WorldWideScience

Sample records for vendelin valdur saks

  1. Valdur Mikita ulguvad rehad / Arno Oja

    Index Scriptorium Estoniae

    Oja, Arno, 1950-

    2016-01-01

    Arvustus: Mikita, Valdur. Metsik lingvistika : sosinaid kartulikummardajate külast. Tallinn : Grenader, 2008; Mikita, Valdur. Lingvistiline mets : tsibihärblase paradigma. Teadvuse kiirendi. Tallinn : Grenader, 2013; Mikita, Valdur. Lindvistika, ehk, Metsa see lingvistika. Vara : [HM], 2015

  2. Peeter Saks maksab karmavõlga / Paavo Kangur

    Index Scriptorium Estoniae

    Kangur, Paavo, 1966-

    2006-01-01

    Investeerimispanga Suprema Securities juhatuse esimees Peeter Saks oma sportlasekarjäärist, muudatustest investeerimispanga juhtkonnas ning panga tegevusest sportlaste toetamisel. Kommenteerib mäesuusataja Tiiu Nurmberg

  3. A Reflective Conversation with Ugur Sak: Gifted Education in Turkey

    Science.gov (United States)

    Shaughnessy, Michael F.; Sak, Ugur

    2015-01-01

    In this reflective conversation, Ugur Sak discusses the current "state of the art" of gifted education in Turkey. He reviews the use of enrichment, discusses acceleration and reviews curricular procedures in Turkey. He responds to questions about the identification of gifted students and discusses the age old debate of talent versus…

  4. Rainer Saks : ärgem lohutagem end lootusega, et Herman Simm oli ainus / Rainer Saks ; interv. Rasmus Kagge

    Index Scriptorium Estoniae

    Saks, Rainer

    2008-01-01

    Intervjuu Eesti eriteenistuste endise esikoordinaatori ning praeguse Vabariigi Presidendi kantselei direktoriga, kes vastab küsimustele, mis puudutavad Herman Simmi. Ta möönab, et ei ole põhjust arvata, nagu võiks riigireetmises kahtlustatav Herman Simm olla ainuke, kes riiki petta oskas. Vt. Kes on Rainer Saks?; Kes on Mitrohhin?

  5. Rainer Saks : ärgem lohutagem end lootusega, et Herman Simm oli ainus / Rainer Saks ; interv. Rasmus Kagge

    Index Scriptorium Estoniae

    Saks, Rainer

    2008-01-01

    Intervjuu Eesti eriteenistuste endise esikoordinaatori ning praeguse Vabariigi Presidendi kantselei direktoriga, kes vastab küsimustele riigireetmises kahtlustatava Herman Simmi kohta. Vt. samas: Kes on Rainer Saks? Lühiülevaade elukäigust ja karjäärist

  6. SAK/PLK4 is required for centriole duplication and flagella development.

    Science.gov (United States)

    Bettencourt-Dias, M; Rodrigues-Martins, A; Carpenter, L; Riparbelli, M; Lehmann, L; Gatt, M K; Carmo, N; Balloux, F; Callaini, G; Glover, D M

    2005-12-20

    SAK/PLK4 is a distinct member of the polo-like kinase family. SAK-/- mice die during embryogenesis, whereas SAK+/- mice develop liver and lung tumors and SAK+/- MEFs show mitotic abnormalities. However, the mechanism underlying these phenotypes is still not known. Here, we show that downregulation of SAK in Drosophila cells, by mutation or RNAi, leads to loss of centrioles, the core structures of centrosomes. Such cells are able to undergo repeated rounds of cell division, but display broad disorganized mitotic spindle poles. We also show that SAK mutants lose their centrioles during the mitotic divisions preceding male meiosis but still produce cysts of 16 primary spermatocytes as in the wild-type. Mathematical modeling of the stereotyped cell divisions of spermatogenesis can account for such loss by defective centriole duplication. The majority of spermatids in SAK mutants lack centrioles and so are unable to make sperm axonemes. Finally, we show that depletion of SAK in human cells also prevents centriole duplication and gives rise to mitotic abnormalities. SAK/PLK4 is necessary for centriole duplication both in Drosophila and human cells. Drosophila cells tolerate the lack of centrioles and undertake mitosis but cannot form basal bodies and hence flagella. Human cells depleted of SAK show error-prone mitosis, likely to underlie its tumor-suppressor role.

  7. Cloning, production, and functional expression of the bacteriocin sakacin A (SakA) and two SakA-derived chimeras in lactic acid bacteria (LAB) and the yeasts Pichia pastoris and Kluyveromyces lactis.

    Science.gov (United States)

    Jiménez, Juan J; Borrero, Juan; Diep, Dzung B; Gútiez, Loreto; Nes, Ingolf F; Herranz, Carmen; Cintas, Luis M; Hernández, Pablo E

    2013-09-01

    Mature sakacin A (SakA, encoded by sapA) and its cognate immunity protein (SakI, encoded by sapiA), and two SakA-derived chimeras mimicking the N-terminal end of mature enterocin P (EntP/SakA) and mature enterocin A (EntA/SakA) together with SakI, were fused to different signal peptides (SP) and cloned into the protein expression vectors pNZ8048 and pMG36c for evaluation of their production and functional expression by different lactic acid bacteria. The amount, antimicrobial activity, and specific antimicrobial activity of SakA and its chimeras produced by Lactococcus lactis subsp. cremoris NZ9000 depended on the SP and the expression vector. Only L. lactis NZ9000 (pNUPS), producing EntP/SakA, showed higher bacteriocin production and antimicrobial activity than the natural SakA-producer Lactobacillus sakei Lb706. The lower antimicrobial activity of the SakA-producer L. lactis NZ9000 (pNUS) and that of the EntA/SakA-producer L. lactis NZ9000 (pNUAS) could be ascribed to secretion of truncated bacteriocins. On the other hand, of the Lb. sakei Lb706 cultures transformed with the pMG36c-derived vectors only Lb. sakei Lb706 (pGUS) overproducing SakA showed a higher antimicrobial activity than Lb. sakei Lb706. Finally, cloning of SakA and EntP/SakA into pPICZαA and pKLAC2 permitted the production of SakA and EntP/SakA by recombinant Pichia pastoris X-33 and Kluyveromyces lactis GG799 derivatives although their antimicrobial activity was lower than expected from their production.

  8. PENGARUH PEMBELAJARAN AKUNTANSI BERBASIS SAK IFRS DAN SELF-EFFICACY TERHADAP KESIAPAN MAHASISWA MENJADI GURU AKUNTANSI

    Directory of Open Access Journals (Sweden)

    Raeni Raeni

    2013-06-01

    Full Text Available The research was inspired by students’ readiness to be Accounting teachers with the rapid progress of science and technology and also free-market for workers. The objective of the study was to test the influence of Accounting learning based on SAK IFRS and self-efficacy toward students’ readiness to be Accounting teachers. The population of the research were Accounting education students in classess of 2010 until 2012. Thus, it used proportionate stratified random sampling. The respondents were 85 students in class 2010, 123 students in class 2011 and 154 students in class 2012. Then, the data were analyzed by percentage descriptive and doubled linear regression. The result of regression analysis showed that 1 Accounting learning based on SAK IFRS and self-efficacy contibuted positively and significantly for 52.4% toward students’ readiness to be Accounting students, 2 there was a positive and significant influence of Accounting learning based on SAK IFRS for 26.2% toward students’ readiness to be Accounting teachers, 3 there was a positive and significant influence of self-efficacy for 16.32% toward students’ readiness to be Accounting teachers. The familiarity level for learning Accounting based on SAK IFRS was high with the progress of science and technology and also full adoption from IFRS.

  9. PENGARUH PEMBELAJARAN AKUNTANSI BERBASIS SAK IFRS DAN SELF-EFFICACY TERHADAP KESIAPAN MAHASISWA MENJADI GURU AKUNTANSI

    Directory of Open Access Journals (Sweden)

    Raeni Raeni

    2016-01-01

    Full Text Available The research was inspired by students’ readiness to be Accounting teachers with the rapid progress of science and technology and also free-market for workers. The objective of the study was to test the influence of Accounting learning based on SAK IFRS and self-efficacy toward students’ readiness to be Accounting teachers. The population of the research were Accounting education students in classess of 2010 until 2012. Thus, it used proportionate stratified random sampling. The respondents were 85 students in class 2010, 123 students in class 2011 and 154 students in class 2012. Then, the data were analyzed by percentage descriptive and doubled linear regression. The result of regression analysis showed that 1 Accounting learning based on SAK IFRS and self-efficacy contibuted positively and significantly for 52.4% toward students’ readiness to be Accounting students, 2 there was a positive and significant influence of Accounting learning based on SAK IFRS for 26.2% toward students’ readiness to be Accounting teachers, 3 there was a positive and significant influence of self-efficacy for 16.32% toward students’ readiness to be Accounting teachers. The familiarity level for learning Accounting based on SAK IFRS was high with the progress of science and technology and also full adoption from IFRS.

  10. Sakīna: contribución a su estudio

    Directory of Open Access Journals (Sweden)

    Tornero, Emilio

    2013-06-01

    Full Text Available This article explores the postkoranic evolution of the term sakīna. First, it examines what previous research has said about that. It then presents, translates, and analizes five texts—which had not been taken into consideration previously— pertaining to the Islamic and philosophical fields in which this term occurs. The texts have been taken from Ibn Ḥabīb, al-Tawḥīdī, the Arabic translation of the Golden Verses, and the two Commentaries on the Golden Verses attributed respectively to Iamblichus and Proclus. The article shows how the Koranic sakīna has evolved in these texts: it connotes pacification of violent animals in Ibn Habib, in al-Tawhidi it denotes a state close to Divinity of characters similar to Sufis: in the Golden Verses, the term sakīna is used to translate daímōn, thanks to which evils originating from innate discord among humans are eliminated; finally, the Commentaries on the Golden Verses contain explanations of this term that are both religious and rationalist.Estudio del término sakīna en su evolución postcoránica en el que se muestra, en primer lugar, lo que la investigación ha dicho sobre él, para, a continuación, presentar, traducir y analizar cinco textos pertenecientes al ámbito islámico y al filosófico en donde aparece dicho término y que no habían sido tenidos en cuenta hasta ahora. Estos textos proceden de: Ibn Ḥabīb, al-Tawḥīdī, traducción árabe de los Versos áureos, y Comentarios de Jámblico y de Proclo a estos Versos áureos. La sakīna coránica evoluciona en estos autores pasando a connotar una pacificación en los animales violentos en Ibn Habib y un estado cercano a la divinidad de caracteres próximos al de los sufíes en al-Tawhidi, mientras que en los Versos áureos se emplea sakīna para traducir daímōn, con sus efectos de eliminación de los males originados por la discordia innata a los hombres. En los Comentarios a los Versos áureos se dan explicaciones, de

  11. PEMAHAMAN GURU AKUNTANSI TENTANG SAK-ETAP, PRESTASI BELAJAR DAN PENYERAPAN LULUSAN SESUAI BIDANG AKUNTANSI: BUKTI EMPIRIS DARI KOTA MADIUN

    Directory of Open Access Journals (Sweden)

    Muji Rahayu

    2015-10-01

    Full Text Available Penelitian ini bertujuan untuk menguji pengaruh pamahaman guru akuntansi tentang SAK-ETAP terhadap prestasi belajar yang pada akhirnya mempengaruhi penyerapan lulusan sesuai bidang akuntansi. Dengan menggunakan sampel 64 persepsi guru akuntansi se-kota Madiun, hasil pengujian regresi berganda menunjukkan bahwa pemahaman guru akuntansi tentang SAK-ETAP berpengaruh signifikan terhadap prestasi belajar siswa yang pada akhirnya mempengaruhi penyerapan lulusan sesuai bidang akuntansi.

  12. A Myb transcription factor of Phytophthora sojae, regulated by MAP kinase PsSAK1, is required for zoospore development.

    Directory of Open Access Journals (Sweden)

    Meng Zhang

    Full Text Available PsSAK1, a mitogen-activated protein (MAP kinase from Phytophthora sojae, plays an important role in host infection and zoospore viability. However, the downstream mechanism of PsSAK1 remains unclear. In this study, the 3'-tag digital gene expression (DGE profiling method was applied to sequence the global transcriptional sequence of PsSAK1-silenced mutants during the cysts stage and 1.5 h after inoculation onto susceptible soybean leaf tissues. Compared with the gene expression levels of the recipient P. sojae strain, several candidates of Myb family were differentially expressed (up or down in response to the loss of PsSAK1, including of a R2R3-type Myb transcription factor, PsMYB1. qRT-PCR indicated that the transcriptional level of PsMYB1 decreased due to PsSAK1 silencing. The transcriptional level of PsMYB1 increased during sporulating hyphae, in germinated cysts, and early infection. Silencing of PsMYB1 results in three phenotypes: a no cleavage of the cytoplasm into uninucleate zoospores or release of normal zoospores, b direct germination of sporangia, and c afunction in zoospore-mediated plant infection. Our data indicate that the PsMYB1 transcription factor functions downstream of MAP kinase PsSAK1 and is required for zoospore development of P. sojae.

  13. Introduction of flocculation into industrial yeast, Saccharomyces cerevisiae saké, by protoplast fusion

    OpenAIRE

    Lima, Nelson; MOREIRA, C.; Teixeira, J. A.; M. Mota

    1995-01-01

    Protoplast fusion was applied to obtain intraspecific fusion in yeast strains in order to overcome restrictions imposed by the natural mating system. Acriflavine was used to construct petite mutants from non-flocculent industrial Saccharomyces cerevisiae saké strain. UV radiation was used to construct ura- mutants from a respiratory competent and highly flocculent S. cerevisiae NCYC869 strain. Fusion products were selected by complementation on minimal medium. The frequency of appearance of p...

  14. Kompuroiden korporatismissa, : Eheytyneen SAK:n ristipaineet suomalaisessa korporatismissa 1968-1978

    OpenAIRE

    Savtschenko, Ritva

    2015-01-01

    Summary The study takes a look at the factors that influenced the operating culture of the Central Organization of Finnish Trade Unions (SAK) during the first decade of incomes policy from the point of view of corporatism. The effects of the corporatist system are studied from the perspective of co-operation, resistance and democracy. The theoretical part looks at the relationship between the theory of corporatism and the trade union movement. The empirical part looks at the effect of th...

  15. OP U WOORD SAL EK DIE NET LAAT SAK".* Gemeente van Jesus ...

    African Journals Online (AJOL)

    Test

    Sy lof te sing, is dit mooi, al rys die lofsang ook nie by almal uit die diepte van die hart nie. Dit is nog geen rede om ontmoedig te word nie. Waar die net laat sak word en vol vis is as hy opgetrek word, is dit 'n heerlike werk. Mag dit gebeur dat die net minder inhou as wat ons graag wil sien of as wat ons verwag, dan nog mag ...

  16. Tolko poetom hotel bõt : Rastrogannost; Dozhdlivõi den; Jaanov ogon; Setumaa I-II; Tolko poetom. Haralskije zhizneopissanija : Aire Valgus; Aare Valgus; Peeter Petrov; Vaike Metsleht; Valdur Laiapea; Hillar Aruda, ekonomist; Pärja Lumendi; Valjo Z

    Index Scriptorium Estoniae

    Traat, Mats, 1936-

    1996-01-01

    Orig.: Heldimus; Sajupäev; Jaanituli; Setumaa I-II; Ainult poeet. Harala elulood: Aire Valgus; Aare Valgus; Peeter Petrov; Vaike Metsleht; Valdur Laiapea; Hillar Aruda, ökonomist; Pärja Lumendi; Valjo Zeiger; Pavlo Moskalenko; Johannes Iva; Viljar Laanemägi; Olga Kaljusaar; Aimi Vaimets; Einard Kalm (1923-1984); Sonetid vaikimisest I; Kui

  17. Täienduskoolitus / Malle Saks, Terje Varul, Helin Puksand, Marje Kuslap

    Index Scriptorium Estoniae

    2008-01-01

    Küsimustele: mis (või kes) pani teid laste kõrval ka kolleege harima, kuidas te ennast selles rollis tunnete ja mida see teile kui õpetajale andnud on, millist koolitust ise kõige rohkem vajaksite ja/või milline tore koolitatava-kogemus kõigepealt meenub? - vastavad täienduskoolituse lektorid: Tartu Erakooli matemaatikaõpetaja M. Saks, Kolga Keskkooli eesti keele ja kirjanduse õpetaja T. Varul, Tallinna Mustamäe Gümnaasiumi emakeeleõpetaja ja logopeed H. Puksand, Rakvere Eragümnaasiumi klassiõpetaja M. Kuslap

  18. SmSak, the second Polo-like kinase of the helminth parasite Schistosoma mansoni: conserved and unexpected roles in meiosis.

    Directory of Open Access Journals (Sweden)

    Thavy Long

    Full Text Available Polo-like kinases (Plks are a family of conserved regulators of a variety of events throughout the cell cycle, expanded from one Plk in yeast to five Plks in mammals (Plk1-5. Plk1 is the best characterized member of the Plk family, homolog to the founding member Polo of Drosophila, and plays a major role in cell cycle progression by triggering G2/M transition. Plk4/Sak (for Snk (Serum-inducible kinase akin kinase is a unique member of the family, structurally distinct from other Plk members, with essential functions in centriole duplication. The genome of the trematode parasite Schistosoma mansoni contains only two Plk genes encoding SmPlk1 and SmSak. SmPlk1 has been shown already to be required for gametogenesis and parasite reproduction. In this work, in situ hybridization indicated that the structurally conserved Plk4 protein, SmSak, was largely expressed in schistosome female ovary and vitellarium. Expression of SmSak in Xenopus oocytes confirmed its Plk4 conserved function in centriole amplification. Moreover, analysis of the function of SmSak in meiosis progression of G2-blocked Xenopus oocytes indicated that, in contrast to SmPlk1, SmSak cannot induce G2/M transition in the absence of endogenous Plk1 (Plx1. Unexpectedly, meiosis progression was spontaneously observed in Plx1-depleted oocytes co-expressing SmSak and SmPlk1. Molecular interaction between SmSak and SmPlk1 was confirmed by co-immunoprecipitation of both proteins. These data indicate that Plk1 and Plk4 proteins have the potential to interact and cross-activate in cells, thus attributing for the first time a potential role of Plk4 proteins in meiosis/mitosis entry. This unexpected role of SmSak in meiosis could be relevant to further consider the function of this novel Plk in schistosome reproduction.

  19. Evaluation of a Victim-Centered, Trauma-Informed Victim Notification Protocol for Untested Sexual Assault Kits (SAKs).

    Science.gov (United States)

    Campbell, Rebecca; Shaw, Jessica; Fehler-Cabral, Giannina

    2018-03-01

    Throughout the United States, hundreds of thousands of sexual assault kits (SAKs) have not been submitted by the police for forensic DNA testing, which raises complex issues regarding how victims ought to be notified about what happened to their kits. In this project, we evaluated a victim-centered, trauma-informed victim notification protocol that was implemented in Detroit, Michigan. Most victims (84%) did not have a strong negative emotional reaction to notification, and most (57%) decided to reengage with the criminal justice system. Victims of nonstranger sexual assaults were less likely to reengage postnotification compared with victims of stranger rape.

  20. A new transcription factor for mitosis: in Schizosaccharomyces pombe, the RFX transcription factor Sak1 works with forkhead factors to regulate mitotic expression.

    Science.gov (United States)

    Garg, Angad; Futcher, Bruce; Leatherwood, Janet

    2015-08-18

    Mitotic genes are one of the most strongly oscillating groups of genes in the eukaryotic cell cycle. Understanding the regulation of mitotic gene expression is a key issue in cell cycle control but is poorly understood in most organisms. Here, we find a new mitotic transcription factor, Sak1, in the fission yeast Schizosaccharomyces pombe. Sak1 belongs to the RFX family of transcription factors, which have not previously been connected to cell cycle control. Sak1 binds upstream of mitotic genes in close proximity to Fkh2, a forkhead transcription factor previously implicated in regulation of mitotic genes. We show that Sak1 is the major activator of mitotic gene expression and also confirm the role of Fkh2 as the opposing repressor. Sep1, another forkhead transcription factor, is an activator for a small subset of mitotic genes involved in septation. From yeasts to humans, forkhead transcription factors are involved in mitotic gene expression and it will be interesting to see whether RFX transcription factors may also be involved in other organisms. © The Author(s) 2015. Published by Oxford University Press on behalf of Nucleic Acids Research.

  1. The Aspergillus fumigatus SchASCH9 kinase modulates SakAHOG1 MAP kinase activity and it is essential for virulence

    Science.gov (United States)

    Alves de Castro, Patrícia; dos Reis, Thaila Fernanda; Dolan, Stephen K.; Manfiolli, Adriana Oliveira; Brown, Neil Andrew; Jones, Gary W.; Doyle, Sean; Riaño-Pachón, Diego M.; Squina, Fábio Márcio; Caldana, Camila; Singh, Ashutosh; Del Poeta, Maurizio; Hagiwara, Daisuke; Silva-Rocha, Rafael; Goldman, Gustavo H.

    2016-01-01

    Summary The serine-threonine kinase TOR, the Target of Rapamycin, is an important regulator of nutrient, energy and stress signaling in eukaryotes. Sch9, a Ser/Thr kinase of AGC family (the cAMP-dependent PKA, cGMP- dependent protein kinase G and phospholipid-dependent protein kinase C family), is a substrate of TOR. Here, we characterized the fungal opportunistic pathogen Aspergillus fumigatus Sch9 homologue (SchA). The schA null mutant was sensitive to rapamycin, high concentrations of calcium, hyperosmotic stress and SchA was involved in iron metabolism. The ΔschA null mutant showed increased phosphorylation of SakA, the A. fumigatus Hog1 homologue. The schA null mutant has increased and decreased trehalose and glycerol accumulation, respectively, suggesting SchA performs different roles for glycerol and trehalose accumulation during osmotic stress. The schA was transcriptionally regulated by osmotic stress and this response was dependent on SakA and MpkC. The double ΔschA ΔsakA and ΔschA ΔmpkC mutants were more sensitive to osmotic stress than the corresponding parental strains. Transcriptomics and proteomics identified direct and indirect targets of SchA post-exposure to hyperosmotic stress. Finally, ΔschA was avirulent in a low dose murine infection model. Our results suggest there is a complex network of interactions amongst the A. fumigatus TOR, SakA and SchA pathways. PMID:27538790

  2. Quadruple or quintuple conversion of hlb, sak, sea (or sep), scn, and chp genes by bacteriophages in non-beta-hemolysin-producing bovine isolates of Staphylococcus aureus.

    Science.gov (United States)

    Kumagai, Rina; Nakatani, Kazue; Ikeya, Nanami; Kito, Yukiko; Kaidoh, Toshio; Takeuchi, Shotaro

    2007-05-16

    In 13 of 43 non-beta-hemolysin-producing bovine isolates of Staphylococcus aureus, two truncated beta-hemolysin (hlb) genes were demonstrated by PCR and sequencing, and one truncated hlb gene was located beside the integrase (int) gene of phage origin. The staphylokinase (sak) gene was detected in all 13 isolates in which the truncated hlb genes were detected by PCR. Enterotoxin A (sea) and enterotoxin P (sep) genes were also detected in 5 and 2 of the 13 isolates, respectively. Moreover, the scn and chp genes encoding staphylococcal complement inhibitor (SCIN) and chemotaxis inhibitory protein of S. aureus (CHIPS) were detected in 13 and 4 of the 13 isolates, respectively. The bacteriophage induced by mitomycin C treatment was able to lysogenize one beta-hemolysin-producing isolate of S. aureus, and the sak and scn genes were detected from the lysogenized isolate. These results suggest quadruple or quintuple conversion of hlb, sak, sea (or sep), scn, and chp genes by bacteriophages among non-beta-hemolysin-producing bovine isolates of S. aureus.

  3. Vanemapalk õiglasemaks! / Katrin Saks

    Index Scriptorium Estoniae

    Saks, Katrin, 1956-

    2005-01-01

    Ilmunud ka Vali Uudised 9. märts lk. 2, Põhjarannik 9. märts lk. 2, Severnoje Poberezhje 9. märts lk. 2, Pärnu Postimees 9. märts lk. 2, Sakala 9. märts lk. 2, Vooremaa 10. märts lk. 2, Hiiu Leht 11. märts lk. 2, Virumaa Teataja 17. märts lk. 7. Autor toob ära sotsiaaldemokraatide poolt väljapakutavad vanemapalga põhimõttelised muudatused

  4. Perekond Raus ENSV kaitseliinil / Valdur Ohmann

    Index Scriptorium Estoniae

    Ohmann, Valdur, 1958-

    2015-01-01

    Põhjalikumalt Oskar Rausi ja Viktor Rausi elukäigust. Viktor Rausi seostest tuntud eesti kultuuritegelastega: Jaanus Orgulas, Voldemar Panso, Jaak Joala, Arvo Pärt, Leonhard Lapin, Jüri Arrak, Aarne Vahtra, Heinz Valk, Ott Arder jt.

  5. The effects of pre-harvest napthalene acetic acid and aminoethoxyvinylglycine treatments on storage performance of ‘ Ak Sakı’ apple cultivar grown in Erzincan conditions

    Directory of Open Access Journals (Sweden)

    Burhan OZTÜRK

    2013-06-01

    Full Text Available This study was carried out to determine the effects of pre-harvest aminoethoxyvinylglycine (AVG, 150, 225 ve 300 mg/L and naphthaleneacetic acid (NAA, 20 mg/L treatments in different doses on storage performance of ‘Ak Sakı’ apple cultivar (Malus domestica Borkh. in 2012. The changes on some fruit quality parameters were measured at 2±1 oC temperature and with 90±5 % relative humidity at 45 days interval during storage. The lowest weight loss was obtained from 300 mg/L AVG treated fruits during the storage. In the all analysis date, the highest L* value was obtained from 300 mg/L AVG treated fruits, and the lowest hue angle value was reported from the fruits of control treatment. The flesh firmness was determined that the best kept in the 225 and 300 mg/L AVG treated fruits during the storage. The flesh firmness significantly reduced with NAA treatment at the end of storage. The highest soluble solids concentration (SSC was obtain from control fruit during the storage, whereas the lowest SSC was observed in fruit treated with 300 mg/L AVG. In the all analysis date, the highest titratable acidity was obtained in fruits treated with 225 and 300 mg/L AVG. The starch degradation was delayed with AVG treatments.

  6. Amnestyl on topeltstandardid / Katrin Saks

    Index Scriptorium Estoniae

    Saks, Katrin, 1956-

    2008-01-01

    Ilmunud ka: Linnaleht : Tartu 6. juuni 2008, lk. 4. Äsja ilmunud Amnesty Internationali raportist, kus tõdetakse, et Eestis diskrimineeritakse keelelisi vähemusi. Võrdlus vanade EL-i liikmesriikidega

  7. Venemaal sotsiaaldemokraatiat otsimas / Katrin Saks

    Index Scriptorium Estoniae

    Saks, Katrin, 1956-

    2008-01-01

    Euroopa Sotsiaaldemokraatliku Partei (ESP) ja Alfred Moseri fondi koostöös toimunud visiidist Venemaale, kus osalesid mitme Lääne sotsiaaldemokraatliku partei esindajad, kohtumisest endise Jabloko esimehe Grigori Javlinski, Venemaa Sotsiaaldemokraatliku Partei looja Mihhail Gorbatshovi ja selle praeguse esimehe Vladimir Kishenini ning partei Õiglane Venemaa juhi Sergei Mironoviga

  8. Populaarsemad raamatud : [Sõnum] / Ita Saks

    Index Scriptorium Estoniae

    Saks, Ita, 1921-2003

    1996-01-01

    Aasta populaarseimad raamatud läti kirjanduses: Vizma Belshevica 'Bille', Regina Ezera 'Lohe Muna' ja Karlis Levinshi 'Muinasjutujärve ääres'; populaarseimad publitsistikaraamatud on Guntis Ulmanise 'Sinult ju palju ei nõuta' ja Dainis Ivansi 'Juhuslik sõdalane'

  9. Obtaining a Well-Aligned ZnO Nanotube Array Using the Hydrothermal Growth Method / Labi Sakārtotu Zno Nanocauruļu Kopu Iegūšana, Izmantojot Hidrotermālo Metodi

    Directory of Open Access Journals (Sweden)

    Krasovska M.

    2015-10-01

    Full Text Available Dotajā darbā tika noteikti optimāli parametri labi sakārtotu ZnO nanocaurulīšu kopu iegūšanai, izmantojot hidrotermālo metodi ar temperatūras pazemināšanu, jeb t.s. selektīvu paškodināšanas metodi (self-selective etching, ir uzsvērtas šās metodes priekšrocības salīdzinājumā ar ķīmiskās kodināšanas metodi, kā arī tika aprakstīta dažādu augšanas faktora (tādu, ka darba šķīduma koncentrācija, augšanas temperatūra un laiks, iedīgļu slāņa iegūšanas veids un iegūšanas parametri ietekme uz iegūtu nanostraktūra morfoloģiju.

  10. Eesti esimene kaasaegne tuulepark : [Virtsus] / Raimo Pirksaar, Valdur Tiit

    Index Scriptorium Estoniae

    Pirksaar, Raimo

    2004-01-01

    1,8 MW võimsusega Virtsu tuulepargi käivitamine 2002. a. sügisel oli Eesti taastuvenergeetika jaoks oluline samm. Tuulepargi avamisel osalesid Eesti Vabariigi president Arnold Rüütel, Saksamaa Liitvabariigi suursaadik Eestis Jürgen Dröge, regionaalminister Toivo Asmer, Eesti Energia juhatuse esimees Gunnar Okk jt. Fotod

  11. Gustav Naani kaebekiri EKP Keskkomiteele / Valdur Ohmann, Gustav Naan

    Index Scriptorium Estoniae

    Ohmann, Valdur

    2005-01-01

    Akadeemik Gustav Naani kaebekiri EKP Keskkomiteele, milles ta nõudis veelgi jäigemat kurssi ideoloogiatöös ja otsustavad tegutsemist 40. kirja autorite vastu. Põhiline tähelepanu on suunatud Arvo Valtoni ja Jaan Kaplinski vastu. Kiri: Mõtteid ideoloogilisest situatsioonist. Lk. 102-104.

  12. Tuuleenergia kasutamisvõimalused Eestis / Ain Kull, Valdur Tiit

    Index Scriptorium Estoniae

    Kull, Ain, 1973-

    2005-01-01

    Autorite hinnangul on seni Eestis ulatuslik tuulejõu kasutamine raskendatud nii finantsprobleemide, kodumaise tootmise puudumise, rannikupiirkondade elektriliinide väikese võimsuse kui ka Narva põlevkivijaamade alakoormatuse tõttu. Tabel

  13. Obtaining a Well-Aligned ZnO Nanotube Array Using the Hydrothermal Growth Method / Labi Sakārtotu Zno Nanocauruļu Kopu Iegūšana, Izmantojot Hidrotermālo Metodi

    Science.gov (United States)

    Krasovska, M.; Gerbreders, V.; Paskevics, V.; Ogurcovs, A.; Mihailova, I.

    2015-10-01

    Optimal growing parameters have been found using the hydrothermal method to obtain well-aligned vertical ZnO nanorod and nanotube arrays. The influence of different growing factors (such as temperature, growing solution concentration, method of obtaining seed layer and condition) on nanotube morphology and size is described in the paper. Well-structured ZnO nanotubes have been obtained by using a selfselective etching method with lowering temperatures of growth during the hydrothermal process. It is shown that the optical properties of the nanostructure arrays obtained are sensitive to the medium in which they are placed, which is why they can be used as sensors for pure substance detection and in different solutions for impurity determination. Dotajā darbā tika noteikti optimāli parametri labi sakārtotu ZnO nanocaurulīšu kopu iegūšanai, izmantojot hidrotermālo metodi ar temperatūras pazemināšanu, jeb t.s. selektīvu pa\\vskodināšanas metodi (self-selective etching), ir uzsvērtas šās metodes priekšrocības salīdzinājumā ar ķīmiskās kodināšanas metodi, kā arī tika aprakstīta dažādu augšanas faktora (tādu, ka darba šķīduma koncentrācija, augšanas temperatūra un laiks, iedīgļu slāņa iegūšanas veids un iegūšanas parametri) ietekme uz iegūtu nanostraktūra morfoloģiju. Tika konstatēts, ka noteicošu lomu ZnO nanocaurulīšu audzēšanas procesā spēlē iedīgļu slāņa graudu izmēri, kas savā staipā nosaka augošu nanostieņu izmērus un to tendenci pie pa\\vskodināšanas. Rentgenogrannnas parāda, ka iegūtām pie noteiktiem parametriem ZnO nanostruktūrām piemīt augsta kristāliskuma pakāpe un sakārtotība vertikālā virzienā. Optiskie mērījumi parāda, ka ZnO nanocauralītes ir jutīgas gan pret tīrām vielām (ūdens, spirts), gan pret dažādiem šķīdumiem, kas ļauj izmantot tos kā pie­jaukumu sensora. Salīdzinājumā ar ZnO nanostieņiem caurulīšu jūtība pieaug, jo pieaug nanostrakt

  14. Harmonisasi SAK dan Aturan Pajak: Mungkinkah?

    Directory of Open Access Journals (Sweden)

    Heri Sukendar Sukendar

    2014-11-01

    Full Text Available This paper is intended to illustrate the fact that the case today, especially in Indonesia's commitment to convergency of IFRS, where the decision was certainly not out of global importance that in order to improve the information from the financial statements of companies in Indonesia. In addition, the IFRS Convergence is one of the Indonesian government agreements as a member of the G20 forum, the results of the meeting of G20 leaders in Washington DC forum, 15 November 2008. On the other hand, the tax rules that apply are still using the old accounting standards and do not follow the development of increasingly different. Previous differences between GAAP and tax rules are limited to the "deductible and non-deductible" which is resolved through fiscal reconciliation mechanism with positive correction and correction negatipnya. The widening gap today would be a separate issue for IAI as the organization of the accounting profession. Tax Accountant compartment formation in March 2014 is a serious evidence of the organization as an anticipation, particularly in an effort to bridge the gap widening

  15. Internetiside VoIP sobib ka ettevõtteile / Valdur Laid

    Index Scriptorium Estoniae

    Laid, Valdur, 1969-

    2005-01-01

    Ilmunud ka: Delovõje Vedomosti 8. juuni lk. 19. Kommunikatsiooni liikumisest internetti ehk IP-võrku ning selle võimalustest ettevõtjaile. Vt. samas: Väikefirmade IP-lahendus jõuab aasta lõpus massturule

  16. Hispaaniast fashismivastasest sõjast naasnud pandi NSV Liidus türmi / Valdur Ohmann

    Index Scriptorium Estoniae

    Ohmann, Valdur

    2006-01-01

    Eestlased ja Eestiga seotud isikud Hispaania kodusõjas, sisaldab ka 56 sõjas osalenud eestlase nimesid. Lisa: Igor Aieri 7. augustil 1939. aastal NKVD uurijale Izotovile antud ülestunnistused. Lk. 99-104

  17. Kas holokaust võib korduda? / Elhonen Saks

    Index Scriptorium Estoniae

    Saks, Elhonen, 1927-

    2000-01-01

    Eestit külastas USA Kongressi Esindajatekoja välissuhete komisjoni liige Tom Lantos. Dokumentaalfilm "Viimased päevad" ("The Last Days") Eesti välisministeeriumi pressikeskuses. režissöör James Moll : Ameerika Ühendriigid 1998. Survivors of the Shoah Visual History Foundation algatus. Filmi esitusel osalesid ka L. Meri ja T. H. Ilves.

  18. Kto zashtshitit ot grabitelskogo SMS-kredita? / Katrin Saks

    Index Scriptorium Estoniae

    Saks, Katrin, 1956-

    2008-01-01

    Kiirlaenudest ja nendega seonduvatest probleemidest Eestis, seaduseelnõust, mis suurendab SMS-laenu võtnute võimalusi kaitsta oma õigusi laenuandjate ees ning olukorra ohjeldamisest Rootsis ja Soomes

  19. Äraaetud hobused lastakse maha / Katrin Saks

    Index Scriptorium Estoniae

    Saks, Katrin, 1956-

    2008-01-01

    Tööaja direktiivi muutmise eelnõust, mis suurendaks töötajate tööaja piiranguid. Ilmunud ka Põhjarannik 19. juuni 2008, lk.2 ; Vooremaa 21. juuni 2008, lk. 2 ; Virumaa Teataja 27. juuni 2008, lk. 11 ; Pärnu Postimees 27. juuni 2008, lk. 15 ; Järva Teataja 1. juuli 2008, lk. 2 ; Koit 3. juuli 2008, lk. 6 ; Nädalaleht 20. juuni 2008, lk. 7

  20. Pikk tee märkamiseni / Katrin Saks

    Index Scriptorium Estoniae

    Saks, Katrin, 1956-

    2008-01-01

    Õpilaste koolisuhetest ning koolivägivallast. Ilmunud ka Vooremaa 9. okt. 2008, lk. 2 ; Võrumaa Teataja 11. okt. 2008, lk. 2 ; Koit 11. okt. 2008, lk. 6 ; Meie Maa 13. okt. 2008, lk. 2 ; Pärnu Postimees 10. okt. 2008, lk. 15 ; Virumaa Teataja 15. okt. 2008, lk. 11

  1. Toiduvilja koht pole kütusepaagis / Katrin Saks

    Index Scriptorium Estoniae

    Saks, Katrin, 1956-

    2008-01-01

    Ilmunud ka: Nädaline 22. mai, lk. 4, Pärnu Postimees 22. mai, lk. 15, Võrumaa Teataja 22. mai, lk. 2, Vooremaa 22. mai, lk. 2, Valgamaalane 22. mai lk. 2, Hiiu Leht 23. mai, lk. 2, Kuulutaja 23. mai lk. 4, Koit 24. mai lk. 6, Järva Teataja, Harju Elu 27. mai lk. 2, Vali Uudised 28. mai lk. 2, Meie Maa 29. mai lk. 2, Lääne Elu 5. juuni lk. 2, Virumaa Teataja 6. juuni, lk. 11, Sakala 6. juuni lk. 2, Molodjozh Estonii 9. juuni lk. 7. Euroopa Parlamendi liige annab ülevaate EL biokütusepoliitikast

  2. Laste hulk ei sõltu toonekurgede arvukusest / Katrin Saks

    Index Scriptorium Estoniae

    Saks, Katrin, 1956-

    2006-01-01

    Perekonnaseaduse eelnõust ja samasooliste abielust. Sama ka Harjumaa 24. jaan. 2006, lk. 2 ; Võrumaa Teataja 24. jaan. 2006, lk. 2 ; Vali Uudised 25. jaan. 2006, lk. 2 ; Meie Maa 25. jaan. 2006, lk. 2 ; Hiiu Leht 27. jaan. 2006, lk. 2 ; Kuulutaja 27. jaan. 2006, lk. 4 ; Lõunaleht 26. jaan. 2006, lk. 2 ; Vooremaa 26. jaan. 2006, lk. 2 ; Pärnu Postimees 2. veeb. 2006, lk. 11 ; Sakala 2. veeb. 2006, lk. 2 ; Valgamaalane 25. aprill 2006, lk. 2 ; Hiiu Leht 9. mai 2006, lk. 2 ; Sotsiaaldemokraat 16. veeb. 2006, lk. 5

  3. Ebavõrdsus hukutab Eesti arengu / Katrin Saks

    Index Scriptorium Estoniae

    Saks, Katrin, 1956-

    2004-01-01

    Ilmunud ka: Pärnu Postimees, 22. jaan. 2004, lk. 11; Võrumaa Teataja, 24. jaan. 2004, lk. 2; Meie Maa, 24. jaan. 2004, lk. 2; Hiiu Leht, 27. jaan. 2004, lk. 2; Põhjarannik, 31. jaan. 2004, lk. 2; Severnoje Poberezhje, 31. jaan. 2004, lk. 2; Koit, 3. veebr. 2004, lk. 6; Hiiumaa, 3. veebr. 2004, lk. 2. Autor vaatleb riigi osa ebavõrduse ilmingute likvideerimisel Eestis ja leiab, et ebavõrdsus on meie arengu peamine takistus, mille kõrvaldamine on sotsiaaldemokraatide peamine eesmärk

  4. Riskikapital vajab riigi kehtestatud mängureegleid / Peeter Saks

    Index Scriptorium Estoniae

    Saks, Peeter

    2004-01-01

    AS-i Suprema Securities juhatuse esimehe sõnul on Euroopa riskikapitali turul selge nõudlus sobiva seadusliku raamistiku ja hea mainega riigi või piirkonna järele, Eestil on praegu võimalus kujuneda Euroopa üheks riskikapitali keskuseks. Autori arvates peaks esimeseks sammuks olema eraldi riskikapitali seaduse loomine. Vt. samas: Andrus Ansip, Taavi Veskimägi ja Linnar Viik vastavad küsimusele, kas Eesti vajab riiklikku riskikapitali fondi

  5. Necip Fazıl Kısakürek’in “Kaldırımlar” Şiiri Üzerine Dil Bilimsel Bir Çözümleme A Linguistic Analysis On Necip Fazıl Kısakurek’s Poem Called As ‘Kaldırımlar’

    Directory of Open Access Journals (Sweden)

    Yusuf TEPELİ

    2013-03-01

    önüyle şiirin başarısında ve kalıcılığında büyük paya sahiptir. Şiir dilden ayrı düşünülemeyeceği için şiir eleştirisi de dilden bağımsız gerçekleştirilemez. Şiirin yansıttığı duyguları, okuyucuya yaşattığı atmosferi birtakım öznel değerlendirmelerle aktarmak yerine tamamen metnin kendi söz varlığına dayanan, bilimsel bir yöntemle açıklamak ihtiyacı bu çalışmanın yapılmasında etkili olmuştur. Bu çalışma için Necip Fazıl Kısakürek’in şiirinin tercih edilmesinde şairin sapmalar ve aktarmalarla özgün imgeler yaratması, ses ögelerinden bolca yararlanması, konuşulan dilin verdiği rahat söyleyişi yakalaması etkili olmuştur. Şair kişinin yoğun iç hesaplaşmalarının, ruh çalkantılarının yansımalarını dış dünyanın gerçekliğiyle aktardığı mistik şiirler kaleme almıştır. “Kaldırımlar” şiiri tüm bu nitelikleri içermesi bakımından bizlere ideal bir dil malzemesi sağlamaktadır.Bu çalışmada, Necip Fazıl Kısakürek’in Kaldırımlar adlı şiiri dilbilimsel bakışla çözümlenmeye çalışılmıştır. Bunun için Doğan Aksan'ın "Şiir Dili ve Türk Şiir Dili" adlı eseri temel alınarak, Aksan’ın değişik şiir örnekleri üzerinde gösterdiği şiir inceleme yöntemi bir Kaldırımlar şiiri üzerinde uygulanmıştır.İki bölümden oluşan çalışmanın ilk bölümünde kısaca sözcük türleri üzerinde durulmuş, ikinci bölümde ise metnin söz varlığını oluşturan sözcüklerin dil bilimsel/ anlam bilimsel/ gösterge bilimsel incelemesi yapılmış, bulgular tablolaştırılarak aktarılmıştır. Metinde geçen sözcükler tür, anlam yönü, ses ögeleri bakımından incelenmiş, bunların duygu değerleri, geçiş sıklıkları ve birbirleriyle ilişkileri tespit edilerek çözümlemeye gidilmiştir.

  6. Globaalpohmeluse lokaalravitsus ehk viiul insenerina läbikukkunud inimkonnale / Mihkel Kunnus

    Index Scriptorium Estoniae

    Kunnus, Mihkel, 1982-

    2016-01-01

    Arvustus: Mikita, Valdur. Metsik lingvistika : sosinaid kartulikummardajate külast. Tallinn : Grenader, 2008 ; Mikita, Valdur. Lingvistiline mets : tsibihärblase paradigma. Teadvuse kiirendi. Tallinn : Grenader, 2013 ; Mikita, Valdur. Lindvistika, ehk, Metsa see lingvistika. Vara : [HM], 2015

  7. Uudised : TÜ Kammerkoor laulis Rootsis. Suzuki Nordic String Eestis. Vello Loogna sünnipäevakontsert / Valdur Liiv

    Index Scriptorium Estoniae

    Liiv, Valdur

    2000-01-01

    TÜ Kammerkoor esines ülestõusmispühadel Rootsi kirikutes. Põhjamaade laste keelpilliorkester esineb Eestis 1., 2. ja 3. mail. Lühidalt Suzuki pedagoogikast. V. Loogna 60. juubeli kontserdist 30. apr. Estonia kontserdisaalis

  8. Raimond Valgre noorem vend - kes ta oli? : Kuno-Enn Valgre (30.05.1918-02.03.1987) / Valdur Ohmann

    Index Scriptorium Estoniae

    Ohmann, Valdur, 1958-

    2011-01-01

    Vastukäivad andmed ärgitasid uurima, kes õigupoolest oli Valgre noorem vend. Kõige ehedamalt annab Enn Valgre sõjaaegse käekäigu edasi ülekuulamisprotokoll 11. novembrist 1944. Ülekuulamisprotokolli tekst

  9. Uued muutused nõuavad enam selgitustööd / Katrin Saks

    Index Scriptorium Estoniae

    Saks, Katrin, 1956-

    2008-01-01

    Euroopa Liidu otsustest ja nende tähtsusest ning selgitamise vajadusest. Ilmunud ka Koit 22. jaan. 2008, lk. 6, pealkiri kujul: Muutused nõuavad poliitikutelt järjest enam selgitustööd, Meie Maa 22. jaan. 2008, lk. 2 ; Sakala 24. jaan. 2008, lk. 2 ; Valgamaalane 22. jaan. 2008, lk. 2 ; Virumaa Teataja 25. jaan. 2008, lk. 11 ; Lääne Elu 24. jaan. 2008, lk. 2 ; Pärnu Postimees 5. veeb. 2008, lk. 19

  10. Ohutusnõuded laste mänguasjadele muutuvad senisest karmimaks / Katrin Saks

    Index Scriptorium Estoniae

    Saks, Katrin, 1956-

    2008-01-01

    Euroopa Komisjoni avaldatud kauaoodatud mänguasjade ohtuse direktiivi eelnõust, mis reguleerib siin müüdavate mängukannide ohutusnõudeid. Ilmunud ka Meie Maa 23. okt. 2008, lk. 2, pealkiri kujul: nõuded laste mänguasjadele muutuvad karmimaks ; Põhjarannik 23. okt. 2008, lk. 2 ; Järva Teataja 25. okt. 2008, lk. 2, pealkiri kujul: lelude ohutusnõuded karmistuvad ; Kuulutaja 24. okt. 2008, lk. 4 ; Oma Saar 6. nov. 2008, lk. 5 ; Pärnu Postimees 7. nov. 2008, lk. 15 ; Valgamaalane 11. nov. 2008, lk. 2

  11. Kes kaitseb röövelliku kiirlaenu eest? / Katrin Saks

    Index Scriptorium Estoniae

    Saks, Katrin, 1956-

    2008-01-01

    Kiirlaenudest ja nendega seonduvatest probleemidest Eestis, seaduseelnõust, mis suurendab SMS-laenu võtnute võimalusi kaitsta oma õigusi laenuandjate ees ning olukorra ohjeldamisest Rootsis ja Soomes. Ilmunud ka Pärnu Postimees 31. okt. 2008, lk. 11, pealkiri kujul: kaitse röövelliku kiirlaenu vastu ja tarbijakaitsepoliitika ; Lõunaleht 6. nov. 2008, lk. 4, pealkiri kujul: kes kaitseb röövelliku kiirlaenu eest ehk tarbijakaitsepoliitika lakmustest ; Vali Uudised 7. nov. 2008, lk. 2 ; Harju Ekspress 7. nov. 2008, lk. 8, pealkiri kujul: kes kaitseb röövelliku kiirlaenu vastu ehk tarbijakaitsepoliitika lakmustest ; Türi Rahvaleht 14. nov. 2008, lk. 4 ; Virumaa Teataja 14. nov. 2008, lk. 11, pealkiri kujul: kiirlaenud on test tarbijakaitsepoliitikale ; Kuulutaja 14. nov. 2008, lk. 4, pealkiri kujul: kes kaitseb kiirlaenu vastu ; Vooremaa 18. nov. 2008, lk. 2 ; Sõnumitooja 26. nov. 2008, lk. 2 ; Koit : Tarbijaleht 27. nov. 2008, lk. 10

  12. Onu Miltie mälestuseks ehk Mis seob New Orleansi ja Keilat? / Katrin Saks

    Index Scriptorium Estoniae

    Saks, Katrin, 1956-

    2008-01-01

    16. novembril sai kaks aastat liberaalse majanduse guru Milton Friedmani surmast. Friedmani šokidoktriinist, katastroofikapitalismist ja pimedast usust erakapitali, ajal, mil Keila linnaisad olid otsustanud, et haridust hakkab munitsipaalkooli asemel edendama sihtasutus

  13. Valitsusliit jätab lasteaiaõpetajad virelema / Katrin Saks

    Index Scriptorium Estoniae

    Saks, Katrin, 1956-

    2004-01-01

    Koolieelsete lasteasutuste seaduse muutmise seaduseelnõu hääletati Riigikogu menetlusest välja, vanemahüvitistest. Ilmunud ka Pärnu Postimees 23. sept. 2004, lk. 15 ; Hiiu Leht 24. sept. 2004, lk. 2 ; Sakala 24. sept. 2004, lk. 2 ; Vali Uudised 24. sept. 2004, lk. 2 ; Nädaline 23. sept. 2004, lk. 4 ; Põhjarannik 24. sept. 2004, lk. 2 ; Türi Rahvaleht 24. sept. 2004, lk. 4, Meie Maa 28. sept. 2004. lk. 2 ; Koit 30. sept. 2004, lk. 6 ; Vooremaa 7. okt. 2004, lk. 2 ; Valgamaalane 16. okt. 2004, lk. 2

  14. DVD-plaatide hind langeb / Ivar Sild

    Index Scriptorium Estoniae

    Sild, Ivar

    2003-01-01

    DVD (Digital Versatile Disk = digitaalne mitmekülgne plaat) kui ka juba Eestis videolindiga edukalt konkureeriv audiovisuaalse info kandja. Ivar Vendelin firmast V&K Holding loodab jõuda DVDga massidesse

  15. Justiitsminister Langi umbusaldamine kogub hoogu / Tuuli Koch; kommenteerinud Andrus Ansip, AIn Seppik, Valdur Lahtvee, Karel Rüütli, Andres Herkel, Sven Mikser

    Index Scriptorium Estoniae

    Koch, Tuuli

    2009-01-01

    Reformierakonna valitsuspartner IRL ja opositsioon ei mõista justiitsminister Rein Langi otsust ajutise siseministrina kustutada küberrünnakuga seotud Sergei Markovi nimi Schengeni mustast nimekirjast

  16. Kriitilisi mõtisklusi antoloogiatest, läti luulest ja kirjandusest / Ivar Ivask ; tõlkinud Ita Saks

    Index Scriptorium Estoniae

    Ivask, Ivar, 1927-1992

    2010-01-01

    Neljast paguluses ilmunud läti luuleantoloogiast: Elav luule (Stockholm, 1955); Luule ja näod (New York, 1962); A century of Latvian poetry (tlk. William Kleesmann Matthews. London, 1957); Lettische Lyrik (tlk. E. Eckardt-Skalberg. Hannover-Döhren, 1960)

  17. Formation of Hydrochemical River Regime Under Extreme Contamination by Waste Water (the Sak-Elga River in the Chelyabinsk Region)

    Science.gov (United States)

    Denisov, S. E.; Ulrikh, D. V.; Zhbankov, G. O.

    2017-11-01

    Modern technologies designed to use natural resources in different ways are applied to restructure the environment. The use of technologies results in the deformation of environment, its local, regional and global changes occur. In the course of mining the spaces disturbed by the mine opening rock heaps and processing wastes are formed and rapidly appear. These spaces are dead surfaces the negative effect of which extends to the surrounding areas. Thus, the indirect impact on the lands connected with the change of the condition and regime of the surface and groundwater, settling of dust and chemical compounds from emissions to the atmosphere as well as the products of wind and water erosion lead to deterioration in the quality of the lands, surface and groundwater resources in the area affected by mining.

  18. Juriidilise isiku õigusvõime : [bakalaureusetöö] / Siret Saks ; Tartu Ülikool, õigusteaduskond ; juhendaja: Kadri Siibak

    Index Scriptorium Estoniae

    Saks, Siret

    2006-01-01

    Juriidilise isiku koht ja areng õigussüsteemis, õigusvõime subjektide liigituse alused ja muudatused, ultra vires doktriinist tänapäevase olukorrani, juriidilise isiku õigusvõime omastamine, õigusvõime lõpetamine

  19. Kognitiivsete ja metakognitiivsete õpistrateegiate toetamine tehnoloogiaga tõhustatud keeleõppes / Katrin Saks, Äli Leijen

    Index Scriptorium Estoniae

    Saks, Katrin, 1968-

    2015-01-01

    Tehnoloogiliste vahenditega tõhustatud võõrkeelekursuse raames välja töötatud sekkumisest, mis võimaldab õpetajal parimal moel toetada õppijate kognitiivseid ja metakognitiivseid keele- õppestrateegiaid

  20. Nurettin Topçu and Necip Fazıl Kısakürek: stories of 'conversion' and ...

    African Journals Online (AJOL)

    ... the Naqshbandi practices inspired in these two authors a new methodology to propagate religion within the strict limits of secular Turkey. On the other hand, the new 'modern' intellectual environment also forced Islamist intellectuals to change their way of advocating religiosity through academically accepted standards ...

  1. Ars longa, vita brevis... / Leelo Tamm

    Index Scriptorium Estoniae

    Tamm, Leelo

    1998-01-01

    16. veebr. 1998 avati Aegviidu rahvamajas maalikunstnik Valdur Ohaka 65 taiesest koosnev õlimaalide näitus, kus on töid aastaist 1943-1998. Samal päeval asus manalateele teoste looja. Aegviidu olulisusest Valdur Ohaka jaoks. Kunstniku viimastest maalidest.

  2. Conjugation with Eight-Arm PEG Markedly Improves the In Vitro Activity and Prolongs the Blood Circulation of Staphylokinase.

    Science.gov (United States)

    Qi, Fangbing; Hu, Chunyang; Yu, Weili; Hu, Tao

    2018-01-24

    Staphylokinase (SAK) is a profibrinolytic protein and can be used for therapy of acute myocardial infarction and coronary thrombosis. However, SAK suffers from a short serum half-life time (∼6 min) that limits its clinical application. PEGylation prolongs the half-life time of SAK, whereas it significantly decreases the bioactivity of SAK for the steric shielding effect of PEG. To improve the bioactivity and prolong the half-life time of SAK, 8-arm PEG maleimide (8-arm PEG) was used for conjugation of multiple SAK molecules in one entity. C terminus of SAK was engineered with cysteine residue, followed by reaction with the maleimide moieties of 8-arm PEG to obtain the conjugate (SAKp-PEG). Conjugation with 8-arm PEG retained the secondary structure of SAK, slightly perturbed the tertiary structure of SAK, and essentially maintained its in vitro bioactivity by the multivalence of SAK. Conjugation with 8-arm PEG increased the hydrodynamic volume and thus significantly prolonged the half-life time of SAK. SAKp-PEG elicited a 1.4-fold increase in the SAK-specific IgG titers as compared with SAK, and rendered no apparent toxicity to the cardiac, liver and renal functions of mice. Thus, multiple conjugation of a protein with 8-arm PEG was an effective strategy to develop a long-acting protein drug with improved bioactivity and prolonged blood circulation.

  3. Dicty_cDB: VSF827 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hkllntqtsv*sklkvlshvkiqlfi*vkksv*sakfpn qpktqlvtkfhgvrfakptvvqvlsklvspetshqklwvpqselcythqtsk*ifktkkk --- ---...lahyikwkrftqkvsf*vtedhkllntqtsv*sklkvlshvkiqlfi*vkksv*sak fpnqpktqlvtkfhgvrfakptvvqvlsklvspetshqklwvpqselcyt

  4. Pärnu Keskraamatukogu = Pärnu Central Library / Margit Mutso

    Index Scriptorium Estoniae

    Mutso, Margit, 1966-

    2009-01-01

    Raamatukoguhoone arhitektid Andres Ojari, Ilmar Valdur, Markus Kaasik, Kalle Komissarov ja Mihkel Tüür pälvisid Eesti Kultuurkapitali 2008. aasta peapreemia. Hoone arhitektuursest lahendusest, žürii hinnang hoonele

  5. Повысят ли производители тепла тарифы на услуги, чтобы компенсировать возможные потери дохода? / Владимир Панов, Таави Мадиберк, Маргус �

    Index Scriptorium Estoniae

    2010-01-01

    Vladimir Panov, Taavi Madiberk, Margus Kasepalu ja parlamendiliige Valdur Lahtvee vastavad küsimusele, kas soojusetootjad kavatsevad tariife tõsta, et kompenseerida majade soojustamisega seotud võimalikku sissetulekute kadu

  6. Akna varastamine : eesti Y-kirjandus / Berk Vaher

    Index Scriptorium Estoniae

    Vaher, Berk, 1975-

    2014-01-01

    Valdur Mikita, Erkki Luuk'i, Kiwa, Kaspari ja kirjanike rühmituse “14 NÜ” (Mait Laas, Paavo Matsin, Marko Mägi, Erkki Kadarik, Marianne Ravi, Maarja Vaino, Trip Jarvis, Johannes Üksi) loomingust

  7. Kultuurkapital premeeris raamatukogu arhitekte / Karin Klaus

    Index Scriptorium Estoniae

    Klaus, Karin

    2009-01-01

    Kultuurkapitali 2008. aasta preemiad pälvisid Pärnu Keskraamatukogu hoone arhitektid Ilmar Valdur, Andres Ojari, Markus Kaasik, Kalle Komissarov ja Mihkel Tüür ning Audru folklooriselts Hoiuspuu Sirje Osipovi juhtimisel

  8. Vana hea arhitektuur : Villa-V Nõmmel = Good Old Architecture : Villa-V in Nõmme / Siiri Vallner

    Index Scriptorium Estoniae

    Vallner, Siiri, 1972-

    2001-01-01

    Projekteerija: arhitektibüroo Kolm Pluss Üks. Arhitektid Markus Kaasik, Andres Ojari, Ilmar Valdur. Projekt 1998, valmis 2001. 11 ill.: pindade diagramm, korruste plaanid, lõige, sise- ja välisvaated

  9. Energiamaksudega kütuse tarbimist piirama / Einari Kisel

    Index Scriptorium Estoniae

    Kisel, Einari, 1972-

    2004-01-01

    Energiamaksudest kui riigi energiapoliitika juhtimise vahendist. Vt. samas: Valdur Lahtvee. Võrdne energiamaksustamine kõikidele saastajatele. Graafikud, diagrammid: Energiamaksustamine ja saastetasud. Tabel: Euroopa riikides rakendatud CO₂ maksumäärad

  10. Cloning, high-level expression, purification and characterization of a ...

    African Journals Online (AJOL)

    The staphylokinase (Sak) is emerging as an important thrombolytic agent for the treatment of patients suffering from cardiovascular disease. Hence in this study, we reported the cloning, high-level expression, purification and characterization of the Sak variant SakøC from Staphylococcus aureus QT08 in Escherichia coli ...

  11. Kinetic and stoichiometric analysis of the modification process for N-terminal PEGylation of staphylokinase.

    Science.gov (United States)

    Wang, Jun; Hu, Tao; Liu, Yongdong; Zhang, Guifeng; Ma, Guanghui; Su, Zhiguo

    2011-05-01

    Staphylokinase (SAK) is a therapeutic protein with promise for thrombolytic therapy of acute myocardial infarction. In this study, polyethylene glycol (PEG) aldehyde was used for N-terminal PEGylation of SAK to improve the pharmacological profiles of SAK. Due to the presence of the competitive PEGylation between the N terminus and the Lys residues, kinetic and stoichiometric analysis was carried out to investigate the process for the N-terminal PEGylation of SAK. To achieve this objective, size exclusion chromatography and tryptic peptide mapping were used to measure the PEGylation extent of SAK molecule and its specific amino acid residues, respectively. Copyright © 2010 Elsevier Inc. All rights reserved.

  12. Kemplus pärast lahingut / Tuuli Koch

    Index Scriptorium Estoniae

    Koch, Tuuli

    2005-01-01

    ETV 19. oktoobri saatest "Foorum", kus osalesid erakondade aseesimehed: Mailis Reps (Keskerakond), Meelis Atonen (Reformierakond), Katrin Saks (Sotsiaaldemokraatlik Erakond) ja Andres Herkel (Isamaaliit)

  13. Dicty_cDB: SSE420 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available f*vtedhkllntqtsv*sklkvlshvkiqlfi*vkksv*sakfpnqpkt qlvtkfhgvrfakptvvqvlsklvspetshq...rfarnlppkamgapvrvmlypsni*inl*ne--- ---ptrpikwkrftqkvlf*vtedhkllntqxsv*sklkvlxxvkiqlfi*vkkfv*sak fpnqpktqlvtkfhgvrfakptvvqvlskxvxpets

  14. Staphylokinase Control of Staphylococcus aureus Biofilm Formation and Detachment Through Host Plasminogen Activation.

    Science.gov (United States)

    Kwiecinski, Jakub; Peetermans, Marijke; Liesenborghs, Laurens; Na, Manli; Björnsdottir, Halla; Zhu, Xuefeng; Jacobsson, Gunnar; Johansson, Bengt R; Geoghegan, Joan A; Foster, Timothy J; Josefsson, Elisabet; Bylund, Johan; Verhamme, Peter; Jin, Tao

    2016-01-01

    Staphylococcus aureus biofilms, a leading cause of persistent infections, are highly resistant to immune defenses and antimicrobial therapies. In the present study, we investigated the contribution of fibrin and staphylokinase (Sak) to biofilm formation. In both clinical S. aureus isolates and laboratory strains, high Sak-producing strains formed less biofilm than strains that lacked Sak, suggesting that Sak prevents biofilm formation. In addition, Sak induced detachment of mature biofilms. This effect depended on plasminogen activation by Sak. Host-derived fibrin, the main substrate cleaved by Sak-activated plasminogen, was a major component of biofilm matrix, and dissolution of this fibrin scaffold greatly increased susceptibility of biofilms to antibiotics and neutrophil phagocytosis. Sak also attenuated biofilm-associated catheter infections in mouse models. In conclusion, our results reveal a novel role for Sak-induced plasminogen activation that prevents S. aureus biofilm formation and induces detachment of existing biofilms through proteolytic cleavage of biofilm matrix components. © The Author 2015. Published by Oxford University Press for the Infectious Diseases Society of America. All rights reserved. For permissions, e-mail journals.permissions@oup.com.

  15. The Problem of Untested Sexual Assault Kits: Why Are Some Kits Never Submitted to a Crime Laboratory?

    Science.gov (United States)

    Patterson, Debra; Campbell, Rebecca

    2012-01-01

    Victims of sexual assault are often advised to seek postassault medical care to have a forensic exam, which includes evidence collection (termed a "sexual assault kit" [SAK]). After the exam, law enforcement personnel are supposed to submit the SAK to a crime laboratory for analysis. However, recent media reports suggest that in many communities…

  16. Suur fondijuhtide ülevaade

    Index Scriptorium Estoniae

    2006-01-01

    Küsimustele vastavad Toomas Reisenbuk, Valdur Jaht, Mehis Raud, Siim Valner, Vahur Madisson, Meelis Angerma, Alo Kullamaa, Endriko Võrklaev, Arne Randmaa, Andrei Zaborski, Robert Kitt, Fabio Filipozzi, Martin Hendre, Piotr Chorzewski, Artjom Saia, Aari Stalde ja Märten Kress

  17. Raamatute trükkimine : tiraazhid langevad, nimetuste arv kasvab / Margo Kokerov

    Index Scriptorium Estoniae

    Kokerov, Margo, 1978-

    2001-01-01

    Tallinna Raamatutrükikoja tootmisdirektor Valdur Rebane ja tegevdirektor Jüri Simseli trükikodade majanduslikust olukorrast ja hinnapoliitikast. Diagrammid: raamatu 1 eks. väljaandmiskulude sõltuvus tiraazhist. Kommenteerib Silva Tomingas. Erinevate nimetuste, arvu ja kogutiraazhi sõltuvus keskmisest tiraazhist

  18. Manfred Ketz de Vries : tunne iseennast / Teeli Remmelg

    Index Scriptorium Estoniae

    Remmelg, Teeli

    2006-01-01

    Ilmunud ka: Delovõje Vedomosti 10. mai lk. 24. Professor Manfred Kets de Vries rääkis ettevõtete juhtidele, kuidas jõuda oma karjääris selgusele iseenda soovides. Kommenteerivad Valdur Laid ja Rait Hiiepuu

  19. Kunst eluetenduste inspireerijana / Raivo Kelomees

    Index Scriptorium Estoniae

    Kelomees, Raivo, 1960-

    2005-01-01

    Kunstnikuetenduste põhilised tundemärgid. Inglise kirjaniku John Fowlesi novellist "Eebenipuust torn" ja selle põhjal tehtud lavastusest. Novellile sarnaselt käitusid Valdur Ohakas ja tema kaks kaaslast 1980. aastate alguses Kütioru talus

  20. Eesti ettevõtjad käivad nappide maavaradega pillavalt ümber / Norbert Kaareste

    Index Scriptorium Estoniae

    Kaareste, Norbert

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke 3. sept. lk. 3. Eesti Geoloogide Seltsi presidendi Alvar Soesoo hinnangul kummitab maapõuerikkuste ammendumise oht just killustikutootmist, põlevkivi ja turbaga pole olukord nii kriitiline, suurtes kogustes leidub vaid fosforiiti ja mustkilda. Eesti Looduskaitse Seltsi esimehe Juhan Telgmaa arvamus. Kommenteerib Valdur Lahtvee. Lisa: Eesti tähtsamatele maavaradele terendab erinev tulevik

  1. E-Talu = E-Farm

    Index Scriptorium Estoniae

    2002-01-01

    Harjumaal Viimsi vallas 2002. a. valminud eramus on ühendatud elamine ja programmeerimisega tegeleva perefirma vajadused. Projekteerija arhitektibüroo Kolm Pluss Üks. Arhitektid Markus Kaasik, Andres Ojari, Indrek Tiigi, Ilmar Valdur. Konstruktor Tõnu Peipman. Diagrammiarhitektuur. Projekt 2001. 9 ill.: põhiplaan, välis- ja sisevaated

  2. Pärnu keskraamatukogu arhitektuurse lahenduse võistlus

    Index Scriptorium Estoniae

    1999-01-01

    Tulemused: I preemia ئ Markus Kaasik, Kalle Komissarov, Andres Ojari, Mihkel Tüür, Ilmar Valdur; II ئ Andres Siim, Kristel Ausing, assistent Jan Skolimovski; III ئ Inga Raukas, Tarmo Teedumäe, Toomas Tammis. Ostupreemiad. Võistlustööd on arhitektuurimuuseumi galeriis 25. juulini.

  3. A-, B- ja C-kingades üle salamandrite / Kalev Vapper

    Index Scriptorium Estoniae

    Vapper, Kalev, 1982-

    2010-01-01

    Fotonäitus "Riburajad" Y-galeriis Tartus 5. oktoobrist 17. oktoobrini 2009, kuraator Peeter Laurits. Näitusel eksponeeritud fotode read tekkisid järk-järgult pildivahetuse käigus Tartu Kõrgema Kunstikooli endiste ja praeguste tudengite vahel. Loetletud osalejad, lähemalt Valdur Mikita tekstidest

  4. Eesti käibemiljardärid suuri numbreid ei tähtsusta / Margit Aedla

    Index Scriptorium Estoniae

    Aedla, Margit, 1970-

    2004-01-01

    Merko Ehituse nõukogu liige Ott Kikkas, Silberauto juhatuse esimees Väino Kaldoja ja Elion Ettevõtted AS-i juhatuse esimees Valdur Laid analüüsivad oma ettevõtte edukuse põhjuseid. Tabel: Eestis on 21 käibemiljardäri. Lisa: Edukate valem. Vt. samas: Vabas turukonkurentsis edukaid on vähe

  5. Uusi raamatuid / Lauri Eesmaa

    Index Scriptorium Estoniae

    Eesmaa, Lauri

    2011-01-01

    Tutvustus: Miłosz, Czesław. Miłoszi ABC / tõlkinud Hendrik Lindepuu. Tartu : H. Lindepuu, 2011. Tasuja, Triin. Armastust on ja armastust pole. Pärnu : Jumalikud Ilmutused, 2011. Mikita, Valdur. Teoreem. Tartu : HM, 2011

  6. Modernse arhitektuuri ja okupatsioonimuuseumi liit / Ene Läkk

    Index Scriptorium Estoniae

    Läkk, Ene, 1957-

    2001-01-01

    Okupatsioonimuuseumi ideest ja teostamisest. Avaliku arhitektuurivõistluse "Lähimineviku okupatsioonide muuseum" võitjad: I preemia: Indrek Peil, Siiri Vallner, II preemia Tiina Teng, Peeter Loo, III preemia Reio Avaste (AS Arhitektuuribüroo Eek & Mutso), ostupreemia: Margus (?) Kaasik, Kalle Komissarov, Andres Ojari, Indrek Tiigi, Ilmar Valdur (Arhitektuuribüroo Kolm Pluss Üks OÜ), ostupreemia: Andres Kask

  7. E-piima Põltsamaa Meierei juustumuuseum = E-Piim Põltsamaa Dairy Cheese Museum

    Index Scriptorium Estoniae

    2004-01-01

    Pealeehitus tootmishoonele. Juustutööstust eksponeeritakse läbi laeakende ning multimeedia ja graafiliste vahendite abil seintel ja kaldtasandil. Projekteerija: 3+1 arhitektid. Autorid Markus Kaasik, Kalle Komissarov, Andres Ojari, Ilmar Valdur. Konstruktor Tõnu Peipmann. Projekt 2001. 11 ill

  8. Строительство АЭС: риск неуместен / Татьяна Меркулова

    Index Scriptorium Estoniae

    Меркулова, Татьяна

    2011-01-01

    Reformierakond ning Isamaa ja Res Publica Liit leppisid kokku, et jätkatakse Eestisse tuumaelektrijaama rajamisega seotud uuringuid. 2012. aastal plaanib valitsus otsustada, kas Eestisse tuleb tuumaelektrijaam või mitte. Hanon Barabaner ja riigikogu liige Valdur Lahtvee on tuumaelektrijaama rajamise vastu. Ettevõtjate arvamusi

  9. Alates 13. XII on Vaala galeriis avatud "Talvesalong"

    Index Scriptorium Estoniae

    2004-01-01

    Väljas on Ellinor Aiki, Valdur Ohaka, Herman Talviku, Jaak Arro, Raoul Kurvitza, Andres Toltsi, Laurentsiuse, Lembit Saartsi, Rait Rosina, Merike Estna, Maarit Murka ning Aleksandr Breneri ja Barbara Schurzi tööd. 17. XII Anna Litvinova, Ilmar Kruusamäe ja Lembit Sarapuu ühised maaliseansid

  10. Jalutades Koidula tänava aias = A walk on the grounds of the Koidula building / Veronique Faucheur

    Index Scriptorium Estoniae

    Faucheur, Veronique

    2006-01-01

    Aed Tallinnas Koidula tänava korterelamu siseõues. Elamu projekteeris AB Kolm Pluss Üks. Autorid: Markus Kaasik, Andres Ojari, Ilmar Valdur. Aia projekt: atelier le balto. Aia autorid: Veronique Faucheur, Marc Pouzol. Projekt 2005, valmis 2006. Ill.: aia plaan, 6 vaadet

  11. Vikergallup : eesti kirjandus 2013 / Vahur Afanasjev, Joanna Ellmann, Peeter Helme ... [jt.

    Index Scriptorium Estoniae

    2014-01-01

    Kriitikute arvamus 2013. aastal Eestis ilmunud nüüdiskirjandusest. Aasta parimaks uudisteoseks nimetati Valdur Mikita "Lingvistiline mets", parimaks debüüdiks Sveta Grigorjeva luulekogu "Kes kardab Sveta Grigorjevat?", parima tõlkeraamatuna tõsteti esile Michel Houellebeqi romaan "Kaart ja territoorium" ning Andrei Ivanovi romaan "Harbini ööliblikad"

  12. Silmapaistvaid metsateadlasi Tallinnas 20. sajandi esimesel poolel / Malev Margus

    Index Scriptorium Estoniae

    Margus, Malev, 1923-2014

    1996-01-01

    Julius Kitsing; Jaan Hellat; Aleksander Pals; Arnold Merihein; Voldemar Mathiesen; Bernhard Tuskvere; Kaljo Sotter; Vassili Mutt, Jaan Luik; Aleksander Raukas; Valdur Küng; Nikolai Küttis; Viktor Obet; Jakob Visnapuu; Karl Keerdoja; Edgar Vester. Lühiandmeid. Kokkuv. ingl. k.

  13. Rannikuprojekt arhitektuurimuuseumis

    Index Scriptorium Estoniae

    1998-01-01

    1. aprillist Rotermanni soolalaos rahvusvahelise "Coast Wise Europe" projekti raames näitus "CWEESTI" Rotterdami Arhitektuuri Akadeemia algatatud rahvusvahelisest projektist "Coast Wise Europe", mis keskendub Euroopa ranniku probleemidele ja turismi fenomeni uurimisele. Projekti teemast, eesmärgist, osalejatest, Eesti Kunstiakadeemia arhitektuuri teaduskonna osalemisest projektis. CWE atlase Eesti peatüki koostamist juhendasid I. Raukas, I. Valdur, M. Kaasik.

  14. Fondijuhid jäid Heleniuse isule alla / Martin Hanson

    Index Scriptorium Estoniae

    Hanson, Martin, 1984-

    2007-01-01

    Varahaldusosakonna viis võtmetöötajat - juht Kristel Kivinurm-Priisalm, investeeringute juhid Toomas Reisenbuk ja Aadu Oja, fondijuht Valdur Jaht ja finantsjuht Kadri Haldre lahkusid Trigon Capitalist kuna nende tulevikunägemus erines omaniku Joakim Heleniuse omast. Diagrammid: Trigoni fondide näitajad. Vt. samas: Trigoni uus meeskond juba määratud

  15. Eesti Lähimineviku Okupatsioonide Muuseumi arhitektuurivõistlus : okupatsiooni igaveseks jäädvustamiseks = Architectural Competition of the Museum of Recent Past Occupations in Estonia : for Eternal Remembrance of the Occupation / Leonhard Lapin

    Index Scriptorium Estoniae

    Lapin, Leonhard, 1947-

    2001-01-01

    Zürii koosseis, võistlusest, võidutööst. Preemiad: I - Indrek Peil, Siiri Vallner; II - Tiina Teng, Peeter Loo; III - Reio Avaste; ostud - Andres Kask ning Markus Kaasik, Kalle Komissarov, Andres Ojari, Indrek Tiigi ja Ilmar Valdur. 5 ill.

  16. Olge mõnusad ja kinnitage turvavöö : ehk Kirjanduslikud visiitkaardid / Pille-Riin Larm

    Index Scriptorium Estoniae

    Larm, Pille-Riin, 1981-

    2017-01-01

    Erinevatest trükistest, mida poest ei leia: ajakiri "ELM", festivali HeadRead kogumik "Lõpmatuse lävel", festivali Prima Vista kogumik "Metsik Sõna", Eesti Instituudi kogumik "Nippernaati", Jaan Malini koostatud kogumik "Pilt ja sõna" ja Valdur Mikita "Tartu tähestik"

  17. On Zweier Sequence Spaces and de la Vall\\'{e}e-Poussin mean of order $\\alpha$

    Directory of Open Access Journals (Sweden)

    Bipan Hazarika

    2016-07-01

    Full Text Available The main purpose of this paper is to study some geometrical properties such as order continuous, the Fatou property and the Banach-Saks property of the new space $[\\mathcal{Z}_{\\lambda}^{\\alpha}]_{\\infty}(p.$

  18. Mõte matemaatikast tekitas mõtteid / Aavo Lind

    Index Scriptorium Estoniae

    Lind, Aavo, 1933-

    2009-01-01

    Kriitilisest suhtumisest koolimatemaatikasse, selle lihtsustamise ohtlikkusest tehnilisele haridusele ja murest õpilaste kahanevatest teadmistest matemaatikas. Vastukaja artiklile: Saks, Malle. [Keerukad matemaatikatekstid] : mõte. Õpetajate Leht (2009) 30. jaan., lk. 4

  19. Eesti graafikute edu Hispaanias

    Index Scriptorium Estoniae

    1999-01-01

    Hispaanias Orenses toimunud V rahvusvahelisel graafikabiennaalil (dets. 1998/jaan. 1999) pälvisid kiituse koos rahalise preemiaga Reti Saks, Vive Tolli, Benjamin Vasserman. Julio Prieto Naspereira auhinna žüriilt I preemia Tamoya Uchidale Jaapanist

  20. Graafika Filharmoonias : Harry Liivrand soovitab / Harry Liivrand

    Index Scriptorium Estoniae

    Liivrand, Harry, 1961-

    2004-01-01

    Alustatakse regulaarse kunstinäituse programmiga Estonia Kontserdisaalis. Avatakse graafikanäitus "Lähenemised" (koostaja Vappu Vabar). Osalevad Marje Üksine, Reti Saks, Maria-Kristiina Ulas, Kelli Kagovere, Naima Neidre jt

  1. 27 CFR 25.53 - Submissions of samples of fermented products.

    Science.gov (United States)

    2010-04-01

    ... TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS BEER Miscellaneous Provisions Samples § 25.53...) Materials used in the production of cereal beverage, saké, or any fermented product; and (c) Cereal beverage...

  2. International conference "Cultural Plurality in Estonia : Policies and Solutions"

    Index Scriptorium Estoniae

    2000-01-01

    Ettekandjad: Katrin Saks, Mall Hellam, Mati Luik, Kirsti Häkkinen, Vello Pettai, Ivi Proos, Katri Raik, NiinaOrhimenko, Ib Ostergaard Rasmussen, Urve Läänemets, Jüri Valge, Aleksander Dusman, Raivo Juurak, Rein Ruutsoo

  3. Kolm kiitust eesti graafikale / Annika Koppel

    Index Scriptorium Estoniae

    Koppel, Annika

    1999-01-01

    Graafik Benjamin Vassermanni loomingust, näitustest ja saadud auhindadest. Rahvusvahelisel Orense graafikabiennaalil 1998. a. said kolm eesti graafikut (B. Vassermann, V. Tolli, R. Saks) kiituse osaliseks. B. Vassermannilt oli töö 'Kaalutlus'

  4. Reval Hotel Lietuva Vilniuses : Konstitucijos pr. 20 / Piret Lindpere

    Index Scriptorium Estoniae

    Lindpere, Piret, 1963-

    2004-01-01

    Vilniuse hotelli "Lietuva" renoveerimine. Arhitektuurse projekti koostaja Rootsi arhitektuuribüroo AB SWECO (arhitektid Aare Saks, Nils Palm. Sisekujundus: Vaikla Disain AS (Katrin ja Argo Vaikla, Liis Lindvere, Peeter Loo). Kommenteerivad Argo ja Katrin Vaikla. 3 ill

  5. Sexuality: A Neglected Component of Child Sexual Abuse Education and Training.

    Science.gov (United States)

    Gillman, Ruth; Whitlock, Katherine

    1989-01-01

    A rationale, specific content, and teaching methodologies are suggested for the integration of sexuality content in the preparation of child welfare workers concerned with the prevention, intervention, and treatment of child sexual abuse. (SAK)

  6. Eduard Odinets : "Olen eestlane, kelle emakeel on vene keel" / Eduard Odinets ; interv. Erik Kalda

    Index Scriptorium Estoniae

    Odinets, Eduard, 1976-

    2006-01-01

    Ilmunud ka: Severnoje Poberezhje Ilmunud ka: Severnoje Poberezhje : Subbota 3. juuni lk. 3. Riigikogu sotsiaaldemokraatide fraktsiooni nõunik oma poliitikukarjäärist. Arvamust avaldab Katrin Saks ja Meelis Goldberg (Severnoje Pob.)

  7. [Effect of long-term shallow tillage and straw returning on soil potassium content and stratification ratio in winter wheat/summer maize rotation system in Guanzhong Plain, Northwest China].

    Science.gov (United States)

    Shi, Jiang-lan; Li, Xiu-shuang; Wang, Shu-juan; Li, Shuo; Li, You-bing; Tian, Xiao-hong

    2015-11-01

    Soil stratified sampling method and potassium chemical fractionation analysis were used to investigate effects of long-term shallow tillage and straw returning on soil K contents and stratification ratios in winter wheat/summer maize rotation system in Guanzhong Plain of Northwest China. The results showed that after 13-year continuous shallow tillage and straw returning, surface accumulation and stratification effect obviously occurred for soil available K (SAK) and non-exchangeable K (NEK), which was particularly remarkable for SAK and its fractions. Serious depletion of SAK occurred in 15-30 cm soil layer, and the SAK value was lower than the critical value of soil potassium deficiency. Meanwhile, significant differences were found between SR1 and SR2 values of SAK and its fractions, SR was obtained by values of topsoil layer (0-5 cm) divided by corresponding values of lower soil layers (5-15 cm layer, SR1, or 15-30 cm layer, SR2). However, no significant difference was observed between SR values of NEK and mineral K. In conclusion, returning of all straw over 10 years in the winter wheat/summer maize rotation system contributed greatly to maintaining soil K pool balance, while special attention should be paid to the negative effects of surface accumulation and stratification of SAK on soil K fertility.

  8. Sea Anemone Toxins Affecting Potassium Channels

    Science.gov (United States)

    Diochot, Sylvie; Lazdunski, Michel

    The great diversity of K+ channels and their wide distribution in many tissues are associated with important functions in cardiac and neuronal excitability that are now better understood thanks to the discovery of animal toxins. During the past few decades, sea anemones have provided a variety of toxins acting on voltage-sensitive sodium and, more recently, potassium channels. Currently there are three major structural groups of sea anemone K+ channel (SAK) toxins that have been characterized. Radioligand binding and electrophysiological experiments revealed that each group contains peptides displaying selective activities for different subfamilies of K+ channels. Short (35-37 amino acids) peptides in the group I display pore blocking effects on Kv1 channels. Molecular interactions of SAK-I toxins, important for activity and binding on Kv1 channels, implicate a spot of three conserved amino acid residues (Ser, Lys, Tyr) surrounded by other less conserved residues. Long (58-59 amino acids) SAK-II peptides display both enzymatic and K+ channel inhibitory activities. Medium size (42-43 amino acid) SAK-III peptides are gating modifiers which interact either with cardiac HERG or Kv3 channels by altering their voltage-dependent properties. SAK-III toxins bind to the S3C region in the outer vestibule of Kv channels. Sea anemones have proven to be a rich source of pharmacological tools, and some of the SAK toxins are now useful drugs for the diagnosis and treatment of autoimmune diseases.

  9. Exome sequencing identifies a TCF4 mutation in a Chinese pedigree with symmetrical acral keratoderma.

    Science.gov (United States)

    Chen, P; Sun, S; Zeng, K; Li, C; Wen, J; Liang, J; Tian, X; Jiang, Y; Zhang, J; Zhang, S; Han, K; Han, C; Zhang, X

    2017-09-18

    Symmetrical acral keratoderma (SAK) is a rare skin disorder and its pathogenesis and inheritability are unknown. To investigate the inheritance and pathogenesis of SAK. Four SAK cases occurred in a four-generation Chinese family. Exome sequencing identified SNPs with potential SAK-related mutations, and a potentially responsible gene transcription factor 4 (TCF4) was identified. TCF4 was then sequenced in all 11 family members, and pedigree analysis was performed. Histopathology and immunohistochemistry evaluated TCF4 expression in skin lesions. The gene mutation was investigated in human keratinocytes for keratin-related protein expression. A novel heterozygous missense mutation, c.85C>A (p.Pro29Thr) was found in TCF4. The mutation showed autosomal dominant inheritance and perfectly cosegregated with the SAK phenotype in all family members. In skin lesions, TCF4 was present in the cytoplasm and membranes of the basal layer, the stratum spinosum and the stratum granulosum of the epidermis. The mutant TCF4 induced overexpression of differentiation markers including KRT1, KRT14, loricrin and involucrin. A SAK-related gene mutation in TCF4 may function through transcriptional regulation of keratin. © 2017 European Academy of Dermatology and Venereology.

  10. Use of Structural Assessment of Knowledge for Outcomes Assessment in the Neuroscience Classroom.

    Science.gov (United States)

    Stevenson, Jennifer L; Shah, Samir; Bish, Joel P

    2016-01-01

    Outcomes assessment of undergraduate neuroscience curricula should assess the ability to think integratively about basic neuroscience concepts based on two of the core competencies established by the Faculty for Undergraduate Neuroscience. The current study investigated whether the structural assessment of knowledge (SAK) approach, which evaluates the organization of an individual's knowledge structures, is effective for demonstrating learning of basic neuroscience concepts. Students in an introductory psychology course (n = 29), an introductory neuroscience course (n = 19), or an advanced behavioral neuroscience course (n = 15) completed SAK before and after learning gross brain anatomy and neuronal physiology. All students showed improvements in their SAK after short-term dissemination for gross brain anatomy, but not for neuronal physiology, concepts. Therefore, research is needed to determine whether the effectiveness of SAK in outcomes assessment depends on the content or teaching style. Additional research using SAK should also explore effectiveness for learning over longer time frames and correlations with student performance in the course. However, the results suggest SAK is a promising technique for outcomes assessment of undergraduate neuroscience curricula.

  11. 1998. aasta surnud maailmas ja Eestis

    Index Scriptorium Estoniae

    1998-01-01

    1998. a. surnud kunstiinimesed maailmas: Georg Eisler (14. jaan.), Linda McCartney (17. apr.), Tazio Secchiaroli (24. juuli), Bruno Munari (29. sept.), Roger Vivier (2. okt.), César Baldaccini (6. dets.); Eestis: Valdur Ohakas (16. veebr), Amanda Tõnisson (24. märts), Gustav Ränk (5. apr.), Ella Rajari (25. apr.), Vello Lõugas (21. mai), Uno Kärbis (29. juuli), Hugo Mitt (14. sept), Johannes Uiga (23. okt.), Maimu Vannas (24. okt.), Hillar Jaanus (22. nov.)

  12. Kolmas aed = The Third Garden / Martin Melioranski

    Index Scriptorium Estoniae

    Melioranski, Martin

    2006-01-01

    Aed ja eramu Meriväljal Viimsi ja Väina tee nurgal. Projekt: Arhitektuuriagentuur. Autorid: Inga Raukas, Toomas Tammis, Tarmo Teedumäe. Haljastuse konsultant Signe Peipman. Projekt 2005, valmis 2006. Aed ja eramu Naeri tänaval. Projekt: Kolm Pluss Üks Arhitektid. Autorid: Markus Kaasik, Andres Ojari, Ilmar Valdur, Merje Müürsepp, Kalle Komissarov (2002). Projekt 2002-2004, valmis 2005. Ill.: kaks plaani, 6 värv. vaadet

  13. Žürii kommenteerib Kultuurkapitali arhitektuuripreemiaid 2008 / Marika Lõoke, Laila Põdra, Liina Jänes... [jt.

    Index Scriptorium Estoniae

    2009-01-01

    Peapreemia: Markus Kaasik, Andres Ojari, Ilmar Valdur, Mihkel Tüür, Kalle Komissarov (Pärnu Keskraamatukogu hoone), tegevuspreemia: Maarja Kask, Ralf Lõoke, Neeme Külm, Ingrid Ruudi (projekt Gaasitoru 11. Veneetsia arhitektuuribiennaalil), aastapreemia: Maarja Kask, Ralf Lõoke, Karli Luik (Tartu Kesklinna Kooli juurdeehitus) ja Peep Jänes (Raudna Põhikooli spordihoone), sisearhitektuuri preemia: Tea Tammelaan, Malle Jürgenson, Krista Lepland, restaureerimispreemia: Mari Hammer, Tiiu Lõhmus, Helve Ilves, Villu Kadakas (Vanalinna Hariduskolleegiumi hoone)

  14. ...ja valgus sai / Piret Veigel

    Index Scriptorium Estoniae

    Veigel, Piret, 1961-

    2004-01-01

    Arhitektuuribüroo 3+1 arhitektide Merje Müürisepa, Ilmar Valduri, Markus Kaasiku, Kalle Komissarovi, Indrek Tiigi ja Andres Ojari projekteeritud eramust. Välisviimistluses on kasutatud okaspuulauda. Sisekujunduses on põhitoon valge. Elutoas on klaaskamin, esikut eraldavad elutoast metallraamil kangast lükandseinad jm. A. Ojari ja I. Valdur hoone arhitektuursest lahendusest. Ill.: I ja II korruse plaan, 1 välis- ja 11 sisevaadet.

  15. Eesti arhitektuur trügis maailmakaardile / Tiina Kolk

    Index Scriptorium Estoniae

    Kolk, Tiina

    2004-01-01

    Neli eesti arhitektide projekteeritud hoonet on pääsenud kunstikirjastuse Phaidon raamatusse "The Phaidon Atlas of Contemporary World Architecture": Indrek Allmanni paariselamu Luccas, Martin Aunini eramu Orro Tabasalus, Indrek Näki Neiseri tööstushoone ja büroo 3+1 arhitektide Villa V. 3+1 arhitektid Markus Kaasik, Andres Ojari, Ilmar Valdur ja Inga Raukas esindavad ka Leedumaad Eesti saatkonnahoonega Vilniuses. 4 ill

  16. Exploring New Command and Control Concepts and Capabilities (Exploration de Nouveaux Concepts de Commandement et Controle et de Leurs Capacites)

    Science.gov (United States)

    2007-04-01

    Germany Mr. Geir Enemo NO FFI Mr. Fernando Freire PO Academia Militar Dr. Anne-Marie Grisogono Australia DSTO Dr. Richard Hayes US EBR Dr. Gary...IABG Mr. Arne Norlander SE Swedish Defense Research Agency Maj. Paulo Nunes PO Academia Militar Dr. Paul Phister US AFRL Mr. Valdur Pille CA DRDC...Reiner Huber GE IT IS Universitiat der Bundeswehr Ms. Danielle Martin US EBR Mr. Graham Mathieson UK DSTL Dr. James Moffat UK DSTL Maj. Paulo Nunes PO

  17. Eesti Vilniuse saatkonnahoone õhkab kargust

    Index Scriptorium Estoniae

    1998-01-01

    Eesti Vabariigi 80. aastapäevaks valminud Eesti saatkonnahoonest Vilniuses (Vilnius Zverynase raj. Mickeviciuse 4), kuhu on mahutatud saatkond, konsulaat, vastuvõtusaal, suursaadiku residents, külaliskorter; arhitektid Markus Kaasik, Andres Ojari, Inga Raukas, Ilmar Valdur (AS Kolm Pluss Üks), sisekujundus: AS Kolm Pluss Üks ja OÜ GS-DIS, peatöövõtja Merko Ehituse AS.

  18. Expression of recombinant staphylokinase in the methylotrophic yeast Hansenula polymorpha

    Directory of Open Access Journals (Sweden)

    Moussa Manal

    2012-12-01

    Full Text Available Abstract Background Currently, the two most commonly used fibrinolytic agents in thrombolytic therapy are recombinant tissue plasminogen activator (rt-PA and streptokinase (SK. Whereas SK has the advantage of substantially lower costs when compared to other agents, it is less effective than either rt-PA or related variants, has significant allergenic potential, lacks fibrin selectivity and causes transient hypotensive effects in high dosing schedules. Therefore, development of an alternative fibrinolytic agent having superior efficacy to SK, approaching that of rt-PA, together with a similar or enhanced safety profile and advantageous cost-benefit ratio, would be of substantial importance. Pre-clinical data suggest that the novel fibrinolytic recombinant staphylokinase (rSAK, or related rSAK variants, could be candidates for such development. However, since an efficient expression system for rSAK is still lacking, it has not yet been fully developed or evaluated for clinical purposes. This study’s goal was development of an efficient fermentation process for the production of a modified, non-glycosylated, biologically active rSAK, namely rSAK-2, using the well-established single cell yeast Hansenula polymorpha expression system. Results The development of an efficient large scale (80 L Hansenula polymorpha fermentation process of short duration for rSAK-2 production is described. It evolved from an initial 1mL HTP methodology by successive scale-up over almost 5 orders of magnitude and improvement steps, including the optimization of critical process parameters (e.g. temperature, pH, feeding strategy, medium composition, etc.. Potential glycosylation of rSAK-2 was successfully suppressed through amino acid substitution within its only N-acetyl glycosylation motif. Expression at high yields (≥ 1g rSAK-2/L cell culture broth of biologically active rSAK-2 of expected molecular weight was achieved. Conclusion The optimized production process

  19. Effects of recombinant staphylokinase on coronary thrombosis in Chinese experimental miniature swine.

    Science.gov (United States)

    Liu, Jian-Xun; Shang, Xiao-Hong; Fu, Jian-Hua; Li, Xin-Zhi; Wang, Gang

    2002-06-01

    To study the effects of recombinant staphylokinase (r-Sak) on coronary thrombosis, cardiac ischemia, and myocardial infarction in Chinese experimental miniature swine. Endarterium was injuried and coronary thrombi were formed gradually through direct electrical stimulation on the coronary artery of Chinese experimental miniature swine. Effects of r-Sak in vitro were studied through coronary pathological section, microkinematography, multi media graphic analysis, epicardial electrogram mapping, myocardium histo chemical stain, serum creatine phosphokinase (CPK), and hemorheology. r-Sak showed a remarkable effect on coronary thrombus. Compared w ith the control group, the two dosage groups, r-Sak 0.45 mg/kg and 1.35 mg/kg, reduced the transverse section area of coronary thrombus (P<0.01), lessened the degree and range of cardiac ischemia (P<0.01), decreased the myocardial infarction area (P<0.01), the activity of CPK and blood viscosity (P<0.05), restrained platelet adhesion and aggregation, and reduced fibrinogen concentration (P<0.05). r-Sak could dissolve coronary thrombus obviously and lessen the pathologic reaction of myocardium.

  20. Statistical Modeling of the Case Information From the Ohio Attorney General's Sexual Assault Kit Testing Initiative.

    Science.gov (United States)

    Kerka, Jaimie E; Heckman, Derek J; Albert, James H; Sprague, Jon E; Maddox, Lewis O

    2017-11-29

    The Ohio Attorney General's Sexual Assault Kit (SAK) Testing Initiative has resulted in nearly 14,000 kits being processed since the initiation of the project in 2012. A logistic regression model was fit to the data from 2500 SAKs in order to determine the probability of obtaining at least one Combined DNA Index System (CODIS) eligible DNA profile based on a number of predictor variables. The probability of obtaining at least one CODIS eligible DNA profile from an SAK varied as a function of (i) days to kit collection following a sexual assault; (ii) years to kit submission to the laboratory for testing following kit collection; (iii) the age of the victim; and (iv) the occurrence of victim-reported consensual sex around the time of the assault and/or kit collection. These findings demonstrate the utility of the statistical modeling of data obtained from the "forklift" testing approach of sexual assault kits. © 2017 American Academy of Forensic Sciences.

  1. How Structural Assessment of Knowledge can be used for the identification of specific alternative conceptions and for assessing domain competence in Physics

    Science.gov (United States)

    Sharara, Harold

    The purpose of this study is to investigate the viability of Structural Assessment of Knowledge (SAK) as a tool for identifying alternative conceptions and for predicting domain performance in Physics. The process begins by eliciting and then representing students' knowledge. One of these types of knowledge is conceptual knowledge, which is important for performing procedural tasks. This thesis employs a cognitively based theoretical framework to uncover students' knowledge, and then represents that knowledge for analytical purposes using SAK. SAK uses the Pathfinder algorithm to empirically derive the semantic networks of the students' and experts' cognitive structures, by asking them both to rate the relatedness of pairs of physics terms. Comparing students' and experts' knowledge structures provided some support for the structural assessment theory. In particular, supporting evidence that Pathfinder networks help in predicting student's problem solving capabilities was attained.

  2. PENGARUH PENERAPAN STANDAR AKUNTANSI KEUANGAN ENTITAS TANPA AKUNTABILITAS PUBLIK TERHADAP KUALITAS LAPORAN KEUANGAN

    Directory of Open Access Journals (Sweden)

    Silviana Agustami

    2017-05-01

    Full Text Available This study aims to (1 determine the implementation of SAK ETAP at BPR in the Bandung city (2 determine the quality of the financial reports of BPR in the Bandung city, and (3 determine the effect of the implementation of SAK ETAP to quality financial reports on BPR in Bandung city. In this study, researchers used primary data for variable implementation of SAK ETAP and the quality of financial reporting through questionnaires distributed to 11 BPR in the Bandung city. The method used in this research is descriptive method verikatif. The statistical analysis tools in this study using Spearman rank correlation to determine the direction and strength of the relationship between the two variables, while the coefficient of determination is used to determine the ability of the independent variable (X in influencing the dependent variable (Y. These results indicate (1 the implementation of SAK ETAP at BPR in the Bandung city in general has been implemented adequately (2 BPR in the Bandung city has been preparing and presenting the financial statements sufficient to satisfy the elements of relevant, reliable, able to comparable, and understandable (3 the implementation of SAK ETAP moderate effect on the quality of the financial reports of BPR in the Bandung city, amounting to 0.587. Based on the calculation of the coefficient of determination SAK ETAP implementation contribute to or influence by 34.5%% of the quality of financial reporting at BPR in the Bandung city, while the remaining 65.5% was contributed by other factors not examined

  3. Mida erakonnad tallinlasele pakuvad?

    Index Scriptorium Estoniae

    2002-01-01

    Valimisdebatt: Tallinna elanikkond väheneb ja vananeb. Kuidas seda pidurdada, kui palju on Tallinnas elanikke 20 aasta pärast. Oma nägemuse esitavad Allan Alaküla, Aimar Altosaar, Anatoli Jegorov, Maret Maripuu, Tõnis Palts, Katrin Saks, Ene Tomberg. Autor: Keskerakond (A. Alaküla). Autor: Isamaaliit (A. Altosaar). Autor: EÜRP (A. Jegorov). Autor: Reformierakond (M. Maripuu). Autor: Res Publica (T. Palts). Autor: Rahvaerakond Mõõdukad (K. Saks). Autor: ERL (E. Tomberg). Parlamendisaadik (M. Maripuu, A. Altosaar)

  4. Eesti Vabariigi Vilniuse Suursaatkond. Mickeviciaua 4A, Vilnius / Markus Kaasik, Andres Ojari, Inga Raukas...[jt.

    Index Scriptorium Estoniae

    1998-01-01

    Hoones esindus, büroo ja elumaja. Hoone koosneb tänavaäärsest kolme- ja poolekorruselisest osast ning krundi sisse nihutatud saali ja selle all asuvast majandus- ning olmeruumidest. Tänava ääres terassaed, selle taga majandushoov. Hoonel on 7 poolkorrust, tänavapoolne sinakaks peitsitud Ungru paeplaatidest fassaad ja riputatud roheline täisklaasfassaad. Projekteerija: Kolm Pluss Üks arhitektid M. Kaasik, A. Ojari, I. Raukas, I. Valdur. Sisekujundus: lisaks projekteerijatele GS-DIS: S. Stokas, G. Stokas. Konstruktiivne osa: Estkonsult. Ehituse peatöövõtt: Merko Ehitus AS. Projekt 1996-1997, valmis 1998.

  5. Villa ajalooline interjöör tõi sisearhitektidele kaks preemiat / Anneli Aasmäe

    Index Scriptorium Estoniae

    Aasmäe, Anneli, 1973-

    2004-01-01

    Villa Tannenrode 19. saj. inglise stiilis sisekujunduse autorid Leila Pärtelpoeg ja Karl-Erik Tarbe said Eesti Sisearhitektide Liidu aastapreemia, ajaloolise interjööri preemia ja kodu preemia. Ühiskondliku hoone interjööri preemia Mustamäe Kaubanduskeskuse arhitektidele (Markus Kaasik, Andres Ojari, Ilmar Valdur, Ralf Lõoke ja Kalle Komissarov). Publitsistikapreemia Eesti Kunstiakadeemia raamatule "EKA sisearhitektuur 2002-2003". Ära märgiti Külli Salumi kujundatud numbritoad hotellis "Kolm õde" ja Jan J. Grapsi mööblisari "Incognito". Teisi preemiaid

  6. Uued agulimajad = New Suburb Houses / Andri Ksenofontov

    Index Scriptorium Estoniae

    Ksenofontov, Andri, 1962-

    2005-01-01

    Tallinna ajalooliste eeslinnade teke ja kujunemine. Agulite olukord tänapäeval ja haldus viimastel aastatel. Büroo 3+1 projekteeritud ühepereelamu Magasini kvartalis (arhitektid Andres Ojari, Markus Kaasik, Ilmar Valdur, Merje Müürisepp, Kalle Komissarov). Neljakorruseline elamu Õle t. 23/Härjapea t. 14, ühtlasi arhitektide Madis Eegi ja Margit Mutso kodu. Gert Sarve projekteeritud kahepereelamu Herne t. 9. KOKO arhitektide Raivo Kotovi ja Tõnis Kimmeli projekteeritud korterelamu Vabriku t. 33. Ill.: 12 plaani, 14 värv. vaadet

  7. Cloning, high-level expression, purification and characterization of a ...

    African Journals Online (AJOL)

    Yomi

    African Journal of Biotechnology Vol. 11(22), pp. 5995-6003, 15 March, 2012. Available online at ... streptokinase for the dissolution of whole blood or plasma clots, but significantly more potent for the dissolution of platelet-rich or retracted thrombi (Schlott et al., 1994a). In addition, Sak specifically induces fibrinolysis without.

  8. Macroscopic modelling of solid-state fermentation

    NARCIS (Netherlands)

    Hoogschagen, M.J.

    2007-01-01

    Solid-state fermentation is different from the more well known process of liquid fermentation because no free flowing water is present. The technique is primarily used in Asia. Well-known products are the foods tempe, soy sauce and saké. In industrial solid-state fermentation, the substrate usually

  9. AcEST: BP911482 [AcEST

    Lifescience Database Archive (English)

    Full Text Available . 39 0.016 sp|A5X7A0|SOBPA_DANRE Sine oculis-binding protein homolog OS=Dan... 39 0.021 sp|P48383|SAK1_SCHPO...AATPKPDASPAPGSNTTTPTGIVSTPT 846 >sp|A5X7A0|SOBPA_DANRE Sine oculis-binding protein homolog OS=Danio rerio GN

  10. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 310 ... Vol 10, No 1 (2015), Cardiac autonomic control in the obstructive sleep apnea, Abstract PDF. N Gammoudi, RB Cheikh, MA Saafi, G Sakly, M Dogui. Vol 3, No 1 (2008), Care for People with Diabetes during The Moslem Pilgrimage (Haj): An Overview, Abstract. S.A. Beshyah, I.H. Sherif. Vol 2, No 2 (2007) ...

  11. Providing Base Line Data for the Treatment of Mauritian Sugar ...

    African Journals Online (AJOL)

    cistvr

    their medium to high strength wastewater so that they can comply with the existing environmental law. Since sugar cane factory effluent has been characterised as a non-toxic organic source of pollution (Wong Sak Hoi, 1994), a biological treatment system is desirable. The conventional aerobic wastewater treatment method ...

  12. Büroohoone rekonstruktsioon : [Hansapank, Liivalaia 12, Tallinn

    Index Scriptorium Estoniae

    1999-01-01

    Endise "EKE Projekti" hoone rekonstruktsioon pangahooneks. Projekteerija Arhitektuuristuudio Siim & Kreis. Arhitektid Andres Siim, Kristel Ausing, kaasa töötanud Jan Skolimowski, Kätlin Saks. Sisekujundus Argo ja Katrin Vaikla. Konstruktiivne osa: A-Grupp. Ehitaja: Eesti Ehitus. Projekt 1997-98, valmis 1999. 9 illustratsiooni: I ja IX korruse plaan, välisvaade, sisevaated

  13. An Alignment Analysis of the U.S. Navy Supply Corps Officer’s Career Guidance With Naval Supply Systems Command’s Strategic Publications

    Science.gov (United States)

    2014-06-03

    Ms. Marianne Taflinger coached me from the project’s beginning all the way through to its completion. Her insights improved my writing and added...thesis, Naval Postgraduate School). Retrieved from http://hdl.handle.net/10945/32887 Saks, A. M. (2006). Antecedents and consequences of employee

  14. An Alignment Analysis of the U.S. Navy Supply Corps Officers Career Guidance with Naval Supply Systems Commands Strategic Publications

    Science.gov (United States)

    2014-06-01

    Writing Center team. Specifically, Ms. Marianne Taflinger coached me from the project’s beginning all the way through to its completion. Her...Postgraduate School). Retrieved from http://hdl.handle.net/10945/32887 Saks, A. M. (2006). Antecedents and consequences of employee engagement. Journal of

  15. Author Details

    African Journals Online (AJOL)

    Guida, Michelangelo. Vol 34 (2014) - Articles Nurettin Topçu and Necip Fazıl Kısakürek: stories of 'conversion' and activism in Republican Turkey Abstract. ISSN: 0257-7062. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms ...

  16. Journal for Islamic Studies - Vol 34 (2014)

    African Journals Online (AJOL)

    Nurettin Topçu and Necip Fazıl Kısakürek: stories of 'conversion' and activism in Republican Turkey · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Michelangelo Guida, 98-117 ...

  17. A New Difference Sequence Set of Order α and Its Geometrical Properties

    Directory of Open Access Journals (Sweden)

    Mikail Et

    2014-01-01

    Full Text Available We introduce a new class of sequences named as mαΔr,ϕ,p and, for this space, we study some inclusion relations, topological properties, and geometrical properties such as order continuous, the Fatou property, and the Banach-Saks property of type p.

  18. Heavy oil recovery process: Conceptual engineering of a downhole methanator and preliminary estimate of facilities cost for application to North Slope Alaska

    Energy Technology Data Exchange (ETDEWEB)

    Gondouin, M.

    1991-10-31

    The West Sak (Upper Cretaceous) sands, overlaying the Kuparuk field, would rank among the largest known oil fields in the US, but technical difficulties have so far prevented its commercial exploitation. Steam injection is the most successful and the most commonly-used method of heavy oil recovery, but its application to the West Sak presents major problems. Such difficulties may be overcome by using a novel approach, in which steam is generated downhole in a catalytic Methanator, from Syngas made at the surface from endothermic reactions (Table 1). The Methanator effluent, containing steam and soluble gases resulting from exothermic reactions (Table 1), is cyclically injected into the reservoir by means of a horizontal drainhole while hot produced fluids flow form a second drainhole into a central production tubing. The downhole reactor feed and BFW flow downward to two concentric tubings. The large-diameter casing required to house the downhole reactor assembly is filled above it with Arctic Pack mud, or crude oil, to further reduce heat leaks. A quantitative analysis of this production scheme for the West Sak required a preliminary engineering of the downhole and surface facilities and a tentative forecast of well production rates. The results, based on published information on the West Sak, have been used to estimate the cost of these facilities, per daily barrel of oil produced. A preliminary economic analysis and conclusions are presented together with an outline of future work. Economic and regulatory conditions which would make this approach viable are discussed. 28 figs.

  19. Targeting the oxidative stress response system of fungi with safe, redox-potent chemosensitizing agents

    Science.gov (United States)

    One mode of action of the antimycotics amphotericin B (AMB) or itraconazole (ITZ) against filamentous fungi involves cellular oxidative stress response. Aspergillus fumigatus sakA', a mitogen-activated protein kinase (MAPK) gene deletion mutant in the antioxidation system, was more sensitive to AMB ...

  20. Eesti graafika edu Hispaanias / Benjamin Vasserman

    Index Scriptorium Estoniae

    Vasserman, Benjamin

    1999-01-01

    Hispaanias Orenses dets. 1998/jaan. 1999 peetud V rahvusvahelisel graafikabiennaalil "Julio Prieto Nespereira auhind" pälvisid žürii kiituse eesti graafikud R. Saks, V. Tolli, B. Vasserman. I preemia ئ T. Uchida. Näitusel osales S. Liiva. 1998. a. sügisel Jaapanis toimunud II Tokio rahvusvahelisest väikegraafika triennaalist võttis osa N. Neidre.

  1. Challenges in Utilising Key Leader Engagement in Civil-Military Operations

    Science.gov (United States)

    2011-06-01

    experience from Afghanistan represented different organisations: Swedish Armed Forces (SwAF), Swedish International Development Cooperation Agency ( Sida ...with Swedish civil and military personnel • Extensive experience from several missions, focus on Afghanistan • Organisations: SwAF, Sida , SAK and

  2. Exponential Lower Bounds for the PPSZ k-SAT Algorithm

    DEFF Research Database (Denmark)

    Chen, Shiteng; Scheder, Dominik Alban; Talebanfard, Navid

    2013-01-01

    In 1998, Paturi, Pudl´ak, Saks, and Zane presented PPSZ, an elegant randomized algorithm for k-SAT. Fourteen years on, this algorithm is still the fastest known worst-case algorithm. They proved that its expected running time on k-CNF formulas with n variables is at most 2(1−k)n, where k 2 (1/k...

  3. The pharmaceutics from the foreign empire: the molecular pharming of the prokaryotic staphylokinase in Arabidopsis thaliana plants.

    Science.gov (United States)

    Hnatuszko-Konka, Katarzyna; Łuchniak, Piotr; Wiktorek-Smagur, Aneta; Gerszberg, Aneta; Kowalczyk, Tomasz; Gatkowska, Justyna; Kononowicz, Andrzej K

    2016-07-01

    Here, we present the application of microbiology and biotechnology for the production of recombinant pharmaceutical proteins in plant cells. To the best of our knowledge and belief it is one of few examples of the expression of the prokaryotic staphylokinase (SAK) in the eukaryotic system. Despite the tremendous progress made in the plant biotechnology, most of the heterologous proteins still accumulate to low concentrations in plant tissues. Therefore, the composition of expression cassettes to assure economically feasible level of protein production in plants remains crucial. The aim of our research was obtaining a high concentration of the bacterial anticoagulant factor-staphylokinase, in Arabidopsis thaliana seeds. The coding sequence of staphylokinase was placed under control of the β-phaseolin promoter and cloned between the signal sequence of the seed storage protein 2S2 and the carboxy-terminal KDEL signal sequence. The engineered binary vector pATAG-sak was introduced into Arabidopsis thaliana plants via Agrobacterium tumefaciens-mediated transformation. Analysis of the subsequent generations of Arabidopsis seeds revealed both presence of the sak and nptII transgenes, and the SAK protein. Moreover, a plasminogen activator activity of staphylokinase was observed in the protein extracts from seeds, while such a reaction was not observed in the leaf extracts showing seed-specific activity of the β-phaseolin promoter.

  4. Alternatiivse õppekava üldosa esitlus riigikogu kultuurikomisjonis / Urve Läänemets

    Index Scriptorium Estoniae

    Läänemets, Urve, 1947-

    2004-01-01

    Kirjastuse Avita-Bit esindajad rääkisid 12. oktoobril Riigikogu kultuurikomisjonis oma tööst õppekava arendamisel. Sõna võtsid: Janar Holm, Katrin Saks, Riina Paatsi, Andres Raid, Andres Taimla, Leo Fiveger, Mark Soosaar, Urve Läänemets, Jaak Allik, Mailis Reps ja Signe Kivi

  5. On-line coloring of H-free bipartite graphs

    NARCIS (Netherlands)

    Broersma, Haitze J.; Capponi, A.; Paulusma, Daniël; Calamoneri, T.; Finocchi, I.; Italiano, G.F.

    2006-01-01

    We present a new on-line algorithm for coloring bipartite graphs. This yields a new upper bound on the on-line chromatic number of bipartite graphs, improving a bound due to Lovasz, Saks and Trotter. The algorithm is on-line competitive on various classes of $H$-free bipartite graphs, in particular

  6. Dicty_cDB: VFE366 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AK151142_1( AK151142 |pid:none) Mus musculus bone marrow macrophag... 269 e-144 ( P39872 ) RecName: Full=60S...AK151057_1( AK151057 |pid:none) Mus musculus bone marrow macrophag... 269 e-144 BC008492_1( BC008492 |pid:none)

  7. Dicty_cDB: VFD854 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AK151142_1( AK151142 |pid:none) Mus musculus bone marrow macrophag... 295 e-147 ( P39872 ) RecName: Full=60S...AK151057_1( AK151057 |pid:none) Mus musculus bone marrow macrophag... 295 e-147 ( P21531 ) RecName: Full=60S

  8. Dicty_cDB: VFB101 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AK151142_1( AK151142 |pid:none) Mus musculus bone marrow macrophag... 397 e-109 ( P39872 ) RecName: Full=60S...AK151057_1( AK151057 |pid:none) Mus musculus bone marrow macrophag... 397 e-109 ( P21531 ) RecName: Full=60S

  9. Kolm meest, kes ostsid Thulema / Koit Brinkmann

    Index Scriptorium Estoniae

    Brinkmann, Koit

    2006-01-01

    Mööblifirma Thulemast 60% ostnud Wallenium Grupp OÜ omanikud Henri Rüüsak, Endrus Arge ja Sparry Kivilo tahavad ettevõttest teha Baltimaade suurima mööblitootja. Diagramm. Kommenteerivad Jussi Aine, August Kull, Siiri Maask ja Tõnis Tarbe

  10. Arvutijuhtimisega korter annab omanikule kontrolli / Siiri Suutre

    Index Scriptorium Estoniae

    Suutre, Siiri

    2007-01-01

    Järgmisel aastal valmib Tallinnas Juurdeveo 19 maja, kus korteriomanikel on pidev virtuaalne juurdepääs oma kodule. Projekteerijad Harry Klaar ja Kätlin Saks arhitektuuribüroost On Arhitektid. Tehnoloogiline lahendus AS Eltron ja Yoga Intelligence AS

  11. Uued Uku meistrid / Karin Paulus

    Index Scriptorium Estoniae

    Paulus, Karin, 1975-

    2012-01-01

    Eesti Disainerite Liidu korraldatud meenekonkursist "Väike asi". 2. koha pälvisid tööd "Vaikuse murdja" (Tarmo Luisk, Martin Pütsep) ja "Linnupete lusikad" (Ene Raud), 3. koha töö "Puu" (Erika Saks, Imre Malva, Maarja Niinemägi)

  12. Benjamin Vassermanile preemiad

    Index Scriptorium Estoniae

    2007-01-01

    Graafik Benjamin Vasserman pälvis kolme digitaalse graafilise lehe eest žürii kiituse Ungaris Györis toimunud biennaalil "The Master of Drawing and Graphic Arts" ning II preemia nelja lehe eest Leedus Vilniuses toimunud VI rahvusvahelisel väikegraafika triennaalil. Eestist osalesid veel Reti Saks ja Kelli Valk

  13. Reval Hotel Lietuva / Argo Vaikla

    Index Scriptorium Estoniae

    Vaikla, Argo, 1966-

    2004-01-01

    Vilniuse hotelli "Lietuva" renoveerimine. Arhitektuurne renoveerimisprojekt: Aare Saks, Nils Palm (SWECO FFNS Arkitekter AB, Rootsi), Rolandas Palekas (UAB Viltekta). Sisekujundus: Katrin ja Argo Vaikla, Liis Lindvere, Peeter Loo (Vaikla Disain AS). Ehitaja: Merko Statyba UAB. Projekt 2002, valmis 2003. I korruse plaan, välisvaade, 4 sisevaadet

  14. Download this PDF file

    African Journals Online (AJOL)

    DR. AMIN

    Gadagi” tea preparations,. “sak'',”sada” and “magani”.. LD50 values of each type of the tea were determined. Results of phase. I and phase II of the study showed no mortality was recorded in any of the experimental groups of rats in 24hours ...

  15. Valitsejad püsinud aasta otsa pukis / interv. Enno Tammer

    Index Scriptorium Estoniae

    2000-01-01

    Küsimustele, mis puudutavad valitsuse saavutusi ja probleeme, vastavad valitsuse liikmed M. Laar, J. Luik, T. Loodus, T. Lukas, T. Jürgenson, S. Kallas, M. Rask, S. Kivi, H. Kranich, T. Asmer, T.-H. Ilves, E. Nestor, M. Pärnoja, I. Padar, K. Saks

  16. P300 and Probability in Children.

    Science.gov (United States)

    Ladish, Christine; Polich, John

    1989-01-01

    Investigated the relationship between P300 or P3 event-related brain potential and cognitive development by assessing contributions of short-term memory to changes in component amplitude and latency in 5- to 14-year-old children. Results suggested that cognitive development is indexed by decreases in P300 latency. (SAK)

  17. Toward a model of employee engagement in a public service organization

    DEFF Research Database (Denmark)

    Nielsen, Mette Strange

    Employee engagement has long been capturing the attention of researchers and practitioners, (e.g. Bakker, Albrecht, & Leiter, 2011; Buckingham & Coffman, 1999) due to its positive impact on various measures of organizational performance (Gruman & Saks, 2011; Harter, Schmidt, & Hayes, 2002; Mone...

  18. Implementering af tablets som supplerende og alternativ kommunikation

    DEFF Research Database (Denmark)

    Nielsen, Lisbeth; Stubben, Thomas Waring

    2017-01-01

    Denne artikelsamling har et dobbelt formål. Dels redegør den for aktionsforskningsprojektet Implementering af Tablets som Supplerende og Alternativ Kommunikation (IT-SAK), og dels beskriver den aktionsimplementeringsstrategien meget konkret, så denne kan anvendes som redskab i andre pædagogiske...... omhandler de konkrete resultater af forskningen og implementeringen af tablets som supplerende og alternativ kommunikation....

  19. Trachypodaceae. A critical revision

    NARCIS (Netherlands)

    Zanten, van B.O.

    1959-01-01

    1. Trachypus. 1. T. bicolor Reinw. et Hornsch. is divided into 4 varieties: a. var. bicolor, b. var. hispidus (C. Muell.) Card., c. var. viridulus (Mitt.) Zant. comb. nov., d. var. scindifolius (Sak.) Nog. 2. T. humilis Lindb. is divided into 2 varieties: a. var. humilis, b. var. tenerrimus (Herz.)

  20. Targeting the oxidative stress response system of fungi with safe, redox-potent chemosensitizing agents

    Directory of Open Access Journals (Sweden)

    Jong H. eKim

    2012-03-01

    Full Text Available The cellular antioxidation system is a target in the antifungal action of amphotericin B (AMB and itraconazole (ITZ, in filamentous fungi. The sakAΔ mutant of Aspergillus fumigatus, a mitogen-activated protein kinase (MAPK gene deletion mutant in the antioxidation system, was found to be more sensitive to AMB or ITZ than other A. fumigatus strains, a wild type and a mpkCΔ mutant (MAPK gene deletion mutant in polyalcohol sugar utilization system. The sakAΔ mutant showed no growth at 0.5 μg mL-1 of ITZ or reduced growth at 1.0 to 2.0 μg mL-1 of AMB, while the other strains exhibited robust growth. Complete fungal kill (≥ 99.9% by ITZ or AMB was achieved by much lower dosages for the sakAΔ mutant than for the other strains. SakA and MpkC appear to have overlapping roles in marshalling the oxidative stress response under treatment by an organic peroxide, tert-butyl hydroperoxide (t-BuOOH, or hydrogen peroxide (H2O2. The SakA signalling pathway was found to be responsible for fungal tolerance to AMB or ITZ toxicity. It appears msnA, an Aspergillus ortholog to Saccharomyces cerevisiae MSN2 (encoding a stress-responsive C2H2-type zinc-finger regulator and sakA and/or mpkC (upstream MAPKs are in the same stress response network under t-BuOOH-, H2O2- or AMB-triggered toxicity. Of note is that ITZ-sensitive yeast pathogens (Candida krusei and Cryptococcus neoformans were also sensitive to t-BuOOH, showing a connection between ITZ toxicity and oxidative stress response. This was shown by enhanced antifungal activity of AMB or ITZ when co-applied with redox-potent natural compounds, 2,3-dihydroxybenzaldehyde, thymol or salicylaldehyde, as chemosensitizing agents. Hence, redox compounds, which target the antioxidation system in fungi, possess a potent chemosensitizing capacity to enhance efficacy of conventional drugs inducing oxidative stress. Such chemosensitization can reduce costs and alleviate negative side effects associated with current

  1. Stretch-activated potassium currents in the heart: Focus on TREK-1 and arrhythmias.

    Science.gov (United States)

    Decher, Niels; Kiper, Aytug K; Rinné, Susanne

    2017-11-01

    This review focuses on the role and the molecular candidates of the cardiac stretch-activated potassium current (SAK). The functional properties of the two-pore domain potassium (K2P) channel TREK-1, a major candidate for the cardiac SAK, are analyzed and the molecular mechanism of stretch-activation in K2P potassium channels is discussed. Furthermore, the functional modulation of TREK-1 by different cardiac interaction partners, as well as evidence for the functional role of the stretch-dependent TREK-1 and its putative subunits in the heart is reviewed. In addition, we summarize the recent evidence that TREK-1 is involved in the pathogenesis of human cardiac arrhythmias. Copyright © 2017 Elsevier Ltd. All rights reserved.

  2. Kreutzwaldi radadel / Tarmo Teder

    Index Scriptorium Estoniae

    Teder, Tarmo, 1958-

    2003-01-01

    Sirbi toimetuse ringreisi marsruut: Jõepere-Müüsleri-Kääpa jõgi-Kalevipoja Muuseum-Kalevipoja säng-Kreutzwaldi haud Raadi kalmistul ja Kalevipoja kuju Tartus-Dr. Fr. R. Kreutzwaldi Memoriaalmuuseum Võrus-Saadjärve. F. R. Kreuzwaldi monumendist Jõeperes, hauast Raadi kalmistul ja muuseumist Võrus (1941), taasloodud Kalevipoja kujust Tartus (E. Väli) ja Glehni pargis, Müüsleri parki kavandatavast Kilplalast, Kääpa jõest, Kalevipoja toolist, muuseumist (2002) ja sängist, F. R. Kreutzwaldile püstitatud mälestussambad (A. Adamson, Võru, 1926, A. Eller, Rakvere, 1937, J. Hirv, M. Saks, Tartu,1952, J. Raudsepp, Jõepere, 1953, E. Taniloo, M. Saks, Tallinn, 1958)

  3. Vermikompost ve Mikorizanın Biber Bitkisinin Gelişimi ile Mineral Beslenmesi Üzerine Etkisi

    OpenAIRE

    Zeliha KÜÇÜKYUMUK; GÜLTEKİN, Mehmet; İbrahim ERDAL

    2014-01-01

    Bu çalışmada vermikompost ve mikorizanın ayrı ayrı ve birlikte kullanılmasıyla biber gelişimi ve mineral beslenmesi üzerine olan etkileri incelenmiştir. Çalışmada, mikoriza ( 0, 1 ve 2 g saksı -1) ve vermikompost dozları ( 0, 2.5, 5 ve 10 g saksı -1) kullanılmıştır. Biber bitkisinde besin elementi ve biber bitkisi yaş ve kuru ağırlıkları belirlenmiştir. Sonuçlar değerlendirildiğinde mikoriza ve vermikompost uygulamalarının biber bitkisi yaş, kuru ağırlığı ve besin elementi içerikleri üzerine ...

  4. Interaction between nanoparticles generated by zinc chloride treatment and oxidative responses in rat liver

    OpenAIRE

    Azzouz I; Trabelsi H.; Hanini A; Ferchichi S; Tebourbi O; Sakly M; Abdelmelek H

    2013-01-01

    Inès Azzouz, Hamdi Trabelsi, Amel Hanini, Soumaya Ferchichi, Olfa Tebourbi, Mohsen Sakly, Hafedh AbdelmelekLaboratory of Integrative Physiology, Faculty of Sciences of Bizerte, Carthage University, TunisiaAbstract: The aim of the present study was to investigate the interaction of zinc chloride (3 mg/kg, intraperitoneally [ip]) in rat liver in terms of the biosynthesis of nanoparticles. Zinc treatment increased zinc content in rat liver. Analysis of fluorescence revealed the presen...

  5. Acute Toxicity Study of “Gadagi” Tea on Rats | Gadanya | Bayero ...

    African Journals Online (AJOL)

    Acute toxicity study was carried out on three most common types of “Gadagi” tea preparations, “sak'',”sada” and “magani”.. LD50 values of each type of the tea were determined. Results of phase I and phase II of the study showed no mortality was recorded in any of the experimental groups of rats in 24hours and up to four ...

  6. Selection Indicates Preference in Diverse Habitats: A Ground-Nesting Bird (Charadrius melodus) Using Reservoir Shoreline

    OpenAIRE

    Michael J Anteau; Sherfy, Mark H.; Wiltermuth, Mark T.

    2012-01-01

    Animals use proximate cues to select resources that maximize individual fitness. When animals have a diverse array of available habitats, those selected could give insights into true habitat preferences. Since the construction of the Garrison Dam on the Missouri River in North Dakota, Lake Sakakawea (SAK) has become an important breeding area for federally threatened piping plovers (Charadrius melodus; hereafter plovers). We used conditional logistic regression to examine nest-site selection ...

  7. Läti ja Leedu vallutavad Pärnus "Kunstisuve" / Grete Naaber

    Index Scriptorium Estoniae

    Naaber, Grete, 1942-

    2000-01-01

    17. juunil Pärnus "Kunstisuve" raames Linnagaleriis avatavast pisiplastika näitusest 3D (kuraator Terje Ojaver, esinejate hulgas Tõnu Smidt, Erik Teemägi, Reti Saks, Ivan Zubaka) ja Muuseumiaidas avatavast Jelgava, Shiauliai ja Pärnu kunstnike näitusest 3B (näitused on avatud 29. juulini); korraldaja Sirje Eelma kommentaare; samal päeval toimub Raoul Kurvitsa performance "X-file"

  8. NikA/TcsC histidine kinase is involved in conidiation, hyphal morphology, and responses to osmotic stress and antifungal chemicals in Aspergillus fumigatus.

    Directory of Open Access Journals (Sweden)

    Daisuke Hagiwara

    Full Text Available The fungal high osmolarity glycerol (HOG pathway is composed of a two-component system (TCS and Hog1-type mitogen-activated protein kinase (MAPK cascade. A group III (Nik1-type histidine kinase plays a major role in the HOG pathway of several filamentous fungi. In this study, we characterized a group III histidine kinase, NikA/TcsC, in the life-threatening pathogenic fungus, Aspergillus fumigatus. A deletion mutant of nikA showed low conidia production, abnormal hyphae, marked sensitivity to high osmolarity stresses, and resistance to cell wall perturbing reagents such as congo red and calcofluor white, as well as to fungicides such as fludioxonil, iprodione, and pyrrolnitrin. None of these phenotypes were observed in mutants of the SskA response regulator and SakA MAPK, which were thought to be downstream components of NikA. In contrast, in response to fludioxonil treatment, NikA was implicated in the phosphorylation of SakA MAPK and the transcriptional upregulation of catA, dprA, and dprB, which are regulated under the control of SakA. We then tested the idea that not only NikA, but also the other 13 histidine kinases play certain roles in the regulation of the HOG pathway. Interestingly, the expression of fos1, phkA, phkB, fhk5, and fhk6 increased by osmotic shock or fludioxonil treatment in a SakA-dependent manner. However, deletion mutants of the histidine kinases showed no significant defects in growth under the tested conditions. Collectively, although the signal transduction network related to NikA seems complicated, NikA plays a crucial role in several aspects of A. fumigatus physiology and, to a certain extent, modulates the HOG pathway.

  9. Targeting Nuclear EGFR: Strategies for Improving Cetuximab Therapy in Lung Cancer

    Science.gov (United States)

    2015-12-01

    induced development of cutaneous squamous cell carcinomas in PKCε transgenic mice via inhibition of cell survival signals, Carcinogenesis, 2015. [Epub...4. 48. Toulany M, Kehlbach R, Florczak U, Sak A, Wang S, Chen J, et al. Targeting of AKT1 enhances radiation toxicity of human tumor cells by...the dimerization arm on domain II [4]. The Food and Drug Administration has approved cetuximab treatment for patients with metastatic colorectal cancer

  10. Understanding employee engagement in a public service context

    DEFF Research Database (Denmark)

    Nielsen, Mette Strange

    Employee engagement has long been capturing the attention of researchers and practitioners (Bakker, Albrecht, & Leiter, 2011; Kahn, 1990), due to its positive impact on various measures of organizational performance and individual level outcomes (Gruman & Saks, 2011; Harter, Schmidt, & Hayes, 200...... of the challenges facing public service organizations in particular. Thereafter, several questions are formulated to guide development of a qualitative explorative study following a grounded theory approach (Glaser & Strauss, 1967; Strauss & Corbin, 1990)....

  11. Eesti disain / Silvia Pärmann

    Index Scriptorium Estoniae

    Pärmann, Silvia

    2014-01-01

    Ahti Grünbergi ja Tõnis Kalve mööbliseeria Derelict. Maile Grünbergi disainitud toolid ja laud Madis. Taniel Kolpakovi kaubamärgile Rough Bloom disainitud köögimööbel. Kaubamärgi Varm Country uus kollektsioon Basic no 2. Kersti Laanmaa keraamilised teekannud Kiviaeg ja Jänes kapsas. Tiina Mangi kavandatud diivan Sik-Sak. Tõnis Vellama valgustimudel AET27

  12. A Hybrid Kinetic Model of Asymmetric Thin Current Sheets with Sheared Flows in a Collisionless Plasma

    Science.gov (United States)

    2010-12-27

    different regimes. 15. SUBJECT TERMS Asymmetric Collisionless Current Sheet Solar Wind Theory Reconnection Hybrid Simulation 16. SECllRITY...Pritchett, 2008]. Cas.sak and Shay [2007] provided a theory and simulation of asymmetric reconnection in the MHD regime. Malova et al. [2007] proposed a...z are aligned with those of the usual Geocentric Sun- Earth (aSE) coordinates. In this frame, +x points from the Earth to the Sun, +y points out of

  13. Screening af kulturmiljøer

    DEFF Research Database (Denmark)

    2017-01-01

    Arkitektskolen Aarhus sætter fokus på kulturmiljøer i Danmarks yderområder. Screening af Kulturmiljøer (SAK) er et redskab til at vurdere kulturmiljøer ud fra aflæselige parametre, så kulturarvens værdier, egenskaber og udviklingspotentialer bliver synlige. Formålet er at skabe nye muligheder og...

  14. AS Balti Ameerika Auto Keskus Peterburi tee 50

    Index Scriptorium Estoniae

    1998-01-01

    Tallinna 'Chrysleri' ja 'Jeepi' autokeskuse hoonekompleksis on eristatavad kolm osa: kahekorruseline müügisalong, ühekorruseline töökoda ja hooldusruunid, ladu ning olmeplokk. Klaasfassaadiga automüügisaal ulatub hoonest välja sammastega ümbritsetud poolkaarest paadikujulise siiluna. Peatöövõtja: AS Feer Ehituse projektijuht: AS TSM. Projekteerija: Arhitektuuribüroo R. Puusepp. Arhitekt Aare Saks (FFNS, Rootsi). Sisekujundus Rein Nurmse. Projekt 1996, valmis 1997

  15. Sisearhitektide Liit premeeris / Triin Ojari

    Index Scriptorium Estoniae

    Ojari, Triin, 1974-

    2004-01-01

    ESL aastapreemiad 2003: parima ajaloolise interjööri ja parima kodu preemia - Leila Pärtelpoja ja Karl-Erik Tarbe kujundatud Villa Tannenrode Lükati teel Tallinnas, parim ühiskondlik interjöör - 3+1 arhitektide (Markus Kaasik, Andres Ojari, Ilmar Valdur, kaasautorid Ralf Lõoke, Kalle Komissarov; söögikoha tegi Taavi Aunre ja ühiskondliku mööbli Gert Sarv) kujundatud Mustamäe keskus, publitsistikapreemia - EKA sisearhitektuuri kateedri kataloog "Eesti Kunstiakadeemia sisearhitektuuri osakond 2002-2003". Ära märgiti kaks tooteseeriat: EGO garderoobid (EGO Mööbel OÜ) ning Jan J. Grapsi loodud "Incognito" mööblisari

  16. Mengukur Tingkat Kesesuaian antara Standar Akuntansi Keuangan dengan International Financial Reporting Standards per 1 Januari 2008

    Directory of Open Access Journals (Sweden)

    Rosinta Ria Panggabean

    2010-05-01

    Full Text Available International accounting topic was rare to adress between accounting practices, especially International Accounting Standard. It occured due to the restrictive source and difficulty in finding the source. However, recently the standard has been an addressed issue since Indonesia Chartered of Accountant (IAI plans to comply the Indonesia Accounting Standard (SAK with the International Financialreporting(IFRSon1stJanuary2012.The purpose of the research is to measure the compliance of the (SAK per 1st January 2008 with the IFRS per 1st January 2008 and attain the association between those two standards. Hence, the difference between the two standards and the neccessary steps to be taken for complying can be obtained. The methodology will be used in the paper are Jaccard’s Coefficients, Spearman’s Correlation Coefficient,Euclidean Distances.The sample for the paper will be 43 accounting issues adressed on both standards that have been chosen and investigated. The paper concludes that there are significant equalities (75% between SAK per 1st January 2008 and IFRS 1st January 2008. (using Jaccard’s Coefficients. Due to several problems that have been found in the research, the author wish that the further researchers could widen the research’s samples, so the result will be more accurate and comprehensive. 

  17. Genome comparisons of two Taiwanese community-associated methicillin-resistant Staphylococcus aureus ST59 clones support the multi-origin theory of CA-MRSA.

    Science.gov (United States)

    Feng, Ye; Chen, Hsiu-Ling; Chen, Chih-Jung; Chen, Chyi-Liang; Chiu, Cheng-Hsun

    2017-10-01

    Sequence type (ST) 59 is an epidemic lineage of community-associated methicillin-resistant Staphylococcus aureus (CA-MRSA) in Asia. Two ST59 clones are prevalent in Taiwan: the Taiwan clone (TW) causes severe infections, whereas the Asian-Pacific clone (AP) is usually commensal. In this study, we sequenced the genome and transcriptome of the representative strains of these two clones and found their differences to focus on three mobile genetic elements: TW carries SCCmec Type V T , Panton-Valentine leucocidin (PVL)-encoding prophage ΦSa2, whereas AP carries SCCmec Type IV and staphylokinase (SAK)-encoding prophage ΦSa3. The anti-virulent role of SAK was confirmed using murine skin and bloodstream infection models. ΦSa3 usually integrates into the hlb gene, but in AP was found to be integrated at the genomic island νSaβ. The mutation of the attB site "TGTATCCAAACTGG" to "TGTATCCGAATTGG" led to a failure in the integration of ΦSa3 in hlb, prompting atypical integration at other sites. The sak gene possessed remarkably different patterns of distribution among the different STs of S. aureus. We conclude that the atypical integration of ΦSa3 may help S. aureus adapt to the human host habitat and that the subsequent loss of ΦSa3 contributes toward the development of a virulent CA-MRSA lineage for wider horizontal transmission. Copyright © 2017 Elsevier B.V. All rights reserved.

  18. Molecular Evaluation of Genetic Diversity in Wild-Type Mastic Tree (Pistacia lentiscus L.).

    Science.gov (United States)

    Abuduli, Alimu; Aydin, Yıldız; Sakiroglu, Muhammet; Onay, Ahmet; Ercisli, Sezai; Uncuoglu, Ahu Altinkut

    2016-10-01

    In this study, the patterns of genetic variation and phylogenetic relationships of mastic tree (Pistacia lentiscus L.) genotypes including 12 males and 12 females were evaluated using SSR, RAPD, ISSR, and ITS markers yielding 40, 703, 929 alleles, and 260-292 base pairs for ITS1 region, respectively. The average number of alleles produced from SSR, RAPD, and ISSR primers were 5.7, 14, and 18, respectively. The grouping pattern obtained from Bayesian clustering method based on each marker dataset was produced. Principal component analyses (PCA) of molecular data was investigated and neighbor joining dendrograms were subsequently created. Overall, the results indicated that ISSR and RAPD markers were the most powerful to differentiate the genotypes in comparison with other types of molecular markers used in this study. The ISSR results indicated that male and female genotypes were distinctly separated from each other. In this frame, M9 (Alaçatı) and M10 (Mesta Sakız Adası-Chios) were the closest genotypes and while F11 (Seferihisar) and F12 (Bornova/Gökdere) genotypes fall into same cluster and showing closer genetic relation. The RAPD pattern indicated that M8 (Urla) and M10 (Mesta Sakız Adası-Chios), and F10 (Mesta Sakız Adası-Chios) and F11 (Seferihisar) genotypes were the closest male and female genotypes, respectively.

  19. METHANE HYDRATE PRODUCTION FROM ALASKAN PERMAFROST

    Energy Technology Data Exchange (ETDEWEB)

    Richard Sigal; Kent Newsham; Thomas Williams; Barry Freifeld; Timothy Kneafsey; Carl Sondergeld; Shandra Rai; Jonathan Kwan; Stephen Kirby; Robert Kleinberg; Doug Griffin

    2005-02-01

    Natural-gas hydrates have been encountered beneath the permafrost and considered a nuisance by the oil and gas industry for years. Engineers working in Russia, Canada and the USA have documented numerous drilling problems, including kicks and uncontrolled gas releases, in arctic regions. Information has been generated in laboratory studies pertaining to the extent, volume, chemistry and phase behavior of gas hydrates. Scientists studying hydrate potential agree that the potential is great--on the North Slope of Alaska alone, it has been estimated at 590 TCF. However, little information has been obtained on physical samples taken from actual rock containing hydrates. The work scope drilled and cored a well The Hot Ice No. 1 on Anadarko leases beginning in FY 2003 and completed in 2004. An on-site core analysis laboratory was built and utilized for determining the physical characteristics of the hydrates and surrounding rock. The well was drilled from a new Anadarko Arctic Platform that has a minimal footprint and environmental impact. The final efforts of the project are to correlate geology, geophysics, logs, and drilling and production data and provide this information to scientists developing reservoir models. No gas hydrates were encountered in this well; however, a wealth of information was generated and is contained in this report. The Hot Ice No. 1 well was drilled from the surface to a measured depth of 2300 ft. There was almost 100% core recovery from the bottom of surface casing at 107 ft to total depth. Based on the best estimate of the bottom of the methane hydrate stability zone (which used new data obtained from Hot Ice No. 1 and new analysis of data from adjacent wells), core was recovered over its complete range. Approximately 580 ft of porous, mostly frozen, sandstone and 155 of conglomerate were recovered in the Ugnu Formation and approximately 215 ft of porous sandstone were recovered in the West Sak Formation. There were gas shows in the bottom

  20. Preoperative radiochemotherapy and radical surgery in comparison with radical surgery alone

    Energy Technology Data Exchange (ETDEWEB)

    Mohr, C.; Schettler, D. (Klinik fuer Gesichts- und Kieferchirurgie der Universitaetsklinik Essen, Essen (Germany)); Bohndorf, W. (Strahlenklinik der Universitaetsklinik Wuerzburg, Wuerzburg (Germany)) (and others)

    1994-01-01

    A multicentric, randomized study of squamous cell carcinoma (SCC) of the oral cavity and the oropharynx has been undertaken by DOeSAK. The results after radical surgery alone have been compared with the results of combined preoperative radiochemotherapy followed by radical surgery. Patients with primary (biopsy proven) SCC of the oral cavity or the oropharynx with tumor nodes metastasis (TNM) stages T2-4, N0-3, M0 were included in the study. A total of 141 patients were treated by radical surgery alone, whereas 127 patients were treated by radical surgery preceded by preoperative radiochemotherapy. The pre-operative treatment consisted of conventionally fractioned irradiation on the primary and the regional lymph nodes with a total dose of 36 Gy (5 x 2 Gy per week) and low-dose cisplatin chemotherapy with 5 x 12.5 mg cisplatin per m[sup 2] of body surface during the first week of treatment. Radical surgery according to be DOeSAK definitions (DOeSAK, 1982) was performed after a delay of 10-14 days. During the follow-up period, 28.2% of all patients suffered from locoregional recurrence, and 27.2% of the patients died. The percentages were higher after radical surgery alone for locoregional recurrence (31% and 15.6%) and for death (28% and 18.6%). The life-table analysis showed improved survival rates of 4.5% after 1 year and 8.3% after 2 years in the group of patients treated with combined therapy. The demonstrated improvement appeared to be significant with the Gehan-Wilcoxon test as well as with the log rank test below a P value of 5%. (au) (29 refs.).

  1. Expression of recombinant staphylokinase, a fibrin-specific plasminogen activator of bacterial origin, in potato (Solanum tuberosum L.) plants.

    Science.gov (United States)

    Gerszberg, Aneta; Wiktorek-Smagur, Aneta; Hnatuszko-Konka, Katarzyna; Łuchniak, Piotr; Kononowicz, Andrzej K

    2012-03-01

    One of the most dynamically developing sectors of green biotechnology is molecular farming using transgenic plants as natural bioreactors for the large scale production of recombinant proteins with biopharmaceutical and therapeutic values. Such properties are characteristic of certain proteins of bacterial origin, including staphylokinase. For many years, work has been carried out on the use of this protein in thrombolytic therapy. In this study, transgenic Solanum tuberosum plants expressing a CaMV::sak-mgpf-gusA gene fusion, were obtained. AGL1 A. tumefaciens strain was used in the process of transformation. The presence of the staphylokinase gene was confirmed by PCR in 22.5% of the investigated plants. The expression of the fusion transgene was detected using the β-glucuronidase activity assay in 32 putative transgenic plants. Furthermore, on the basis of the GUS histochemical reaction, the transgene expression pattern had a strong, constitutive character in seven of the transformants. The polyacrylamide gel electrophoresis of a protein extract from the SAK/PCR-positive plants, revealed the presence of a119 kDa protein that corresponds to that of the fusion protein SAK-mGFP-GUSA. Western blot analysis, using an antibody against staphylokinase, showed the presence of the staphylokinase domain in the 119 kDa protein in six analyzed transformants. However, the enzymatic test revealed amidolytic activity characteristic of staphylokinase in the protein extract of only one plant. This is the first report on a Solanum tuberosum plant producing a recombinant staphylokinase protein, a plasminogen activator of bacterial origin.

  2. The innate immune modulators staphylococcal complement inhibitor and chemotaxis inhibitory protein of Staphylococcus aureus are located on beta-hemolysin-converting bacteriophages.

    Science.gov (United States)

    van Wamel, Willem J B; Rooijakkers, Suzan H M; Ruyken, Maartje; van Kessel, Kok P M; van Strijp, Jos A G

    2006-02-01

    Two newly discovered immune modulators, chemotaxis inhibitory protein of Staphylococcus aureus (CHIPS) and staphylococcal complement inhibitor (SCIN), cluster on the conserved 3' end of beta-hemolysin (hlb)-converting bacteriophages (betaC-phis). Since these betaC-phis also carry the genes for the immune evasion molecules staphylokinase (sak) and enterotoxin A (sea), this 8-kb region at the 3' end of betaC-phi represents an innate immune evasion cluster (IEC). By PCR and Southern analyses of 85 clinical Staphylococcus aureus strains and 5 classical laboratory strains, we show that 90% of S. aureus strains carry a betaC-phi with an IEC. Seven IEC variants were discovered, carrying different combinations of chp, sak, or sea (or sep), always in the same 5'-to-3' orientation and on the 3' end of a betaC-phi. From most IEC variants we could isolate active bacteriophages by mitomycin C treatment, of which lysogens were generated in S. aureus R5 (broad phage host). All IEC-carrying bacteriophages integrated into hlb, as was measured by Southern blotting of R5 lysogens. Large quantities of the different bacteriophages were obtained by mitomycin C treatment of the lysogens, and bacteriophages were collected and used to reinfect all lysogenic R5 strains. In total, five lytic families were found. Furthermore, phage DNA was isolated and digested with EcoR1, revealing that one IEC variant can be found on different betaI-phis. In conclusion, the four human-specific innate immune modulators SCIN, CHIPS, SAK, and SEA form an IEC that is easily transferred among S. aureus strains by a diverse group of beta-hemolysin-converting bacteriophages.

  3. Disease: H00056 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available H00056 Alzheimer's disease (AD) Alzheimer's disease (AD) is a chronic disorder tha...sak JM, Holtzman DM ... TITLE ... The role of apolipoprotein E in Alzheimer's disease. ... JOURNAL ... Neuron 63:2...87-303 (2009) DOI:10.1016/j.neuron.2009.06.026 ... PMID:18802446 ... AUTHORS ... Bertram L, Tanzi RE ... TITLE ... Thirty years of Alzheimer...Cacabelos R ... TITLE ... Pharmacogenomics in Alzheimer's disease. ... JOURNAL ... Methods Mol Biol 448:213-357 (2...008) DOI:10.1007/978-1-59745-205-2_10 ... PMID:17082447 ... AUTHORS ... Goedert M, Spillantini MG ... TITLE ... A century of Alzheimer

  4. Evolución de las competencias en la práctica de la psicología organizacional

    OpenAIRE

    Melero Palanco, Jorge

    2015-01-01

    Treball Final de Màster Universitari en Psicologia del Treball, de les Organitzacions i en Recursos Humans. Codi: SAK034. Curs: 2014/2015 En el presente trabajo, se presentan los principales conocimientos teóricos que se han ido desarrollando en los diferentes bloques y asignaturas del Máster de Psicología del trabajo, las Organizaciones y en Recursos Humanos, destacando cuáles han sido los aspectos clave a lo largo de éste. Asimismo, se realiza una reflexión acerca de las compete...

  5. Crosstalk between SNF1 pathway and the peroxisome-mediated lipid metabolism in Magnaporthe oryzae.

    Directory of Open Access Journals (Sweden)

    Xiao-Qing Zeng

    Full Text Available The SNF1/AMPK pathway has a central role in response to nutrient stress in yeast and mammals. Previous studies on SNF1 function in phytopathogenic fungi mostly focused on the catalytic subunit Snf1 and its contribution to the derepression of cell wall degrading enzymes (CWDEs. However, the MoSnf1 in Magnaporthe oryzae was reported not to be involved in CWDEs regulation. The mechanism how MoSnf1 functions as a virulence determinant remains unclear. In this report, we demonstrate that MoSnf1 retains the ability to respond to nutrient-free environment via its participation in peroxisomal maintenance and lipid metabolism. Observation of GFP-tagged peroxisomal targeting signal-1 (PTS1 revealed that the peroxisomes of ΔMosnf1 were enlarged in mycelia and tended to be degraded before conidial germination, leading to the sharp decline of peroxisomal amount during appressorial development, which might impart the mutant great retard in lipid droplets mobilization and degradation. Consequently, ΔMosnf1 exhibited inability to maintain normal appressorial cell wall porosity and turgor pressure, which are key players in epidermal infection process. Exogenous glucose could partially restore the appressorial function and virulence of ΔMosnf1. Toward a further understanding of SNF1 pathway, the β-subunit MoSip2, γ-subunit MoSnf4, and two putative Snf1-activating kinases, MoSak1 and MoTos3, were additionally identified and characterized. Here we show the null mutants ΔMosip2 and ΔMosnf4 performed multiple disorders as ΔMosnf1 did, suggesting the complex integrity is essential for M. oryzae SNF1 kinase function. And the upstream kinases, MoSak1 and MoTos3, play unequal roles in SNF1 activation with a clear preference to MoSak1 over MoTos3. Meanwhile, the mutant lacking both of them exhibited a severe phenotype comparable to ΔMosnf1, uncovering a cooperative relationship between MoSak1 and MoTos3. Taken together, our data indicate that the SNF1 pathway is

  6. Complex function theory

    CERN Document Server

    Sarason, Donald

    2007-01-01

    Complex Function Theory is a concise and rigorous introduction to the theory of functions of a complex variable. Written in a classical style, it is in the spirit of the books by Ahlfors and by Saks and Zygmund. Being designed for a one-semester course, it is much shorter than many of the standard texts. Sarason covers the basic material through Cauchy's theorem and applications, plus the Riemann mapping theorem. It is suitable for either an introductory graduate course or an undergraduate course for students with adequate preparation. The first edition was published with the title Notes on Co

  7. Emergency Fuels Technology

    Science.gov (United States)

    1982-06-01

    example is a naphtha containing 18 percent of materialL . boiling off at 93*C and a natural gasoline containing 70 percent of material " boiling off at 93*C... TRANSPORTATION SCHOOL PROJ MGR M60 TANK DEVELOP. ATTN ATSP-CD-MS ATTN DRCPM-M60-E FORT EUSTIS VA 23604 WARREN MI 48090 12/82 AFLRL No. 155 Page 3 of 5 CHIEF...AFLRL No. 155 Page 4of 5 V - OTHER GOVERNMENT AGENCIES SCI & TECH INFO FACILITY ATTN NASA REP (SAK/DL) 1 US DEPARTMENT OF TRANSPORTATION P 0 BOX 8757

  8. METHANE HYDRATE PRODUCTION FROM ALASKAN PERMAFROST

    Energy Technology Data Exchange (ETDEWEB)

    Donn McGuire; Steve Runyon; Richard Sigal; Bill Liddell; Thomas Williams; George Moridis

    2005-02-01

    Natural-gas hydrates have been encountered beneath the permafrost and considered a nuisance by the oil and gas industry for years. Engineers working in Russia, Canada and the USA have documented numerous drilling problems, including kicks and uncontrolled gas releases, in arctic regions. Information has been generated in laboratory studies pertaining to the extent, volume, chemistry and phase behavior of gas hydrates. Scientists studying hydrate potential agree that the potential is great--on the North Slope of Alaska alone, it has been estimated at 590 TCF. However, little information has been obtained on physical samples taken from actual rock containing hydrates. This gas-hydrate project is in the final stages of a cost-shared partnership between Maurer Technology, Noble Corporation, Anadarko Petroleum, and the U.S. Department of Energy's Methane Hydrate R&D program. The purpose of the project is to build on previous and ongoing R&D in the area of onshore hydrate deposition to identify, quantify and predict production potential for hydrates located on the North Slope of Alaska. Hot Ice No. 1 was planned to test the Ugnu and West Sak sequences for gas hydrates and a concomitant free gas accumulation on Anadarko's 100% working interest acreage in section 30 of Township 9N, Range 8E of the Harrison Bay quadrangle of the North Slope of Alaska. The Ugnu and West Sak intervals are favorably positioned in the hydrate-stability zone over an area extending from Anadarko's acreage westward to the vicinity of the aforementioned gas-hydrate occurrences. This suggests that a large, north-to-south trending gas-hydrate accumulation may exist in that area. The presence of gas shows in the Ugnu and West Sak reservoirs in wells situated eastward and down dip of the Hot Ice location indicate that a free-gas accumulation may be trapped by gas hydrates. The Hot Ice No. 1 well was designed to core from the surface to the base of the West Sak interval using the

  9. Savisaare erakonda toetab veerand kõigist valijatest / Tuuli Koch

    Index Scriptorium Estoniae

    Koch, Tuuli

    2006-01-01

    Ilmunud ka: Postimees : na russkom jazõke ja Pärnu Postimees 9. märts lk. 2,5. Veebruaris korraldas TSN Emor Eesti erakondade reitingu uurimuse, mille kohaselt Keskerakonna toetajaid oli 25%, Reformierakonna toetajaid 13% ning ülejäänud erakonnad said 7 ja vähem protsenti toetushäältest. Graafik: Populaarseim partei on Keskerakond. Diagrammid: Toetus Keskerakonnale (%). Lisa: Parteide toetus. Arvamust avaldavad: Katrin Saks, Margus Tsahkna, Ott Lumi, Kadri Must, Agu Uudelepp ja Kristen Michal. Vt. samas: Protsendi paranoia

  10. GETDB: 105310 [GETDB

    Lifescience Database Archive (English)

    Full Text Available 105310 Link to Original y[*] w[*]; P{GawB}NP6647 / TM6, P{UAS-lacZ.UW23-1}UW23-1 78...D4 Link to DGRC Genome Viewer: 105310 SAK M6 CG7597 6647 3 FlyBase Insertion: P{GawB}NP6647 NP line. Receive...humeral, weak epi internal - - - - - - - Show 105310 DGRC Number 105310 Link to Original Genotype y[*] w[*];... P{GawB}NP6647 / TM6, P{UAS-lacZ.UW23-1}UW23-1 Insertion Site 78D4 Map Viewer Link to DGRC Genome Viewer: 105310

  11. SYRUP AMKESOL REDUCES THE LEVEL OF PRIMARY AND SECONDARY PRODUCTS OF LIPID PEROXIDATION AND TOXIC METABOLITES OF NITRIC OXIDE IN BLOOD SERUM OF IMMATURE RATS WITH BRONCHIOLITIS

    Directory of Open Access Journals (Sweden)

    Storozhenko KV

    2017-03-01

    Full Text Available Aim of this study was to determine the pharmacological effect of syrup Amkesol evaluating the blood serum levels of primary and secondary products of lipid peroxidation, activity of AO enzymes and final rates of NO metabolites in immature rats of different ages with experimental model of bronchoalveolitis. Materials and Methods: The study was carried out on 90 WAG immature rats of ages 1, 2 and 3 menthes, that correlates by morpho-functional features to 4, 10 and 14 years of human age respectively, on a model of bronchoalveolitis. Experimental animals in each age series were randomly divided into 5 groups (n = 6: intact (healthy, 2 groups of control (untreated with bronchoalveolitis 7 and 14 days, and two groups with bronchoalveolatis that received S-AKS daily during 7 and 14 days. The pathological process implemented by inhalation of irritant (Sephadex A-25 Pharmacia, Sweden (5 mg/kg. In the blood serum samples activity of CAT, SOD, content of DC, TBARS, total NO, nitrates and nitrites were determined. Probability of the results was evaluated by using GraphPad Prism Software. The critical level of significance was taken equal to 0.05. Results. The use of S-AKS on the 7th day in the group of 1- and 3-month-old rats significantly exceeded activity of CAT compared to the control group of animals of corresponded age. The SOD activity in group of 2-month-old animals was restored to intact level, the activity of CAT exceeded the baseline level and amounted to 129% (P≤0,05. The concentration of DC in 1-month-old rats was lower by 45.3% in 2 monthly - by 12.5% than in the control group, in the group of 3 month-old animals - restored to normal (P≤0,05. The level of NO metabolites was significantly decreased compared to the corresponding control group in all age series (P≤0,05. After 14 days of treatment with S-AKS in all age group of animals observed restore the contents of primary and secondary products of lipid peroxidation compared to the

  12. Prior-Free Multi-Unit Auctions with Ordered Bidders

    Science.gov (United States)

    2014-05-01

    analysis framework based on revenue benchmarks [6, 20]; see also the survey by Hartline and Karlin [15].1 The idea is to define a real-valued function on...Goldberg, J. D. Hartline, A. Karlin , M. Saks, and A. Wright. Competitive auctions. Games and Economic Behavior, 55(2):242–269, 2006. [12] A. V...design. Book in preparation, 2012. [15] J. D. Hartline and A. Karlin . Profit maximization in mechanism design. In N. Nisan, T. Rough- garden, É. Tardos

  13. Kolga-Jaani kihelkond ja Vabaduse Risti vennad / Jaak Pihlak

    Index Scriptorium Estoniae

    Pihlak, Jaak

    2003-01-01

    Viljandimaaga seotud järgmiste Vabadusristi kavaleride elulood: Jakob Aaren, Joosep Aas, Anton Anni, Jakob Ant, Peeter-Viktor Kanasaar, Julius Kasper, Martin-Alexander Kepmann, Georg Kesküla, Peeter Kolts, Joosep Korts, August Kull, Georg Kütt, Georg Liiv, Eduard Meijel, August Moks, Theodor Mölter, Arnold-Rudolf Orik, August Paia, Aleksander Pajur, Oskar Parvet, Tõnis Pedak, August Pent, Heinrich Puidak, Jaan Päsna, Elmar Rei, Ernst Saar, Jüri Saks, August Schönberg, August-Johannes Teose, Hans Timpson, Anton Unt, Julian Vares, Paul Vares

  14. Optimization of waste water discharge and waste water cleaning on the basis of measurements of the organic pollutant load; Optimierung von Abwasserableitung und Abwasserreinigung durch Messung der organischen Abwasserbelastung

    Energy Technology Data Exchange (ETDEWEB)

    Haeck, M. [Dr. Bruno Lange GmbH Berlin, Duesseldorf (Germany)

    1999-07-01

    The spectral absorption coefficient (SAC) is a sum parameter for describing the organic pollutant load of waste water. It is based on a purely physical measuring technique and can be monitored continuously and directly in the medium by means of the described UV process probe. From this arise numerous opportunities for optimizing waste water discharge and cleaning. (orig.) [German] Der spektrale Absorptionskoeffizient (SAK) ist ein Summenparameter zur Beschreibung der organischen Abwasserbelastung. Er basiert auf einem rein physikalischen Messverfahren und kann mit der hier vorgestellten UV-Prozess-Sonde kontinuierlich und direkt im Medium erfasst werden. Daraus ergeben sich zahlreiche Moeglichkeiten zur Optimierung von Abwasserableitung und -reinigung. (orig.)

  15. Flavour-active wine yeasts

    OpenAIRE

    Cordente, Antonio G.; Curtin, Christopher D.; Varela, Cristian; Pretorius, Isak S.

    2012-01-01

    The flavour of fermented beverages such as beer, cider, saké and wine owe much to the primary fermentation yeast used in their production, Saccharomyces cerevisiae. Where once the role of yeast in fermented beverage flavour was thought to be limited to a small number of volatile esters and higher alcohols, the discovery that wine yeast release highly potent sulfur compounds from non-volatile precursors found in grapes has driven researchers to look more closely at how choice of yeast can infl...

  16. Eestlased graafikanäitustel / Benjamin Vasserman

    Index Scriptorium Estoniae

    Vasserman, Benjamin

    1999-01-01

    IV Kochi graafikatriennaalil Jaapanis 13. III-18. IV osales Eestist Benjamin Vasserman tööga "Vaheldus I". Peapreemia: Eduardo Roca Zalazar. XIV rahvusvahelisel graafikanäitusel "Premio Internationale Biella per I'Incisione" Itaalias 23. IV-23. V osalesid Eestist Peeter Allik, Reti Saks, Benjamin Vasserman. Näituse nimeline preemia: Seung Yeon Kim. 26. VIII avati Fredrikstadis 12. Norra rahvusvaheline graafikatriennaal. 5. nov. avatakse X Varna graafikabiennaal Bulgaarias, 15. XII ئ III Egiptuse graafikatriennaal Gizas. "International Print Triennial Cracow 2000" näitustest

  17. Characterization of oil and gas reservoir heterogeneity. Annual report, November 1, 1990--October 31, 1991

    Energy Technology Data Exchange (ETDEWEB)

    1991-12-31

    The objective of the cooperative research program is to characterize Alaskan reservoirs in terms of their reserves, physical and chemical properties, geologic configuration and structure, and the development potential. The tasks completed during this period include: (1) geologic reservoir description of Endicott Field; (2) petrographic characterization of core samples taken from selected stratigraphic horizons of the West Sak and Ugnu (Brookian) wells; (3) development of a polydispersed thermodynamic model for predicting asphaltene equilibria and asphaltene precipitation from crude oil-solvent mixtures, and (4) preliminary geologic description of the Milne Point Unit.

  18. Characterization of oil and gas reservoir heterogeneity

    Energy Technology Data Exchange (ETDEWEB)

    1991-01-01

    The objective of the cooperative research program is to characterize Alaskan reservoirs in terms of their reserves, physical and chemical properties, geologic configuration and structure, and the development potential. The tasks completed during this period include: (1) geologic reservoir description of Endicott Field; (2) petrographic characterization of core samples taken from selected stratigraphic horizons of the West Sak and Ugnu (Brookian) wells; (3) development of a polydispersed thermodynamic model for predicting asphaltene equilibria and asphaltene precipitation from crude oil-solvent mixtures, and (4) preliminary geologic description of the Milne Point Unit.

  19. Characterization of oil and gas reservoir heterogeneity; Final report, November 1, 1989--June 30, 1993

    Energy Technology Data Exchange (ETDEWEB)

    Sharma, G.D.

    1993-09-01

    The Alaskan North Slope comprises one of the Nation`s and the world`s most prolific oil province. Original oil in place (OOIP) is estimated at nearly 70 BBL (Kamath and Sharma, 1986). Generalized reservoir descriptions have been completed by the University of Alaska`s Petroleum Development Laboratory over North Slope`s major fields. These fields include West Sak (20 BBL OOIP), Ugnu (15 BBL OOIP), Prudhoe Bay (23 BBL OOIP), Kuparuk (5.5 BBL OOIP), Milne Point (3 BBL OOIP), and Endicott (1 BBL OOIP). Reservoir description has included the acquisition of open hole log data from the Alaska Oil and Gas Conservation Commission (AOGCC), computerized well log analysis using state-of-the-art computers, and integration of geologic and logging data. The studies pertaining to fluid characterization described in this report include: experimental study of asphaltene precipitation for enriched gases, CO{sup 2} and West Sak crude system, modeling of asphaltene equilibria including homogeneous as well as polydispersed thermodynamic models, effect of asphaltene deposition on rock-fluid properties, fluid properties of some Alaskan north slope reservoirs. Finally, the last chapter summarizes the reservoir heterogeneity classification system for TORIS and TORIS database.

  20. Nest survival of piping plovers at a dynamic reservoir indicates an ecological trap for a threatened population.

    Science.gov (United States)

    Anteau, Michael J; Shaffer, Terry L; Sherfy, Mark H; Sovada, Marsha A; Stucker, Jennifer H; Wiltermuth, Mark T

    2012-12-01

    In the past 60 years, reservoirs have reshaped riverine ecosystems and transformed breeding habitats used by the threatened piping plover (Charadrius melodus; hereafter plover). Currently, 29 % of the Northern Great Plains plover population nests at reservoirs that might function as ecological traps because reservoirs have more diverse habitat features and greater dynamics in water levels than habitats historically used by breeding plovers. We examined factors influencing daily survival rates (DSR) of 346 plover nests at Lake Sakakawea (SAK; reservoir) during 2006-2009 by evaluating multiple a priori models, and we used our best model to hindcast nest success of plovers during 1985-2009. Our observed and hindcast estimates of nest success were low compared to published estimates. Previous findings indicate that plovers prefer nest sites that are low relative to water level. We found that elevation of nests above the water level had a strong positive correlation with DSR because water levels of SAK typically increased throughout the nesting period. Habitat characteristics on the reservoir differ from those that shaped nest-site selection for plovers. Accordingly, extraordinary nest loss occurs there in many years, largely due to inundation of nests, and based on low fledging rates those losses were not compensated by potential changes in chick survival. Therefore, our example supports the concept of ecological traps in birds because it addresses quantitative assessments of habitat preference and productivity over 25 years (since species listing) and affects a large portion of the population.

  1. Schistosoma mansoni Polo-like kinases and their function in control of mitosis and parasite reproduction.

    Science.gov (United States)

    Dissous, Colette; Grevelding, Christoph G; Long, Thavy

    2011-06-01

    Polo-like kinases are important regulators of cell cycle progression and mitosis. They constitute a family of conserved serine/threonine kinases which are highly related in their catalytic domains and contain polo boxes involved in protein-protein interactions and subcellular localization. In mammals, five Plks (Plk 1-5) encompass diverse roles in centrosome dynamics, spindle formation, intra S-phase and G2/M checkpoints and DNA damage response. Plk1 is a key positive regulator of mitosis and is overexpressed in various types of cancers. Plk4 is a divergent member of the Plk family, with essential functions in centriole duplication. Homozygous disruption of Plk1 or Plk4 in mice is lethal in embryos. Two Plk members SmPlk1 and SmSak, homologous to Plk1 and Plk4 respectively, are present in the parasitic platyhelminth Schistosoma mansoni. Structural and functional analyses of SmPlk1 have demonstrated its conserved function in the regulation of cell cycle G2/M transition in Xenopus oocytes. The anti-cancer drug BI 2536 (the most potent and selective Plk1 inhibitor) inhibits specifically the catalytic activity of SmPlk1 and induced profound alterations in schistosome gonads, indicating a role of SmPlk1 in parasite gametogenesis and its potential as a novel chemotherapeutic target against schistosomiasis. Functions of SmSak in cell cycle regulation and schistosome gonad development are currently investigated.

  2. Evidence for Domesticated and Wild Populations of Saccharomyces cerevisiae.

    Directory of Open Access Journals (Sweden)

    2005-07-01

    Full Text Available Saccharomyces cerevisiae is predominantly found in association with human activities, particularly the production of alcoholic beverages. S. paradoxus, the closest known relative of S. cerevisiae, is commonly found on exudates and bark of deciduous trees and in associated soils. This has lead to the idea that S. cerevisiae is a domesticated species, specialized for the fermentation of alcoholic beverages, and isolates of S. cerevisiae from other sources simply represent migrants from these fermentations. We have surveyed DNA sequence diversity at five loci in 81 strains of S. cerevisiae that were isolated from a variety of human and natural fermentations as well as sources unrelated to alcoholic beverage production, such as tree exudates and immunocompromised patients. Diversity within vineyard strains and within saké strains is low, consistent with their status as domesticated stocks. The oldest lineages and the majority of variation are found in strains from sources unrelated to wine production. We propose a model whereby two specialized breeds of S. cerevisiae have been created, one for the production of grape wine and one for the production of saké wine. We estimate that these two breeds have remained isolated from one another for thousands of years, consistent with the earliest archeological evidence for winemaking. We conclude that although there are clearly strains of S. cerevisiae specialized for the production of alcoholic beverages, these have been derived from natural populations unassociated with alcoholic beverage production, rather than the opposite.

  3. Using continuous UV extinction measurements to monitor and control the aerated phase of sequencing batch reactors; Einsatz der kontinuierlichen UV-Extinktionsmessung fuer die Ueberwachung und Regelung der Belueftungsphase in SBR-Anlagen

    Energy Technology Data Exchange (ETDEWEB)

    Nicolet, L.; Rott, U. [Stuttgart Univ. (Germany). Inst. fuer Siedlungswasserbau, Wasserguete- und Abfallwirtschaft; Bardeck, S. [Optek-Danulat GmbH (Germany)

    1999-07-01

    The work describes the measurement of UV extinction - expressed as the spectral absorption coefficient SAC - at a randomly chosen wave length as a technique for monitoring organic load in effluents from sequencing batch reactors (SBR) at municipal and industrial waste water treatment plants. Further described is to what extent the continuous determination of the SAC can be used in practice for the control of the aerated phase of sequencing batch reactors. By this means, process stabilization and optimization can be achieved and operating reliability can be enhanced. (orig.) [German] Inhalt dieses Beitrages ist es, die Messung der UV-Extinktion - ausgedrueckt durch den spektralen Absorptionskoeffizient (SAK) - bei einer frei gewaehlten Wellenlaenge als Verfahren fuer die Ueberwachung der organischen Belastung in den Ablaeufen von SBR-Anlagen (Sequencing-Batch-Reactor) in der kommunalen und industriellen Abwasserreinigung vorzustellen. Weiterhin soll dargestellt werden, in wieweit die kontinuierliche Bestimmung des SAK in der Praxis fuer die Regelung der beluefteten Phase von SBR-Anlagen eingesetzt werden kann. Hiermit kann eine Prozessstabilisierung und -optimierung der Anlagen erreicht sowie die Betriebssicherheit erhoeht werden. (orig.)

  4. Scientific Creativity and High Ability: Gender and academic level differences

    Directory of Open Access Journals (Sweden)

    Fernando Javier ESPARZA MOLINA

    2015-10-01

    Full Text Available  The purpose of this study was to investigate the influence of gender and educational level on scientific creativity among gifted/talented students. A cohort of creatividad científica y alta habilidad: diferencias de género y nivel educativo 78 secondary school students from 12 to 16 years old participated in this research. The scientific creativity was measured using the Creative Scientific Ability Test (Sak & Ayas, 2011 designed for secondary school students from 11 to 14 years old. Its theoretical framework sets up the measurement of a three dimensional structure: general creative abilities (fluency, flexibility and creativity, scientific creative abilities (hypothesis generation, hypothesis testing and evidence evaluation and scientific knowledge. This test has the right adequate psychometric properties with a Cronbach’s alpha coefficient of 0.848 (Sak & Ayas, 2013. Results indicated that male students scored significantly higher in a task named Interaction Graph which measures hypothesis generation in interdisciplinary science. The analysis also showed that students involved in upper education levels scores significantly higher in general fluency and in the task called The Food Chain which measures evidence evaluation in the area of ecology.

  5. KELUARGA NIRKEKERASAN SEBAGAI PRASYARAT KELUARGA SAKÎNAH

    Directory of Open Access Journals (Sweden)

    Moh. Makmun

    2015-09-01

    Full Text Available The article tries to redefine the meaning of sakînah family by emphasizing the importance of understanding the essence of marriage and domestic violence, which leads to criminal action, for spouse. Marriage is a social contract and agreement between a man and a woman, which aims at legalizing sexual interaction, making familial relationship through marriage, ensuring one’s descendant, making a family, and living life together. Criminal action within marital relationship is any action committed by each spouse over another that violates laws, any action that harms his/her spouse physically, physiologically and economically, and/or a spouse who ignores his/her responsibility over another and over his/her children in the domestic sphere. Sakînah family is a family which build on the basis of faith and piety upon God, a family whose breadwinner is able to fulfill the needs of family members based on his ability, a family which lives harmoniously and peacefully, a family which possesses ability and capability to overcome any conflicts among its members, a family with no violence and domestic crime, and a family whose members play their role respectively.

  6. Genetic diversity and population structure of Nuphar submersa (Nymphaeaceae), a critically endangered aquatic plant endemic to Japan, and implications for its conservation.

    Science.gov (United States)

    Shiga, Takashi; Yokogawa, Masashi; Kaneko, Shingo; Isagi, Yuji

    2017-01-01

    Nuphar submersa (Nymphaeaceae) is a critically endangered freshwater macrophyte indigenous to central Japan, with only four small extant populations represented across its entire range. We investigated the genotypic and genetic diversity as well as the genetic structure of all extant individuals of N. submersa based on analysis of 15 microsatellite loci. Among 278 individual ramets, 52 multilocus genotypes were detected: 30 genotypes in Nikko City (NIK), 18 in Nasukarasuyama City (NAS), 3 in Mooka City (MOK), and 1 in Sakura City (SAK). The average number of alleles per locus ranged from 1.20 to 1.93, whereas the observed and expected heterozygosities ranged from 0.11 to 0.33 and from 0.10 to 0.24, respectively. With the exception of SAK, all populations contained multiple clones, but our results indicated low levels of within-population genetic diversity. The populations NIK and NAS comprised few large or middle-sized genets and many small genets. The populations NIK and NAS were suggested to comprise large old, old fragmented, and/or young small genets resulting from seedling establishment. All four populations were differentiated, and gene flow between the populations was restricted (average level of gene flow (Nm) = 0.122, G' ST  = 0.639). Of the total genetic diversity, 67.20 and 9.13% were attributable to inter- and intra-population diversity, respectively. STRUCTURE analysis revealed two or three well-differentiated groups of populations. Cluster I comprised one population (NIK) and cluster II comprised the remaining populations at K = 2. The populations NIK, NAS, and the remaining populations were assigned to clusters I, II, and III, respectively, at K = 3. For conservation practices, we recommend that each cluster be regarded as a different management unit. We further suggest that artificial gene flow among MOK and SAK populations is an appropriate option, whereas NIK should not be reinforced with genotypes from the remaining populations.

  7. Questioni minori di lingua e cultura egiziana

    Directory of Open Access Journals (Sweden)

    Franco Crevatin

    2000-12-01

    Full Text Available Il graffito Sakkara T (riedito in K. A. Kitchen, Ramess. Inscript. 3, 438, datato all' anno 48 del regno di Ramesse II, è piuttosto interessante: iscritto sulle pareti di uno dlegli edifici del complesso funerario del Faraone Djoser, esso è composto da due testi distinti (A: 1-4; B: 5-7, redatti da due persone diverse che forse sono andate assieme per turismo culturale o religioso a Sak.kara. B è costituito da una serie di auguri funebri piuttosto banali, mentre A, molto mal conservato, pone problemi esegetici fastidiosi. Dopo la datazione e la citazione del nome del redattore, compare un poco comprensibile ]hry wtś-R' [, che il primo editore del testo ha ritenuto equivalente alla designazione della necropoli.

  8. A Livestock-Associated, Multidrug-Resistant, Methicillin-Resistant Staphylococcus aureus Clonal Complex 97 Lineage Spreading in Dairy Cattle and Pigs in Italy

    DEFF Research Database (Denmark)

    Feltrin, Fabiola; Alba, Patricia; Kraushaar, Britta

    2016-01-01

    Pandemic methicillin-resistant Staphylococcus aureus (MRSA) clonal complex 97 (CC97) lineages originated from livestock-to-human host jumps. In recent years, CC97 has become one of the major MRSA lineages detected in Italian farmed animals. The aim of this study was to characterize and analyze...... by macrorestriction pulsed-field gel electrophoresis (PFGE) analysis, multilocus sequence typing (MLST), spa typing, staphylococcal cassette chromosome mec (SCCmec) typing, and antimicrobial resistance pattern analysis. Virulence and resistance genes were investigated by PCR and microarray analysis. Most...... Panton-Valentine leukocidin (PVL) negative, and a few (n = 7) tested positive for sak or scn. All MRSA isolates were multidrug resistant (MDR), and the main features were erm(B)- or erm(C)-mediated (n = 18) macrolide-lincosamide-streptogramin B resistance, vga(A)-mediated (n = 37) pleuromutilin...

  9. Tinjauan Hukum Islam terhadap Perkawinan Beda Kelas Muslim Sasak di Lombok

    Directory of Open Access Journals (Sweden)

    Basriadi Basriadi

    2015-08-01

    Full Text Available This article attempts to examine in depth, based on the theory of kafâ‘ah, different class marriages in the Sasak Muslim community, Lombok. The study concludes that on one hand, the different class marriages between noblewomen and non-noblemen do not have an impact on the purpose of marriage which is to create sakînah, mawaddah, and rahmah household. On the other hand, the marriage that is based on Islamic values is able to realize a happy and harmonious household regardless of social status background. The most important thing in domestic life is communication and trust between husbands and wives. In fiqh munâkah}ât, it is required when someone is looking for a spouse, something that needs to be seen is lineage, beauty, wealth and religion. This article would like to emphasize that there is no prohibition in Islam to marry people of different social class.

  10. Editorial

    CERN Multimedia

    Staff Association

    2012-01-01

    For its fiftieth anniversary the Kindergarten and School run by the Staff Association   is in better shape than ever. The CERN site has resounded for 50 years with the joyful shouts of the children there. It is indeed in this joyful and multicultural atmosphere than many generations of children of CERN staff have followed one another all those years. Operating on one of the most beautiful sites of CERN and supervised by competent and creative professionals, the children learn through play, the basics needed for their integration into society and entry into academic learning. Active learning is the heart of the action.  Children take in knowledge as they develop and are exposed to multiple experiences. The activities proposed in the SAKS are based on a global approach to development as well as on values such as self-respect, respect towards others, the environment, autonomy, sharing, cooperation, communication and creativity. In the large, specially designed garden surrounding...

  11. Orlicz difference sequence spaces generated by infinite matrices and de la Vallée-Poussin mean of order α

    Directory of Open Access Journals (Sweden)

    Bipan Hazarika

    2016-10-01

    Full Text Available In this paper we introduce the spaces V^λ[A,M,Δ,p]o,V^λ[A,M,Δ,p] and V^λ[A,M,Δ,p]∞ generated by infinite matrices defined by Orlicz functions. Also we introduce the concept of S^λ[A,Δ]−convergence and derive some results between the spaces S^λ[A,Δ] and V^λ[A,Δ]. Further, we study some geometrical properties such as order continuity, the Fatou property and the Banach–Saks property of the new space V^λα[A,Δ,p]∞. Finally, we introduce the notion of almost λ-statistically-[A, Δ]-convergence of order α or S^λα[A,Δ]−convergence and obtain some inclusion relations between the set S^λα[A,Δ] and the space V^λα[A,Δ,p]∞.

  12. Schistosoma mansoni polo-like kinases and their function in control of mitosis and parasite reproduction

    Directory of Open Access Journals (Sweden)

    Colette Dissous

    2011-06-01

    Full Text Available Polo-like kinases are important regulators of cell cycle progression and mitosis. They constitute a family of conserved serine/threonine kinases which are highly related in their catalytic domains and contain polo boxes involved in protein-protein interactions and subcellular localization. In mammals, five Plks (Plk 1-5 encompass diverse roles in centrosome dynamics, spindle formation, intra S-phase and G2/M checkpoints and DNA damage response. Plk1 is a key positive regulator of mitosis and is overexpressed in various types of cancers. Plk4 is a divergent member of the Plk family, with essential functions in centriole duplication. Homozygous disruption of Plk1 or Plk4 in mice is lethal in embryos. Two Plk members SmPlk1 and SmSak, homologous to Plk1 and Plk4 respectively, are present in the parasitic platyhelminth Schistosoma mansoni. Structural and functional analyses of SmPlk1 have demonstrated its conserved function in the regulation of cell cycle G2/M transition in Xenopus oocytes. The anti-cancer drug BI 2536 (the most potent and selective Plk1 inhibitor inhibits specifically the catalytic activity of SmPlk1 and induced profound alterations in schistosome gonads, indicating a role of SmPlk1 in parasite gametogenesis and its potential as a novel chemotherapeutic target against schistosomiasis. Functions of SmSak in cell cycle regulation and schistosome gonad development are currently investigatedQuinases do tipo Polo ("polo-like" são importantes reguladores da progressão do ciclo celular e da mitose. Elas constituem uma família de serina/treonina quinases que são altamente relacionadas entre si no seu domínio catalítico e contêm blocos "polo" envolvidos com interações proteína-proteína e com localização subcelular. Em mamíferos, cinco Plks (Plk 1-5 englobam diversos papéis na dinâmica do centrossomo, formação do fuso, "checkpoints" dentro da fase S e da transição G2/M, e na resposta aos danos do DNA. Plk1 é um regulador

  13. Klp10A modulates the localization of centriole-associated proteins during Drosophila male gametogenesis.

    Science.gov (United States)

    Gottardo, Marco; Callaini, Giuliano; Riparbelli, Maria Giovanna

    2016-12-16

    Mutations in Klp10A, a microtubule-depolymerising Kinesin-13, lead to overly long centrioles in Drosophila male germ cells. We demonstrated that the loss of Klp10A modifies the distribution of typical proteins involved in centriole assembly and function. In the absence of Klp10A the distribution of Drosophila pericentrin-like protein (Dplp), Sas-4 and Sak/Plk4 that are restricted in control testes to the proximal end of the centriole increase along the centriole length. Remarkably, the cartwheel is lacking or it appears abnormal in mutant centrioles, suggesting that this structure may spatially delimit protein localization. Moreover, the parent centrioles that in control cells have the same dimensions grow at different rates in mutant testes with the mother centrioles longer than the daughters. Daughter centrioles have often an ectopic position with respect to the proximal end of the mothers and failed to recruit Dplp.

  14. NCBI nr-aa BLAST: CBRC-PVAM-01-0962 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0962 ref|NP_735995.1| hypothetical protein gbs1559 [Streptococcus agal...actiae NEM316] ref|YP_330130.1| hypothetical protein SAK_1524 [Streptococcus agalactiae A909] ref|ZP_00785276.1| Unknown [Streptococc...us agalactiae COH1] ref|ZP_00790163.1| Unknown [Streptococcus agalactiae 515] emb|CAD47218.1| Unknown [Strep...tococcus agalactiae NEM316] gb|ABA44427.1| conserved hypothetical protein [Strept...ococcus agalactiae A909] gb|EAO71108.1| Unknown [Streptococcus agalactiae 515] gb|EAO75947.1| Unknown [Streptococcus agalactiae COH1] NP_735995.1 0.65 24% ...

  15. SAKIZ AĞACI (Pistacia lentiscus var. chia Duhamel)’NIN IN VITRO MİKROÇOĞALTIMI ÜZERİNE ARAŞTIRMALAR

    OpenAIRE

    TAŞKIN, Tuncer; İNAL, Abdullah

    2015-01-01

    Bu çalışmada, ülkemizde sayısı giderek azalan Sakız ağacı (Pistacia lentiscus L. var. chia)’ nın apikal sürgün uçları in vitro koşullarda farklı hormon konsantrasyonları içeren MS (Murashige ve Skoog, 1962) ve B5 (Gamborg ve ark., 1968) DKW (Driver ve Kuniyuki, 1984) ortamları orijinal ya da modifikasyonlar yapılarak ve antioksidantlar ilave edilerek hazırlanan ortamlarda kültüre alınmışlardır. Yaşlı ağaçlar ve genç fidanlardan alınan materyalde fenolik bileşiklerin etkisinden dolayı gelişebi...

  16. The Potential of Class II Bacteriocins to Modify Gut Microbiota to Improve Host Health.

    Science.gov (United States)

    Umu, Özgün C O; Bäuerl, Christine; Oostindjer, Marije; Pope, Phillip B; Hernández, Pablo E; Pérez-Martínez, Gaspar; Diep, Dzung B

    2016-01-01

    Production of bacteriocins is a potential probiotic feature of many lactic acid bacteria (LAB) as it can help prevent the growth of pathogens in gut environments. However, knowledge on bacteriocin producers in situ and their function in the gut of healthy animals is still limited. In this study, we investigated five bacteriocin-producing strains of LAB and their isogenic non-producing mutants for probiotic values. The LAB bacteriocins, sakacin A (SakA), pediocin PA-1 (PedPA-1), enterocins P, Q and L50 (enterocins), plantaricins EF and JK (plantaricins) and garvicin ML (GarML), are all class II bacteriocins, but they differ greatly from each other in terms of inhibition spectrum and physicochemical properties. The strains were supplemented to mice through drinking water and changes on the gut microbiota composition were interpreted using 16S rRNA gene analysis. In general, we observed that overall structure of the gut microbiota remained largely unaffected by the treatments. However, at lower taxonomic levels, some transient but advantageous changes were observed. Some potentially problematic bacteria were inhibited (e.g., Staphylococcus by enterocins, Enterococcaceae by GarML, and Clostridium by plantaricins) and the proportion of LAB was increased in the presence of SakA-, plantaricins- and GarML-producing bacteria. Moreover, the treatment with GarML-producing bacteria co-occurred with decreased triglyceride levels in the host mice. Taken together, our results indicate that several of these bacteriocin producers have potential probiotic properties at diverse levels as they promote favorable changes in the host without major disturbance in gut microbiota, which is important for normal gut functioning.

  17. Bacteriocin production and inhibition of Listeria monocytogenes by Lactobacillus sakei subsp. sakei 2a in a potentially synbiotic cheese spread.

    Science.gov (United States)

    Martinez, Rafael Chacon Ruiz; Staliano, Cristina Dini; Vieira, Antonio Diogo Silva; Villarreal, Martha Lissete Morales; Todorov, Svetoslav Dimitrov; Saad, Susana Marta Isay; Franco, Bernadette Dora Gombossy de Melo

    2015-06-01

    Survival, bacteriocin(s) production, and antilisterial effect of Lactobacillus sakei subsp. sakei 2a were evaluated in a potentially synbiotic cheese spread, throughout storage at 4 °C and 15 °C for up to 28 days, using culture-dependent (plate count) and culture-independent (qPCR) methods. Bacteriocin(s) production in the food product was monitored by phenotypic and molecular (RT-qPCR) techniques. Three cheese spread trials (T) containing the prebiotic fiber inulin were produced in duplicates and studied: T1 (control - without inoculation of lactic acid bacteria); T2 (inoculated with the non-bacteriocinogenic Lb. sakei ATCC 15521 strain), and T3 (inoculated with the bacteriocinogenic Lb. sakei 2a strain). The cheese spreads were challenged with Listeria monocytogenes serotypes 4b and 1/2a, individually added to the food product. The counts of Lb. sakei 2a in the cheese spread T3 remained high during storage and the growth of L. monocytogenes was inhibited at both temperatures, especially L. monocytogenes 4b in the food product kept at 15 °C due to the production of bacteriocins (up to 6,400 AU/mL). Expression of the genes sakP and sakQ encoding for bacteriocins production during the cheese spread storage was demonstrated. Lb. sakei 2a can be used for production of potentially synbiotic cheese spreads with increased safety. Copyright © 2015 Elsevier Ltd. All rights reserved.

  18. Poultry-Like pA+ Biotype of Staphylococcus aureus CC346/084 Clone in Human Population.

    Science.gov (United States)

    Piechowicz, Lidia; Garbacz, Katarzyna

    2016-07-01

    The aim of the study was (1) to analyse the prevalence of P-like pA+ biotype of S. aureus in material from healthy and diseased individuals, not employed at slaughterhouses or meat processing plants, and (2) to analyse the relatedness of these strains and their genetic variability. The study included 344 strains of Staphylococcus aureus isolated from hospitalized patients with staphylococcal infections and from healthy carriers. The biotypes of S. aureus were determined on the basis of fibrinolysin and β-haemolysin production, coagulation of bovine plasma, and type of growth on crystal violet agar. Additionally, the strains were tested for the synthesis of protein A in order to distinguish between P-like pA+ and poultry biotypes. Fibrinolysin gene (sak) and methicillin resistance (mecA) were detected by means of PCR. The clonal structure of studied strains was analysed using pulsed field gel electrophoresis and sequencing of spa gene. Finally, the strains were typed with a basic set of 23 bacteriophages. The strains belonging to P-like pA+ biotype corresponded to nearly 20 % of all the studied strains. In contrast to the human biotype, they formed one clonal complex, spa-CC346/084. The P-like pA+ biotype strains did not synthesize fibrinolysin, lacked the sak gene, and showed susceptibility to methicillin. In contrast to the human biotype strains, they belonged mostly to phage group II. The P-like pA+ biotype strains, previously described solely in meat products and meat industry workers, can be also present in hospitalized patients and extra-hospital carriers. These strains form a single, fibrinolysin-negative, clonal complex t084/CC346.

  19. Selection indicates preference in diverse habitats: a ground-nesting bird (Charadrius melodus) using reservoir shoreline.

    Science.gov (United States)

    Anteau, Michael J; Sherfy, Mark H; Wiltermuth, Mark T

    2012-01-01

    Animals use proximate cues to select resources that maximize individual fitness. When animals have a diverse array of available habitats, those selected could give insights into true habitat preferences. Since the construction of the Garrison Dam on the Missouri River in North Dakota, Lake Sakakawea (SAK) has become an important breeding area for federally threatened piping plovers (Charadrius melodus; hereafter plovers). We used conditional logistic regression to examine nest-site selection at fine scales (1, 3, and 10 m) during summers 2006-2009 by comparing characteristics at 351 nests to those of 668 random sites within nesting territories. Plovers selected sites (1 m(2)) that were lower than unused random sites, increasing the risk of nest inundation. Plovers selected nest sites that were flat, had little silt, and at least 1 cobble; they also selected for 3-m radius nest areas that were relatively flat and devoid of vegetation and litter. Ninety percent of nests had <38% coverage of silt and <10% slope at the site, and <15% coverage of vegetation or litter and <31% slope within the 3-m radius. Gravel was selected for at nest sites (11% median), but against in the area 10-m from the nest, suggesting plovers select for patches or strips of gravel. Although elevation is rarely evaluated in studies of ground-nesting birds, our results underscore its importance in habitat-selection studies. Relative to where plovers historically nested, habitat at SAK has more diverse topography, substrate composition, vegetation communities, and greater water-level fluctuations. Accordingly, our results provide an example of how habitat-selection results can be interpreted as habitat preferences because they are not influenced by desired habitats being scarce or absent. Further, our results will be useful for directing habitat conservation for plovers and interpreting other habitat-selection studies.

  20. Selection indicates preference in diverse habitats: a ground-nesting bird (Charadrius melodus using reservoir shoreline.

    Directory of Open Access Journals (Sweden)

    Michael J Anteau

    Full Text Available Animals use proximate cues to select resources that maximize individual fitness. When animals have a diverse array of available habitats, those selected could give insights into true habitat preferences. Since the construction of the Garrison Dam on the Missouri River in North Dakota, Lake Sakakawea (SAK has become an important breeding area for federally threatened piping plovers (Charadrius melodus; hereafter plovers. We used conditional logistic regression to examine nest-site selection at fine scales (1, 3, and 10 m during summers 2006-2009 by comparing characteristics at 351 nests to those of 668 random sites within nesting territories. Plovers selected sites (1 m(2 that were lower than unused random sites, increasing the risk of nest inundation. Plovers selected nest sites that were flat, had little silt, and at least 1 cobble; they also selected for 3-m radius nest areas that were relatively flat and devoid of vegetation and litter. Ninety percent of nests had <38% coverage of silt and <10% slope at the site, and <15% coverage of vegetation or litter and <31% slope within the 3-m radius. Gravel was selected for at nest sites (11% median, but against in the area 10-m from the nest, suggesting plovers select for patches or strips of gravel. Although elevation is rarely evaluated in studies of ground-nesting birds, our results underscore its importance in habitat-selection studies. Relative to where plovers historically nested, habitat at SAK has more diverse topography, substrate composition, vegetation communities, and greater water-level fluctuations. Accordingly, our results provide an example of how habitat-selection results can be interpreted as habitat preferences because they are not influenced by desired habitats being scarce or absent. Further, our results will be useful for directing habitat conservation for plovers and interpreting other habitat-selection studies.

  1. The response regulator BcSkn7 is required for vegetative differentiation and adaptation to oxidative and osmotic stresses in Botrytis cinerea.

    Science.gov (United States)

    Yang, Qianqian; Yin, Dafang; Yin, Yanni; Cao, Yi; Ma, Zhonghua

    2015-04-01

    The high-osmolarity glycerol pathway plays an important role in the responses of fungi to various environmental stresses. Saccharomyces cerevisiae Skn7 is a response regulator in the high-osmolarity glycerol pathway, which regulates the oxidative stress response, cell cycle and cell wall biosynthesis. In this study, we characterized an Skn7 orthologue BcSkn7 in Botrytis cinerea. BcSKN7 can partly restore the growth defects of S. cerevisiae SKN7 mutant and vice versa. The BcSKN7 mutant (ΔBcSkn7-1) revealed increased sensitivity to ionic osmotic and oxidative stresses and to ergosterol biosynthesis inhibitors. In addition, ΔBcSkn7-1 was also impaired dramatically in conidiation and sclerotial formation. Western blot analysis showed that BcSkn7 positively regulated the phosphorylation of BcSak1 (the orthologue of S. cerevisiae Hog1) under osmotic stress, indicating that BcSkn7 is associated with the high-osmolarity glycerol pathway in B. cinerea. In contrast with BcSak1, BcSkn7 is not involved in the regulation of B. cinerea virulence. All of the phenotypic defects of ΔBcSkn7-1 are restored by genetic complementation of the mutant with the wild-type BcSKN7. The results of this study indicate that BcSkn7 plays an important role in the regulation of vegetative differentiation and in the response to various stresses in B. cinerea. © 2014 BSPP AND JOHN WILEY & SONS LTD.

  2. El léxico cromático y la ideología maya Chromatic lexic and Maya ideology

    Directory of Open Access Journals (Sweden)

    Sanja Savkic

    2011-01-01

    Full Text Available Para acercarse al campo semántico de los colores, de primera importancia son diversos diccionarios de las lenguas mayances. El objetivo es hacer una descripción preliminar del vocabulario cromático, compuesto de cinco términos referidos a colores básicos que en el maya yucateco se llaman sak, ek', chak, k'an y ya'ax y significan "blanco", "negro", "rojo", "amarillo" y "verde-azul", respectivamente. El mismo vocabulario remite a determinadas categorías extralingüísticas que la lengua es capaz de acumular, reflejar y comunicar. Éstas dependen de una cultura particular, por lo que el estudio se amplía con las informaciones de diferentes fuentes escritas redactadas durante la época colonial. La intención es detectar los múltiples usos que se hacían en todos los ámbitos de la vida de los colores, lo cual a su vez permite considerar estos últimos como conceptualizaciones articuladas en pares de oposición o agrupamientos tripartitos.To gain greater insight into the color semantic field, it is important to consult various Mayance language dictionaries, in order to assemble a preliminary chromatic vocabulary, composed of five basic color terms which in Yucatec Maya are sak, ek', chak, k'an and ya'ax, or "white", "black", "red", "yellow" and "green-blue", respectively. The very vocabulary addresses certain extra-linguistic categories that language is capable of accumulating, reflecting, and communicating. These categories depend on a particular culture; consequently this study is amplified with greater information from different sources written during the colonial period in order to shed light on the many uses that the colors had in the aspects of human life which, at the same time, can be seen in conceptualizations articulated in pairs of opposition or tripartite groupings.

  3. Memoir and the Diagnosis of Schizophrenia: Reflections on The Center Cannot Hold, Me, Myself, and Them, and the 'Crumbling Twin Pillars' of Kraepelinian Psychiatry.

    Science.gov (United States)

    Woods, Angela M

    In 1896 Emil Kraepelin revolutionised the classification of psychosis by identifying what he argued were two natural disease entities: manic-depressive psychosis (bipolar disorder) and dementia praecox (schizophrenia). Kraepelin's twin pillars have governed psychiatric thinking, practice and research for over a century. However, a growing number of researchers, clinicians, and mental health service users argue contest the claim that there are fundamental differences between schizophrenia and bipolar disorder, and call for a symptom-led approach which prioritises subjective experience over diagnostic category. How can the published first-person accounts of experts by experience contribute to this debate? This short paper looks at the representation of psychiatric diagnosis in two much-lauded autobiographies: Kurt Snyder's Me, Myself, and Them: A Firsthand Account of One Young Person's Experience with Schizophrenia (2007) and Elyn Saks' The Center Cannot Hold: My Journey Through Madness (2007). As well as providing a prognosis and a plan for treatment, the psychiatric diagnosis of schizophrenia, for both these writers, gives shape and meaning to the illness experience and ultimately becomes the pivot or platform from which identity and memoir unfold. Saks and Snyder do not claim to speak for all people who receive a diagnosis of schizophrenia and it would be a mistake to read their texts in this way even if they did. But if the debate about the future of psychiatric nosology is going to respect subjective experience, the insights they and others offer in to the multiple meanings and effects of psychiatric diagnosis more than compel our attention.

  4. Alaska North Slope National Energy Strategy initiative: Analysis of five undeveloped fields

    Energy Technology Data Exchange (ETDEWEB)

    Thomas, C.P.; Allaire, R.B.; Doughty, T.C.; Faulder, D.D.; Irving, J.S.; Jamison, H.C.; White, G.J.

    1993-05-01

    The US Department of Energy was directed in the National Energy Strategy to establish a federal interagency task force to identify specific technical and regulatory barriers to the development of five undeveloped North Slope Alaska fields and make recommendations for their resolution. The five fields are West Sak, Point Thomson, Gwydyr Bay, Seal Island/Northstar, and Sandpiper Island. Analysis of environmental, regulatory, technical, and economic information, and data relating to the development potential of the five fields leads to the following conclusions: Development of the five fields would result in an estimated total of 1,055 million barrels of oil and 4.4 trillion cubic feet of natural gas and total investment of $9.4 billion in 1992 dollars. It appears that all five of the fields will remain economically marginal developments unless there is significant improvement in world oil prices. Costs of regulatory compliance and mitigation, and costs to reduce or maintain environmental impacts at acceptable levels influence project investments and operating costs and must be considered in the development decision making process. The development of three of the fields (West Sak, Point Thomson, and Gwydyr Bay) that are marginally feasible would have an impact on North Slope production over the period from about 2000 to 2014 but cannot replace the decline in Prudhoe Bay Unit production or maintain the operation of the Trans-Alaska Pipeline System (TAPS) beyond about 2014 with the assumption that the TAPS will shut down when production declines to the range of 400 to 200 thousand barrels of oil/day. Recoverable reserves left in the ground in the currently producing fields and soon to be developed fields, Niakuk and Point McIntyre, would range from 1 billion to 500 million barrels of oil corresponding to the time period of 2008 to 2014 based on the TAPS shutdown assumption.

  5. Review of the Monograph of Zardyhan Qinayatuly Kazak State and Jochi Khan» »

    Directory of Open Access Journals (Sweden)

    Zh.M. Sabitov

    2015-09-01

    Full Text Available Research monograph of Zardykhan Qinayatuly “Qazaq memleketі zhane Zhoshy khan” (“Kazakh State and Jochi Khan” was published in the Kazakh language in 2014 in Kazakhstan. There are very few studies in Kazakhstan pub- lished in the Kazakh language on the Golden Horde history. Most historians wri- ting in Russian and English about the Golden Horde history are not familiar with research literature published in other languages. In this review, we note the fol- lowing errors of the author: 1. Purely grammatical errors when writing the names of the historians engaged in all aspects of the history of the ulus of Jochi. 2. Negligence in the design of the monograph, which often do not bear the full output of books and articles that are referenced by the author, neither there is a single list of references at the end of the monograph. 3. Fantastic map of the ulus of Jochi, which contains a lot of factual errors. 4. Ignorance of the historiography of modern research of the ulus of Jochi. From this derive such errors as: naming Jochi with the title of khan, while he was not a khan; confusion with the localiza- tion of the Ak Horde and Kok Horde; ignorance of the fact that Abul Khair Khan became khan only in 1430; uncritical confidence in such unreliable source as Natanzi; improper and unreasoned periodization of the history of the Eastern part of the ulus of Jochi; ignorance of the fact that Berke did not come to power in 1257 but a little later; ignorance of the name of khan Tuda-Mengu when listing the Golden Horde khans; errors in compiling genealogies of the Jochids; incorrect genealogy of the Golden Horde khan Kutlug Timur and his descendants; erro- neous etymology of the ethnonym “Kazak” by attributing to it the origin from the ancient Saks; numerous errors in the chronology of the eastern part of the ulus of Jochi; pseudoscientific etymology of the origin of the term Juz from the ancient Xiongnu as well as pseudoscientific attempt to find

  6. Produção de álcool de mandioca utilização de bolores na sacarificação do amido

    Directory of Open Access Journals (Sweden)

    C. G. Teixeira

    1950-01-01

    Full Text Available It has been shown that cassava starch can be converted into alcohol most efficiently when fungal enzyme preparations from submerged cultures are used to hydrolyze the starch into sugar. The use of barley malt in the process for conversion of cassava starch has resulted in alcohol yields of 70-74% of the theoretical. Cassava mashes converted by submerged fungal cultures (Aspergillus niger van Tieghem, strain NRRL-337 resulted in alcohol yields up to 90% of the theoretical. Substitutes for the distillers'dried solubles-corn medium were tried. Screened cotton seed meal and soybean meal proved to be a satisfactory substitute for distillers'dried solubles. Dehydrated cassava meal was effectively used in place of corn meal. A comparative study was carried out using several molds from the Collection of the Instituto Agronômico for the purpose of determining their enzyme activity. The mold that presented the highest enzyme potency was found to be the strain of Aspergillus oryzae (Ahlburg Cohn strain F-27 which had been originally isolated from saké (rice wine. Studies of the dehydrated residues (7% moisture from hydrolized and fermented mash were found to contain approximately 25% protein indicating their possible value in animal feeds. Simple substrates can be used for the propagation of the mold which is a very efficient conversion agent. It is, indeed, the best saccharifying agent for the countries where a good malt is not available at a low price.

  7. Magistritööde kaitsmine : [Anu Sepp jt.

    Index Scriptorium Estoniae

    2001-01-01

    17.05.2001 kaitsesid TPÜ kasvatusteaduste ja pedagoogika magistritööde kaitsmise nõukogu koosolekul magistritöid Anu Sepp "4.-6. klassi muusika õppekirjanduse kontseptuaalsed alused", Katrin Saks "Mängud keeletunnis aktiivse õppimise eeldusena", 1.06. Katrin Karu "Täiskasvanud õppija enesehindamine kui koolituse hindamise vahend ja koolituse mõju tegur", Tiia Kessel "Õpilaste iseseisva mõtlemise arendamise võimalusi 4.-6. klassi emakeeletundides". 23.05. kasvatusteaduste ja pedagoogika (kutseõpetuse ja reaalainete didaktika) magistritööde kaitsmise nõukogu koosolekul Gled-Airiin Saarso "Iseseisvust arendavad tööjuhendid esimese kooliastme käelise tegevuse tundides" 24.05. infoteaduste osakonna magistritööde kaitsmise nõukogu koosolekul Maria Kalentzits "Eesti Mereinstituudi teadlaste publikatsioonide bibliomeetriline analüüs". 28.05. germaani filoloogia magistritööde kaitsmise nõukogu koosolekul Paul Rüsse "Narratiivi ülesehitus Louise Erdrichì loomingus", Annika Namme "Ameerika Ühendriikide Lõuna Tennessee Williamsì näidendites", Maris Saagpakk "Esimese Maailmasõja heiastusi baltisaksa kirjanduses"

  8. Augmenting the activity of antifungal agents against aspergilli using structural analogues of benzoic acid as chemosensitizing agents.

    Science.gov (United States)

    Kim, Jong H; Campbell, Bruce C; Mahoney, Noreen; Chan, Kathleen L; Molyneux, Russell J; Balajee, Arunmozhi

    2010-10-01

    A number of benzoic acid analogues showed antifungal activity against strains of Aspergillus flavus, Aspergillus fumigatus and Aspergillus terreus, causative agents of human aspergillosis, in in vitro bioassays. Structure-activity analysis revealed that antifungal activities of benzoic and gallic acids were increased by addition of a methyl, methoxyl or chloro group at position 4 of the aromatic ring, or by esterification of the carboxylic acid with an alkyl group, respectively. Thymol, a natural phenolic compound, was a potent chemosensitizing agent when co-applied with the antifungal azole drugs fluconazole and ketoconazole. The thymol-azole drug combination demonstrated complete inhibition of fungal growth at dosages far lower than the drugs alone. Co-application of thymol with amphotericin B had an additive effect on all strains of aspergilli tested with the exception of two of three strains of A. terreus, where there was an antagonistic effect. Use of two mitogen-activated protein kinase (MAPK) mutants of A. fumigatus, sakAΔ and mpkCΔ, having gene deletions in the oxidative stress response pathway, indicated antifungal and/or chemosensitization activity of the benzo analogues was by disruption of the oxidative stress response system. Results showed that both these genes play overlapping roles in the MAPK system in this fungus. The potential of safe, natural compounds or analogues to serve as chemosensitizing agents to enhance efficacy of commercial antifungal agents is discussed. Published by Elsevier Ltd.

  9. FARKLI TAURİN DOZLARININ VE DONDURMA HIZININ KOÇ SPERMASININ DONDURULMASI ÜZERİNE ETKİLERİ

    OpenAIRE

    2004-01-01

    Çalışmada koç spermalarının dondurulması/çözdürülmesi sonrası kimi spermatolojik değerler üzerine sperma sulandırıcısına katılan farklı dozlarda antioksidan (taurin) ile değişik hızlarda soğutmanın etkisinin araştırılması amaçlanmıştır.Araştırmada toplam 3 koçtan (Akkaraman, Sakız, Ramlıç) sun’i vagina ile alınan ejekülatlar kullanılmıştır. Çift ejekülat olarak alınan, başlıca spermatolojik özellikleri belirlenen ve normospermi gösteren ejekülatlar birleştirilmiştir. Spermaların sulandırılmas...

  10. A key centriole assembly interaction interface between human PLK4 and STIL appears to not be conserved in flies

    Directory of Open Access Journals (Sweden)

    Matthew A. Cottee

    2017-03-01

    Full Text Available A small number of proteins form a conserved pathway of centriole duplication. In humans and flies, the binding of PLK4/Sak to STIL/Ana2 initiates daughter centriole assembly. In humans, this interaction is mediated by an interaction between the Polo-Box-3 (PB3 domain of PLK4 and the coiled-coil domain of STIL (HsCCD. We showed previously that the Drosophila Ana2 coiled-coil domain (DmCCD is essential for centriole assembly, but it forms a tight parallel tetramer in vitro that likely precludes an interaction with PB3. Here, we show that the isolated HsCCD and HsPB3 domains form a mixture of homo-multimers in vitro, but these readily dissociate when mixed to form the previously described 1:1 HsCCD:HsPB3 complex. In contrast, although Drosophila PB3 (DmPB3 adopts a canonical polo-box fold, it does not detectably interact with DmCCD in vitro. Thus, surprisingly, a key centriole assembly interaction interface appears to differ between humans and flies.

  11. Rare occurrence of methicillin-resistant Staphylococcus aureus CC130 with a novel mecA homologue in humans in Germany.

    Directory of Open Access Journals (Sweden)

    Christiane Cuny

    Full Text Available MRSA CC130 containing the mecA homologue mecA(LGA251 were reported from the UK and from Denmark so far from cattle and humans. Here we report on 11 MRSA CC130 among a sample of 12691 isolates of human origin collected from January 2006 until June 2011. MRSA CC130 grew insufficiently on chromogernic agar plates for detection of MRSA; the agglutination test for presence of PBP2a was negative. We designed primers for specific detection of mecA(LGA251 as well as for concomitant detection of both, mec(LGA251 and mecA. As already described, the isolates exhibited spa-types t843, t1736, and t1773. The ccrA homologue indicated the presence SCCmec(XI. When subjected to further characterization by means of a commercially available microarray the isolates were negative for sak chp, and scn, and as expected positive for hla, untruncated hlb, and hld. They furthermore contained edinB, aur, slpA, slpB, slpE. From genes coding for surface and cell wall associated products the ica-operon, cap8, clfA, clfF, ebpS, fnbA, fnbB, sdrC were detected but not cna. The isolates were negative for enterotoxin genes and tst, as well as for eta, and etb; agr-type was III.

  12. Projekts Sporta kluba izveidošanai

    OpenAIRE

    Andrejevs, Jurijs

    2010-01-01

    Maģistra darba temats ir „PROJEKTS SPORTA KLUBA „URBAN GYM” IZVEIDOŠANA.” Uzņēmējdarbības vide Latvijā pēdējos gados sākusi stipri vien mainīties. No vienas puses, tā lēnām kļūst sakārtotāka, no otras puses, iezīmējas arvien lielāks konkurences pieaugums. Tirgus tiek piesātināts, un aizvien grūtāk kļūst darboties, nedomājot par konkurenci, darbības aktivitāti un rentabilitāti. Vadītājiem un īpašniekiem nemitīgi jādomā, ar ko uzņēmums īsti pelna naudu, kā varētu pelnīt vairāk. Bet neskatoti...

  13. Identification of virulence genes carried by bacteriophages obtained from clinically isolated methicillin-resistant Staphylococcus aureus.

    Science.gov (United States)

    Karasartova, Djursun; Cavusoglu, Zeynep Burcin; Turegun, Buse; Ozsan, Murat T; Şahin, Fikret

    2016-12-01

    Bacteriophages play an important role in the pathogenicity of Staphylococcus aureus (S. aureus) either by carrying accessory virulence factors or several superantigens. Despite their importance, there are not many studies showing the actual distribution of the virulence genes carried by the prophages obtained from the clinically isolated Staphylococcus. In this study, we investigated prophages obtained from methicillin-resistant S. aureus (MRSA) strains isolated from hospital- and community-associated (HA-CA) infections for the virulence factors. In the study, 43 phages isolated from 48 MRSA were investigated for carrying toxin genes including the sak, eta, lukF-PV, sea, selp, sek, seg, seq chp, and scn virulence genes using polymerase chain reaction (PCR) and Southern blot. Restriction fragment length polymorphism was used to analyze phage genomes to investigate the relationship between the phage profiles and the toxin genes' presence. MRSA strains isolated from HA infections tended to have higher prophage presence than the MRSA strains obtained from the CA infections (97% and 67%, respectively). The study showed that all the phages with the exception of one phage contained one or more virulence genes in their genomes with different combinations. The most common toxin genes found were sea (83%) followed by sek (77%) and seq (64%). The study indicates that prophages encode a significant proportion of MRSA virulence factors.

  14. İnsanlıkdışı Suçların İşlenmesinde Ahlakî Bağlantının Kesilmesi

    OpenAIRE

    BANDURA, Albert; ONAY, Yrd. Doç. Dr. Hamdi

    2012-01-01

    Ahlakî yargılar oluşturma ve ahlakî eylemde bulunma ka-pasitesi, hem insanlık dışı bir şekilde davranmaktan sakınma gü-cünde hem de insanca davranmak için önleyici tedbirler alma gü-cünde kendini gösterir. Ahlakî aracılık, kendine-yönelik yaptırımlarla bağlantılı kişisel ahlakî değerlerde kökleşmiş kendini-örgütleyen, önleyici tedbirler alan, kendini-gözlemleyen ve kendini-düzenleyici mekanizmaları kapsayan daha geniş bir sosyo-bilişsel öz kuramında gömülüdür. Etkinleştirilmedikleri takdirde ...

  15. The spatial alignment of the Muon Detector for the LHCb experiment

    CERN Document Server

    Pozzi, S; Savriè, M; Vecchi, S

    2010-01-01

    The phenomenology of particle physics is well described by the Standard Model. However, some of the parameters of the model are not predicted and have to be experimentally determined, as for instance, the four parameters of the quark mixing matrix, the Cabibbo-Kobayashi-Maskawa (CKM) matrix. One of these parameters, the phase of the CKM matrix, is responsible of the violation of the CP symmetry that was identified as one of the causes for the asymmetry between matter and anti-matter in the Universe~\\cite{bib:Sak}. LHCb is one of the four experiments of particle physics at the Large Hadron Collider accelerator built at CERN. The LHCb experiment is dedicated to high precision measurement of CP violating parameters in the system of $B$ mesons. The large samples of $B-\\overline{B}$ pairs that will be produced allow to measure very rare $B$ decays like $B_{s} \\rightarrow \\mu^{+} \\mu^{-}$. The branching ratio predicted by the Standard Model for this decay is of the order of $O(10^{-9})$, but it can receive large co...

  16. Datu integrācija reālā laika datu noliktavā

    OpenAIRE

    Greckis, Maksims

    2012-01-01

    20. gadsimta beigās pasaulē strauji sāka pieaugt virtuālo datu apjomi. Tā kā informācijai ir vērtība, visu laiku tiek meklētas iespējas to iegūt un apstrādāt ātrāk, jo novecojot informācijai strauji zūd vērtība. Datu noliktavas allaž tika izmantotas lielu datu apjomu apkopošanai, bet galvenā viľu problēma bija nespēja apstrādāt tekošos datus. 21. gadsimts sakās ar mēģinājumiem dot iespēju datu noliktavām apstrādāt datus reālā laikā ar jauniem datu integrācijas risinājumiem. Bakalaura da...

  17. Antecedents and consequences of work engagement among nurses.

    Science.gov (United States)

    Sohrabizadeh, Sanaz; Sayfouri, Nasrin

    2014-11-01

    Engaged nurses have high levels of energy and are enthusiastic about their work which impacts quality of health care services. However, in the context of Iran, due to observed burnout, work engagement among nurses necessitates immediate exploration. This investigation aimed to identify a suitable work engagement model in nursing profession in hospitals according to the hypothesized model and to determine antecedents and consequences related to work engagement among nurses. In this cross-sectional study, a questionnaire was given to 279 randomly-selected nurses working in two general teaching hospitals of Shiraz University of Medical Sciences (Shiraz, Iran) to measure antecedents and consequences of work engagement using the Saks's (2005) model. Structural Equation Modeling was used to examine the model fitness. Two paths were added using LISREL software. The resulting model showed good fitness indices (χ(2) = 23.62, AGFI = 0.93, CFI = 0.97, RMSEA = 0.07) and all the coefficients of the paths were significant (t ≥ 2, t ≤ -2). A significant correlation was found between work engagement and model variables. Paying adequate attention to the antecedents of work engagement can enhance the quality of performance among nurses. Additionally, rewards, organizational and supervisory supports, and job characteristics should be taken into consideration to establish work engagement among nurses. Further researches are required to identify other probable antecedents and consequences of nursing work engagement, which might be related to specific cultural settings.

  18. Regular Dental Visits: Influence on Health-Related Quality of Life in 1,607 Patients with Oral Squamous Cell Carcinoma

    Directory of Open Access Journals (Sweden)

    Simon Spalthoff

    2017-01-01

    Full Text Available Background. The incidence of oral squamous cell carcinoma (OSCC is in the top 10 of all cancer entities. Regular oral examinations by dentists play an important role in oral cancer prevention. Methods. Patients with OSCC (n=1,607 and physicians (n=1,489 completed questionnaires during the DÖSAK Rehab Study. The psychosocial and functional factors collected in these questionnaires were assessed in the present study. We compared patients who visited their dentist at least once a year (group A with those who visited their dentist less than once a year (group B. Results. Patients in group A had significantly better health-related quality of life after tumor treatment than patients in group B. Patients in group A also had a smaller tumor size and less lymph node metastasis and lost fewer teeth during the treatment. This resulted in better prosthetic rehabilitation and better psychological status after tumor treatment. Conclusions. Dentists play an important role in the early recognition of oral cancer. This study should encourage dentists to take a more active role in oral cancer prevention.

  19. Low occurrence of the new species Staphylococcus argenteus in a Staphylococcus aureus collection of human isolates from Belgium.

    Science.gov (United States)

    Argudín, M A; Dodémont, M; Vandendriessche, S; Rottiers, S; Tribes, C; Roisin, S; de Mendonça, R; Nonhoff, C; Deplano, A; Denis, O

    2016-06-01

    Staphylococcus argenteus is a novel Staphylococcus species closely related to Staphylococcus aureus that has been recently described. In this study, we investigated the proportion and the characteristics of S. argenteus recovered from humans in Belgium. S. aureus. human isolates collected in Belgium from 2006 to 2015 (n = 1,903) were retrospectively characterised via the presence of non-pigmented colonies on chocolate agar, spa typing and rpoB sequencing to determine if some of them were in fact S. argenteus. Out of 73 strains non-pigmented on chocolate plates, 3 isolates (0.16 %) showed rpoB sequences, in addition to spa and sequence types (ST2250/t5787, ST2250/t6675, ST3240/t6675), related to S. argenteus. Two of them were methicillin-resistant, harbouring a SCCmec type IV. The three S. argenteus isolates carried genes (sak, scn) of the immune evasion cluster. This first Belgian nationwide analysis showed a low occurrence of S. argenteus. Further studies should be conducted to identify the distribution range and the clinical impact of this new species.

  20. Novel wine yeast with mutations in YAP1 that produce less acetic acid during fermentation.

    Science.gov (United States)

    Cordente, Antonio G; Cordero-Bueso, Gustavo; Pretorius, Isak S; Curtin, Christopher D

    2013-02-01

    Acetic acid, a byproduct formed during yeast alcoholic fermentation, is the main component of volatile acidity (VA). When present in high concentrations in wine, acetic acid imparts an undesirable 'vinegary' character that results in a significant reduction in quality and sales. Previously, it has been shown that saké yeast strains resistant to the antifungal cerulenin produce significantly lower levels of VA. In this study, we used a classical mutagenesis method to isolate a series of cerulenin-resistant strains, derived from a commercial diploid wine yeast. Four of the selected strains showed a consistent low-VA production phenotype after small-scale fermentation of different white and red grape musts. Specific mutations in YAP1, a gene encoding a transcription factor required for oxidative stress tolerance, were found in three of the four low-VA strains. When integrated into the genome of a haploid wine strain, the mutated YAP1 alleles partially reproduced the low-VA production phenotype of the diploid cerulenin-resistant strains, suggesting that YAP1 might play a role in (regulating) acetic acid production during fermentation. This study offers prospects for the development of low-VA wine yeast starter strains that could assist winemakers in their effort to consistently produce wine to definable quality specifications. © 2012 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. All rights reserved.

  1. Study of hydrocarbon miscible solvent slug injection process for improved recovery of heavy oil from Schrader Bluff Pool, Milne Point Unit, Alaska. Final report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-11-01

    The National Energy Strategy Plan (NES) has called for 900,000 barrels/day production of heavy oil in the mid-1990s to meet our national needs. To achieve this goal, it is important that the Alaskan heavy oil fields be brought to production. Alaska has more than 25 billion barrels of heavy oil deposits. Conoco, and now BP Exploration have been producing from Schrader Bluff Pool, which is part of the super heavy oil field known as West Sak Field. Schrader Bluff reservoir, located in the Milne Point Unit, North Slope of Alaska, is estimated to contain up to 1.5 billion barrels of (14 to 21{degrees}API) oil in place. The field is currently under production by primary depletion; however, the primary recovery will be much smaller than expected. Hence, waterflooding will be implemented earlier than anticipated. The eventual use of enhanced oil recovery (EOR) techniques, such as hydrocarbon miscible solvent slug injection process, is vital for recovery of additional oil from this reservoir. The purpose of this research project was to determine the nature of miscible solvent slug which would be commercially feasible, to evaluate the performance of the hydrocarbon miscible solvent slug process, and to assess the feasibility of this process for improved recovery of heavy oil from Schrader Bluff reservoir. The laboratory experimental work includes: slim tube displacement experiments and coreflood experiments. The components of solvent slug includes only those which are available on the North Slope of Alaska.

  2. DEVELOPMENT OF SHALLOW VISCOUS OIL RESERVES IN NORTH SLOPE

    Energy Technology Data Exchange (ETDEWEB)

    Kishore K. Mohanty

    2004-12-01

    North Slope of Alaska has huge oil deposits in heavy oil reservoirs such as Ugnu, West Sak and Shrader Bluff etc. The viscosity of the last two reservoir oils vary from {approx}30 cp to {approx}3000 cp and the amount in the range of 10-20 billion barrels. High oil viscosity and low formation strength impose problems to high recovery and well productivity. Water-alternate-gas injection processes can be effective for the lower viscosity end of these deposits in West Sak and Shrader Bluff. Several gas streams are available in the North Slope containing NGL and CO{sub 2} (a greenhouse gas). The goal of this research is to develop tools to find optimum solvent, injection schedule and well-architecture for a WAG process in North Slope shallow sand viscous oil reservoirs. Coreflood, quarter 5-spot study, compositional simulation, wettability, relative permeability study and streamline-based simulation were conducted in this project. 1D compositional simulation results agree reasonably well with those of the slim tube experiments. Injection of CO{sub 2}-NGL is preferable over that of PBG-NGL. MME is sensitive to pressure (in the range of 1300-1800 psi) for the injection of PBG-NGL, but not for CO{sub 2}-NGL. Three hydrocarbon phases form in this pressure range. As the mean thickness of the adsorbed organic layer on minerals increases, the oil-water contact angle increases. The adsorbed organic films left behind after extraction of oil by common aromatic solvents used in core studies, such as toluene and decalin, are thinner than those left behind by non-aromatic solvents, such as cyclohexane. The force of adhesion for minerals aged with just the asphaltene fraction is similar to that of the whole oil implying that asphaltenes are responsible for the mixed-wettability in this reservoir. A new relative permeability model for a four-phase, mixed-wet system has been proposed. A streamline module is developed which can be incorporated in an existing finite-difference based

  3. Animal and human Staphylococcus aureus associated clonal lineages and high rate of Staphylococcus pseudintermedius novel lineages in Spanish kennel dogs: predominance of S. aureus ST398.

    Science.gov (United States)

    Gómez-Sanz, Elena; Torres, Carmen; Benito, Daniel; Lozano, Carmen; Zarazaga, Myriam

    2013-10-25

    Methicillin-susceptible Staphylococcus aureus (MSSA) and Staphylococcus pseudintermedius (MSSP) are gaining interest to track the evolution of emerging methicillin-resistant strains in animals and humans. We focused on the characterization of the methicillin-susceptible coagulase-positive staphylococci (MSCoPS) recovered from nasal samples of 98 healthy kennel-dogs. Isolates were typed by spa, agr, MLST and SmaI/ApaI-PFGE. Antimicrobial resistance and virulence profiles were investigated. Presence of the human-associated Immune-Evasion-Cluster (IEC) genes was analyzed in MSSA. Twenty-four MSSA, 16 MSSP and one MS Staphylococcus schleiferi subspecies coagulans were obtained. Thirteen spa-types and 12 sequence-types (STs) were detected among MSSA, with ST398 predominance (7/24, 29.2%). MSSA isolates were enclosed within 6 clonal complexes (no. of isolates): CC5 (8), CC398 (7), CC88 (4), CC45 (2), CC133 (1), and CC22 (1), and one singleton. High clonal diversity was observed among MSSP, and 14 STs (10 of them new) were detected. Twelve (50%) MSSA and 12 (75%) MSSP isolates showed resistance to at least one of the tested antimicrobials, with low MSSA penicillin resistance (5 isolates) and high MSSP tetracycline resistance (9 isolates). MSSA isolates ST398, ST133, ST1 and ST2329[new] were susceptible to all antimicrobials and were the only ones lacking the scn, chp and/or sak IEC genes. High diversity of enterotoxin genes was detected among non-ST398/ST133 MSSA isolates. MSSP showed a more homogeneous virulence genes profile. Our results give evidence that dogs can be S. aureus carriers of not only typical human associated lineages but also lineages commonly detected among other animal species. Continue surveillance on CoPS in dogs is required to unveil their role in the dissemination of clones adapted to other animal species. Copyright © 2013 Elsevier B.V. All rights reserved.

  4. Sosyal Paylaşım Sitelerinin Dijital Yerlilerin Bilgi Edinme ve Mahremiyet Anlayışına Etkisi

    Directory of Open Access Journals (Sweden)

    Asiye KAKIRMAN YILDIZ

    2012-10-01

    Full Text Available Literatürde 1980 ve sonrasında doğanlar dijital yerli olarak tanımlanmaktadır. Adeta teknoloji bilgisiyle doğdukları belirtilen dijital yerlilerin en önemli özelliği aynı anda pek çok işi tek bir cihazla yapabilmeleri ve bunu tanımadıkları insanlar da dâhil olmak üzere başkalarıyla paylaşmakta bir sakınca görmemeleridir. Bunu bilgi edinmek ya da paylaşmak amacıyla yaptıklarını belirtseler de yeni neslin bilgi edinme ve mahremiyet anlayışının sorgulanması gerekliliği ortaya çıkmıştır. Bu çalışmada, Bilgi ve Belge Yönetimi Bölümü (BBY öğrencilerinin birer dijital yerli olarak sosyal paylaşım sitelerini nasıl kullandıkları sorgulanmış ve neticesinde öğrencilerin bilgi edinme yaklaşımları ve mahremiyet konusuna bakış açıları incelenmiştir. Çalışma kapsamında BBY’de öğrenim gören 200 öğrenciye anket uygulanmıştır.

  5. Oral cancer malnutrition impacts weight and quality of life.

    Science.gov (United States)

    Gellrich, Nils-Claudius; Handschel, Jörg; Holtmann, Henrik; Krüskemper, Gertrud

    2015-03-27

    Diet is important for both quality of life (QoL) and survival of patients with oral cancer. Their intake of food is impeded by functional restrictions in chewing and swallowing. In the DÖSAK REHAB STUDY 1652 patients from 38 hospitals within the German-language area of Germany; Austria and Switzerland were examined with regard to functional and psychological variables having an impact on diet. Chewing and swallowing are correlated with mobility of the tongue and the mandible as well as opening of the mouth. Thirty five percent of the patients lost weight; 41% maintained their weight and 24% gained weight. The QoL of patients who were able to maintain their weight and of those who gained weight was significantly better than that of patients who lost weight. A normal diet was important for maintaining weight. Mashed food; liquid food and loss of appetite were closely associated with loss of weight; although it was possible for nutritional counseling and dietary support to be implemented particularly favorably in this respect. Due to problems with eating patients' strength deteriorated; thus restricting activity. Radiotherapy had a negative impact on diet and weight. It influenced sense of taste; dryness of the mouth; swelling and discomfort when ingesting food. Pain and scars in the region of the operation also cause patients to dislike hard; spicy and sour food. Support from a nutritional counselor in implementing a calorie-rich diet remedied this and such support needs to be integrated into patient management. The fact that a poor nutritional status is of such great importance is well-known; but what is often lacking is the systematic implementation of continued professional nutritional counseling over a long period of time; weight control and psycho-social support of the operated patients; particularly those who also have had radiotherapy.

  6. Operational Challenges in Gas-To-Liquid (GTL) Transportation Through Trans Alaska Pipeline System (TAPS)

    Energy Technology Data Exchange (ETDEWEB)

    Godwin A. Chukwu; Santanu Khataniar; Shirish Patil; Abhijit Dandekar

    2006-06-30

    Oil production from Alaskan North Slope oil fields has steadily declined. In the near future, ANS crude oil production will decline to such a level (200,000 to 400,000 bbl/day) that maintaining economic operation of the Trans-Alaska Pipeline System (TAPS) will require pumping alternative products through the system. Heavy oil deposits in the West Sak and Ugnu formations are a potential resource, although transporting these products involves addressing important sedimentation issues. One possibility is the use of Gas-to-Liquid (GTL) technology. Estimated recoverable gas reserves of 38 trillion cubic feet (TCF) on the North Slope of Alaska can be converted to liquid with GTL technology and combined with the heavy oils for a product suitable for pipeline transport. Issues that could affect transport of this such products through TAPS include pumpability of GTL and crude oil blends, cold restart of the pipeline following a prolonged winter shutdown, and solids deposition inside the pipeline. This study examined several key fluid properties of GTL, crude oil and four selected blends under TAPS operating conditions. Key measurements included Reid Vapor Pressure, density and viscosity, PVT properties, and solids deposition. Results showed that gel strength is not a significant factor for the ratios of GTL-crude oil blend mixtures (1:1; 1:2; 1:3; 1:4) tested under TAPS cold re-start conditions at temperatures above - 20 F, although Bingham fluid flow characteristics exhibited by the blends at low temperatures indicate high pumping power requirements following prolonged shutdown. Solids deposition is a major concern for all studied blends. For the commingled flow profile studied, decreased throughput can result in increased and more rapid solid deposition along the pipe wall, resulting in more frequent pigging of the pipeline or, if left unchecked, pipeline corrosion.

  7. Impact of beliefs about pain control on perceptions of illness in surgical patients

    Directory of Open Access Journals (Sweden)

    Jaroslaw Jerzy Sak

    2015-12-01

    Full Text Available [b][/b][b]Objectives.[/b] Adequacy of pain management in surgical patients is a major contributor to overall treatment outcomes and positive illness perceptions. However, it may be subjectively predetermined by a patient’s beliefs about pain control. This study assesses the relationships between beliefs about pain control and perceptions of illness in thoracic surgical patients. [b]Materials and method.[/b] A total of 135 patients (72 women and 63 men; mean age 58.4±14.25y were enrolled in the questionnaire study based on the Beliefs about Pain Control Questionnaire (BPCQ by S. Skevington and the Multidimensional Essence of Disease and Illness Scale (MEDIS by J. Sak. Analyses were conducted with use of the k-means clustering technique and one-way ANOVA. [b]Results.[/b] Applied classification revealed 3 different clusters of patients with regard to their beliefs about pain control: 1 weak, undifferentiated pain control; 2 intensified influence of chance pain control; 3 strong undifferentiated pain control. Significant differences in illness perceptions between clusters were disclosed in 3 MEDIS dimensions: self-realization constraints (F=4.70; p=0.01; 1 vs. 3, mental dysfunction (F=3.44, p=0.04; 1 vs. 3 and physical dysfunction (F=3.10, p=0.05; 1 vs 2. Patients in cluster 3 demonstrated a greater feeling of self-realization constraints and mental dysfunction than in cluster 1, whereas patients in cluster 2 perceived physical dysfunction as a greater distress than those in cluster 1. [b]Conclusions.[/b] Beliefs about pain control significantly influence illness perceptions, and thus may affect the results of treatment in surgical patients. Psychological modelling of beliefs about pain control may offer a valuable way to improve overall clinical outcomes.

  8. BİLEZİKLİ ASENKRON MAKİNELERDE ANLIK YÜKSEK MOMENT VE HIZ DENETİMİ İÇİN ROTOR DEVRESİNE BULANIK MANTIK TABANLI GÜÇ ENJEKSİYONU

    Directory of Open Access Journals (Sweden)

    Selami KESLER

    2009-01-01

    Full Text Available Büyük güç gerektiren uygulamalarda yüksek moment üretimi ve rüzgâr santrallerinde sabit frekanslı sabit güç üretimi için kullanılan bilezikli asenkron makinelerde rotor devresi güç akışı farklı yöntemlerle denetlenir. Denetimli yüksek moment üretmek, en uygun güç katsayısı elde etmek ve hız denetimi için rotor devresine bilezikler üzerinden kayma frekanslı gerilim uygulanabilir. Bu çalışmada, öncelikle bilezikli bir asenkron makinede rotor sargılarına bilezikler üzerinden gerilim uygulanmasının dinamik etkileri araştırılmış ve yöntemin sakıncalı yönleri uygulama desteğiyle ortaya konulmuştur. Daha sonra bu dinamik etkileri iyileştirmek üzere, makinenin anlık zorlanmalarda yüksek moment üretimini denetlemek ve hızını ayarlamak için rotor tarafında bulanık mantık denetleyicili bir evirici modeli önerilmiştir. Sürekli çalışma durumunda stator sargıları doğrudan şebekeye bağlı olan sistemin benzetim modeli için C/C++ programı geliştirilmiş ve farklı yük şartları için elde edilen sonuçlar tartışılmıştır.

  9. Oral Cancer Malnutrition Impacts Weight and Quality of Life

    Directory of Open Access Journals (Sweden)

    Nils-Claudius Gellrich

    2015-03-01

    Full Text Available Diet is important for both quality of life (QoL and survival of patients with oral cancer. Their intake of food is impeded by functional restrictions in chewing and swallowing. In the DÖSAK REHAB STUDY 1652 patients from 38 hospitals within the German-language area of Germany; Austria and Switzerland were examined with regard to functional and psychological variables having an impact on diet. Chewing and swallowing are correlated with mobility of the tongue and the mandible as well as opening of the mouth. Thirty five percent of the patients lost weight; 41% maintained their weight and 24% gained weight. The QoL of patients who were able to maintain their weight and of those who gained weight was significantly better than that of patients who lost weight. A normal diet was important for maintaining weight. Mashed food; liquid food and loss of appetite were closely associated with loss of weight; although it was possible for nutritional counseling and dietary support to be implemented particularly favorably in this respect. Due to problems with eating patients’ strength deteriorated; thus restricting activity. Radiotherapy had a negative impact on diet and weight. It influenced sense of taste; dryness of the mouth; swelling and discomfort when ingesting food. Pain and scars in the region of the operation also cause patients to dislike hard; spicy and sour food. Support from a nutritional counselor in implementing a calorie-rich diet remedied this and such support needs to be integrated into patient management. The fact that a poor nutritional status is of such great importance is well-known; but what is often lacking is the systematic implementation of continued professional nutritional counseling over a long period of time; weight control and psycho-social support of the operated patients; particularly those who also have had radiotherapy.

  10. Plk4 is required for cytokinesis and maintenance of chromosomal stability.

    Science.gov (United States)

    Rosario, Carla O; Ko, Michael A; Haffani, Yosr Z; Gladdy, Rebecca A; Paderova, Jana; Pollett, Aaron; Squire, Jeremy A; Dennis, James W; Swallow, Carol J

    2010-04-13

    Aneuploidy is a characteristic feature of established cancers and can promote tumor development. Aneuploidy may arise directly, through unequal distribution of chromosomes into daughter cells, or indirectly, through a tetraploid intermediate. The polo family kinase Plk4/Sak is required for late mitotic progression and is haploinsufficient for tumor suppression in mice. Here we show that loss of heterozygosity (LOH) occurs at the Plk4 locus in 50% of human hepatocellular carcinomas (HCC) and is present even in preneoplastic cirrhotic liver nodules. LOH at Plk4 is associated with reduced Plk4 expression in HCC tumors but not with mutations in the remaining allele. Plk4(+/-) murine embryonic fibroblasts (MEFs) at early passage show a high incidence of multinucleation, supernumerary centrosomes, and a near-tetraploid karyotype. Underlying these phenotypes is a high rate of primary cytokinesis failure, associated with aberrant actomyosin ring formation, reduced RhoA activation, and failure to localize the RhoA guanine nucleotide exchange factor Ect2 to the spindle midbody. We further show that Plk4 normally localizes to the midbody and binds to and phosphorylates Ect2 in vitro. With serial passaging Plk4(+/-) MEFs rapidly immortalize, acquiring an increasing burden of nonclonal and clonal gross chromosomal irregularities, and form tumors in vivo. Our results indicate that haploid levels of Plk4 disrupt RhoGTPase function during cytokinesis, resulting in aneuploidy and tumorigenesis, thus implicating early LOH at Plk4 as one of the drivers of human hepatocellular carcinogenesis. These findings represent an advance in our understanding of genetic predisposition to HCC, which continues to increase in incidence globally and particularly in North America.

  11. Pathogenic Characteristics of Staphylococcus aureus Endovascular Infection Isolates from Different Clonal Complexes

    Directory of Open Access Journals (Sweden)

    Dafne Pérez-Montarelo

    2017-05-01

    Full Text Available Staphylococcus aureus is a major cause of bacteremia and, even with appropriate clinical management, causes high morbidity, and mortality due to its involvement in endovascular complications and metastatic infections. Through different pathogenic in vivo and in vitro models we investigated the behavior of S. aureus most relevant clonal complexes (CCs causing endovascular complications. We analyzed 14 S. aureus strains representing CC5, CC8, CC15, CC30, and CC45 that caused endovascular complications, including methicillin susceptible and resistant isolates and strains with different functionality of the agr global regulator. Their adherence to collagen, interaction with the endothelium, resistance to immune attack, capacity to form biofilm and virulence in the Galleria mellonella model were analyzed. CC30 and CC45 showed greater adhesion to collagen and CC8 showed a trend towards higher rate of intracellular persistence in endothelial cells. All CCs exhibited similar tolerance to neutrophil antimicrobial peptide hNP-1 and were capable of forming biofilms under static conditions. The virulence assay in the G. mellonella model demonstrated that CC15 and CC30 were the most and least virulent, respectively. The analysis of the genomic sequences of the most relevant virulence genes identified some CC15 specific gene patterns (absence of enterotoxins and sak gene and variants (mainly in leucocidins and proteases, but did not reveal any gene or variant that could be responsible for the increased virulence detected for CC15 strains. Even though all the CCs were capable of causing endovascular complications, our results showed that different CCs are likely to produce these complications through different mechanisms which, if confirmed in more sophisticated models, would indicate the need to more specific management and therapeutic approaches.

  12. Genetic composition and connectivity of the Antillean manatee (Trichechus manatus manatus) in Panama

    Science.gov (United States)

    Díaz-Ferguson, Edgardo; Hunter, Margaret; Guzmán, Héctor M.

    2017-01-01

    Genetic diversity and haplotype composition of the West Indian manatee (Trichechus manatus) population from the San San Pond Sak wetland in Bocas del Toro, Panama was studied using a segment of mitochondrial DNA (D’loop). No genetic information has been published to date for Panamanian populations. Due to the secretive behavior and small population size of the species in the area, DNA extraction was conducted from opportunistically collected fecal (N=20), carcass tissue (N=4) and bone (N=4) samples. However, after DNA processing only 10 samples provided good quality DNA for sequencing (3 fecal, 4 tissue and 3 bone samples). We found three haplotypes in total; two of these haplotypes are reported for the first time, J02 (N=3) and J03 (N=4), and one J01 was previously published (N=3). Genetic diversity showed similar values to previous studies conducted in other Caribbean regions with moderate values of nucleotide diversity (π= 0.00152) and haplotipic diversity (Hd= 0.57). Connectivity assessment was based on sequence similarity, genetic distance and genetic differentiation between San San population and other manatee populations previously studied. The J01 haplotype found in the Panamanian population is shared with populations in the Caribbean mainland and the Gulf of Mexico showing a reduced differentiation corroborated with Fst value between HSSPS and this region of 0.0094. In contrast, comparisons between our sequences and populations in the Eastern Caribbean (South American populations) and North Western Caribbean showed fewer similarities (Fst =0.049 and 0.058, respectively). These results corroborate previous phylogeographic patterns already established for manatee populations and situate Panamanian populations into the Belize and Mexico cluster. In addition, these findings will be a baseline for future studies and comparisons with manatees in other areas of Panama and Central America. These results should be considered to inform management decisions

  13. Cell Respiration of Rat Cardiomyocytes and Soleus Muscle Fibers under Ultra-Short-Term Antiorthostatic Suspension

    Directory of Open Access Journals (Sweden)

    Irina V. Ogneva

    2014-09-01

    Full Text Available The aim of the study was to analyses rat soleus fibers and left ventricle (LV cardiomyocyte cell respiration after 6, 12, 18, 24 and 72 hours of antiorthostatic suspension by the tail. We measured V0 – basal oxygen consumption rate, V Glu+Mal – respiration velocity over a catalyst of malate and glutamate (5 mM glutamate + 2 mM malate and Vmax – maximal respiratory rate (in the presence of 1 mM ADP using the Saks polarography technique. We also determined the cytochrome c content and expression of its gene (Cycs and the GAPDH gene using Western blotting and real-time PCR. Cell respiration parameters in cardiomyocytes increased after 18 hours of suspension: V0 increased by 35%, VGlu+Mal by 90% and Vmax by 85% in comparison with the control group (p<0.05. Cytochrome c content in a mix of the membrane and mitochondrial fractions grew by 34.6% (p<0.05 compared to control after 18 hours. However, Cycs and Gapdh expression rates remained stable. Protein content increase in this case may result from increased translation efficiency and/or a reduction in the level of proteolysis. Intensity of soleus fiber cell respiration decreased after 72 hours of suspension, V0 decreased by 76%, VGlu+Mal by 59% and Vmax by 53% compared to controls (p<0.05. Cytochrome c content fell after 24 hours of suspension by 15.7% (p<0.05 and by 57.9% (p<0.05 after 72 hours relative to controls. At the same time, Cycs mRNA content decreased after 6 hours of unloading by 23% (p<0.05 and continued to decrease to 59% (p<0.05 of the control level after 72 hours.

  14. Molecular characterization of spa type t127, sequence type 1 methicillin-resistant Staphylococcus aureus from pigs.

    Science.gov (United States)

    Franco, Alessia; Hasman, Henrik; Iurescia, Manuela; Lorenzetti, Raniero; Stegger, Marc; Pantosti, Annalisa; Feltrin, Fabiola; Ianzano, Angela; Porrero, Maria Concepción; Liapi, Maria; Battisti, Antonio

    2011-06-01

    The aim of this study was to provide molecular characterization of methicillin-resistant Staphylococcus aureus (MRSA) spa type t127, sequence type (ST) 1 isolates, detected in a European baseline survey in holdings of breeding pigs, to determine phenotypic and genotypic drug resistance and to compare the results with those obtained from a collection of t127, ST1 MRSA and methicillin-susceptible S. aureus (MSSA) clinical isolates. Twenty-four t127, ST1 MRSA from dust sampled in different breeding holdings in Italy, Spain and Cyprus were studied, along with 2 t127, ST1 MRSA from fattening pigs and 11 human t127, ST1 MRSA and MSSA. Genotyping was performed using multilocus sequence typing (MLST), spa typing and PFGE. SCCmec elements were characterized by multiplex-PCR and resistance and pathogenicity genes by PCR and microarray. PFGE patterns separated a porcine cluster (PC) from a human cluster (HC), with 75% similarity. The PC carried SCCmec cassette type V, while all isolates of the HC carried SCCmec cassette type IVa. Kanamycin resistance mediated by aadD, fluoroquinolone and erm(A)-mediated macrolide resistance and the absence of the sakA gene were features of the PC only. All isolates of both clusters were positive for LukE-LukD and LuF-LukS-HlgA leukotoxin genes and one human MSSA harboured Panton-Valentine leucocidin genes. Despite differences in the host-specific genetic features, the possibility of PC transmission to humans cannot be excluded. MRSA spa type t127, ST1 from pigs possesses several virulence and resistance genes towards major classes of antimicrobials and may represent a serious therapeutic challenge in case of invasive infections in humans.

  15. Livestock-Associated Methicillin Resistant and Methicillin Susceptible Staphylococcus aureus Sequence Type (CC)1 in European Farmed Animals: High Genetic Relatedness of Isolates from Italian Cattle Herds and Humans.

    Science.gov (United States)

    Alba, Patricia; Feltrin, Fabiola; Cordaro, Gessica; Porrero, María Concepción; Kraushaar, Britta; Argudín, María Angeles; Nykäsenoja, Suvi; Monaco, Monica; Stegger, Marc; Aarestrup, Frank M; Butaye, Patrick; Franco, Alessia; Battisti, Antonio

    2015-01-01

    Methicillin-resistant Staphylococcus aureus (MRSA) Sequence Type (ST)1, Clonal Complex(CC)1, SCCmec V is one of the major Livestock-Associated (LA-) lineages in pig farming industry in Italy and is associated with pigs in other European countries. Recently, it has been increasingly detected in Italian dairy cattle herds. The aim of this study was to analyse the differences between ST1 MRSA and methicillin-susceptible S. aureus (MSSA) from cattle and pig herds in Italy and Europe and human isolates. Sixty-tree animal isolates from different holdings and 20 human isolates were characterized by pulsed-field gel electrophoresis (PFGE), spa-typing, SCCmec typing, and by micro-array analysis for several virulence, antimicrobial resistance, and strain/host-specific marker genes. Three major PFGE clusters were detected. The bovine isolates shared a high (≥90% to 100%) similarity with human isolates and carried the same SCCmec type IVa. They often showed genetic features typical of human adaptation or present in human-associated CC1: Immune evasion cluster (IEC) genes sak and scn, or sea; sat and aphA3-mediated aminoglycoside resistance. Contrary, typical markers of porcine origin in Italy and Spain, like erm(A) mediated macrolide-lincosamide-streptograminB, and of vga(A)-mediated pleuromutilin resistance were always absent in human and bovine isolates. Most of ST(CC)1 MRSA from dairy cattle were multidrug-resistant and contained virulence and immunomodulatory genes associated with full capability of colonizing humans. As such, these strains may represent a greater human hazard than the porcine strains. The zoonotic capacity of CC1 LA-MRSA from livestock must be taken seriously and measures should be implemented at farm-level to prevent spill-over.

  16. Livestock-Associated Methicillin Resistant and Methicillin Susceptible Staphylococcus aureus Sequence Type (CC1 in European Farmed Animals: High Genetic Relatedness of Isolates from Italian Cattle Herds and Humans.

    Directory of Open Access Journals (Sweden)

    Patricia Alba

    Full Text Available Methicillin-resistant Staphylococcus aureus (MRSA Sequence Type (ST1, Clonal Complex(CC1, SCCmec V is one of the major Livestock-Associated (LA- lineages in pig farming industry in Italy and is associated with pigs in other European countries. Recently, it has been increasingly detected in Italian dairy cattle herds. The aim of this study was to analyse the differences between ST1 MRSA and methicillin-susceptible S. aureus (MSSA from cattle and pig herds in Italy and Europe and human isolates. Sixty-tree animal isolates from different holdings and 20 human isolates were characterized by pulsed-field gel electrophoresis (PFGE, spa-typing, SCCmec typing, and by micro-array analysis for several virulence, antimicrobial resistance, and strain/host-specific marker genes. Three major PFGE clusters were detected. The bovine isolates shared a high (≥90% to 100% similarity with human isolates and carried the same SCCmec type IVa. They often showed genetic features typical of human adaptation or present in human-associated CC1: Immune evasion cluster (IEC genes sak and scn, or sea; sat and aphA3-mediated aminoglycoside resistance. Contrary, typical markers of porcine origin in Italy and Spain, like erm(A mediated macrolide-lincosamide-streptograminB, and of vga(A-mediated pleuromutilin resistance were always absent in human and bovine isolates. Most of ST(CC1 MRSA from dairy cattle were multidrug-resistant and contained virulence and immunomodulatory genes associated with full capability of colonizing humans. As such, these strains may represent a greater human hazard than the porcine strains. The zoonotic capacity of CC1 LA-MRSA from livestock must be taken seriously and measures should be implemented at farm-level to prevent spill-over.

  17. Weathering Rinds and Soil Development on Basaltic Andesite, Guadeloupe

    Science.gov (United States)

    Sak, P. B.; Murphy, M.; Ma, L.; Engel, J.; Pereyra, Y.; Gaillardet, J.; Brantley, S. L.

    2014-12-01

    An oriented clast of basaltic andesite collected from the B horizon of a soil developed in a late Quaternary volcanoclastic debris flow on the eastern, windward side of Basse Terre Island, Guadeloupe exhibits weathering patterns like that observed in many clasts from tropical settings. The sample consists of unweathered core material overlain by a ~19 mm thick weathering rind and a narrow ≤ 2mm thick indurated horizon separating the outer portion of the rind from the overlying >10mm of soil matrix material. Elemental variations are constrained by a seven point bulk ICP-AES vertical transect extending from the core, across the rind and ~15 mm into the overlying soil matix and six parallel electron microprobe transections. The porous-hydrated fraction increases from the core to the rind to the surrounding soil from 7±4% to 45±18% to 60±15%, respectively. Like the well-studied clast from the nearby Bras David watershed (Sak et al., 2010) the isovolumetric transformation from core to rind material is marked by a narrow (Ba>K≈Mn>Mg>Si>Al≈P>Fe»Ti, consistent with the relative reactivity of phases in the clast from plagioclasepyroxeneglass>apatite>ilmenite. Unlike previously studied clasts, the preservation of the rind-soil interface permits characterization of weathering reactions between the weathering clast and surrounding soil matrix. The abrupt (Mn, Ba, Al, Mg and K. The enrichment trends may result from soil waters percolating through atmospherically depositioned dust within the upper few meters of the soil profile, as documented in a deep soil profile in the Bras David watershed. The lack of an enrichment signal within the weathering rind suggests that weathering processes active within clasts are distinct from surrounding soil formation processes.

  18. Livestock-Associated Methicillin Resistant and Methicillin Susceptible Staphylococcus aureus Sequence Type (CC)1 in European Farmed Animals: High Genetic Relatedness of Isolates from Italian Cattle Herds and Humans

    Science.gov (United States)

    Alba, Patricia; Feltrin, Fabiola; Cordaro, Gessica; Porrero, María Concepción; Kraushaar, Britta; Argudín, María Angeles; Nykäsenoja, Suvi; Monaco, Monica; Stegger, Marc; Aarestrup, Frank M.; Butaye, Patrick; Franco, Alessia; Battisti, Antonio

    2015-01-01

    Methicillin-resistant Staphylococcus aureus (MRSA) Sequence Type (ST)1, Clonal Complex(CC)1, SCCmec V is one of the major Livestock-Associated (LA-) lineages in pig farming industry in Italy and is associated with pigs in other European countries. Recently, it has been increasingly detected in Italian dairy cattle herds. The aim of this study was to analyse the differences between ST1 MRSA and methicillin-susceptible S. aureus (MSSA) from cattle and pig herds in Italy and Europe and human isolates. Sixty-tree animal isolates from different holdings and 20 human isolates were characterized by pulsed-field gel electrophoresis (PFGE), spa-typing, SCCmec typing, and by micro-array analysis for several virulence, antimicrobial resistance, and strain/host-specific marker genes. Three major PFGE clusters were detected. The bovine isolates shared a high (≥90% to 100%) similarity with human isolates and carried the same SCCmec type IVa. They often showed genetic features typical of human adaptation or present in human-associated CC1: Immune evasion cluster (IEC) genes sak and scn, or sea; sat and aphA3-mediated aminoglycoside resistance. Contrary, typical markers of porcine origin in Italy and Spain, like erm(A) mediated macrolide-lincosamide-streptograminB, and of vga(A)-mediated pleuromutilin resistance were always absent in human and bovine isolates. Most of ST(CC)1 MRSA from dairy cattle were multidrug-resistant and contained virulence and immunomodulatory genes associated with full capability of colonizing humans. As such, these strains may represent a greater human hazard than the porcine strains. The zoonotic capacity of CC1 LA-MRSA from livestock must be taken seriously and measures should be implemented at farm-level to prevent spill-over. PMID:26322785

  19. Väike teatmik (Tartu paranoiakriitilise risoomi kohta / A Small Guide to the (Tartu Paranoiac-Critical Rhizome

    Directory of Open Access Journals (Sweden)

    Aare Pilv

    2013-06-01

    Full Text Available The paper gives an overview of a network of authors who have been active since the end of the 20th century, mainly (but not only in Tartu. They can be characterized as having an experimental attitude and maintaining distance from the literary mainstream, but at the same time they do not try to be consciously polemical or novatory, because partly they repeat the techniques of the 20th century avant-garde and, what is maybe more important, they sidestep the dialectics of innovating or altering the literary canon. The network is not strictly organized; it is rather a rhizome that has some denser nodes (literary journals and mailing lists. There have been different attempts to name the phenomenon: Tartu avant-garde, microcosmic literature, cognitive realism, Y-literature, "eksp" and so on. I have chosen "paranoiac-critique" as the term that best captures the common characteristics of these authors and their artistic practices (some of the authors are active not only as text writers, but also as conceptual artists.The paper then gives a list, with commentary, of the most important groups and individuals of that movement. In the role of "predecessors" are the group 14NÜ (Paavo Matsin, Mait Laas, Marianne Ravi et al., which also experimented with the format of the book, and a company in Tartu that developed a specific actionist stylistics called "mugiv" (Marko Kompus, Mehis Heinsaar, Martiini, Kaspar et al.. The sovereign figure in the experimental network is Valdur Mikita, who has also academically researched the problems of creativity; he is also a theoretician and metapoet. An important institution for the network has been the literary journal Vihik (initiator Berk Vaher; the later editor of the journal Jaak Tomberg has also participated in activities of the Tartu Theatre Laboratory (managed by Andreas W, which has experimented with "technological theatre". In the middle of the first decade of the 21st century the network has gathered around the

  20. Healthcare- and Community-Associated Methicillin-Resistant Staphylococcus aureus (MRSA) and Fatal Pneumonia with Pediatric Deaths in Krasnoyarsk, Siberian Russia: Unique MRSA's Multiple Virulence Factors, Genome, and Stepwise Evolution.

    Science.gov (United States)

    Khokhlova, Olga E; Hung, Wei-Chun; Wan, Tsai-Wen; Iwao, Yasuhisa; Takano, Tomomi; Higuchi, Wataru; Yachenko, Svetlana V; Teplyakova, Olga V; Kamshilova, Vera V; Kotlovsky, Yuri V; Nishiyama, Akihito; Reva, Ivan V; Sidorenko, Sergey V; Peryanova, Olga V; Reva, Galina V; Teng, Lee-Jene; Salmina, Alla B; Yamamoto, Tatsuo

    2015-01-01

    Methicillin-resistant Staphylococcus aureus (MRSA) is a common multidrug-resistant (MDR) pathogen. We herein discussed MRSA and its infections in Krasnoyarsk, Siberian Russia between 2007 and 2011. The incidence of MRSA in 3,662 subjects was 22.0% and 2.9% for healthcare- and community-associated MRSA (HA- and CA-MRSA), respectively. The 15-day mortality rates for MRSA hospital- and community-acquired pneumonia (HAP and CAP) were 6.5% and 50%, respectively. MRSA CAP cases included pediatric deaths; of the MRSA pneumonia episodes available, ≥27.3% were associated with bacteremia. Most cases of HA-MRSA examined exhibited ST239/spa3(t037)/SCCmecIII.1.1.2 (designated as ST239Kras), while all CA-MRSA cases examined were ST8/spa1(t008)/SCCmecIV.3.1.1(IVc) (designated as ST8Kras). ST239Kras and ST8Kras strongly expressed cytolytic peptide (phenol-soluble modulin α, PSMα; and δ-hemolysin, Hld) genes, similar to CA-MRSA. ST239Kras pneumonia may have been attributed to a unique set of multiple virulence factors (MVFs): toxic shock syndrome toxin-1 (TSST-1), elevated PSMα/Hld expression, α-hemolysin, the staphylococcal enterotoxin SEK/SEQ, the immune evasion factor SCIN/SAK, and collagen adhesin. Regarding ST8Kras, SEA was included in MVFs, some of which were common to ST239Kras. The ST239Kras (strain OC3) genome contained: a completely unique phage, φSa7-like (W), with no att repetition; S. aureus pathogenicity island SaPI2R, the first TSST-1 gene-positive (tst+) SaPI in the ST239 lineage; and a super copy of IS256 (≥22 copies/genome). ST239Kras carried the Brazilian SCCmecIII.1.1.2 and United Kingdom-type tst. ST239Kras and ST8Kras were MDR, with the same levofloxacin resistance mutations; small, but transmissible chloramphenicol resistance plasmids spread widely enough to not be ignored. These results suggest that novel MDR and MVF+ HA- and CA-MRSA (ST239Kras and ST8Kras) emerged in Siberian Russia (Krasnoyarsk) associated with fatal pneumonia, and also with ST

  1. Maksimum Yagıslar için Süreden Bagımsız Bir Bölgesel Model Yaklasımı

    Directory of Open Access Journals (Sweden)

    Ömer Levend AŞIKOĞLU

    2009-04-01

    Full Text Available Bu çalısmada, Ege Bölgesi örneginde belli tekerrürlü standart süreli yıllık maksimum yagıs (SSMY tahmininde kullanılabilecek, Lognormal tabanlı bir bölgesel model gelistirilmistir. Bölgesel modellerin temel amacı, proje alanına yakın birkaç istasyondaki noktasal veri ve bilgilerin proje alanına aktarılması ile ortaya çıkacak sakıncaları en aza indirmektir. Ayrıca, bölgesel modeller yardımıyla plüvyografsız istasyon bulunan veya hiç istasyon bulunmayan proje alanlarına da bilgi aktarma olanagı mevcuttur. Çalısmada, Lognormal dagılım fonksiyonunun tanımlanması için gerekli olan degiskenlik katsayısının yagıs süresinden bagımsız oldugu belirlenmis, tüm bölge için süreden bagımsız bir "bölgesel degiskenlik katsayısı" kullanılmıstır. Bölgesel degiskenlik katsayısının kullanımıyla gelistirilen "boyutsuz bölgesel tekerrür egrisi", proje alanında ortalama yagıs yüksekligi bilinen her noktada verilen tekerrüre karsılık gelecek yagıs yüksekliginin hesaplanmasını saglayacaktır. Böylelikle bölgede daha etkin boyutsuz yagıs tahminleri yapılabilmesine imkan verecektir. Bu model, yagıs ölçüm istasyonlarının standart süreli yagısları Lognormal frekans dagılım modeline uyan bölgelerde, bölgesel model kurma açısından büyük kolaylıklar getirecektir.

  2. Antifungal activity of redox-active benzaldehydes that target cellular antioxidation

    Science.gov (United States)

    2011-01-01

    Background Disruption of cellular antioxidation systems should be an effective method for control of fungal pathogens. Such disruption can be achieved with redox-active compounds. Natural phenolic compounds can serve as potent redox cyclers that inhibit microbial growth through destabilization of cellular redox homeostasis and/or antioxidation systems. The aim of this study was to identify benzaldehydes that disrupt the fungal antioxidation system. These compounds could then function as chemosensitizing agents in concert with conventional drugs or fungicides to improve antifungal efficacy. Methods Benzaldehydes were tested as natural antifungal agents against strains of Aspergillus fumigatus, A. flavus, A. terreus and Penicillium expansum, fungi that are causative agents of human invasive aspergillosis and/or are mycotoxigenic. The yeast Saccharomyces cerevisiae was also used as a model system for identifying gene targets of benzaldehydes. The efficacy of screened compounds as effective chemosensitizers or as antifungal agents in formulations was tested with methods outlined by the Clinical Laboratory Standards Institute (CLSI). Results Several benzaldehydes are identified having potent antifungal activity. Structure-activity analysis reveals that antifungal activity increases by the presence of an ortho-hydroxyl group in the aromatic ring. Use of deletion mutants in the oxidative stress-response pathway of S. cerevisiae (sod1Δ, sod2Δ, glr1Δ) and two mitogen-activated protein kinase (MAPK) mutants of A. fumigatus (sakAΔ, mpkCΔ), indicates antifungal activity of the benzaldehydes is through disruption of cellular antioxidation. Certain benzaldehydes, in combination with phenylpyrroles, overcome tolerance of A. fumigatus MAPK mutants to this agent and/or increase sensitivity of fungal pathogens to mitochondrial respiration inhibitory agents. Synergistic chemosensitization greatly lowers minimum inhibitory (MIC) or fungicidal (MFC) concentrations. Effective

  3. Effects of Biochar and Lime on Soil Physicochemical Properties and Tobacco Seedling Growth in Red Soil

    Directory of Open Access Journals (Sweden)

    ZHU Pan

    2015-12-01

    Full Text Available Red soil, mainly found in the southern China, is developed in a warm, moist climate. The main property of the soils is strong acidity, aluminum toxicity, and low available nutrients. In this study, different effects of biochar and lime on soil physicochemical properties and tobacco growth were determined in red soil, so as to provide a scientific foundation for soil improvement tobacco field. A pot experiment was designed and conducted at four biochar levels(0, 0.5%, 1%, 2% and normal lime level (0.3% to study effects of two different soil amendments on red soil pH, exchangeable aluminum(Exc-Al and exchangeable manganese(Exc-Mn, available nutrients and organic carbon (SOC. Meanwhile, agronomic traits, biomass and leaves elements of tobacco were also tested. Results showed that the agronomic characters and biomass of tobacco seedling had changed effectively after biochar or lime was added. Under 0.5%, 1% biochar treatment, the content of nitrogen(N, phosphorus(P, potassium(K, calcium(Ca and magnesium(Mg in tobacco leaves substantially raised. However, when 2% biochar was applied, leaves N content declined by 9.3%. Compared with the control, leaves N, P and Ca content increased observably in the lime treatment. However, its K and Mg content decreased by 9.0% and 13.3% respectively. Alkaline nitrogen(SAN, available phosphorus (SAP, available potassium (SAK, and exchangeable calcium (Exc-Ca and exchangeable magnesium (Exc-Mg were improved obviously in soil applied with biochar. Only the content of Exc-Ca was significantly increased in lime treatment. In addition, it was beneficial to improve soil pH and reduce soil Exc-Al when biochar or lime had been used. Thus, both biochar and lime are propitious to increase soil pH value, lessen soil Exc-Al content, and improve the growth of tobacco seedling. Furthermore, biochar application also can raise the content of available nutrient and SOC in red soil.

  4. Healthcare- and Community-Associated Methicillin-Resistant Staphylococcus aureus (MRSA) and Fatal Pneumonia with Pediatric Deaths in Krasnoyarsk, Siberian Russia: Unique MRSA's Multiple Virulence Factors, Genome, and Stepwise Evolution

    Science.gov (United States)

    Khokhlova, Olga E.; Hung, Wei-Chun; Wan, Tsai-Wen; Iwao, Yasuhisa; Takano, Tomomi; Higuchi, Wataru; Yachenko, Svetlana V.; Teplyakova, Olga V.; Kamshilova, Vera V.; Kotlovsky, Yuri V.; Nishiyama, Akihito; Reva, Ivan V.; Sidorenko, Sergey V.; Peryanova, Olga V.; Reva, Galina V.; Teng, Lee-Jene; Salmina, Alla B.; Yamamoto, Tatsuo

    2015-01-01

    Methicillin-resistant Staphylococcus aureus (MRSA) is a common multidrug-resistant (MDR) pathogen. We herein discussed MRSA and its infections in Krasnoyarsk, Siberian Russia between 2007 and 2011. The incidence of MRSA in 3,662 subjects was 22.0% and 2.9% for healthcare- and community-associated MRSA (HA- and CA-MRSA), respectively. The 15-day mortality rates for MRSA hospital- and community-acquired pneumonia (HAP and CAP) were 6.5% and 50%, respectively. MRSA CAP cases included pediatric deaths; of the MRSA pneumonia episodes available, ≥27.3% were associated with bacteremia. Most cases of HA-MRSA examined exhibited ST239/spa3(t037)/SCCmecIII.1.1.2 (designated as ST239Kras), while all CA-MRSA cases examined were ST8/spa1(t008)/SCCmecIV.3.1.1(IVc) (designated as ST8Kras). ST239Kras and ST8Kras strongly expressed cytolytic peptide (phenol-soluble modulin α, PSMα; and δ-hemolysin, Hld) genes, similar to CA-MRSA. ST239Kras pneumonia may have been attributed to a unique set of multiple virulence factors (MVFs): toxic shock syndrome toxin-1 (TSST-1), elevated PSMα/Hld expression, α-hemolysin, the staphylococcal enterotoxin SEK/SEQ, the immune evasion factor SCIN/SAK, and collagen adhesin. Regarding ST8Kras, SEA was included in MVFs, some of which were common to ST239Kras. The ST239Kras (strain OC3) genome contained: a completely unique phage, φSa7-like (W), with no att repetition; S. aureus pathogenicity island SaPI2R, the first TSST-1 gene-positive (tst+) SaPI in the ST239 lineage; and a super copy of IS256 (≥22 copies/genome). ST239Kras carried the Brazilian SCCmecIII.1.1.2 and United Kingdom-type tst. ST239Kras and ST8Kras were MDR, with the same levofloxacin resistance mutations; small, but transmissible chloramphenicol resistance plasmids spread widely enough to not be ignored. These results suggest that novel MDR and MVF+ HA- and CA-MRSA (ST239Kras and ST8Kras) emerged in Siberian Russia (Krasnoyarsk) associated with fatal pneumonia, and also with ST

  5. Healthcare- and Community-Associated Methicillin-Resistant Staphylococcus aureus (MRSA and Fatal Pneumonia with Pediatric Deaths in Krasnoyarsk, Siberian Russia: Unique MRSA's Multiple Virulence Factors, Genome, and Stepwise Evolution.

    Directory of Open Access Journals (Sweden)

    Olga E Khokhlova

    Full Text Available Methicillin-resistant Staphylococcus aureus (MRSA is a common multidrug-resistant (MDR pathogen. We herein discussed MRSA and its infections in Krasnoyarsk, Siberian Russia between 2007 and 2011. The incidence of MRSA in 3,662 subjects was 22.0% and 2.9% for healthcare- and community-associated MRSA (HA- and CA-MRSA, respectively. The 15-day mortality rates for MRSA hospital- and community-acquired pneumonia (HAP and CAP were 6.5% and 50%, respectively. MRSA CAP cases included pediatric deaths; of the MRSA pneumonia episodes available, ≥27.3% were associated with bacteremia. Most cases of HA-MRSA examined exhibited ST239/spa3(t037/SCCmecIII.1.1.2 (designated as ST239Kras, while all CA-MRSA cases examined were ST8/spa1(t008/SCCmecIV.3.1.1(IVc (designated as ST8Kras. ST239Kras and ST8Kras strongly expressed cytolytic peptide (phenol-soluble modulin α, PSMα; and δ-hemolysin, Hld genes, similar to CA-MRSA. ST239Kras pneumonia may have been attributed to a unique set of multiple virulence factors (MVFs: toxic shock syndrome toxin-1 (TSST-1, elevated PSMα/Hld expression, α-hemolysin, the staphylococcal enterotoxin SEK/SEQ, the immune evasion factor SCIN/SAK, and collagen adhesin. Regarding ST8Kras, SEA was included in MVFs, some of which were common to ST239Kras. The ST239Kras (strain OC3 genome contained: a completely unique phage, φSa7-like (W, with no att repetition; S. aureus pathogenicity island SaPI2R, the first TSST-1 gene-positive (tst+ SaPI in the ST239 lineage; and a super copy of IS256 (≥22 copies/genome. ST239Kras carried the Brazilian SCCmecIII.1.1.2 and United Kingdom-type tst. ST239Kras and ST8Kras were MDR, with the same levofloxacin resistance mutations; small, but transmissible chloramphenicol resistance plasmids spread widely enough to not be ignored. These results suggest that novel MDR and MVF+ HA- and CA-MRSA (ST239Kras and ST8Kras emerged in Siberian Russia (Krasnoyarsk associated with fatal pneumonia, and also with ST

  6. Phase Behavior, Solid Organic Precipitation, and Mobility Characterization Studies in Support of Enhanced Heavy Oil Recovery on the Alaska North Slope

    Energy Technology Data Exchange (ETDEWEB)

    Shirish Patil; Abhijit Dandekar; Santanu Khataniar

    2008-12-31

    amount of geographically diverse data, it is not possible to develop a comprehensive predictive model. Based on the comprehensive phase behavior analysis of Alaska North Slope crude oil, a reservoir simulation study was carried out to evaluate the performance of a gas injection enhanced oil recovery technique for the West Sak reservoir. It was found that a definite increase in viscous oil production can be obtained by selecting the proper injectant gas and by optimizing reservoir operating parameters. A comparative analysis is provided, which helps in the decision-making process.

  7. Evsel Atıklardan Elde Edilen Kompostun Mısır ve Biberin Gelişimi ve Besin Elementi İçeriğine Etkisi

    Directory of Open Access Journals (Sweden)

    Derviş AYNACI

    2016-04-01

    Full Text Available Araştırmada, 1 ay süre ile 10 ayrı haneden mutfak atıkları toplanmış, toplanan evsel atıklardan elde edilen kompostun sera koşullarında mısır ve biber bitkilerinin gelişimi ve besin elementi içeriğine etkisi araştırılmıştır. Deneme 2 kg toprak alan saksılarda yürütülmüş olup, kompostun 6 (0, 0.25, 0.50, 1.00, 2.00 ve 4.00 ton/da dozu uygulanmıştır. Araştırma, 4 paralelli olarak, tesadüf parselleri deneme desenine göre planlanmış ve 2 ay süreyle yürütülmüştür. Araştırma sonunda hasat edilen bitkilerde kuru ağırlık değerleriyle N, P, K, Ca, Mg, Fe, Cu, Zn ve Mn konsantrasyonları belirlenmiştir. Uygulanan kompost miktarı arttıkça bitki kuru ağırlığı artmış, biber bitkisinin N konsantrasyonunda 2-2.4 kat arasında artışlar görülmüştür. Mısır bitkisi N konsantrasyonları da kompost dozlarından olumlu etkilenmiş fakat burada dozlar arası fark önemli olmamıştır. Bitkilerde P, K ve Ca konsantrasyonları kompost miktarı arttıkça olumlu yönde etkilenmiş, biberde Fe, Zn ve Mn konsantrasyonları, mısırda ise Mn konsantrasyonu etkisi istatistiksel anlamda önemli bulunmuştur.

  8. A Livestock-Associated, Multidrug-Resistant, Methicillin-Resistant Staphylococcus aureus Clonal Complex 97 Lineage Spreading in Dairy Cattle and Pigs in Italy.

    Science.gov (United States)

    Feltrin, Fabiola; Alba, Patricia; Kraushaar, Britta; Ianzano, Angela; Argudín, María Angeles; Di Matteo, Paola; Porrero, María Concepción; Aarestrup, Frank M; Butaye, Patrick; Franco, Alessia; Battisti, Antonio

    2015-11-20

    Pandemic methicillin-resistant Staphylococcus aureus (MRSA) clonal complex 97 (CC97) lineages originated from livestock-to-human host jumps. In recent years, CC97 has become one of the major MRSA lineages detected in Italian farmed animals. The aim of this study was to characterize and analyze differences in MRSA and methicillin-susceptible S. aureus (MSSA) mainly of swine and bovine origins. Forty-seven CC97 isolates, 35 MRSA isolates, and 6 MSSA isolates from different Italian pig and cattle holdings; 5 pig MRSA isolates from Germany; and 1 human MSSA isolate from Spain were characterized by macrorestriction pulsed-field gel electrophoresis (PFGE) analysis, multilocus sequence typing (MLST), spa typing, staphylococcal cassette chromosome mec (SCCmec) typing, and antimicrobial resistance pattern analysis. Virulence and resistance genes were investigated by PCR and microarray analysis. Most of the isolates were of SCCmec type V (SCCmec V), except for two German MRSA isolates (SCCmec III). Five main clusters were identified by PFGE, with the German isolates (clusters I and II) showing 60.5% similarity with the Italian isolates, most of which (68.1%) grouped into cluster V. All CC97 isolates were Panton-Valentine leukocidin (PVL) negative, and a few (n = 7) tested positive for sak or scn. All MRSA isolates were multidrug resistant (MDR), and the main features were erm(B)- or erm(C)-mediated (n = 18) macrolide-lincosamide-streptogramin B resistance, vga(A)-mediated (n = 37) pleuromutilin resistance, fluoroquinolone resistance (n = 33), tet(K) in 32/37 tet(M)-positive isolates, and blaZ in almost all MRSA isolates. Few host-associated differences were detected among CC97 MRSA isolates: their extensive MDR nature in both pigs and dairy cattle may be a consequence of a spillback from pigs of a MRSA lineage that originated in cattle as MSSA and needs further investigation. Measures should be implemented at the farm level to prevent spillover to humans in intensive farming

  9. The Danish Testicular Cancer database

    Directory of Open Access Journals (Sweden)

    Daugaard G

    2016-10-01

    Full Text Available Gedske Daugaard,1 Maria Gry Gundgaard Kier,1 Mikkel Bandak,1 Mette Saksø Mortensen,1 Heidi Larsson,2 Mette Søgaard,2 Birgitte Groenkaer Toft,3 Birte Engvad,4 Mads Agerbæk,5 Niels Vilstrup Holm,6 Jakob Lauritsen1 1Department of Oncology 5073, Copenhagen University Hospital, Rigshospitalet, Copenhagen, 2Department of Clinical Epidemiology, Aarhus University Hospital, Aarhus, 3Department of Pathology, Copenhagen University Hospital, Rigshospitalet, Copenhagen, 4Department of Pathology, Odense University Hospital, Odense, 5Department of Oncology, Aarhus University Hospital, Aarhus, 6Department of Oncology, Odense University Hospital, Odense, Denmark Aim: The nationwide Danish Testicular Cancer database consists of a retrospective research database (DaTeCa database and a prospective clinical database (Danish Multidisciplinary Cancer Group [DMCG] DaTeCa database. The aim is to improve the quality of care for patients with testicular cancer (TC in Denmark, that is, by identifying risk factors for relapse, toxicity related to treatment, and focusing on late effects. Study population: All Danish male patients with a histologically verified germ cell cancer diagnosis in the Danish Pathology Registry are included in the DaTeCa databases. Data collection has been performed from 1984 to 2007 and from 2013 onward, respectively. Main variables and descriptive data: The retrospective DaTeCa database contains detailed information with more than 300 variables related to histology, stage, treatment, relapses, pathology, tumor markers, kidney function, lung function, etc. A questionnaire related to late effects has been conducted, which includes questions regarding social relationships, life situation, general health status, family background, diseases, symptoms, use of medication, marital status, psychosocial issues, fertility, and sexuality. TC survivors alive on October 2014 were invited to fill in this questionnaire including 160 validated questions

  10. Transformation of Resources to Reserves: Next Generation Heavy-Oil Recovery Techniques

    Energy Technology Data Exchange (ETDEWEB)

    Stanford University; Department of Energy Resources Engineering Green Earth Sciences

    2007-09-30

    (BN) of the crude oil. A significant number of laboratory-scale tests were made to evaluate the solution gas drive potential of West Sak (AK) viscous oil. The West Sak sample has a low acid number, low asphaltene content, and does not appear foamy under laboratory conditions. Tests show primary recovery of about 22% of the original oil in place under a variety of conditions. The acid number of other Alaskan North Slope samples tests is greater, indicating a greater potential for recovery by heavy-oil solution gas drive. Effective cold production leads to reservoir pressure depletion that eases the implementation of thermal recovery processes. When viewed from a reservoir perspective, thermal recovery is the enhanced recovery method of choice for viscous and heavy oils because of the significant viscosity reduction that accompanies the heating of oil. One significant issue accompanying thermal recovery in cold environments is wellbore heat losses. Initial work on thermal recovery found that a technology base for delivering steam, other hot fluids, and electrical heat through cold subsurface environments, such as permafrost, was in place. No commercially available technologies are available, however. Nevertheless, the enabling technology of superinsulated wells appears to be realized. Thermal subtasks focused on a suite of enhanced recovery options tailored to various reservoir conditions. Generally, electrothermal, conventional steam-based, and thermal gravity drainage enhanced oil recovery techniques appear to be applicable to 'prime' Ugnu reservoir conditions to the extent that reservoir architecture and fluid conditions are modeled faithfully here. The extent of reservoir layering, vertical communication, and subsurface steam distribution are important factors affecting recovery. Distribution of steam throughout reservoir volume is a significant issue facing thermal recovery. Various activities addressed aspects of steam emplacement. Notably, hydraulic

  11.  gomùs, -i „norus, noringas, linkęs“, la. gãma „kas pernelyg daug valgo“ ir kiti giminiški žodžiai

    Directory of Open Access Journals (Sweden)

    Vincas Urbutis

    2011-05-01

    Full Text Available LIT. gomùs, -i „WILLIG, BEREIT, GENEIGT“, LETT. gãma „EINER, DER ÜBERMÄSSIG VIEL IßT“ UND ANDERE VERWANDTE WÖRTERZusammenfassungLit. gãmas „Vielfraß, Freßsak; jemand, der mehr arbeitet als er kann“, gamúoti „wünschen, begehren, nach etwas Leckerem suchen“, gomùs, -ì „willig, bereit, geneigt“, gomurà „ein habsüchtiger Mensch, Habgieriger“, gumãras „ds.“, gumė́ti „beabsichtigen, Lust haben, bereit sein“; lett. gam̃ris „ein ausgehungerter Mensch, der gierig ißt“, gãma „einer, der übermässig viel ißt“, gãmêt „hungern; übermässig viel essen“, gum̃zât (gumzêt „verschlingen, großartig essen“ usw. gehören zu derselben Wortfamilie wie lit. gamãkas „Stück, Klumpen“, gamulỹs „Klumpen, (Schneeball, Ballen“, gõmulti „zusammenknäueln, -drücken; einhüllen, einmummen“, gumsà (gumšà „etwas, das hervorragt, Beule“, gumulis, -ė „hornlos, ungehörnt; hornloses Stück Rindvieh“; lett. gams (? „Knoten, Knollen (an Pflanzen“, gums „Bolle, Knolle; blätterlose Knospe“, gùmt (gum̂t „sich biegen; wulstig werden; überfallen, sich auf einen langsam senken; greifen“, gumzdît „mit der Hand (jem. von hinten vorwärts schieben, anspornen, anreizen; quälen; knüllen; drücken, stopfend quet­schen“; russ. гомо́ла „Klumpen, Ballen“, жать (жму „pressen, drücken“ usw. (idg. *gem-: *gm-:*g- „zusammendrücken; Klumpen“. Die semantische Entwicklung von „(zusammen­drücken; Klumpen, Ballen“ bis „begehren, habsüchtig sein“ geht über die Zwischenbedeutung „übermässig viel, gierig essen“ (eigentlich „große Bissen schlucken, große Stücke (mit vollgestopftem Munde essen“ oder „(in den Mund stopfen“. Zu derselben Wortfamilie gehört wahrscheinlich lett. guõmele „eine Art grosser Erdbienen, Hummel“ (vgl. lett. kamane „Erdbiene, Hummel“ neben kams „Klumpen, eine gr

  12. Globalization, differentiation and drinking cultures, an anthropological perspective

    Directory of Open Access Journals (Sweden)

    Thomas Wilson

    2004-12-01

    Full Text Available L’alcool et sa consommation ne renvoient pas simplement au domaine économique. L’alcool est devenu aujourd’hui une partie intégrale des relations sociales dans différentes cultures au point où son importance globale est souvent sous-estimée par ses plus ardents critiques. En dépit de ses conséquences directes sur la santé, sa consommation a pris une certaine ampleur dans le monde industriel développé. Certainement son rôle central dans la construction des identités individuelles explique sa position clé au sein des sociétés. Que nous dit le saké à propos du Japon ou le vin de Bourgogne sur la France? Que nous dit la consommation ou l’abstinence d’alcool sur les questions d’identité individuelle, d’ethnicité, de classe et de culture? Quelle place tient l’alcool dans la définition de soi et dans la notion de résistance? Répondre à ces questions et à d’autres est le but essentiel de cet article qui examine la consommation d’alcool à travers différentes cultures et ce que boire signifie pour ceux qui choisissent de consommer ou de s’abstenir. De l’Irlande à Hong-Kong, Mexico à l’Allemagne, l’alcool occupe un certain nombre de fonctions sociales, religieuses, politiques et familiales. Les cultures du boire définissent ces consommations dans le cadre plus large des pratiques sociales et montrent comment classes sociales, ethnicité et nationalisme peuvent s’exprimer à travers cette commodité. En partant d’approches de terrain, les contributeurs analysent l’interface entre culture et pouvoir dans les bars et pubs, la signification des images publicitaires, le rôle de ces boissons dans la vie quotidienne. Le résultat est la première publication comparative sur les questions de l’impact que la consommation d’alcool a sur l’identité nationale dans le monde aujourd’hui.Alcohol is not only big business, it has become an essential part of social relations in so many cultures that

  13. Using Uranium-series isotopes to understand processes of rapid soil formation in tropical volcanic settings: an example from Basse-Terre, French Guadeloupe

    Science.gov (United States)

    Ma, Lin

    2015-04-01

    Lin Ma1, Yvette Pereyra1, Peter B Sak2, Jerome Gaillardet3, Heather L Buss4 and Susan L Brantley5, (1) University of Texas at El Paso, El Paso, TX, United States, (2) Dickinson College, Carlisle, PA, United States, (3) Institute de Physique d Globe Paris, Paris, France, (4) University of Bristol, Bristol, United Kingdom, (5) Pennsylvania State University Main Campus, University Park, PA, United States Uranium-series isotopes fractionate during chemical weathering and their activity ratios can be used to determine timescales and rates of soil formation. Such soil formation rates provide important information to understand processes related to rapid soil formation in tropical volcanic settings, especially with respect to their fertility and erosion. Recent studies also highlighted the use of U-series isotopes to trace and quantify atmospheric inputs to surface soils. Such a process is particularly important in providing mineral nutrients to ecosystems in highly depleted soil systems such as the tropical soils. Here, we report U-series isotope compositions in thick soil profiles (>10 m) developed on andesitic pyroclastic flows in Basse-Terre Island of French Guadeloupe. Field observations have shown heterogeneity in color and texture in these thick profiles. However, major element chemistry and mineralogy show some general depth trends. The main minerals present throughout the soil profile are halloysite and gibbsite. Chemically immobile elements such as Al, Fe, and Ti show a depletion profile relative to Th while elements such as K, Mn, and Si show a partial depletion profile at depth. Mobile elements such as Ca, Mg, and Sr have undergone intensive weathering at depths, and an addition profile near the surface, most likely related to atmospheric inputs. (238U/232Th) activity ratios in one soil profile from the Brad David watershed in this study ranged from 0.374 to 1.696, while the (230Th/232Th) ratios ranged from 0.367 to 1.701. A decrease of (238U/232Th) in the

  14. Effect of humic-rich peat extract on plant growth and microbial activity in contaminated soil / Ar humusvielām bagāta kūdras ekstrakta ietekme uz augu augšanu un mikroorganismu aktivitāti piesārņotā augsnē

    Directory of Open Access Journals (Sweden)

    Muter Olga

    2015-11-01

    Full Text Available Humusvielu kūdras ekstrakts (HKE, kas satur augu un dzīvnieku valsts sadalīšanās produktus, raisa lielu zinātnisko interesi augsnes auglības un revitalizācijas jomā. Darbā izmantojamais HKE tika iegūts kūdras ekstrakcijas rezultātā saskaņā ar standarta metodi. Kūdras humīnskābes satur C 52 %; H 5 %, N 1.6 %, S 0.5 %, О - 32-43 %, pelnus 2 %. Iegūtie rezultāti pēc Van-Klevelena metodes liecināja, ka analizējamais materiāls ir organisko vielu sadalīšanās sākotnējā stadijā. Eksperiments tika veikts laboratorijas apstākļos 23 dienas kultivējot kviešus, pupas, rapsi un kressalātus. Eksperimentiem izmantota smilšmāla augsne, kas iegūta municipālo atkritumu glabātuves apkārtnē. Katrā izmēģinājuma traukā bija 32 g (50 ml augsnes, 0,5 ml (1 tilp. % vai 2.5 ml (5 tilp. % HKE, kā arī 20 ml toksiska infiltrāta, kas iegūts atkritumu glabāšanas vietā. Visu testējamo augu virszemes daļas biomasas pieaugums bija lielāks variantos ar nepiesārņoto augsni. HEK pievienošana stimulēja pupiņu un kressalātu sakņu sistēmas attīstību nepiesārņotā augsnē, bet kviešiem un rapsim - piesārņotā augsnē. HEK stimulējošā ietekme uz augsnes mikroorganismiem tika novērota variantos ar kviešiem, pupiņām un rapsi. Statistiski ticami iegūti ureāzes aktivitātes palielināšanās rezultāti piesārņotā augsnē ar HEK piedevu kviešiem (p = 0.005 un rapsim (p = 0.027. Variantā ar kressalātiem HEK nomāc mikroorganismu ureāzes un fluoresceīna diacetāta aktivitāti. Variantos ar rapsi HEK pievienošana piesārņotai augsnei ievērojami stimulēja augsnes mikrofloras substrāta inducēto elpošanu. Tādejādi HEK ietekmi uz testējamo augu augšanu un augsnes mikroorganismu aktivitāti var novērtēt kā sugasspecifisku. Iegūtie rezultāti liecina, ka HEK efekts ir atkarīgs no augsnes piesārņojuma un humātu iedarbības izraisītā mehānisma komplicēto fizikāli-ķīmisko un biolo

  15. Blood on their hands: How heroines in biblical and Apocryphal literature differ from those in ancient literature regarding violence

    Directory of Open Access Journals (Sweden)

    Robin Gallaher Branch

    2014-12-01

    van Herodotus, Homeros en Tacitus onthul interessante ooreenkomste. Hierdie artikel bespreek karakterstudies uit die verhaal van die Amasone – vrouekrygers wat nie geskroom het om hulle eie liggame te skend ter wille van die beter hantering van hulle wapens nie; die verhaal van Tomyris, wat ’n geveg teen Cyrus wen en sy kop in ’n sak, gevul met menslike bloed, geplaas het; Anchita, ’n Spartaanse moeder wat haar goedkeuring gee om haar seun lewend in tempel van Minerva af te seël; en Boadicea, wat ’n rebellie teen Rome aangevoer het waarin 80 000 Britte omgekom het. Die slotsom van hierdie artikelis dat Debora en Jael, Ester, en Judit, in teenstelling met vroue uit ander kulture, hulle inkrisistye tot geweldpleging gewend het slegs wanneer hulle volksgenote bedreig is. Hulle eenmalige dade is net tot die aggressors beperk en word waarskynlik deur ’n gevoel van erbarming getemper.

  16. Šaukėnų šnektos veiksmažodžio asmenavimo sistema (vientisinės formos

    Directory of Open Access Journals (Sweden)

    Albertas Rosinas

    2011-12-01

    -stem verbs constitute a highly productive and stable class while in the subdialect there have remained only four i̯a (former i - stem verbs: tí·l̑ : ti·líeti, gál̑ : galíeti, mí·l̑ : mi·líeti  and gúl̑ : gulíeti. The verbs of the 2nd conjugation (or a-stem are also rather productive.The Šaukėnai subdialect has preserved some remnants of athematic conjugation. Some verbs are impersonal, e.g. per̃št, the others possess all personal forms derived from underlying form stems, e.g. mĩ·i̯ktu, etc.The categories in the Šaukėnai subdialect indicate a variety of symbolization.The categories of person and number are usually represented by grammatical morphemes, or endings (i.e. the morphological markers of the categories: /-u/, /-a·u/symbolize the categories of person and number, i.e.  the 1st person and the singular, /-i/, /-a· /, /-e· / -- the 2nd person and the singular /-am/, /-uom/, /-iem/, /-ma/--  the 1st person and the plural, /-at/, /-uot/, /-iet/, /-te/-- the 2nd person and the plural. The ending forms of the 3rd person represent the category of person, i.e. the 3rd person only.The article rejects the opinion, which dominates in Lithuanian linguistic literature, as if the verbal form endings could also represent the category of tense. It is complete misunderstanding, cf. sak-á·u (present and suk-á·u (past, mùš-ù (present and mùš-ù (future, etc. As evidenced by the data from the Šaukėnai subdialect, the tense can be expressed by syntactic category markers, phonological means, cf. mat-á·u and mač̑-ǽ·u, various formants (infixes, such as –n-, -st-, -s-, cf. añk and ãka, ki̲m̃b and kì̲ba, ti̲r̃pst  and ti̲r̃pa, dí̲́rbu and dí̲́rpsu, suffixes, cf. dí̲́rb-a·u and dí̲́rb-dav-a·u as well as vowel gradation, cf. ker̃t and ki̲r̃ta, etc. However, only the simple form endings of the indicative and subjunctive moods can express the mood.The forms of the subjunctive mood, alongside their specific

  17. Okuma Yazma Öğretimi Yöntemleri Ve “Ses Temelli Cümle Yöntemi” Uygulaması The Methods Of Teaching Reading And Writing In Turkish: Practice The Phonetic Based Method

    Directory of Open Access Journals (Sweden)

    Raşit KOÇ

    2012-12-01

    ğrenmede ve bu işi zevkli bir alışkanlığa dönüştürmede okuma ve yazma öğretiminde nasıl bir yol izleneceği de önem kazanmaktadır.Ülkemizde dünyadaki gelişmelere paralel olarak okuma yazma öğretiminde kullanılan yöntemler de zaman içerisinde değişmiştir. Okuma yazma öğretiminde uzun süre harf yöntemi kullanılmıştır. Harf yöntemini sırasıyla ses yöntemi, hece yöntemi kelime ve cümle yöntemi izlemiştir.Davranışçı kuram merkeze alınarak hazırlanmış olan eski Türkçe programı öğrencileri ezbere sevk ettiği, etkili ve kalıcı bir okuma alışkanlığı kazandırmada yeterli olmadığı için eleştirilere muhatap olmuştur. Zaman zaman revizyon geçiren eski program 2005 yılında yerini yeni programa bırakmıştır.Temel felsefesini yapılandırmacı yaklaşımın oluşturduğu yeni Türkçe programında okuma yazma öğretim yöntemi olarak ses temelli cümle yöntemi benimsenmiştir. Bu yöntemle beraber dik temel harflerle yapılan yazı öğretimi yerine bitişik eğik yazı kullanılmaya başlanmıştır.Bu çalışmada, okuma yazma öğretiminde günümüze kadar kullanılan yöntemler ve bu yöntemlerin faydalı ve sakıncalı yönleri belirtildikten sonra yeni hazırlanan Türkçe programında yer alan ses temelli cümle yöntemiyle ilgili düşüncelere yer verilecektir.

  18. Effektive representasjoner? Forventninger til og bekymringer for forskning på befruktede egg

    Directory of Open Access Journals (Sweden)

    Marie Auensen Antonsen

    2011-05-01

    Full Text Available I Norge har vi hatt kontroverser omkring regulering avhumanmedisinsk bioteknologi siden 1980-tallet. Denneartikkelen analyserer et lite utsnitt av disse reguleringsdebattene,nærmere bestemt kontroversen omkring forskningpå befruktede egg. Med utgangspunkt i skriftlig materialeknyttet til tre reguleringsrunder (1994, 2003/2004 og2008 undersøker vi her hvordan ulike aktører arbeidet forå ramme inn denne kontroversen, bl.a. ved hjelp av ulikevitenskapelige og politiske representasjoner av det befruktedeegget.Vi finner at det i perioden 1987–2007 ble arbeidet medulike innramminger som utgangspunkt for retoriske ogpolitiske strategier: På den ene siden ser vi forsøk på å innrammekontroversen i et risikorammeverk som først ogfremst fokuserte på de potensielle negative sidene vedhumanmedisinsk bioteknologi, og som spesielt vektlarespekten for det ufødte liv. På den andre siden ser vi atman arbeidet med en forventningsinnramming som lahovedvekten på håpet om nye behandlingsregimer foralvorlig syke mennesker.Forbudet mot forskning på befruktede egg som ble vedtatti 1987, ble opprettholdt i 1994 og 2003. Med lovendringeni 2008 fikk vi imidlertid et markant brudd i dennorske lovgivningspraksisen, da forskning på befruktedeegg ble tillatt på visse premisser. Vi argumenterer for at den viktigste årsaken til denne lovendringen var Mehmet-saken, en sak som medførtesåkalte «oversvømmelser» (Callon 1998 i begge innrammingsforsøkenesom er omtalt ovenfor. Mehmet-saken eksponerte samtidig et generelt demokratiskdilemma. Saken illustrerte hvor sårbare lovregler og etiske prinsippkan være for det som for allmennheten fremstår som helt urimelig, og dennesaken etterspør slik sett mer hybride måter å tenke forholdet mellom det universelleog det partikulære, mellom prinsipiell etikk og lekmannsskjønn, mellomfakta og verdier som utgangspunkt for politikkutforming.Nøkkelord: humanmedisinsk bioteknologi, forskning på befruktede egg

  19. Chemical Methods for Ugnu Viscous Oils

    Energy Technology Data Exchange (ETDEWEB)

    Kishore Mohanty

    2012-03-31

    The North Slope of Alaska has large (about 20 billion barrels) deposits of viscous oil in Ugnu, West Sak and Shraeder Bluff reservoirs. These shallow reservoirs overlie existing productive reservoirs such as Kuparuk and Milne Point. The viscosity of the Ugnu reservoir on top of Milne Point varies from 200 cp to 10,000 cp and the depth is about 3300 ft. The same reservoir extends to the west on the top of the Kuparuk River Unit and onto the Beaufort Sea. The depth of the reservoir decreases and the viscosity increases towards the west. Currently, the operators are testing cold heavy oil production with sand (CHOPS) in Ugnu, but oil recovery is expected to be low (< 10%). Improved oil recovery techniques must be developed for these reservoirs. The proximity to the permafrost is an issue for thermal methods; thus nonthermal methods must be considered. The objective of this project is to develop chemical methods for the Ugnu reservoir on the top of Milne Point. An alkaline-surfactant-polymer (ASP) formulation was developed for a viscous oil (330 cp) where as an alkaline-surfactant formulation was developed for a heavy oil (10,000 cp). These formulations were tested in one-dimensional and quarter five-spot Ugnu sand packs. Micromodel studies were conducted to determine the mechanisms of high viscosity ratio displacements. Laboratory displacements were modeled and transport parameters (such as relative permeability) were determined that can be used in reservoir simulations. Ugnu oil is suitable for chemical flooding because it is biodegraded and contains some organic acids. The acids react with injected alkali to produce soap. This soap helps in lowering interfacial tension between water and oil which in turn helps in the formation of macro and micro emulsions. A lower amount of synthetic surfactant is needed because of the presence of organic acids in the oil. Tertiary ASP flooding is very effective for the 330 cp viscous oil in 1D sand pack. This chemical formulation

  20. ASİDİK YAGIŞLARIN TRİTİCUM VULGARE ( BUGDAY ve ZEA • • • • • MA YS SACCHARA TA (MISIR BITKILERINE ETKILERI

    Directory of Open Access Journals (Sweden)

    NEVİN YALÇIN

    1999-12-01

    Full Text Available Bu çalışmada, asidik yağışların Triticum Vulgare (Buğday ve Zea Mays Saccbarata ( Mısır bitkile rine et ki leri incel enmiştir. Bu a1naçla, 24 adet 20x20x30 cn1 boyutundaki teneke saksı lara ekilen tohumlar pH 1 � 2, 3, 4. 5, 6 olan HN03 ve H2S04 ç özel til e ri ile bir ay bo yunc a sulanmışlar dır.T. Vulgar e ve Z.M. Saccharata yap r a k lar ı n d a k loroz i s (sa r arma ve flecking (benekleşme görülmüştür.Büyüme, 15. g ünde n sonra durınuştur. pH s ı düşük olan çö zel t i l er ile sulanan bitkilerde boyca enge llennıe görülmüş, çürüme daha önce b aş ! an1ış tı r . Ayrıca as i di k çöz elti lerl e sulamanın tohum çim l e n m es i ni gec i ktirdi ğ i gözlenıniştir. Biyomas değ e r lerinde de k ayıpla r kaydedilıniştir. Düşük pH derecelerinde ka yıp l arı n daha fazla olduğu b eli r le nnı i ş t ir. Her iki bit k inin kök ve gövdelerinin anatemisinde bir bozulına görülmeıniştir. ABSTRACT In this study, the effects of acid rains on Triticum Vu l g a re (\\Vheat and Zea Mays Saccharata (Com were investigated. For this purpose, seeds were sowed to 24 tin pots at diı n ensions of 20x20x30 cm and they were vvatered with HN03 and H2S04 solutions which to be pH L 2, 3, 4, 5, 6 for o ne month. T.Vulgare and Z.M. Saccharata leavcs showed chlorosis and flecking. The growing stopped after 15 days. At solutions with low pH, p I ant l e ngt h s w ere n1easured shorter and rotting w as begun earlier than otlıers. It also inhibited seed gennination by de lay ing the same. The bi o mass values alsa s h owe d a loss and this was the h i g hest at the low pH degree s . The root and stern defo rmat i ons in each the two s p c ci es were not seemed . I. GİRİŞ Atmosferin kirl errmesi sonucu rneydana gelen asit yağmurlar1 veya asit ç ö k e J n 1 es i sanayinin, termik santr allerin , ulaşun araçlan n ın ve fosil yakıtların yaydığı SOx , kükürt oksit ve NOx , azot oksit

  1. Bilim ve Sanat Merkezi Öğret‐menlerinin Üstün ve Özel Yetenekli Öğrenciler için Tasarlanan Doğa ve Bilim Kampı Hakkında Görüşleri (Perceptions of Science and Art Centers’ Teachers about a Nature and Science Camp Designed for Gifted and Talented Students

    Directory of Open Access Journals (Sweden)

    Necati Hırça

    2012-06-01

    all of them worked in the SACs. As they were aware of the situation, they stated that they needed this kind of programs and various science activities from other education faculties to improve their skills in order to teach gifted students in science.Identification, training and employment of gifted individuals significantly contribute to the development of society. Training of these individuals in every academic level will provide value-added benefits to the future of our country (BSMİDR, 2010. The lack of these condi-tions will impede or delay their self-esteem, self-perception, discipline and achievement (Sak, 2011.

  2. Turkish Journal of Chemistry’nin Bibliyometrik Analizi / Bibliometric Analysis of Turkish Journal of Chemistry

    Directory of Open Access Journals (Sweden)

    Hatice Gülşen Birinci

    2008-10-01

    multiple authorships in TJC? What are the institutional affiliations of authors? Does the distribution of authors fit Bradford’s, Lotka’s and Price’s Law and 80/20 Rule? Which types of sources get cited more often in articles? Which journals are the most cited? According to cited journals what are the core journals in chemistry? With regard to impact factor, what is the place of TJC in JCR and SCI?The most productive authors are Sakıp Ali and İhsan Çalış. Distribution of authors does not fit Bradford’s, Lotka’s and Price’s Law and 80/20 Rule, but distirbution of citations fit Bradford and 80/20 Rule. Contributors affiliated with Hacettepe University, Ankara University, and Ataturk University. Journals received %82 of all citations in the TJC. Turkish Journal of Chemistry, Journal of the American Chemical Society, Phytochemistry and Journal of Organic Chemistry were the most frequently cited journals. Number of references made to TJC has been growing consistently since 1996.

  3. IMPORTANT CHANGE IN RELIGIO-LEGAL STANDARDIZATION OF OTTOMAN PRODUCTS: PASSAGE TO CERTIFICATE OF THE SEAL “IT IS CLEAN/TÂHİRDİR” OSMANLI’DA ÜRÜNLERİN DİNÎ/ŞER‘Î STANDARDİZASYONUNDA DÖNÜM NOKTASI: TÂHİRDİR DAMGALI SERTİFİKASYONA GEÇİŞ

    Directory of Open Access Journals (Sweden)

    Mehmet YILDIZ

    2010-01-01

    Full Text Available It is known that the Ottoman state implemented austere certification of products monitored by organizations such as ihtisab office/ office of the superintendent of guilds and markets and akhi office/ urban fraternity ruling over parts of Anatolia in late Seljuk and early Ottoman times. The monitoring process that was implemented based on religio-legal perspective or material quality aspect moved to an important phase with a critical decision made in modern times: The seal of “it is clean/tâhirdir” was introduced to include inedible products for the first time to be supervised by religio-legal standarts. This decision was made to protect Muslims from products that might contained harmful ingredients according to religio-legal norms. This move was made before the kosher certification that was formed within the Jewish community in America, which became a certain measure of food standart later in the world. This decision also can provide historical background for the practice of halal food certificates in the world. The notion of “it is clean” becomes more evident in the midst of today’s world where genetically modified organisms became so widespread to the level that threatens the health of human generation now. This article aims to study the relevant Ottoman official documents on this issue probably for the first time, and share them with the academic world. Osmanlı devleti ve toplumunda ürünlerin, standartları hisbe/ihtisap ve ahîlik teşkilatları gibi kurumlar vasıtasıyla denetlenen oldukça ciddi sertifikasyon uygulamasına tabi tutuldukları bilinmektedir. Gerek dinî/şer‛î boyutuyla gerekse maddi/nesnel kalite yönleriyle yürütülen bu denetleme işlemi, modern zamanlarda gerçekten çok çarpıcı bir kavşak noktasına ulaştırılmıştır: Özellikle dinî/şer‛î ölçütlerin gıda ürünleri dışındaki ürünlerde de gözetilerek Müslümanların kullanmalarında sakınca bulunmayan ürünlere t

  4. FRESHWATER FISH FARMING CONDITIONS IN 1999 AND THE PRODUCTION PLAN FOR 2000

    Directory of Open Access Journals (Sweden)

    Zlatko Homen

    2000-09-01

    at 7.945,43 tons of the freshwater fish, of which 7.173,33 tons are warm-water fish species, and 772,10 tons are cold-water species. Carp farming is the most dominante and most significant production branch in both of the years mentioned. Distribution of the produced freshwater fish was conducted as follows. The largest quantity of the produced fish was placed on the market through wholesale (48,51 percent. This was fallowed by the distribution of produced fish for reproduction purposes (plantation which comprises 40,25 percent. Retail trade claimed 4,39 percent and personal use recorded (recreatinal fishing 2,04 percent. Production losses due to diseases or other factors made up 4,81 percent of the overall production. The overall areas of the fish farms in 1999 were 11.921.06 hectares. The actual production sites made up 9.782 hectares. Compared to 1998, the overall areas decreased for 5,84 percentt, while the production sites were increased by 0,94 percent. When taking into account the production areas and the arhieved production for 1999, the fish production average for carp farming ponds was 632,63 kilograms per hectare. Of course, as we already highlighted this is the average, and according to the data provided, some fish farms arhieved cost-effective production, i. e. a produstion of over 1.000 kilograms per hectare. In trout farming ponds, the fish production average amounded to 133,17 tons per hectare. During 1999. 13.501,93 tons of fish food were used. Of this quantity, 12.553,13 tons were used in carp ponds and 948,81 tons in trout ponds. Naturally, corn is still most predominant food for carp species fish. As to the use of various raw materials, the overall amound used was 2.690,21 tons. Among the fixed assets for 1999, there were 218 boats, 74 outboard engines, 121 landing nets, 57 scatter guns. Among the accessories there were mats (known in colloquial Croatian terms as sak and meredov, receptacle for fish transport (tubs, pumps, devices for fish sorting

  5. Kongre İzlenimleri

    Directory of Open Access Journals (Sweden)

    Yasemin Balcı

    2007-12-01

    çilere açtığı şarap mahzenleri var. Görülmeye değerdi. Kongrenin son günü, Portoya özel bir festival vardı. S. Joe festival olarak anılıyor. Bu festivalin özelliği bir nevi şaka ya da hoşgörü günü gibi olması idi. Bu festival nedeniyle Portekiz’in diğer şehirlerinden pek çok kişi şehre geldi. Her ne kadar herkes sabaha kadar sokaklarda olup eğlense de otellerde yer kalmıyor. Her tarafta rengârenk plastik çekiçler satılıyor. Çoluk çocuk, genç ihtiyar herkes bu çekiçlerden satın alıyor. Sokaklarda yanında bulunan ya da yanından geçen herkese bu çekiçle vuruyor. Kongre organizasyon komitesi de bu nedenle bizi çekiçsiz bırakmadı. Katılımcılara çekiç verdiler. Ayrıca, sokaklarda kötü koku ile özdeşleştirilen fesleğen saksıları (bizde güzel koku olarak bilinir ile çiçeklenmiş/tohuma dönmüş erkek soğanlar satılıyor. İnsanlar yapraklarını koparıp elini yanındaki-nin burnuna sürüyor. Soğanın tohumlu kısmını yüzüne kulağına vs. sürtüyor. Tüm bunlar bir nevi şaka, kimse kimseye kırılmıyor. Şehrin tüm meydanlarında konser platformları kuruluyor, herkes sokaklarda dans ediyor, Super Bock adlı bira çeşmelerinden biralar alınıp içiliyor. Ezilme tehlikesi geçirecek kadar insan seli olmasına karşın, en küçük bir taşkınlıkla karşılaşılmaması oldukça ilgimizi çekti. Gece yarısından sonra nehri baştan yaratacak şekilde yapılan havai fişek gösterisi ile havaya fırlatılan yüzlerce ateş balonları görmeye değerdi. Türkiye’den kongre katılımcıları Uzm. Dr. Özlem Ersoy Adli Tıp Kurumu Prof. Dr. Mete Gülmen Çukurova Üniversitesi Dr. Hüsniye Canan, Phd. Çukurova Üniversitesi Dr. Demet Meral Çukurova Üniversitesi Dr. Dilek Battal, Phd. Çukurova Üniversitesi Prof. Dr. Yasemin Balcı Eskişehir Osmangazi Üniversitesi Yard. Doç. Dr. Birol Demirel Gazi Üniversitesi Doç. Dr. Coşkun Yorulmaz İstanbul Üniversitesi Yard. Doç. Dr. Gökhan Ersoy