under the ROC curve over that range, rather than over the full curve, as the performance outside the prescribed range is irrelevant. This measure is labelled as the partial area under the ROC curve (pAUC). We propose a novel ensemble learning method which achieves a maximal detection rate at a user-defined range of false positive rates by directly optimizing the partial AUC using structured learning. In addition, in order to achieve high object detection performance, we propose a new approach to extracting low-level visual features based on spatial pooling. Incorporating spatial pooling improves the translational invariance and thus the robustness of the detection process. Experimental results on both synthetic and real-world data sets demonstrate the effectiveness of our approach, and we show that it is possible to train state-of-the-art pedestrian detectors using the proposed structured ensemble learning method with spatially pooled features. The result is the current best reported performance on the Caltech-USA pedestrian detection dataset.

  1. Free-Form Region Description with Second-Order Pooling.

    Science.gov (United States)

    Carreira, João; Caseiro, Rui; Batista, Jorge; Sminchisescu, Cristian

    2015-06-01

    Semantic segmentation and object detection are nowadays dominated by methods operating on regions obtained as a result of a bottom-up grouping process (segmentation) but use feature extractors developed for recognition on fixed-form (e.g. rectangular) patches, with full images as a special case. This is most likely suboptimal. In this paper we focus on feature extraction and description over free-form regions and study the relationship with their fixed-form counterparts. Our main contributions are novel pooling techniques that capture the second-order statistics of local descriptors inside such free-form regions. We introduce second-order generalizations of average and max-pooling that together with appropriate non-linearities, derived from the mathematical structure of their embedding space, lead to state-of-the-art recognition performance in semantic segmentation experiments without any type of local feature coding. In contrast, we show that codebook-based local feature coding is more important when feature extraction is constrained to operate over regions that include both foreground and large portions of the background, as typical in image classification settings, whereas for high-accuracy localization setups, second-order pooling over free-form regions produces results superior to those of the winning systems in the contemporary semantic segmentation challenges, with models that are much faster in both training and testing.

  2. Ingestion of swimming pool water by recreational swimmers.

    Science.gov (United States)

    Dufour, A P; Behymer, T D; Cantú, R; Magnuson, M; Wymer, L J

    2017-06-01

    The volume of water ingested by swimmers while swimming is of great interest to individuals who develop risk assessments using quantitative microbial risk assessment or epidemiological approaches. We have used chloroisocyanurate disinfected swimming pool waters to determine the amount of water swallowed by swimmers during swimming activity. The chloroisocyanurate, which is in equilibrium with chlorine and cyanuric acid in the pool water, provides a biomarker, cyanuric acid, that once swallowed passes through the body into the urine unchanged. The concentration of cyanuric acid in a 24 hour urine specimen and the concentration in pool water can be used to calculate the amount of water swallowed. Our study population of 549 participants, which was about evenly divided by gender, and young and adult swimmers, indicated that swimmers ingest about 32 mL per hour (arithmetic mean) and that children swallowed about four times as much water as adults during swimming activities. It was also observed that males had a tendency to swallow more water than females during swimming activity and that children spent about twice as much time in the water than adults.

  3. Environmental Assessment -- Test Area North pool stabilization project update

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-08-01

    The purpose of this Environmental Assessment (EA) is to update the ``Test Area North Pool Stabilization Project`` EA (DOE/EA-1050) and finding of no significant impact (FONSI) issued May 6, 1996. This update analyzes the environmental and health impacts of a drying process for the Three Mile Island (TMI) nuclear reactor core debris canisters now stored underwater in a facility on the Idaho National Engineering and Environmental Laboratory (INEEL). A drying process was analyzed in the predecision versions of the EA released in 1995 but that particular process was determined to be ineffective and dropped from the EA/FONSI issued May 6, 1996. A new drying process was subsequently developed and is analyzed in Section 2.1.2 of this document. As did the 1996 EA, this update analyzes the environmental and health impacts of removing various radioactive materials from underwater storage, dewatering these materials, constructing a new interim dry storage facility, and transporting and placing the materials into the new facility. Also, as did the 1996 EA, this EA analyzes the removal, treatment and disposal of water from the pool, and placement of the facility into a safe, standby condition. The entire action would take place within the boundaries of the INEEL. The materials are currently stored underwater in the Test Area North (TAN) building 607 pool, the new interim dry storage facility would be constructed at the Idaho Chemical Processing Plant (ICPP) which is about 25 miles south of TAN.

  4. Draft environmental assessment -- Test Area North pool stabilization project update

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-06-01

    The purpose of this Environmental Assessment (EA) is to update the ``Test Area North Pool Stabilization Project`` EA (DOE/EA-1050) and finding of no significant impact (FONSI) issued May 6, 1996. This update analyzes the environmental and health impacts of a drying process for the Three Mile Island (TMI) nuclear reactor core debris canisters now stored underwater in a facility on the Idaho National Engineering and Environmental Laboratory (INEEL). A drying process was analyzed in the predecision versions of the EA released in 1995 but that particular process was determined to be ineffective and dropped form the Ea/FONSI issued May 6, 1996. The origin and nature of the TMI core debris and the proposed drying process are described and analyzed in detail in this EA. As did the 1996 EA, this update analyzes the environmental and health impacts of removing various radioactive materials from underwater storage, dewatering these materials, constructing a new interim dry storage facility, and transporting and placing the materials into the new facility. Also, as did the 1996 EA, this EA analyzes the removal, treatment and disposal of water from the pool, and placement of the facility into a safe, standby condition. The entire action would take place within the boundaries of the INEEL. The materials are currently stored underwater in the Test Area North (TAN) building 607 pool, the new interim dry storage facility would be constructed at the Idaho Chemical Processing Plant (ICPP) which is about 25 miles south of TAN.

  5. Path dependency and collective action in common pool governance

    Directory of Open Access Journals (Sweden)

    Tim Heinmiller

    2009-03-01

    Full Text Available Collective action among resource users has long been identified as a basic element of successful common pool governance, and one of the main concerns of common pool research is the identification of factors that affect collective action. Among the most commonly identified factors are trust, social capital, common preferences, shared knowledge, collaborative experiences, focusing events and expectations of future interactions. Thus far, however, relatively little attention has been paid to the historical-institutional context of collective action and the constraining effects of path dependency. Path dependency suggests that investments and adaptations in early resource management institutions can make it difficult for actors to abandon these institutions, thereby influencing and shaping subsequent collective action efforts. This article examines the impact that path dependency can have on collective action in common pools, by examining transboundary water management in the Murray-Darling Basin of Australia, the Colorado Basin of the US and the Saskatchewan-Nelson Basin of Canada. In all three cases, early transboundary water apportionment institutions have proven strongly path dependent, significantly shaping subsequent collective action efforts at transboundary water conservation.

  6. Mathematical modelling and simulation of the thermal performance of a solar heated indoor swimming pool

    Directory of Open Access Journals (Sweden)

    Mančić Marko V.

    2014-01-01

    Full Text Available Buildings with indoor swimming pools have a large energy footprint. The source of major energy loss is the swimming pool hall where air humidity is increased by evaporation from the pool water surface. This increases energy consumption for heating and ventilation of the pool hall, fresh water supply loss and heat demand for pool water heating. In this paper, a mathematical model of the swimming pool was made to assess energy demands of an indoor swimming pool building. The mathematical model of the swimming pool is used with the created multi-zone building model in TRNSYS software to determine pool hall energy demand and pool losses. Energy loss for pool water and pool hall heating and ventilation are analyzed for different target pool water and air temperatures. The simulation showed that pool water heating accounts for around 22%, whereas heating and ventilation of the pool hall for around 60% of the total pool hall heat demand. With a change of preset controller air and water temperatures in simulations, evaporation loss was in the range 46-54% of the total pool losses. A solar thermal sanitary hot water system was modelled and simulated to analyze it's potential for energy savings of the presented demand side model. The simulation showed that up to 87% of water heating demands could be met by the solar thermal system, while avoiding stagnation. [Projekat Ministarstva nauke Republike Srbije, br. III 42006: Research and development of energy and environmentally highly effective polygeneration systems based on using renewable energy sources

  7. Identification of disinfection by-products in freshwater and seawater swimming pools and evaluation of genotoxicity.

    Science.gov (United States)

    Manasfi, Tarek; De Méo, Michel; Coulomb, Bruno; Di Giorgio, Carole; Boudenne, Jean-Luc

    2016-03-01

    Exposure to disinfection byproducts (DBPs) in swimming pools has been linked to adverse health effects. Numerous DBPs that occur in swimming pools are genotoxic and carcinogenic. This toxicity is of a greater concern in the case of brominated DBPs that have been shown to have substantially greater toxicities than their chlorinated analogs. In chlorinated seawater swimming pools, brominated DBPs are formed due to the high content of bromide. Nevertheless, very little data is reported about DBP occurrence and mutagenicity of water in these pools. In the present study, three seawater and one freshwater swimming pools located in Southeastern France were investigated to determine qualitatively and quantitatively their DBP contents. An evaluation of the genotoxic properties of water samples of the freshwater pool and a seawater pool was conducted through the Salmonella assay (Ames test). The predominant DBPs identified in the freshwater pool were chlorinated species and included trichloroacetic acid, chloral hydrate, dichloroacetonitrile, 1,1,1-trichloropropanone and chloroform. In the seawater pools, brominated DBPs were the predominant species and included dibromoacetic acid, bromoform and dibromoacetonitile. Bromal hydrate levels were also reported. In both types of pools, haloacetic acids were the most prevalent chemical class among the analyzed DBP classes. The distribution of other DBP classes varied depending on the type of pool. As to genotoxicity, the results of Ames test showed higher mutagenicity in the freshwater pool as a consequence of its considerably higher DBP contents in comparison to the tested seawater pool. Copyright © 2015 Elsevier Ltd. All rights reserved.

  8. Removal of volatile iodine from gas bubbles rising in water pools: review and assessment of pool scrubbing codes

    Energy Technology Data Exchange (ETDEWEB)

    Polo, J.; Herranz, L.E.; Peyres, V.; Escudero, M. [CIEMAT, Nuclear Technology Institute, Madrid (Spain)

    1996-12-01

    During a hypothetical nuclear reactor accident with core damage the fission products released from the degrading fuel bundles often pass through aqueous beds before entering the containment, mitigating in part the source term. Several computer codes have been developed for predicting the fission product and aerosols removal in pool scrubbing scenarios. In addition to particle removal, these codes simulate the retention of some volatile iodine compounds. In this work a review of volatile iodine removal models included in SPARC and BUSCA codes is presented. Besides, the results and discussions of a validation of both codes against the available experimental data are summarized. SPARC and BUSCA codes model the diffusion of iodine toward the bubble interface by using the film penetration theory, which assumes a double layer gas-liquid at the interface. However, there are some differences between the two models, mainly related to the boundary conditions in the aqueous volume for the diffusion of molecular iodine. In SPARC, a set of fast reactions in the liquid phase control both the molecular iodine concentration in the pool and the partition coefficient of iodine at the interface. Thus, the aqueous chemistry plays an important role in the boundary conditions for the diffusion process. On the contrary, the BUSCA model has no chemical considerations at all, and assumes a null iodine concentration in the water bulk. Several sensitivity studies have been made in order to weight the effect of these differences. The variables examined in these studies were the pool temperature and the incoming iodine concentration in the pool. Additionally, sensitivity studies focused on the steam mass fraction of the injected gas were performed to study the effect of the different approach of both models for the condensation process. The results showed a different sensitivity of SPARC and BUSCA to the incoming concentration. (author) 5 tabs., 26 refs.

  9. Leisure time physical activity of moderate to vigorous intensity and mortality: a large pooled cohort analysis

    National Research Council Canada - National Science Library

    Moore, Steven C; Patel, Alpa V; Matthews, Charles E; Berrington de Gonzalez, Amy; Park, Yikyung; Katki, Hormuzd A; Linet, Martha S; Weiderpass, Elisabete; Visvanathan, Kala; Helzlsouer, Kathy J; Thun, Michael; Gapstur, Susan M; Hartge, Patricia; Lee, I-Min

    2012-01-01

    ...) groups, in a large pooled analysis. We examined the association of leisure time physical activity with mortality during follow-up in pooled data from six prospective cohort studies in the National Cancer Institute Cohort Consortium...

  10. Relationship between lipid distribution and geochemical environment within Champagne Pool, Waiotapu, New Zealand

    NARCIS (Netherlands)

    Kaur, G.; Mountain, B.W.; Hopmans, E.C.; Pancost, R.D.

    2011-01-01

    The lipid biomarkers associated with various geothermal facies within Champagne Pool were investigated and compared with previous microbiological characterisation. Biomarker analysis revealed two distinct microbial communities spanning the margin of Champagne Pool: the first in the subaqueous domal

  11. Evaluation of biological and physico-chemical quality of public swimming pools, Hamadan (Iran

    Directory of Open Access Journals (Sweden)

    Edris Hoseinzadeh

    2013-01-01

    Conclusion: As results showed the residual chlorine in pools water was lower than standard level and as regard to microbial contamination in pool water, it can be concluded that the disinfection system has been impaired.

  12. Swimming pool attendance and respiratory symptoms and allergies among Dutch children

    NARCIS (Netherlands)

    Jacobs, J.H.; Fuertes, E.; Krop, E.J.M.; Spithoven, J.; Tromp, P.; Heederik, D.J.J.

    2012-01-01

    Objectives: To describe associations among swimming, respiratory health, allergen sensitisation and Clara cell protein 16 (CC16) levels in Dutch schoolchildren. Trichloramine levels in swimming pool air were determined to assess potential exposure levels. Methods: Respiratory health and pool

  13. UMRS LTRMP 2010/11 LCU Mapping -- Illinois River LaGrange Pool

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Aerial photographs for Pools 1-13 Upper Mississippi River System and Pools, Alton-Marseilles, Illinois River were collected in color infrared (CIR) in August of 2010...

  14. UMRS LTRMP 2010/11 LCU Mapping -- Illinois River Alton Pool

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Aerial photographs for Pools 1-13 Upper Mississippi River System and Pools, Alton-Marseilles, Illinois River were collected in color infrared (CIR) in August of 2010...

  15. UMRS LTRMP 2010/11 LCU Mapping -- Illinois River Starved Rock Pool

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Aerial photographs for Pools 1-13 Upper Mississippi River System and Pools, Alton-Marseilles, Illinois River were collected in color infrared (CIR) in August of 2010...

  16. UMRS LTRMP 2010/11 LCU Mapping -- Illinois River Marseillies Pool

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Aerial photographs for Pools 1-13 Upper Mississippi River System and Pools, Alton-Marseilles, Illinois River were collected in color infrared (CIR) in August of 2010...

  17. Analysis and Prospective in Management of Pool 9 at Erie National Wildlife Refuge 1983

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The purpose of this study is to prepare a bathometric map of Pool 9 at Erie National Wildlife refuge. Pool 9 is the refuge’s largest impoundment, covering...

  18. Hydraulics, morphology, and energy dissipation in an alpine step-pool channel

    National Research Council Canada - National Science Library

    Andrew C. Wilcox; Ellen E. Wohl; Francesco Comiti; Luca Mao

    2011-01-01

    ...; ponded steps result in slow pools To investigate the relationship between hydraulics and channel morphology in step-pool channels, we combined three-dimensional velocity measurements with an acoustic...

  19. UMRS LTRMP 2010/11 LCU Mapping -- Illinois River Peoria Pool

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Aerial photographs for Pools 1-13 Upper Mississippi River System and Pools, Alton-Marseilles, Illinois River were collected in color infrared (CIR) in August of 2010...

  20. Effects of Drawdown and Structures on Bed-Load Transport in Pool 8 Navigation Channel

    National Research Council Canada - National Science Library

    Abraham, David; Hendrickson, Jon

    2003-01-01

    ... of a pool drawdown and structures on bed-load transport in the Pool 8 navigation channel. Work was conducted as part of the Monitoring of Completed Navigation Projects (MCNP) program. BACKGROUND...