
Sample records for varroa-sensitive hygiene vsh

  1. Expression of varroa sensitive hygiene (VSH) in commercial VSH honey bees (Hymenoptera: Apidae) (United States)

    We tested six commercial sources of honey bees (Apis mellifera L.) that were bred to include the trait of varroa sensitive hygiene (VSH). VSH confers resistance to the parasitic mite Varroa destructor Anderson & Trueman. Queens from these sources were established in colonies which later were measure...

  2. Simplified methods of evaluating colonies for levels of Varroa Sensitive Hygiene (VSH) (United States)

    Varroa sensitive hygiene (VSH) is a trait of honey bees, Apis mellifera, that supports resistance to varroa mites, Varroa destructor. Components of VSH were evaluated to identify simple methods for selection of the trait. Varroa mite population growth was measured in colonies with variable levels of...

  3. A Genome Wide Genotyping Study To Find Candidate Genes That Influence Varroa-Sensitive Hygiene (VSH) (United States)

    Varroa parasitism of honey bees is widely considered by apicultural researchers to be the greatest threat to beekeeping. Varroa-sensitive hygiene (VSH) is one of two identified behaviors that are highly important for controlling the growth of Varroa mite populations in bee hives. Bees exhibiting th...

  4. Varroa Sensitive Hygiene and Drone Brood (United States)

    Honey bees have been bred to express high levels of varroa sensitive hygiene (VSH), which is the removal of mite-infested pupae from capped worker brood. This hygienic behavior is a complex interaction of bees and brood in which brood cells sometimes are inspected, and then brood is either removed (...

  5. Responses to Varroa by honey bees with different levels of Varroa Sensitive Hygiene (United States)

    The mite-resistance trait called suppression of mite reproduction (SMR) is a form of hygienic behavior that we have named varroa sensitive hygiene (VSH). With VSH, adult worker bees (Apis mellifera) disrupt the population growth of parasitic mites (Varroa destructor) by removing mite-infested bee p...

  6. Antennae hold a key to Varroa-sensitive hygiene behaviour in honey bees


    Mondet, Fanny; Alaux, C?dric; Severac, Dany; Rohmer, Marine; Mercer, Alison R.; Le Conte, Yves


    In honey bees, Varroa sensitive hygiene (VSH) behaviour, which involves the detection and removal of brood parasitised by the mite Varroa destructor, can actively participate in the survival of colonies facing Varroa outbreaks. This study investigated the mechanisms of VSH behaviour, by comparing the antennal transcriptomes of bees that do and do not perform VSH behaviour. Results indicate that antennae likely play a key role in the expression of VSH behaviour. Comparisons with the antennal t...

  7. Phenotypic and genetic analyses of the varroa sensitive hygienic trait in Russian honey bee (Hymenoptera: Apidae) colonies


    Kirrane, Maria J.; de Guzman, Lilia I.; Holloway, Beth; Frake, Amanda M.; Rinderer, Thomas E.; Whelan, Padraig M.


    Varroa destructorcontinues to threaten colonies of European honey bees. General hygiene, and more specific Varroa Sensitive Hygiene (VSH), provide resistance towards the Varroa mite in a number of stocks. In this study, 32 Russian (RHB) and 14 Italian honey bee colonies were assessed for the VSH trait using two different assays. Firstly, colonies were assessed using the standard VSH behavioural assay of the change in infestation of a highly infested donor comb after a one-week exposure. Secon...

  8. Antennae hold a key to Varroa-sensitive hygiene behaviour in honey bees. (United States)

    Mondet, Fanny; Alaux, Cédric; Severac, Dany; Rohmer, Marine; Mercer, Alison R; Le Conte, Yves


    In honey bees, Varroa sensitive hygiene (VSH) behaviour, which involves the detection and removal of brood parasitised by the mite Varroa destructor, can actively participate in the survival of colonies facing Varroa outbreaks. This study investigated the mechanisms of VSH behaviour, by comparing the antennal transcriptomes of bees that do and do not perform VSH behaviour. Results indicate that antennae likely play a key role in the expression of VSH behaviour. Comparisons with the antennal transcriptome of nurse and forager bees suggest that VSH profile is more similar to that of nurse bees than foragers. Enhanced detection of certain odorants in VSH bees may be predicted from transcriptional patterns, as well as a higher metabolism and antennal motor activity. Interestingly, Deformed wing virus/Varroa destructor virus infections were detected in the antennae, with higher level in non-VSH bees; a putative negative impact of viral infection on bees' ability to display VSH behaviour is proposed. These results bring new perspectives to the understanding of VSH behaviour and the evolution of collective defence by focusing attention on the importance of the peripheral nervous system. In addition, such data might be useful for promoting marker-assisted selection of honey bees that can survive Varroa infestations.

  9. Changes in infestation, cell cap condition, and reproductive status of Varroa destructor (Mesostigmata: Varrroidae) in brood exposed to honey bees with Varroa sensitive hygiene (United States)

    Honey bees (Apis mellifera L.) bred for Varroa sensitive hygiene (VSH) selectively remove pupae infested with Varroa destructor Anderson & Trueman from capped brood that is inserted into the nest. After one week, remaining brood cells tend to have been uncapped and recapped, and remaining mites are...

  10. Phenotypic and genetic analyses of the varroa sensitive hygienic trait in Russian honey bee (hymenoptera: apidae) colonies. (United States)

    Kirrane, Maria J; de Guzman, Lilia I; Holloway, Beth; Frake, Amanda M; Rinderer, Thomas E; Whelan, Pádraig M


    Varroa destructor continues to threaten colonies of European honey bees. General hygiene, and more specific Varroa Sensitive Hygiene (VSH), provide resistance towards the Varroa mite in a number of stocks. In this study, 32 Russian (RHB) and 14 Italian honey bee colonies were assessed for the VSH trait using two different assays. Firstly, colonies were assessed using the standard VSH behavioural assay of the change in infestation of a highly infested donor comb after a one-week exposure. Secondly, the same colonies were assessed using an "actual brood removal assay" that measured the removal of brood in a section created within the donor combs as a potential alternative measure of hygiene towards Varroa-infested brood. All colonies were then analysed for the recently discovered VSH quantitative trait locus (QTL) to determine whether the genetic mechanisms were similar across different stocks. Based on the two assays, RHB colonies were consistently more hygienic toward Varroa-infested brood than Italian honey bee colonies. The actual number of brood cells removed in the defined section was negatively correlated with the Varroa infestations of the colonies (r2 = 0.25). Only two (percentages of brood removed and reproductive foundress Varroa) out of nine phenotypic parameters showed significant associations with genotype distributions. However, the allele associated with each parameter was the opposite of that determined by VSH mapping. In this study, RHB colonies showed high levels of hygienic behaviour towards Varroa -infested brood. The genetic mechanisms are similar to those of the VSH stock, though the opposite allele associates in RHB, indicating a stable recombination event before the selection of the VSH stock. The measurement of brood removal is a simple, reliable alternative method of measuring hygienic behaviour towards Varroa mites, at least in RHB stock.

  11. Phenotypic and genetic analyses of the varroa sensitive hygienic trait in Russian honey bee (hymenoptera: apidae colonies.

    Directory of Open Access Journals (Sweden)

    Maria J Kirrane

    Full Text Available Varroa destructor continues to threaten colonies of European honey bees. General hygiene, and more specific Varroa Sensitive Hygiene (VSH, provide resistance towards the Varroa mite in a number of stocks. In this study, 32 Russian (RHB and 14 Italian honey bee colonies were assessed for the VSH trait using two different assays. Firstly, colonies were assessed using the standard VSH behavioural assay of the change in infestation of a highly infested donor comb after a one-week exposure. Secondly, the same colonies were assessed using an "actual brood removal assay" that measured the removal of brood in a section created within the donor combs as a potential alternative measure of hygiene towards Varroa-infested brood. All colonies were then analysed for the recently discovered VSH quantitative trait locus (QTL to determine whether the genetic mechanisms were similar across different stocks. Based on the two assays, RHB colonies were consistently more hygienic toward Varroa-infested brood than Italian honey bee colonies. The actual number of brood cells removed in the defined section was negatively correlated with the Varroa infestations of the colonies (r2 = 0.25. Only two (percentages of brood removed and reproductive foundress Varroa out of nine phenotypic parameters showed significant associations with genotype distributions. However, the allele associated with each parameter was the opposite of that determined by VSH mapping. In this study, RHB colonies showed high levels of hygienic behaviour towards Varroa -infested brood. The genetic mechanisms are similar to those of the VSH stock, though the opposite allele associates in RHB, indicating a stable recombination event before the selection of the VSH stock. The measurement of brood removal is a simple, reliable alternative method of measuring hygienic behaviour towards Varroa mites, at least in RHB stock.

  12. Repeatability of measurements of removal of mite-infested brood to assess Varroa Sensitive Hygiene (United States)

    Varroa Sensitive Hygiene is a useful resistance trait that bee breeders could increase in different populations with cost-effective and reliable tests. We investigated the reliability of a one-week test estimating the changes in infestation of brood introduced into highly selected and unselected co...

  13. High-resolution linkage analyses to identify genes that influence Varroa sensitive hygiene behavior in honey bees. (United States)

    Tsuruda, Jennifer M; Harris, Jeffrey W; Bourgeois, Lanie; Danka, Robert G; Hunt, Greg J


    Varroa mites (V. destructor) are a major threat to honey bees (Apis melilfera) and beekeeping worldwide and likely lead to colony decline if colonies are not treated. Most treatments involve chemical control of the mites; however, Varroa has evolved resistance to many of these miticides, leaving beekeepers with a limited number of alternatives. A non-chemical control method is highly desirable for numerous reasons including lack of chemical residues and decreased likelihood of resistance. Varroa sensitive hygiene behavior is one of two behaviors identified that are most important for controlling the growth of Varroa populations in bee hives. To identify genes influencing this trait, a study was conducted to map quantitative trait loci (QTL). Individual workers of a backcross family were observed and evaluated for their VSH behavior in a mite-infested observation hive. Bees that uncapped or removed pupae were identified. The genotypes for 1,340 informative single nucleotide polymorphisms were used to construct a high-resolution genetic map and interval mapping was used to analyze the association of the genotypes with the performance of Varroa sensitive hygiene. We identified one major QTL on chromosome 9 (LOD score = 3.21) and a suggestive QTL on chromosome 1 (LOD = 1.95). The QTL confidence interval on chromosome 9 contains the gene 'no receptor potential A' and a dopamine receptor. 'No receptor potential A' is involved in vision and olfaction in Drosophila, and dopamine signaling has been previously shown to be required for aversive olfactory learning in honey bees, which is probably necessary for identifying mites within brood cells. Further studies on these candidate genes may allow for breeding bees with this trait using marker-assisted selection.

  14. High-resolution linkage analyses to identify genes that influence Varroa sensitive hygiene behavior in honey bees.

    Directory of Open Access Journals (Sweden)

    Jennifer M Tsuruda

    Full Text Available Varroa mites (V. destructor are a major threat to honey bees (Apis melilfera and beekeeping worldwide and likely lead to colony decline if colonies are not treated. Most treatments involve chemical control of the mites; however, Varroa has evolved resistance to many of these miticides, leaving beekeepers with a limited number of alternatives. A non-chemical control method is highly desirable for numerous reasons including lack of chemical residues and decreased likelihood of resistance. Varroa sensitive hygiene behavior is one of two behaviors identified that are most important for controlling the growth of Varroa populations in bee hives. To identify genes influencing this trait, a study was conducted to map quantitative trait loci (QTL. Individual workers of a backcross family were observed and evaluated for their VSH behavior in a mite-infested observation hive. Bees that uncapped or removed pupae were identified. The genotypes for 1,340 informative single nucleotide polymorphisms were used to construct a high-resolution genetic map and interval mapping was used to analyze the association of the genotypes with the performance of Varroa sensitive hygiene. We identified one major QTL on chromosome 9 (LOD score = 3.21 and a suggestive QTL on chromosome 1 (LOD = 1.95. The QTL confidence interval on chromosome 9 contains the gene 'no receptor potential A' and a dopamine receptor. 'No receptor potential A' is involved in vision and olfaction in Drosophila, and dopamine signaling has been previously shown to be required for aversive olfactory learning in honey bees, which is probably necessary for identifying mites within brood cells. Further studies on these candidate genes may allow for breeding bees with this trait using marker-assisted selection.

  15. Selection of VSH-derived “Pol-line” honey bees and evaluation of their Varroa-resistance characteristics


    Danka , Robert G.; Harris , Jeffery W.; Dodds , Garrett E.


    International audience; AbstractHoney bees with Varroa sensitive hygiene (VSH) have good resistance to Varroa destructor. We bred “Pol-line” bees by outcrossing VSH queens to US commercial stocks from 2008 to 2014 and then selecting colonies with low mite infestations. Beginning in 2011, field performance of colonies with outcrossed Pol-line queens was compared to colonies with outcrossed VSH queens. Mite infestations after one season were comparable in colonies of the two bee types. Queens f...

  16. Using Single-nucleotide Polymorphisms and Genetic Mapping to find Candidate Genes that Influence Varroa-Specific Hygiene (United States)

    Varroa-sensitive hygienic (VSH) behavior is one of two behaviors identified that are most important for controlling the growth of Varroa mite populations in bee hives. A study was conducted to map quantitative trait loci (QTL) that influence VSH so that resistance genes could be identified. Crosses ...

  17. Varroa destructor resistance of honey bees in Hawaii, USA, that express various levels of Varroa sensitive hygiene (VSH) (United States)

    The Big Island of Hawaii, USA, supports an important honey bee (Apis mellifera) queen rearing industry that has been threatened by Varroa destructor since 2008. Miticides widely used to manage mites are known to interfere with queen rearing and sperm production. We investigated whether bees bred for...

  18. Hygienic Activity Toward Varroa Mites in Capped Brood is not Dependent on Mite Reproductive Status (United States)

    - The varroa resistance of bees selectively bred for high levels of varroa sensitive hygiene (VSH) is characterized by a reduction of (1) the mite infestation rate (Harris 2007 J. Apic. Res. / Bee World 46: 134-139) and (2) the percentage of fertile mites (Harris and Harbo 1999 J. Econ. Entomol. 92:...

  19. Varroa Sensitive Hygiene contributes to naturally selected varroa resistance in honey bees

    NARCIS (Netherlands)

    Panziera, Delphine; Langevelde, van Frank; Blacquière, Tjeerd


    The parasitic mite Varroa destructor is a serious threat for western honey bee colonies and beekeepers are compelled to control it to keep their colonies healthy. Yet, by controlling varroa no resistance to the parasite can evolve. As a trial, honey bee colonies have been left untreated in

  20. Varroa Sensitive Hygiene contributes to naturally selected varroa resistance in honey bees


    Panziera, Delphine; Langevelde, van, Frank; Blacquière, Tjeerd


    The parasitic mite Varroa destructor is a serious threat for western honey bee colonies and beekeepers are compelled to control it to keep their colonies healthy. Yet, by controlling varroa no resistance to the parasite can evolve. As a trial, honey bee colonies have been left untreated in isolated locations to allow development of resistance or tolerance to the mite. These colonies developed an ability to live without control measures against varroa, although the traits responsible for this ...

  1. Dicty_cDB: VSH207 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSH207 (Link to dictyBase) - - - Contig-U12548-1 VSH207P (Link... to Original site) VSH207F 228 VSH207Z 107 VSH207P 335 - - Show VSH207 Library VS (Link to library) Clone ID VSH207 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12548-1 Original site URL http://dict...ents: (bits) Value N ( AU267072 ) Dictyostelium discoideum vegetative cDNA clone:VS... 206 2e-58 2 ( AC116982 ) Dict...yostelium discoideum chromosome 2 map 3622643... 206 4e-49 1 ( AU267073 ) Dict

  2. High-Resolution Linkage Analyses to Identify Genes That Influence Varroa Sensitive Hygiene Behavior in Honey Bees. (United States)

    Varroa mites (V. destructor) are a major threat to honey bees (Apis melilfera) and beekeeping worldwide and likely lead to colony decline if colonies are not treated. Most treatments involve chemical control of the mites; however, Varroa has evolved resistance to many of these miticides, leaving be...

  3. High-Resolution Linkage Analyses to Identify Genes That Influence Varroa Sensitive Hygiene Behavior in Honey Bees


    Tsuruda, Jennifer M.; Harris, Jeffrey W.; Bourgeois, Lanie; Danka, Robert G.; Hunt, Greg J.


    Varroa mites (V. destructor) are a major threat to honey bees (Apis melilfera) and beekeeping worldwide and likely lead to colony decline if colonies are not treated. Most treatments involve chemical control of the mites; however, Varroa has evolved resistance to many of these miticides, leaving beekeepers with a limited number of alternatives. A non-chemical control method is highly desirable for numerous reasons including lack of chemical residues and decreased likelihood of resistance. Var...

  4. Identification of a Divided Genome for VSH-1, the Prophage-Like Gene Transfer Agent of Brachyspira hyodysenteriae (United States)

    The Brachyspira hyodysenteriae B204 genome sequence revealed three VSH-1 tail genes hvp31, hvp60, and hvp37, in a 3.6 kb cluster. The location and transcription direction of these genes relative to the previously described VSH-1 16.3 kb gene operon indicate that the gene transfer agent VSH-1 has a ...

  5. Collateral Effects of Antibiotics: Carbadox and Metronidazole Induce VSH-1 and Facilitate Gene Transfer among Brachyspira hyodysenteriae Strains▿ (United States)

    Stanton, Thaddeus B.; Humphrey, Samuel B.; Sharma, Vijay K.; Zuerner, Richard L.


    Brachyspira hyodysenteriae is an anaerobic spirochete and the etiologic agent of swine dysentery. The genome of this spirochete contains a mitomycin C-inducible, prophage-like gene transfer agent designated VSH-1. VSH-1 particles package random 7.5-kb fragments of the B. hyodysenteriae genome and transfer genes between B. hyodysenteriae cells. The chemicals and conditions inducing VSH-1 production are largely unknown. Antibiotics used in swine management and stressors inducing traditional prophages might induce VSH-1 and thereby stimulate lateral gene transfer between B. hyodysenteriae cells. In these studies, VSH-1 induction was initially detected by a quantitative real-time reverse transcriptase PCR assay evaluating increased transcription of hvp38 (VSH-1 head protein gene). VSH-1 induction was confirmed by detecting VSH-1-associated 7.5-kb DNA and VSH-1 particles in B. hyodysenteriae cultures. Nine antibiotics (chlortetracycline, lincomycin, tylosin, tiamulin, virginiamycin, ampicillin, ceftriaxone, vancomycin, and florfenicol) at concentrations affecting B. hyodysenteriae growth did not induce VSH-1 production. By contrast, VSH-1 was detected in B. hyodysenteriae cultures treated with mitomycin C (10 μg/ml), carbadox (0.5 μg/ml), metronidazole (0.5 μg/ml), and H2O2 (300 μM). Carbadox- and metronidazole-induced VSH-1 particles transmitted tylosin and chloramphenicol resistance determinants between B. hyodysenteriae strains. The results of these studies suggest that certain antibiotics may induce the production of prophage or prophage-like elements by intestinal bacteria and thereby impact intestinal microbial ecology. PMID:18359835

  6. Food hygienics

    International Nuclear Information System (INIS)

    Ryu, Yeong Gyun; Lee, Gwang Bae; Lee, Han Gi; Kim, Se Yeol


    This book deals with food hygienics with eighteen chapters, which mention introduction on purpose of food hygienics, administration of food hygienics, food and microscopic organism, sanitary zoology, food poisoning, food poisoning by poisonous substance, chronic poisoning by microscopic organism, food and epidemic control , control of parasitic disease, milk hygiene meat hygiene, an egg and seafood hygiene, food deterioration and preservation, food additives, food container and field hygiene, food facilities hygiene, food hygiene and environmental pollution and food sanitation inspection.

  7. Proteome Analysis of the Hemolymph, Mushroom Body, and Antenna Provides Novel Insight into Honeybee Resistance against Varroa Infestation. (United States)

    Hu, Han; Bienefeld, Kaspar; Wegener, Jakob; Zautke, Fred; Hao, Yue; Feng, Mao; Han, Bin; Fang, Yu; Wubie, Abebe Jenberie; Li, Jianke


    Varroa destructor has been identified as a major culprit responsible for the losses of millions of honeybee colonies. Varroa sensitive hygiene (VSH) is a suite of behaviors from adult bees to suppress mite reproduction by uncapping and/or removing mite infested pupae from a sealed brood. Despite the efforts to elucidate the molecular underpinnings of VSH, they remain largely unknown. We investigated the proteome of mushroom bodies (MBs) and antennae of adult bees with and without VSH from a stock selected for VSH based on their response to artificially Varroa-infected brood cells by near-infrared camera observation. The pupal hemolymph proteome was also compared between the VSH-line and the line that was not selected for VSH. The identified 8609 proteins in the hemolymph, MBs, and antennae represent the most depth coverage of the honeybee proteome (>55%) to date. In the hemolymph, the VSH-line adapts a unique strategy to boost the social immunity and drive pupal organogenesis by enhancing energy metabolism and protein biosynthesis. In MBs, the up-regulated proteins implicated in neuronal sensitivity suggest their roles to promote the execution of VSH by activation of synaptic vesicles and calcium channel activities. In antennae, the highly expressed proteins associated with sensitivity of olfactory senses and signal transmissions signify their roles by inputting a strong signal to the MBs for initiating VSH. These observations illustrate that the enhanced social immunities and olfactory and neuronal sensitivity play key roles in the combat against Varroa infestation. The identified candidate markers may be useful for accelerating marker-associated selection for VSH to aid in resistance to a parasite responsible for decline in honeybee health.

  8. Hygiene Basics (United States)

    ... Staying Safe Videos for Educators Search English Español Hygiene Basics KidsHealth / For Teens / Hygiene Basics What's in this article? Oily Hair Sweat ... smell, anyway? Read below for information on some hygiene basics — and learn how to deal with greasy ...

  9. Oral Hygiene

    DEFF Research Database (Denmark)

    Sørensen, Marie Toftdahl; Villadsen, Dorte Buxbom

    The aim of the study was to explore how adults with schizo- phrenia describe their lived experiences with oral hygiene. 23 adults with schizophrenia were interviewed within a period of four months in late 2015. Transcriptions of the interviews were analysed using the Reflective Lifeworld Research...... health care professionals and adults with schizophrenia in order to improve oral health, well-being and recovery....

  10. Oral Hygiene

    DEFF Research Database (Denmark)

    Villadsen, Dorte Buxbom; Sørensen, Marie Toftdahl


    The aim of the study is to explore how adults with schizophrenia describe their lived experiences with oral hygiene. 23 adults with schizophrenia were interviewed within a period of four months in late 2015. Transcriptions of the interviews were analysed using the Reflective Lifeworld Research ph...... health care professionals and adults with schizophrenia in order to improve oral health, well-being and recovery....

  11. Hygiene habits through time


    Kalan, Petra


    In this work I did a research about hygiene habits of people and their home environment. The work presents how the hygiene habits changed in people home environment through time. The work presents changes of the body hygiene standards adopted by people from the middle ages onward. Todays customs are quite different from the ones we had some time ago. Moreover, hygiene of living environment has also changes which resulted into lower death rate and death illness related to bad hygiene among pop...

  12. Clothing and personal hygiene (United States)

    Finogenov, A. M.; Azhayev, A. N.; Kaliberdin, G. V.


    The biomedical maintenance of astronauts is discussed in terms of personal hygiene. Principal characteristics and general requirements are described which must be followed in perfecting a system of hygienic practices and in devising means to maintain personal hygiene, flight clothing, underwear, bedding, and medical-domestic equipment for manned space flights of varying durations. Factors discussed include: disposable clothing, thermal protection, oral hygiene, cleansing of the skin, and grooming of the hair.

  13. Hand hygiene strategies


    Yazaji, Eskandar Alex


    Hand hygiene is one of the major players in preventing healthcare associated infections. However, healthcare workers compliance with hand hygiene continues to be a challenge. This article will address strategies to help improving hand hygiene compliance. Keywords: hand hygiene; healthcare associated infections; multidisciplinary program; system change; accountability; education; feedback(Published: 18 July 2011)Citation: Journal of Community Hospital Internal Medicine Perspectives 2011, 1: 72...

  14. Teaching minority children hygiene

    DEFF Research Database (Denmark)

    Rheinländer, Thilde; Samuelsen, Helle; Dalsgaard, Anders


    infrastructures were important barriers for the implementation of safe home child hygiene. Furthermore, the everyday life of highland villages, with parents working away from the households resulted in little daily adult supervision of safe child hygiene practices. While kindergartens were identified......Objectives. Ethnic minority children in Vietnam experience high levels of hygiene- and sanitation-related diseases. Improving hygiene for minority children is therefore vital for improving child health. The study objective was to investigate how kindergarten and home environments influence...... children were further disadvantaged as teaching was only provided in non-minority language. Conclusions. Kindergartens can be important institutions for the promotion of safe hygiene practices among children, but they must invest in the maintenance of hygiene and sanitation infrastructures and adopt...

  15. Advance in radiation hygiene

    International Nuclear Information System (INIS)

    Klener, V.


    The development is reviewed of radiation hygiene in Czechoslovakia during the past twenty years since the formation of the branch as an independent discipline. The responsibilities of individual radiation hygiene research institutes in the country are indicated and the main tasks that have been solved so far are briefly outlined, including the research into the incidence of pulmonary cancer in uranium miners in which Czechoslovak radiation hygiene ranks first in the world. (L.O.)

  16. Guideline Implementation: Hand Hygiene. (United States)

    Goldberg, Judith L


    Performing proper hand hygiene and surgical hand antisepsis is essential to reducing the rates of health care-associated infections, including surgical site infections. The updated AORN "Guideline for hand hygiene" provides guidance on hand hygiene and surgical hand antisepsis, the wearing of fingernail polish and artificial nails, proper skin care to prevent dermatitis, the wearing of jewelry, hand hygiene product selection, and quality assurance and performance improvement considerations. This article focuses on key points of the guideline to help perioperative personnel make informed decisions about hand hygiene and surgical hand antisepsis. The key points address the necessity of keeping fingernails and skin healthy, not wearing jewelry on the hands or wrists in the perioperative area, properly performing hand hygiene and surgical hand antisepsis, and involving patients and visitors in hand hygiene initiatives. Perioperative RNs should review the complete guideline for additional information and for guidance when writing and updating policies and procedures. Copyright © 2017 AORN, Inc. Published by Elsevier Inc. All rights reserved.

  17. Radiation hygiene in photofluorography

    Energy Technology Data Exchange (ETDEWEB)

    Welde, F [The state institute of radiation hygiene, Montebello, Oslo (Norway)


    This paper comprises measurements and experiences from the surveillance of 36 photofluorographic units in Norway. Measured patient doses are given. Practical means for reducing the doses are emphasized. The radiation hygiene for the personnel in mass chest surveys is discussed.

  18. Space for personal hygiene

    DEFF Research Database (Denmark)

    Bech-Danielsen, Claus


    This paper focuses on spaces used for personal hygiene in housing over the last hundred years. The paper begins with a description of the hygienic movement in the late 19th century. At that time urinating took place in semi-public spaces outside the dwelling. Today, the WC has moved well...... into the dwelling, and in many dwellings the bathroom has developed into being the most private space. Thus, the bathroom can be regarded as the last domain of privacy in today's housing, and in a number of new dwellings this quality is exploited in new ways. The development of ‘space for hygiene’ in the 20th...... century will be studied by analysing the spatial organisation of dwellings: Where and how has the space for hygiene been situated and designed in housing in different periods over the last hundred years?...

  19. Introduction to radiation hygiene

    International Nuclear Information System (INIS)

    Huyskens, Ch.J.


    This document is to introduce personnel who come into contact with any radiological activities to different aspects of radiation hygiene. The basic theory of radiation physics is given and units and dose equivalents are discussed. The biological effects of ionizing radiations are described and risk analysis is introduced. The various sources of radiation to which the population is exposed are outlined. Saftey standards and legislation regarding radiation hygiene are described and the various methods and instruments for measuring radiation are given. Dosimetry and safety precautions and measures are finally discussed. (C.F.)

  20. Dental Hygiene Student Attrition. (United States)

    Young, Lynda J.; Fellows, Avis L.


    A study to determine differences between graduating and withdrawing students in the University of Minnesota Dental Hygiene program is discussed. The identification of differences may prove useful in the selection process for future classes through identification of students likely to complete their education. (MLW)

  1. Chemical hygiene plan

    International Nuclear Information System (INIS)


    This plan was written to administer and monitor safety measures and chemical hygiene principles in the TAC Uranium Mill Tailing Remedial Action Project sample preparation facility in Albuquerque, New Mexico. It applies to toxic and/or hazardous materials to radioactive materials

  2. Hand Hygiene: When and How (United States)

    Hand Hygiene When and How August 2009 How to handrub? How to handwash? RUB HANDS FOR HAND HYGIENE! WASH HANDS WHEN VISIBLY SOILED Duration of the ... its use. When? YOUR 5 MOMENTS FOR HAND HYGIENE 1 BEFORETOUCHINGA PATIENT 2 B P ECFLOER R ...

  3. History of dental hygiene research. (United States)

    Bowen, Denise M


    Dental hygiene is defined as the science and practice of the recognition, treatment and prevention of oral diseases. The history of dental hygiene research is considered in the context of the development of the discipline and an emerging infrastructure. Research-related events supporting the growth and maturation of the profession are considered from the early years to the most recent. The benefits of preventive oral health services provided by dental hygienists have been supported by research, and the practice of dental hygiene has expanded as a result of research findings since its inception 100 years ago. Dental hygienists' engagement in research, however, did not begin until the 1960s as research associates or administrators, primarily with dental researchers as primary investigators. The Journal of Dental Hygiene (JDH) has provided information for dental hygiene practice since 1927, and has been the primary venue for dissemination of dental hygiene research since 1945. Graduate education in dental hygiene at the master's degree level and the work of early dental hygiene researchers led to the first conference on dental hygiene research in 1982. Over 30 years later, dental hygiene has established a meta-paradigm and defined conceptual models, built an initial infrastructure to support research endeavors and contributed much to the development of dental hygiene as a unique discipline. A doctoral degree in the discipline, continued theory-based research, initiatives to foster collaborations between dental hygiene and other researchers and enhanced capabilities to attract funding to support large scale studies are goals that must be attained through the efforts of future researchers to address the needs for additional development in the discipline of dental hygiene. Dental hygiene research supports the growing discipline and its value to society.

  4. Hygiene in radiology

    International Nuclear Information System (INIS)

    Kapp-Schwoerer, A.; Daschner, F.


    A survey is given of the hygienic management in radiological departments with special regard to the handling of injections and infusions. It includes prevention of bacterial as well as viral infections. In radiological departments disinfection of X-ray tables is necessary only in exceptional cases. A special proposal for disinfection is added. A safe method of sterilisation of flexible catheders is included, which proved to prevent bacterial infection. (orig.) [de

  5. Immunoassay in radiation hygiene

    International Nuclear Information System (INIS)

    Shubik, V.M.


    Methods for estimation of nonspecific protection factors, T- and B-immunity system factors, which application is advisable when solving problems of radiation hygiene are described. Data on changes in immunity under chronic low dose irradiation of external and internl radiation by incorporated radiomechides are genralized and analysed. Combined action of ionizing radiation and factors of nonradiation nature is described. 120 refs.; 11 figs.; 33 tabs

  6. Hygienization aspects of composting


    Termorshuizen, A.J.; Alsanius, Beatrix


    • Compost use in agriculture always brings about the risk of introducing plant and human pathogens. • The backbone of the hygienization process consists of temperature, moisture content and chemical compounds formed during composting and activity of antagonists. • Compost produced by proper composting, i.e. a process that produces high temperatures during asufficiently long thermophilic phase can be applied safely. • Farmers should invest in good relationships with compost produce...

  7. Norwegian honey bees surviving Varroa destructor mite infestations by means of natural selection

    Directory of Open Access Journals (Sweden)

    Melissa A.Y. Oddie


    Full Text Available Background Managed, feral and wild populations of European honey bee subspecies, Apis mellifera, are currently facing severe colony losses globally. There is consensus that the ectoparasitic mite Varroa destructor, that switched hosts from the Eastern honey bee Apis cerana to the Western honey bee A. mellifera, is a key factor driving these losses. For >20 years, breeding efforts have not produced European honey bee colonies that can survive infestations without the need for mite control. However, at least three populations of European honey bees have developed this ability by means of natural selection and have been surviving for >10 years without mite treatments. Reduced mite reproductive success has been suggested as a key factor explaining this natural survival. Here, we report a managed A. mellifera population in Norway, that has been naturally surviving consistent V. destructor infestations for >17 years. Methods Surviving colonies and local susceptible controls were evaluated for mite infestation levels, mite reproductive success and two potential mechanisms explaining colony survival: grooming of adult worker bees and Varroa Sensitive Hygiene (VSH: adult workers specifically detecting and removing mite-infested brood. Results Mite infestation levels were significantly lower in surviving colonies and mite reproductive success was reduced by 30% when compared to the controls. No significant differences were found between surviving and control colonies for either grooming or VSH. Discussion Our data confirm that reduced mite reproductive success seems to be a key factor for natural survival of infested A. mellifera colonies. However, neither grooming nor VSH seem to explain colony survival. Instead, other behaviors of the adult bees seem to be sufficient to hinder mite reproductive success, because brood for this experiment was taken from susceptible donor colonies only. To mitigate the global impact of V. destructor, we suggest learning

  8. Norwegian honey bees surviving Varroa destructor mite infestations by means of natural selection. (United States)

    Oddie, Melissa A Y; Dahle, Bjørn; Neumann, Peter


    Managed, feral and wild populations of European honey bee subspecies, Apis mellifera , are currently facing severe colony losses globally. There is consensus that the ectoparasitic mite Varroa destructor , that switched hosts from the Eastern honey bee Apis cerana to the Western honey bee A. mellifera , is a key factor driving these losses. For >20 years, breeding efforts have not produced European honey bee colonies that can survive infestations without the need for mite control. However, at least three populations of European honey bees have developed this ability by means of natural selection and have been surviving for >10 years without mite treatments. Reduced mite reproductive success has been suggested as a key factor explaining this natural survival. Here, we report a managed A. mellifera population in Norway, that has been naturally surviving consistent V. destructor infestations for >17 years. Surviving colonies and local susceptible controls were evaluated for mite infestation levels, mite reproductive success and two potential mechanisms explaining colony survival: grooming of adult worker bees and Varroa Sensitive Hygiene (VSH): adult workers specifically detecting and removing mite-infested brood. Mite infestation levels were significantly lower in surviving colonies and mite reproductive success was reduced by 30% when compared to the controls. No significant differences were found between surviving and control colonies for either grooming or VSH. Our data confirm that reduced mite reproductive success seems to be a key factor for natural survival of infested A. mellifera colonies. However, neither grooming nor VSH seem to explain colony survival. Instead, other behaviors of the adult bees seem to be sufficient to hinder mite reproductive success, because brood for this experiment was taken from susceptible donor colonies only. To mitigate the global impact of V. destructor , we suggest learning more from nature, i.e., identifying the obviously

  9. Can education influence stethoscope hygiene? (United States)

    Holleck, Jürgen L; Merchant, Naseema; Lin, Shin; Gupta, Shaili


    The importance of stethoscope hygiene has been demonstrated in prior studies, and is acknowledged by guidelines, yet it is rarely done. We implemented a pilot project consisting of provider education, reminder flyers and provision of cleaning supplies at the start of clinical rotations for housestaff, medical students, and attending physicians. Hand hygiene rates did not change significantly with rates between 58% and 63% while stethoscope hygiene remained at zero. Published by Elsevier Inc.

  10. Optimizing Health Care Environmental Hygiene. (United States)

    Carling, Philip C


    This article presents a review and perspectives on aspects of optimizing health care environmental hygiene. The topics covered include the epidemiology of environmental surface contamination, a discussion of cleaning health care patient area surfaces, an overview of disinfecting health care surfaces, an overview of challenges in monitoring cleaning versus cleanliness, a description of an integrated approach to environmental hygiene and hand hygiene as interrelated disciplines, and an overview of the research opportunities and challenges related to health care environmental hygiene. Copyright © 2016 Elsevier Inc. All rights reserved.

  11. Dental Hygiene Realpolitik Affecting Education. (United States)

    Bader, James D.


    Current conditions in dental hygiene influencing professional education are discussed. Workplace/practice issues include dental hygiene care as a component of dental practice, content, effects, and quality of care, hygienist supply and demand, and job satisfaction. Professional issues include the knowledge base, definitions of practice, and…

  12. Improving Hygiene in Food Transportation

    NARCIS (Netherlands)

    Thoden van Velzen, E.U.; Lukasse, L.J.S.


    The hygiene aspect of food transport has become an issue for European transport operators. This development started roughly in 1990, when national governments urged transport operators to act on food safety. However, nowadays retailers and food producers are demanding more hygiene measures from

  13. [Hygiene between tradition and implementation]. (United States)

    Hansis, M L


    The basis of evidence for hygiene rules implemented in hospitals is traditionally small. This is not only because there is little theoretical knowledge on the reciprocal influence between a single hygienic mistake/a single microbial input and the manifestation of a nosocomial infection. There are also not enough clinical studies, especially on complex hygiene questions, to determine whether special measures (e.g., septic rooms)can compensate for deficits in hygiene practice. Furthermore, it would be necessary to designate security buffers distinctly. In-house traditions are able to stabilize hygienic behavior in an excellent manner. They should be fostered and not disparaged as myths. Discussions of experts should not be conducted in public; that is disastrous for the everyday work of physicians in hospitals.

  14. Advancing education in dental hygiene. (United States)

    Battrell, Ann; Lynch, Ann; Steinbach, Pam; Bessner, Sue; Snyder, Josh; Majeski, Jean


    The changing health care environment and societal imperatives indicate the need for transformative change within the dental hygiene profession to serve the emerging needs of the public. The American Dental Hygienists' Association is leading the way toward meaningful change. The American Dental Hygienists' Association (ADHA) has as its vision the integration of dental hygienists into the health care delivery system as essential primary care providers to expand access to oral health care. This article provides data on current dental hygiene education programs and those in development. Also included is a discussion regarding how the dental hygiene profession can better serve the health and wellness needs of society by transforming the way graduates are prepared for the future. ADHA's dental hygiene survey center data, policies and a futuristic analysis plus a review of the professional literature describe the current state of dental hygiene education and the profession. A discussion of societal, health care and educational trends that creates the imperative for transformation of the dental hygiene profession is provided. Ultimately, the purpose of advancing education in dental hygiene is to achieve better oral and overall health for more people. The profession's responsibility to the public includes evaluating its own ability to provide care and taking the steps necessary to ensure its maximum effectiveness. ADHA is leading this process for dental hygienists in diverse ways. It is imperative that the dental hygiene profession understands and embraces the changing health care environment. Through open dialog and the sharing of evidence the professional path will be determined along with forward movement for the benefit of society and the dental hygiene profession. Copyright © 2014 Elsevier Inc. All rights reserved.

  15. Space Station personal hygiene study (United States)

    Prejean, Stephen E.; Booher, Cletis R.


    A personal hygiene system is currently under development for Space Station application that will provide capabilities equivalent to those found on earth. This paper addresses the study approach for specifying both primary and contingency personal hygiene systems and provisions for specified growth. Topics covered are system definition and subsystem descriptions. Subsystem interfaces are explored to determine which concurrent NASA study efforts must be monitored during future design phases to stay up-to-date on critical Space Station parameters. A design concept for a three (3) compartment personal hygiene facility is included as a baseline for planned test and verification activities.

  16. Task of radiation hygiene inspection at NPPs

    International Nuclear Information System (INIS)

    Shevts, J.; Kunz, Eh.


    The task and functions of the radiation-hygiene inspection in Czechoslovakia are presented. The radiation safety related information amounts that are to be presented to the hygiene inspection institutions are determined. The hygiene inspection content and forms at the stages of NPP designing, construction and operation are discussed. The hygiene inspection place is determined within the general radiation safety system [ru

  17. Inexpensive and Time-Efficient Hand Hygiene Interventions Increase Elementary School Children's Hand Hygiene Rates (United States)

    Snow, Michelle; White, George L.; Kim, Han S.


    Routine hand hygiene has been cited by the World Health Organization and the Centers for Disease Control and Prevention as a cost-effective and important hygiene measure in preventing the spread of infectious diseases. Several studies have explored children's hand hygiene habits, effects of scheduled hand hygiene, hand hygiene environmental…

  18. Hygiene at Work: An Engineering Perspective on the Development of Hygiene Science

    Directory of Open Access Journals (Sweden)

    Peter J Pityn


    Full Text Available The present article examines the work of contemporary hygiene practitioners. Discussion converges from a broad examination of hygiene at work in our society serving the common good to occupational hygiene in the workplace. The article considers the expanding role of hygiene today, juxtaposed against the lack of awareness and perceptions of hygiene. It considers some of the current social challenges facing hygiene, perceptions of risk and problems specifically encountered by occupational hygienists.

  19. [Comprehensive hygienic assessment of solaria]. (United States)

    Kravchenko, O K


    The paper gives data on the positive and negative effects of human exposure to ultraviolet radiation (UVR). It provides the hygienic characteristics of solaria used to produce an artificial tan. This device has been found to present a high health risk to its users. There are considerable problems in the hygienic assessment of this type of exposure. The ways of solving the arising problems in developing the metrological monitoring of UVR and compiling a document regulating the sanitary-and-epidemiological surveillance of solaria are defined.

  20. Hygienic diagnosis in extreme conditions

    International Nuclear Information System (INIS)

    Sofronov, G.A.


    Review for book by M.P. Zakharchenko, S.A. Lopatin, G.N. Novozhilov, V.I. Zakharov Hygienic diagnosis in extreme conditions is presented discussing the problem of people health preservation under extreme conditions. Hygienic diagnosis is considered illustrated by cases of hostilities (Afghan War), earthquake response in Armenia (1988) and Chernobyl accident response. Attention is paid to the estimation of radiation doses to people and characteristics of main types of dosimeters. The high scientific level of the book is marked

  1. Menstrual hygiene among adolescent girls

    Directory of Open Access Journals (Sweden)

    Rakesh Sharma


    Full Text Available Background: Menstruation and menstrual practices are still clouded by taboos and socio-cultural restrictions resulting in adolescent girls remaining ignorant of the scientific facts and hygienic health practices, which sometimes result into adverse health outcomes. Objective: To assess knowledge and practice regarding menstrual hygiene before and after teaching program among adolescent girls. Materials and Methods: A true experimental study was conducted among 50 adolescent girls of a secondary school situated in the Bhaniyawala of Dehradun district, Uttarakhand, with the help of a pre-designed and pre-tested questionnaire. Participants were randomly assigned into control (n=25 and experimental group (n=25. Adolescent girls from both groups were assessed for knowledge and practice regarding menstrual hygiene on day 1 and on 15th day.  Participants of experimental group were administered educational programme regarding menstrual hygiene on day 1 after assessment for knowledge and practice regarding menstrual hygiene. Data were analysed statistically by simple proportions. Results: The mean age of the adolescent girl was 13.88± 1.5 and age of menarche 12.74±0.98. Out of 50, 32 (64% mothers’ of adolescent girls were educated at graduate level.  The mean pre-test knowledge and practice in experimental group 8.04±1.54, 3.52±1.0 and control group 8.02±2.0, 3.24±1.0 respectively. The level of knowledge and practice regarding menstrual hygiene of subjects who participated in educational program was significantly better than that of the control group. Conclusions: Menstrual hygiene, a very important risk factor for reproductive tract infections, is a vital aspect of health education for adolescent girls. Educational television programmes, trained school nurses/health personnel, motivated school teachers and knowledgeable parents can play a very important role in transmitting the vital message of correct menstrual hygiene to the

  2. Dentistry and Dental Hygiene Handbook. (United States)

    New York State Education Dept., Albany. Office of the Professions.

    The handbook contains laws, rules, and regulations of the New York State Education Department that govern dentistry and dental hygiene practice in the state. It describes licensure requirements and includes complete application forms and instructions for obtaining license and first registration as a dentist and dental hygienist. Applicants are…

  3. Oral Hygiene. Learning Activity Package. (United States)

    Hime, Kirsten

    This learning activity package on oral hygiene is one of a series of 12 titles developed for use in health occupations education programs. Materials in the package include objectives, a list of materials needed, a list of definitions, information sheets, reviews (self evaluations) of portions of the content, and answers to reviews. These topics…

  4. Nosocomial infections and staff hygiene. (United States)

    Petroudi, Dimitra


    Nosocomial infections are a major source of morbidity and mortality in hospital settings. The most important defences against nosocomial transmission of viral, bacterial, and other infections are detailed and continuing education of staff and strict adherence to infection control policies. The issue is no longer whether hand hygiene is effective, but how to produce a sustained improvement in health workers' compliance.

  5. Patient Hand Hygiene at Home Predicts Their Hand Hygiene Practices in the Hospital


    Barker, Anna; Sethi, Ajay; Shulkin, Emily; Caniza, Rachell; Zerbel, Sara; Safdar, Nasia


    We examine factors associated with hand hygiene practices of hospital patients. Hygiene decreased compared to at home, and home practices were strongly associated with hospital practices. Understanding and leveraging the intrinsic value some patients associate with hand hygiene may be important for improving overall hospital hygiene and decreasing healthcare-associated infections.

  6. A Cognitive Task Analysis for Dental Hygiene. (United States)

    Cameron, Cheryl A.; Beemsterboer, Phyllis L.; Johnson, Lynn A.; Mislevy, Robert J.; Steinberg, Linda S.; Breyer, F. Jay


    As part of the development of a scoring algorithm for a simulation-based dental hygiene initial licensure examination, this effort conducted a task analysis of the dental hygiene domain. Broad classes of behaviors that distinguish along the dental hygiene expert-novice continuum were identified and applied to the design of nine paper-based cases…

  7. Assessing Oral Hygiene in Hospitalized Older Veterans. (United States)

    Jennings, Andrea


    Poor oral health for all older adults can result in higher risk for heart disease, stroke, diabetes, and oral cancer. Findings from this study indicated older veterans needed to improve their oral hygiene habits but barriers to oral hygiene performance prevented them from receiving and performing oral hygiene measures.

  8. 28 CFR 551.6 - Personal hygiene. (United States)


    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Personal hygiene. 551.6 Section 551.6... Grooming § 551.6 Personal hygiene. The Warden shall make available to an inmate those articles necessary for maintaining personal hygiene. [46 FR 59509, Dec. 4, 1981] ...

  9. A hand-hygiene behaviour monitoring system

    NARCIS (Netherlands)

    Van Schie, M.; Wiesman, R.F.F.


    The invention relates to a hand-hygiene behaviour monitoring system, comprising: means for detecting the occurrence of an event specified in a hand-hygiene rule, wherein the event involves a person; means for updating behaviour data that is related to acts according to the hand-hygiene rule, wherein

  10. Food hygiene on the wards. (United States)

    Steuer, Walter


    A PROBLEM THAT IS OFTEN OVERLOOKED OR SIMPLY NOT GIVEN ENOUGH ATTENTION: the food served to patients from the kitchen is not sterile. If food is allowed to stand at room temperature for a long time, both in the case of food cooked for lunch and of food intended for supper which has been previously chilled, there is the possibility of massive spore germination or of dangerous toxin formation. Therefore regulations on how to handle food and beverages (e.g. tea) must be set out in the infection control policy, and checks carried out to monitor compliance with the rules relating to temperature checks, duration and type of storage, need for reheating, etc. Making staff aware of the issues involved is of paramount importance. These include monitoring hygiene standards in the ward kitchen, formulation of a cleaning policy, periodic bacteriological checks (not only of workstations but also of the dishwasher results), whenever possible the use of disposable cloths for working surfaces and equipment, changing cleaning cloths at least once daily and hygienic hand disinfection before and after handing out food. Foodstuffs brought in by visitors represent a special hygienic and organizational problem because in many cases they already have a high baseline microbial count. Visitors must be made aware that, for example, slices of cake left in the patient's room and often eaten only hours later can pose a risk of infection.In summary, the following principles of food hygiene must be observed on the wards:Maintenance of the cold-hot chainNot only reheat food, but ensure it is well heated throughout Avoid situations giving rise to spore germination in foodstuffs brought in by visitorsCleanliness and minimal contamination of kitchen worktopsCleanliness of crockery and kitchen towels Do not allow food to stand at room temperature for a long time, in particular desserts and confectionery A standard policy must be enforced to define the hygienic status and organization for food

  11. Menstrual hygiene: How hygienic is the adolescent girl?

    Directory of Open Access Journals (Sweden)

    Dasgupta A


    Full Text Available Background: Menstruation and menstrual practices are still clouded by taboos and socio-cultural restrictions resulting in adolescent girls remaining ignorant of the scientific facts and hygienic health practices, which sometimes result into adverse health outcomes. Objectives: (i To elicit the beliefs, conception and source of information regarding menstruation among the study population and (ii to find out the status of menstrual hygiene among adolescent girls. Materials and Methods: A descriptive, cross-sectional study was conducted among 160 adolescent girls of a secondary school situated in the field practice area of Rural Health Unit and Training Center, Singur, West Bengal, with the help of a pre-designed and pre-tested questionnaire. Data were analyzed statistically by simple proportions. Results: Out of 160 respondents, 108 (67.5% girls were aware about menstruation prior to attainment of menarche. Mother was the first informant regarding menstruation in case of 60 (37.5% girls. One hundred and thirty-eight (86.25% girls believed it as a physiological process. Seventy-eight (48.75% girls knew the use of sanitary pad during menstruation. Regarding practices, only 18 (11.25% girls used sanitary pads during menstruation. For cleaning purpose, 156 (97.5% girls used both soap and water. Regarding restrictions practiced, 136 (85% girls practised different restrictions during menstruation. Conclusions: Menstrual hygiene, a very important risk factor for reproductive tract infections, is a vital aspect of health education for adolescent girls. Educational television programmes, trained school nurses/health personnel, motivated school teachers and knowledgeable parents can play a very important role in transmitting the vital message of correct menstrual hygiene to the adolescent girl of today.

  12. Improved Hand Hygiene Compliance is Associated with the Change of Perception toward Hand Hygiene among Medical Personnel


    Lee, Seung Soon; Park, Se Jeong; Chung, Moon Joo; Lee, Ju Hee; Kang, Hyun Joo; Lee, Jeong-a; Kim, Yong Kyun


    Background Hand hygiene compliance has improved significantly through hand hygiene promotion programs that have included poster campaign, monitoring and performance feedback, and education with special attentions to perceived subjective norms. We investigated factors associated with improved hand hygiene compliance, focusing on whether the improvement of hand hygiene compliance is associated with changed perception toward hand hygiene among medical personnel. Materials and Methods Hand hygien...

  13. Dnepropetrovsk hygienic school: past, present and future

    Directory of Open Access Journals (Sweden)

    Beletskaya E.M.


    Full Text Available The article presents historical analysis of formation of hygiene school of Dnipropetrovsk Medical Academy over the 100 year period - from formation of Katerinoslav province sanitary district council, as a unique self-government social organization in XIX century to the present. The basic stages of its development, including foundation of Hygiene Courses at High Mining School, their transformation into department of general hygiene, social hygiene and hygiene of labor in Katerinoslav Medical Academy in 1922, foundation of separate departments of hygiene in 1940-1948, their reorganization at the end of XX – beginning of XXI centuries are outlined. It is established, that Dnipropetrovsk hygiene school during its existence formed a great number of outstanding scientists, more than 100 dissertations in different directions devoted to hygienic diagnostics of technogenically changing environment, its impact on human health as well as hygienic control levers and health strengthening of population of industrial areas were defended. Scientific contribution of prominent scientists and teachers, their achievements and discoveries in the field of preventive medicine, role in the formation of preventive world outlook of students are estimated. At the XIV hygienic congress 30 hygienists were recognized as leading scientists of Ukraine over XX century, seven of them are from Dnipropetrovsk hygiene school; this indicates its importance in the noble cause of serving public health.


    Kaptsov, V A


    There are presented the main ethical and deontological problems encountered in practice and research activities of the hygienist in transport. There is shown the importance of strict compliance with hygienic standards, disregard for the principle of "technical attainability", the necessity of continuous training, improvement of skills of sanitary-educational activity and readiness to solve emerging ethical issues in connection with the development of scientific and technical progress.

  15. Nudging to improve hand hygiene. (United States)

    Caris, M G; Labuschagne, H A; Dekker, M; Kramer, M H H; van Agtmael, M A; Vandenbroucke-Grauls, C M J E


    Hand hygiene is paramount to prevent healthcare-associated infections, but improving compliance is challenging. When healthcare workers seldom encounter healthcare-associated infections, they will consider the odds of causing infections through poor hand hygiene negligible. Cognitive biases such as these may induce non-compliance. Nudging, 'a friendly push to encourage desired behaviour', could provide an easily implemented, inexpensive measure to address cognitive biases and thus support hand hygiene interventions. To investigate whether behavioural nudges, displayed as posters, can increase the use of alcohol-based hand rub. We developed nudges based on a systematic review of previously described cognitive biases, and tested these through a cross-sectional survey among the target audience. We then conducted a controlled before-after trial on two hospital wards, to assess the effect of these nudges on the use of alcohol-based hand rub, measured with electronic dispensers. Poisson regression analyses adjusted for workload showed that nudges displayed next to dispensers increased their overall use on one ward [poster 1: relative risk: 1.6 (95% confidence interval: 1.2-2.2); poster 2: 1.7 (1.2-2.5)] and during doctor's rounds on both wards [poster 1: ward A: 1.7 (1.1-2.6); ward B: 2.2 (1.3-3.8)]. Use of dispensers without adjacent nudges did not increase. Nudges based on cognitive biases that play a role in hand hygiene, and displayed as posters, could provide an easy, inexpensive measure to increase use of alcohol-based hand rub. When applying nudges to change behaviour, it is important to identify the right nudge for the right audience. Copyright © 2017 The Healthcare Infection Society. Published by Elsevier Ltd. All rights reserved.

  16. [Ecological and hygienic problems of nanotech progress]. (United States)

    Latyshevskaia, N I; Strekalova, A S


    In article necessity of development of new directions of researches--nanoecology (ecology of nanoindustry) and nanohygiene (hygiene of nanotechnologies and nanomaterials) is proved. On the basis of the spent review key ecological and hygienic problems of nanoindustrial development are systematized and also debatable questions are allocated. The conclusion is drawn on necessity of an intensification of studying of ecological and hygienic aspects of nanotechnologies and nanomaterials.

  17. Guidelines for hand hygiene in hospital


    Christina Sotnikova; Georgia Fasoi


    The appropriate compliance of rules regarding hand hygiene, have been and continue to be, one of the basic points of all prevention programs of nosocomial infections. Aim: The aim of the present study was the presentation of guidelines for hand hygiene by nurses. Method and material: Study of international and Greek literature from electronic databases Medline, PubMed and scientific journals, KEELPNO mainly from the last three years. The keywords used were: nosocomial infections, hand hygiene...

  18. Hygienic regulation of ionizing radiations

    International Nuclear Information System (INIS)

    Saurov, M.M.


    Modern state of the problem on hygienic regulation of ionizing radiations is considered. Concepts and principles of the regulation based on risk concept are presented according to ICRP 26 and 27. Two types of risk are designated: ''absolute'' and ''relative'' ones. The concept of acceptable risk on the basis of cost - benefit ratio is substantiated. Special attention is paid to the principle of accounting the complex of health signs, when determining radiation hazard. To determine the level of permissible risk and permissible dose to population the concept of ''inadmissibility of s-tatistically significant risk'' has been developed. Standards, regulating population doses in the USSR, which are valid nowadays, are considered

  19. The validity and reliability study of Hand Hygiene Belief Scale and Hand Hygiene Practices Inventory

    Directory of Open Access Journals (Sweden)

    Mevlude Karadag


    Conclusion: The adaptation of translated and ldquo;Hand Hygiene Belief Scale and Hand Hygiene Practices Inventory and rdquo; in Turkey is found to be reliable and valid to evaluate hand hygiene belief and practices. [Cukurova Med J 2016; 41(2.000: 271-284

  20. Current problems of radiation hygiene

    International Nuclear Information System (INIS)

    Krotkov, F.G.; Golikov, V.Ya.


    Present status of radiation hygiene is considered and prospects of its further development are outlined in connection with the expansion of atomic energy use for peaceful purposes. Transfer to the new system of irradiation level reglamentation which is recommended by ICRP presupposes further investigations and data acquisition. Necessity of data acquisition on the frequency of stochastic effects of the doses not exceeding 100 rem, substantiations of methodical approaches to the assessment of the collective radiation doses of large human population groups at low levels of personal irradiation, obtaining of reliable information on the contribution of different sources into collective radiation doses are pointed out. Further investigations on the problems of radiation safety of patients and also prediction assessment of the existing systems of radioactive waste disposal, forecasting and insurance of radioactive wastes, forecasting and insurance of radiation accidents, connected with the injection of radionuclides into the biosphere deserve special attention. Perspective directions of scientific investigations in the field of occupational radiation hygiene are poined out

  1. Dental hygiene work in a clinical trial. (United States)

    Luís, H S; Morgado, I; Assunção, V; Bernardo, M F; Leroux, B; Martin, M D; DeRouen, T A; Leitão, J


    Dental hygiene activities were developed as part of a randomized clinical trial designed to assess the safety of low-level mercury exposure from dental amalgam restorations. Along with dental-hygiene clinical work, a community programme was implemented after investigators noticed the poor oral hygiene habits of participants, and the need for urgent action to minimize oral health problems in the study population. Clinical and community activity goal was to promote oral health and prevent new disease. Community activities involved participants and their fellow students and were aimed at providing education on oral health in a school environment. Dental hygienists developed clinical work with prophylaxis, sealants application and topical fluoride and implemented the community programme with in-class sessions on oral health themes. Twice a month fluoride mouthrinses and bi-annual tooth brushing instructional activity took place. Participation at dental-hygiene activities, sealed teeth with no need of restoration and dental-plaque-index were measures used to evaluate success of the programme for the participants. Improvement in dental hygiene is shown by the decrease in dental plaque index scores (P dental hygiene activities. Teachers became aware of the problem and included oral-health in school curricula. Dental hygiene activities have shown to be helpful to promote dental hygiene, promote oral health and to provide school-age children with education on habits that will be important for their future good health.

  2. Baccalaureate Dental Hygiene Education: Creating a Reality. (United States)

    Wayman, Dona E.


    Inherent in the meaning of baccalaureate dental hygiene education is the offering of upper-division courses in the theory and practice of dental hygiene itself. Restructuring the associate programs as strictly two-year, lower-division programs would require standardization of baccalaureate programs as strictly upper-division curricula. (MLW)

  3. Hand Hygiene Saves Lives: Patient Admission Video

    Centers for Disease Control (CDC) Podcasts

    This podcast is for hospital patients and visitors. It emphasizes two key points to help prevent infections: the importance of practicing hand hygiene while in the hospital, and that it's appropriate to ask or remind healthcare providers to practice hand hygiene.

  4. Prevention of gingivitis: Oral hygiene and dentifrices

    NARCIS (Netherlands)

    Sälzer, S.A.


    At the basis of Oral Health lies daily oral hygiene self-care with the result, if correctly performed, of plaque and gingivitis reduction. Epidemiological studies indicate that the level of oral hygiene in the general population has increased over the last decades. However, there still appears to be

  5. 9 CFR 416.5 - Employee hygiene. (United States)


    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Employee hygiene. 416.5 Section 416.5 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE REGULATORY... Employee hygiene. (a) Cleanliness. All persons working in contact with product, food-contact surfaces, and...

  6. [Hygiene and body odors across time]. (United States)

    Daich, D C


    Since Ancient Times, the Middle Ages and Modern times, there have been references to hygiene and body smells as well. According to each time there is a change in hygienic criteria and methods to avoid or diminish these annoying smells. Several beliefs and also science give their explanation to the different evolutionary stages of this process.

  7. Progress and prospects in labour radiation hygiene

    International Nuclear Information System (INIS)

    Parkhomenko, G.M.; Tarasenko, N.Yu.


    Stages of the development of radiation hygiene as a branch of hygienic science from 1940-1950 till now are being analyzed. The results and major research trends are presented. During the period under consideration the sanitary legislation was developed and important activity on setting up safety standards for ionizing raiation carried out

  8. Menstrual hygiene practices among adolescents in selected ...

    African Journals Online (AJOL)

    Menstrual hygiene is vital to the health, well-being, dignity and productivity of women and girls. The study assessed menstrual hygiene practices among adolescents in selected secondary schools around the University of Ibadan. The study was descriptive. A semi structured questionnaire was used to collect data from 381 ...

  9. Chemical Hygiene and Safety Plan

    Energy Technology Data Exchange (ETDEWEB)

    Berkner, K.


    The objective of this Chemical Hygiene and Safety Plan (CHSP) is to provide specific guidance to all LBL employees and contractors who use hazardous chemicals. This Plan, when implemented, fulfills the requirements of both the Federal OSHA Laboratory Standard (29 CFR 1910.1450) for laboratory workers, and the Federal OSHA Hazard Communication Standard (29 CFR 1910.1200) for non-laboratory operations (e.g., shops). It sets forth safety procedures and describes how LBL employees are informed about the potential chemical hazards in their work areas so they can avoid harmful exposures and safeguard their health. Generally, communication of this Plan will occur through training and the Plan will serve as a the framework and reference guide for that training.

  10. Comparative study of presurgical hand hygiene with hydroalcoholic solution versus traditional presurgical hand hygiene. (United States)

    López Martín, M Beatriz; Erice Calvo-Sotelo, Alejo

    To compare presurgical hand hygiene with hydroalcoholic solution following the WHO protocol with traditional presurgical hand hygiene. Cultures of the hands of surgeons and surgical nurses were performed before and after presurgical hand hygiene and after removing gloves at the end of surgery. Cultures were done in 2different days: the first day after traditional presurgical hand hygiene, and the second day after presurgical hand hygiene with hydroalcoholic solution following the WHO protocol. The duration of the traditional hand hygiene was measured and compared with the duration (3min) of the WHO protocol. The cost of the products used in the traditional technique was compared with the cost of the hydroalcoholic solution used. The variability of the traditional technique was determined by observation. Following presurgical hand hygiene with hydroalcoholic solution, colony-forming units (CFU) were detected in 5 (7.3%) subjects, whereas after traditional presurgical hand hygiene CFU were detected in 14 subjects (20.5%) (p < 0.05). After glove removal, the numbers of CFU were similar. The time employed in hand hygiene with hydroalcoholic solution (3min) was inferior to the time employed in the traditional technique (p < 0.05), its cost was less than half, and there was no variability. Compared with other techniques, presurgical hand hygiene with hydroalcoholic solution significantly decreases CFU, has similar latency time, a lower cost, and saves time. Copyright © 2017 Elsevier España, S.L.U. All rights reserved.

  11. Hand hygiene in the intensive care unit. (United States)

    Tschudin-Sutter, Sarah; Pargger, Hans; Widmer, Andreas F


    Healthcare-associated infections affect 1.4 million patients at any time worldwide, as estimated by the World Health Organization. In intensive care units, the burden of healthcare-associated infections is greatly increased, causing additional morbidity and mortality. Multidrug-resistant pathogens are commonly involved in such infections and render effective treatment challenging. Proper hand hygiene is the single most important, simplest, and least expensive means of preventing healthcare-associated infections. In addition, it is equally important to stop transmission of multidrug-resistant pathogens. According to the Centers for Disease Control and Prevention and World Health Organization guidelines on hand hygiene in health care, alcohol-based handrub should be used as the preferred means for routine hand antisepsis. Alcohols have excellent in vitro activity against Gram-positive and Gram-negative bacteria, including multidrug-resistant pathogens, such as methicillin-resistant Staphylococcus aureus and vancomycin-resistant enterococci, Mycobacterium tuberculosis, a variety of fungi, and most viruses. Some pathogens, however, such as Clostridium difficile, Bacillus anthracis, and noroviruses, may require special hand hygiene measures. Failure to provide user friendliness of hand hygiene equipment and shortage of staff are predictors for noncompliance, especially in the intensive care unit setting. Therefore, practical approaches to promote hand hygiene in the intensive care unit include provision of a minimal number of handrub dispensers per bed, monitoring of compliance, and choice of the most attractive product. Lack of knowledge of guidelines for hand hygiene, lack of recognition of hand hygiene opportunities during patient care, and lack of awareness of the risk of cross-transmission of pathogens are barriers to good hand hygiene practices. Multidisciplinary programs to promote increased use of alcoholic handrub lead to an increased compliance of healthcare

  12. Improved Hand Hygiene Compliance is Associated with the Change of Perception toward Hand Hygiene among Medical Personnel (United States)

    Park, Se Jeong; Chung, Moon Joo; Lee, Ju Hee; Kang, Hyun Joo; Lee, Jeong-a; Kim, Yong Kyun


    Background Hand hygiene compliance has improved significantly through hand hygiene promotion programs that have included poster campaign, monitoring and performance feedback, and education with special attentions to perceived subjective norms. We investigated factors associated with improved hand hygiene compliance, focusing on whether the improvement of hand hygiene compliance is associated with changed perception toward hand hygiene among medical personnel. Materials and Methods Hand hygiene compliance and perceptions toward hand hygiene among medical personnel were compared between the second quarter of 2009 (before the start of a hand hygiene promotion program) and the second quarter of 2012. We assessed adherence to hand hygiene among medical personnel quarterly according to the WHO recommended method for direct observation. Also, we used a modified self-report questionnaire to collect perception data. Results Hand hygiene compliance among physicians and nurses improved significantly from 19.0% in 2009 to 74.5% in 2012 (P Hand hygiene compliance among the medical personnel continued to improve, with a slight decline in 2013. Perceptions toward hand hygiene improved significantly between 2009 and 2012. Specifically, improvements were evident in intention to adhere to hand hygiene, knowledge about hand hygiene methods, knowledge about hand hygiene indications including care of a dirty and a clean body site on the same patient, perceived behavioral and subjective norms, positive attitude toward hand hygiene promotion campaign, perception of difficulty in adhering to hand hygiene, and motivation to improve adherence to hand hygiene. Conclusions The examined hand hygiene promotion program resulted in improved hand hygiene compliance and perception toward hand hygiene among medical personnel. The improved perception increased hand hygiene compliance. Especially, the perception of being a role model for other colleagues is very important to improve hand hygiene

  13. Main problems of modern radiation hygiene

    International Nuclear Information System (INIS)

    Il'in, L.A.; Buldakov, L.A.; Knizhnikov, V.A.


    The results of investigations carried out in 1980-81 in the field of radiation hygiene as well as plans for 1981-85 are considered. Three main groups of problems which the radiation hygiene is facing at the present time are discussed. The determination of levels and study of regularities of ionizing radiation dose formation in the population and personnel working with ionizing radiation sources in one of the promissing directions of the investigations. Delayed irradiation aftereffects andcontaminant action ofirradiation and chemical substances are no less important. The third important problem lies in the development of protective measures and arrangements on improving state sanitary inspection in the field of radiation hygiene

  14. Memorandum on standards for environmental hygiene 1976

    International Nuclear Information System (INIS)


    This report from the Dutch Ministry of Health is an advisory document on the influence of the memorandum on Standards for Environmental Hygiene 1976. It is a result of discussions between the Committee for Radiation Hygiene and the Commission for Toxicology. The environmental hygiene standards are defined and the difference between 150 standards and legal standards explained. Comments are given on the concepts that the memorandum covers and advice is given on the enforcement of such standards. This document deals with air and surface water pollution, radiation effects and toxicological standards. The difficulty in fixing maximum permissible doses for specific damaging agents is discussed. (C.F.)

  15. Oral Hygiene and Oral Flora Evaluation in Psychiatric Patients in ...

    African Journals Online (AJOL)

    Conclusions: The oral hygiene of most patients was insufficient. The presence of Gram‑negative Bacilli growth in the oral flora can be explained by poor hand hygiene. These findings suggest that it is useful to educate individuals about oral hygiene and hand hygiene and to inform the staff and families about this issue.

  16. Curriculum Guidelines for Clinical Dental Hygiene. (United States)

    Journal of Dental Education, 1985


    The American Association of Dental Schools curriculum guidelines for clinical dental hygiene include definitions, notes on the interrelationship of courses, an overview of course objectives, and suggested primary educational goals, prerequisites, core content, specific objectives, sequencing, faculty, and facilities. (MSE)

  17. Older people, personal hygiene, and skin care. (United States)

    Cowdell, Fiona


    Skin health is essential for well being in older people. Personal hygiene is fundamental to skin health, but a lack of evidence exists about effective practices. An evidence base, disseminated through nursing education and patient health promotion, must be developed.

  18. Trends in occupational hygiene in Finland. (United States)

    Pääkkönen, Rauno; Koponen, Milja


    The aim of this work is to evaluate and describe the current status of, and prospects for, the future of occupational hygiene in Finland. The main sources of information include a seminar held in the annual meeting of Finnish Occupational Hygiene Society and interviews with different stakeholders. Nanotechnology and other new materials, changing work environments, circular economy including green jobs, new medical methods and advances of construction methods were recognized as future challenges. Future work opportunities for occupational hygiene experts included exposure assessments in indoor air surveys, private consulting and entrepreneurship in general, international activities and product safety issues. Unclear topics needing more attention in the future were thought to be in new exposures, sensitive persons, combined effects, skin exposures and applicability of personal protective equipment. Occupational hygiene should broaden its view; occupational hygienists should have to cooperate with other specialists and grasp new challenges.

  19. Teething & Dental Hygiene for Young Children (United States)

    ... Living Listen Español Text Size Email Print Share Dental Health & Hygiene for Young Children Page Content Article ... and lead to future dental problems. Teaching Good Dental Habits The best way to protect your child's ...

  20. Daily Tips for Good Oral Hygiene (United States)

    ... this article Daily Tips for Good Oral Hygiene Bacteria can live in your mouth in the form of plaque, causing cavities and gingivitis, which can lead to periodontal (gum) disease. In order to keep your mouth ...

  1. [Parmentier hygiene and public health]. (United States)

    Lafont, O


    The legend about Parmentier is quite reductive when it limits his activity to the promotion of potato. This military pharmacist intended mainly to make science serve human being, whatever could be his various activities. Actor of the foundation of food chemistry, reorganizer of military pharmacy, he has always been highly concerned with hygiene and public health. He then studied the quality of water, particularly in the case of river Seine, or the purity of air, especially in hospitals. The affair of Dunkerque exhumations or that of cesspools, or the utilisation of human excrements in agriculture were parts of the occurrences for which he had the opportunity to find a scientific approach allowing to solve the difficult questions that were asked to him, for the best benefit of public health. The exhaustive study he published in "Bulletin de pharmacie" for the conservation of meat shows that he did not ignore anything about freezing of food in order to preserve it. It is necessary not to forget the important role he played, as soon as he were informed of Jenner's discovery, for the diffusion of vaccination in France. It is simply astounding to observe how modern were the questions he solved and how intense was his spirit of dedication to the public good, when exerting his functions in "Comité de Salubrité de la Seine" or "Conseil de Santé des Armées", as well as outside these prestigious institutions. Copyright © 2014 Elsevier Masson SAS. All rights reserved.

  2. The process of institutionalization of hygiene: the State, healt and hygiene

    Directory of Open Access Journals (Sweden)

    María Teresa Gutiérrez


    Full Text Available This paper seeks to set out the process by which national elites made major efforts to the hygiene apparatus in Colombia a responsibility of the national state. The motivations behind this were a mix of racial, medical and social reasons. During this period, Colombian doctors, thanks to a racial ideology, built a pro-hygiene narrative in which they argued for the importance of institutionalizing the hygiene apparatus. The paper’s analysis is based upon legislation, reports to the National Congress and medical conferences. The sources have been studied from the perspective of discourse analysis. Key words: hygienism, institutionalization, racial theories. I

  3. Hand Hygiene Saves Lives: Patient Admission Video

    Centers for Disease Control (CDC) Podcasts


    This podcast is for hospital patients and visitors. It emphasizes two key points to help prevent infections: the importance of practicing hand hygiene while in the hospital, and that it's appropriate to ask or remind healthcare providers to practice hand hygiene.  Created: 5/1/2008 by National Center for Preparedness, Detection, and Control of Infectious Diseases (NCPDCID).   Date Released: 6/19/2008.

  4. Hand hygiene in emergency medical services. (United States)

    Teter, Jonathan; Millin, Michael G; Bissell, Rick


    Hospital-acquired infections (HAIs) affect millions of patients annually (World Health Organization. Guidelines on Hand Hygiene in Healthcare. Geneva: WHO Press; 2009). Hand hygiene compliance of clinical staff has been identified by numerous studies as a major contributing factor to HAIs around the world. Infection control and hand hygiene in the prehospital environment can also contribute to patient harm and spread of infections. Emergency medical services (EMS) practitioners are not monitored as closely as hospital personnel in terms of hand hygiene training and compliance. Their ever-changing work environment is less favorable to traditional hospital-based aseptic techniques and education. This study aimed to determine the current state of hand hygiene practices among EMS providers and to provide recommendations for improving practices in the emergency health services environment. This study was a prospective, observational prevalence study and survey, conducted over a 2-month period. We selected participants from visits to three selected hospital emergency departments in the mid-Atlantic region. There were two data components to the study: a participant survey and hand swabs for pathogenic cultures. This study recruited a total sample of 62 participants. Overall, the study revealed that a significant number of EMS providers (77%) have a heavy bacterial load on their hands after patient care. All levels of providers had a similar distribution of bacterial load. Survey results revealed that few providers perform hand hygiene before (34%) or in between patients (24%), as recommended by the Centers for Disease Control and Prevention guidelines. This study demonstrates that EMS providers are potential vectors of microorganisms if proper hand hygiene is not performed properly. Since EMS providers treat a variety of patients and operate in a variety of environments, providers may be exposed to potentially pathogenic organisms, serving as vectors for the exposure of

  5. [Historical materials of Chinese food hygiene (1927-1949)]. (United States)

    Li, X; Wang, X


    The author discusses the situation on the work of food hygiene from 1928 to 1949 in China. During this period, the Health and Epidemic Prevention Bureau under the Ministry of Health were all in charge of food hygiene work. They formulated a series of standards, laws and rules on food hygiene which were carried out by hygienic policemen of the Bureau of Public Security. There were two ways for the education of food hygiene: Short-term course teaching class for food hygiene in medical college. The inspection and research work of food hygiene were performed by the Central Testing House of Hygiene, The Central Experimental Office of Hygienic Facilities and the Central Office of Epidemic Prevention and Nutritional Institute of the Health Office. After anti-Japanese war was broken out in 1937, food hygiene work were carried out mainly in the service in the war.

  6. ISS Hygiene Activities - Issues and Resolutions (United States)

    Prokhorov, Kimberlee S.; Feldman, Brienne; Walker, Stephanie; Bruce, Rebekah


    Hygiene is something that is usually taken for granted by those of us on the Earth. The ability to perform hygiene satisfactorily during long duration space flight is crucial for the crew's ability to function. Besides preserving the basic health of the crew, crew members have expressed that the ability to clean up on-orbit is vital for mental health. Providing this functionality involves more than supplying hygiene items such as soap and toothpaste. On the International Space Station (ISS), the details on where and how to perform hygiene were left to the crew discretion for the first seventeen increments. Without clear guidance, the methods implemented on-orbit have resulted in some unintended consequences to the ISS environment. This paper will outline the issues encountered regarding hygiene activities on-board the ISS, and the lessons that have been learned in addressing those issues. Additionally, the paper will address the resolutions that have been put into place to protect the ISS environment while providing the crew sufficient means to perform hygiene.

  7. Ethics instruction in the dental hygiene curriculum. (United States)

    Kacerik, Mark G; Prajer, Renee G; Conrad, Cynthia


    Dental hygiene ethics is an essential component of the dental hygiene curriculum. The accreditation standards for dental hygiene education state that graduates must be competent in applying ethical concepts to the provision and/or support of oral health care services. Although the standards for entry into the profession of dental hygiene emphasize the importance of ethical reasoning, there is little published research specific to ethics instruction in dental hygiene programs. The purpose of this study was to assess how ethics is taught in the dental hygiene curriculum. A 17-item survey was designed and distributed to 261 accredited dental hygiene programs in the United States for a response rate of 56% (N=147). The survey requested that participants provide information on teaching and evaluation methodologies, didactic and clinical hours of instruction, individuals responsible for providing instruction, and the degree of emphasis placed on ethics and integration of ethical reasoning within the dental hygiene curriculum. Results of the survey reflect that dental hygiene programs devote a mean of 20. hours to teaching dental hygiene ethics in the didactic component of the curriculum. With regard to the clinical component of the curriculum, 63% of respondents indicated that 10 or less hours are devoted to ethics instruction. These results show an increase in didactic hours of instruction from previous studies where the mean hours of instruction ranged from 7 to 11.7 hours. Results showed 64% of respondents offered a separate course in ethics; however, 82% of programs surveyed indicated that ethics was incorporated into one or more dental hygiene courses with 98% utilizing dental hygiene faculty to provide instruction. Most programs utilized a variety of instructional methods to teach ethics with the majority employing class discussion and lecture (99% and 97% respectively). The type of institution-technical college, community college, four-year university with a

  8. Computer screen saver hand hygiene information curbs a negative trend in hand hygiene behavior

    NARCIS (Netherlands)

    Helder, Onno K.; Weggelaar, Anne Marie; Waarsenburg, Daniël C. J.; Looman, Caspar W. N.; van Goudoever, Johannes B.; Brug, Johannes; Kornelisse, René F.


    Background: Appropriate hand hygiene among health care workers is the most important infection prevention measure; however, compliance is generally low. Gain-framed messages (ie, messages that emphasize the benefits of hand hygiene rather than the risks of noncompliance) may be most effective, but

  9. Cross-Cultural Competency Adaptability of Dental Hygiene Educators in Entry Level Dental Hygiene Programs (United States)

    Engeswick, Lynnette Marie


    This study was conducted to discover the extent dental hygiene educators in 25 entry-level dental hygiene programs from the Upper Midwest demonstrate Emotional Resilience, Flexibility and Openness, Perceptual Acuity, and Personal Autonomy as they relate to their level of education and multicultural experiences. An additional purpose was to examine…

  10. Computer screen saver hand hygiene information curbs a negative trend in hand hygiene behavior

    NARCIS (Netherlands)

    K. Helder MScN (Onno); J.W.M. Weggelaar-Jansen (Anne Marie); D.J.C. Waarsenburg (Daniël); C.W.N. Looman (Caspar); J.B. van Goudoever (Hans); J. Brug (Hans); R.F. Kornelisse (René)


    markdownabstract__Abtract__ Background: Appropriate hand hygiene among health care workers is the most important infection prevention measure; however, compliance is generally low. Gain-framed messages (ie, messages that emphasize the benefits of hand hygiene rather than the risks of

  11. Allergenic Ingredients in Personal Hygiene Wet Wipes. (United States)

    Aschenbeck, Kelly A; Warshaw, Erin M

    Wet wipes are a significant allergen source for anogenital allergic contact dermatitis. The aim of the study was to calculate the frequency of potentially allergenic ingredients in personal hygiene wet wipes. Ingredient lists from brand name and generic personal hygiene wet wipes from 4 large retailers were compiled. In the 54 personal hygiene wet wipes evaluated, a total of 132 ingredients were identified (average of 11.9 ingredients per wipe). The most common ingredients were Aloe barbadensis (77.8%), citric acid (77.8%), fragrance (72.2%), sorbic acid derivatives (63.0%), tocopherol derivatives (63.0%), glycerin (59.3%), phenoxyethanol (55.6%), disodium cocoamphodiacetate (53.7%), disodium ethylenediaminetetraacetic acid (EDTA) (42.6%), propylene glycol (42.6%), iodopropynyl butylcarbamate (40.7%), chamomile extracts (38.9%), sodium benzoate (35.2%), bronopol (22.2%), sodium citrate (22.2%), lanolin derivatives (20.4%), parabens (20.4%), polyethylene glycol derivatives (18.5%), disodium phosphate (16.7%), dimethylol dimethyl hydantoin (DMDM) (14.8%), and cocamidopropyl propylene glycol (PG)-dimonium chloride phosphate (11.1%). Of note, methylisothiazolinone (5.6%) was uncommon; methylchloroisothiazolinone was not identified in the personal hygiene wet wipes examined. There are many potential allergens in personal hygiene wet wipes, especially fragrance and preservatives.

  12. Back to basics: hand hygiene and isolation (United States)

    Lin Huang, G. Khai; Stewardson, Andrew J.; Lindsay Grayson, M.


    Purpose of review Hand hygiene and isolation are basic, but very effective, means of preventing the spread of pathogens in healthcare. Although the principle may be straightforward, this review highlights some of the controversies regarding the implementation and efficacy of these interventions. Recent findings Hand hygiene compliance is an accepted measure of quality and safety in many countries. The evidence for the efficacy of hand hygiene in directly reducing rates of hospital-acquired infections has strengthened in recent years, particularly in terms of reduced rates of staphylococcal sepsis. Defining the key components of effective implementation strategies and the ideal method(s) of assessing hand hygiene compliance are dependent on a range of factors associated with the healthcare system. Although patient isolation continues to be an important strategy, particularly in outbreaks, it also has some limitations and can be associated with negative effects. Recent detailed molecular epidemiology studies of key healthcare-acquired pathogens have questioned the true efficacy of isolation, alone as an effective method for the routine prevention of disease transmission. Summary Hand hygiene and isolation are key components of basic infection control. Recent insights into the benefits, limitations and even adverse effects of these interventions are important for their optimal implementation. PMID:24945613

  13. Sleep hygiene among veterinary medical students. (United States)

    Royal, Kenneth D; Hunt, Suzanne A; Borst, Luke B; Gerard, Mathew


    The objective of this study was to better understand veterinary medical students' sleep hygiene and identify the extent to which sleep hygiene behaviors may result in consequences (either positive or negative) for students. A total of 187 doctor of veterinary medicine (DVM) program students at a large College of Veterinary Medicine in the United States. The Epworth Sleep Scale and Daytime Sleepiness Scale were administered to 393 students enrolled in the DVM program. About 55.1% of students reported sleep per night, 28.9% reported having trouble sleeping, and 50.3% reported feeling sleepy all day. With respect to sleep quality, 5.3% described it as excellent, 52.4% as good, 34.2% as fair, and 8.0% as poor. A significant percentage of veterinary medical students exhibit poor sleep hygiene habits that may be detrimental to both their health and academic endeavors.

  14. Physiologie foundations of radiation hygiene of work

    International Nuclear Information System (INIS)

    Parkhomenko, G.M.; Kopaev, V.V.


    The book deals with the physiological foundations of labour hygiene in handling sources of ionizing radiations. The main principles of radiation protection of personnel, questions of providing optimum hygienic working conditions, which ensure the maintenance of the working capacity of the personnel and their health are considered. Extensive factual material on estimation of the factors of professional effects on personnel is generalized. Particular attention is given to the functional reactions of the organism and extension of the physiological mechanisms of development of production fatigue in various forms of labour activity (when using sources of ionizing radiations in isotope laboratories and on nuclear reactors). A physiological substantiation of the hygienic requirements imposed on the equipment for handling radioactive materials is presented

  15. Hand hygiene posters: motivators or mixed messages? (United States)

    Jenner, E A; Jones, F; Fletcher, B C; Miller, L; Scott, G M


    Poster campaigns regarding hand hygiene are commonly used by infection control teams to improve practice, yet little is known of the extent to which they are based on established theory or research. This study reports on the content analysis of hand hygiene posters (N=69) and their messages (N=75) using message-framing theory. The results showed that posters seldom drew on knowledge about effective ways to frame messages. Frequently, they simply conveyed information 'telling' rather than 'selling' and some of this was confusing. Most posters were not designed to motivate, and some conveyed mixed messages. Few used fear appeals. Hand hygiene posters could have a greater impact if principles of message framing were utilized in their design. Suggestions for gain-framed messages are offered, but these need to be tested empirically.

  16. An automated hand hygiene compliance system is associated with improved monitoring of hand hygiene. (United States)

    McCalla, Saungi; Reilly, Maggie; Thomas, Rowena; McSpedon-Rai, Dawn


    Consistent hand hygiene is key to reducing health care-associated infections (HAIs) and assessing compliance with hand hygiene protocols is vital for hospital infection control staff. A new automated hand hygiene compliance system (HHCS) was trialed as an alternative to human observers in an intensive care unit and an intensive care stepdown unit at a hospital facility in the northeastern United States. Using a retrospective cohort design, researchers investigated whether implementation of the HHCS resulted in improved hand hygiene compliance and a reduction in common HAI rates. Pearson χ 2 tests were used to assess changes in compliance, and incidence rate ratios were used to test for significant differences in infection rates. During the study period, the HHCS collected many more hand hygiene events compared with human observers (632,404 vs 480) and ensured that the hospital met its compliance goals (95%+). Although decreases in multidrug-resistant organisms, central line-associated bloodstream infections, and catheter-associated urinary tract infection rates were observed, they represented nonsignificant differences. Human hand hygiene observers may not report accurate measures of compliance. The HHCS is a promising new tool for fine-grained assessment of hand hygiene compliance. Further study is needed to examine the association between the HHCS and HAI rate reduction. Copyright © 2017 Association for Professionals in Infection Control and Epidemiology, Inc. Published by Elsevier Inc. All rights reserved.

  17. Hygiene aspects of cosmetic services

    Directory of Open Access Journals (Sweden)

    Anita Kukułowicz


    Full Text Available Introduction. Currently beauty salons offer a wide range of services, from beauty treatments starting with skin cleansing, peeling or manicure, to permanent makeup and body piercing. During all these treatments, there is a risk of infection with different diseases caused most often by Fungi (Candida albicans, pathogenic bacteria (Staphylococcus aureus and viruses (herpes, hepatitis B and C, and therefore the staff should use disposable equipment and sterilized tools.Aim of research. The aim of the study was to assess the hygiene conditions in a selected beauty salon. Material and methods. The research was carried out in a selected Salon in the Tri-city. The subject of microbiological analysis were the hands of beauticians, the surface of the table, the uniform, the cover of the chair for treatments for the face, clean towels and bowls for soaking feet prior to pedicure treatment. The aim of the research was to establish the total number of microorganisms (OLD, the number of yeasts and moulds, and the presence of staphylococci. Results. In the analysed material, the presence of Staphylococcus aureus was not confirmed. Among the studied samples, only slightly above 8% were free of moulds, while 25% were free of the presence of yeasts. Staphylococci settled on about 14% of the evaluated surfaces, mostly occurring on the hands of beauticians and in bowls for soaking feet. The average number of microorganisms isolated from the tips of 5 fingers amounted to 32 cfu/25 cm2. Staphylococcus epidermidis was present on the hands in more than 60% of the samples. Only about 7% of the samples were found to exceed the limit for class D premises, amounting to 50 cfu/25 cm2, while on over 70% of the analysed surfaces the microorganisms reached the level of 1–25 cfu/25 cm2, which confirms high standard of provided services. Conclusions. 1 In the examined beauty salon the analyzed surfaces were clean and free of Staphylococcus aureus, but Staphylococcus

  18. Improving the hygienic design of closed equipment

    DEFF Research Database (Denmark)

    Friis, Alan; Jensen, Bo Boye Busk


    Maintenance of proper hygiene in closed process equipment is in many ways a complex task. The interaction between the physical design and the nature of fluid flow is of main concern. During cleaning the main performance of the flow is to bring cleaning agents in the right doses to all parts of th...... computational fluid dynamics models to be able to predict the cleaning efficiency in especially complex parts of process plants has excellent potentials for desktop improvements and computer pre-validation of the hygienic performance of process plants....

  19. A Community Based Study on Menstrual Hygiene among ...

    African Journals Online (AJOL)

    women in South Asia are uncomfortable discussing in public. ... hygiene and safe practices are less vulnerable to RTI ..... places. Privacy for washing, changing, or cleaning purpose is something very important for proper menstrual hygiene.

  20. Hygiene and sanitation among ethnic minorities in Northern Vietnam

    DEFF Research Database (Denmark)

    Rheinländer, Thilde; Samuelsen, Helle; Dalsgaard, Anders


    Improving sanitation and hygiene to prevent infectious diseases is of high priority in developing countries. This study attempts to gain in-depth understanding of hygiene and sanitation perceptions and practices among four Ethnic Minority Groups (EMGs) in a rural area of northern Vietnam. It is b......-based hygiene promotion is also recommended to curb dependency and spark initiatives in ethnic minority communities. Finally, interventions should focus on hygiene "software"--promoting hygiene behaviour changes known to effectively prevent hygiene related diseases.......Improving sanitation and hygiene to prevent infectious diseases is of high priority in developing countries. This study attempts to gain in-depth understanding of hygiene and sanitation perceptions and practices among four Ethnic Minority Groups (EMGs) in a rural area of northern Vietnam...

  1. Sequential Low Cost Interventions Double Hand Hygiene Rates ...

    African Journals Online (AJOL)

    Sequential Low Cost Interventions Double Hand Hygiene Rates Among Medical Teams in a Resource Limited Setting. Results of a Hand Hygiene Quality Improvement Project Conducted At University Teaching Hospital of Kigali (Chuk), Kigali, Rwanda.

  2. Brief introduction about radiation hygiene in Russian navy

    International Nuclear Information System (INIS)

    Li Yu; Min Rui; Pan Zhen


    During long-time radiation working practice, there have been established comprehensive radiation hygiene system of technique and regulation in Russian navy. Brief introduction about radiation hygiene in Russian navy are as follows. (authors)

  3. Outcomes Assessment in Dental Hygiene Programs. (United States)

    Grimes, Ellen B.


    A survey of 22 dental-hygiene-program directors found that programs routinely and effectively assess student outcomes and use the information for program improvements and to demonstrate accountability. Both policy and faculty/administrative support were deemed important to implementation. Time constraints were a major barrier. Outcomes-assessment…

  4. Initiating Tobacco Curricula in Dental Hygiene Education (United States)

    Boyd, Linda D.; Fun, Kay; Madden, Theresa E.


    Two hours of tobacco instructions were incorporated into the baccalaureate dental hygiene curricula in a university in the Northwestern United States. Prior to graduation, all senior students were invited to complete anonymously a questionnaire surveying attitudes and clinical skills in providing tobacco services to their clinic patients. Twenty…

  5. The Inquiry Approach in Dental Hygiene Education. (United States)

    Scott, Ruth Lois; And Others


    A study to assess the impact of an inquiry-oriented curriculum in a dental hygiene program is described. Two instruments, designed to measure student perception of personal and faculty inquiry and disinquiry behavior, were administered. The implications of the findings are discussed. (Author/MLW)

  6. Prospectus for Dental Hygiene. April 1988. (United States)

    American Dental Hygienists' Association, Chicago, IL.

    A prospectus providing a rational basis for decision and action in the field of dental hygiene is presented, noting that all occupations are obliged to assess their value to society and take whatever actions are indicated to fulfill their social contract. A philosophical and conceptual foundation for change is examined. Three chapters focus on the…

  7. Dentistry and Dental Hygiene Handbook. 1988 Edition. (United States)

    New York State Education Dept., Albany. Office of the Professions.

    The laws, rules and regulations of the New York State Education Department governing dentistry and dental hygiene practice in the state are presented. In addition, the requirements and procedures for obtaining licensure and first registration as a dentist and dental hygienist in New York are discussed. The following chapters are provided: (1)…

  8. Medical Emergency Education in Dental Hygiene Programs. (United States)

    Stach, Donna J.; And Others


    A survey of 169 dental hygiene training programs investigated the curriculum content and instruction concerning medical emergency treatment, related clinical practice, and program policy. Several trends are noted: increased curriculum hours devoted to emergency care; shift in course content to more than life-support care; and increased emergency…

  9. Oral Hygiene. Instructor's Packet. Learning Activity Package. (United States)

    Hime, Kirsten

    This instructor's packet accompanies the learning activity package (LAP) on oral hygiene. Contents included in the packet are a time sheet, suggested uses for the LAP, an instruction sheet, final LAP reviews, a final LAP review answer key, suggested activities, additional resources (student handouts), student performance checklists for both…

  10. [Hygiene in otorhinolaryngology: Requirements and reality]. (United States)

    Jager, E; Heudorf, U


    Considering the physiological contamination of skin and mucous membranes in the ear, nose, and throat region by facultative pathogen microorganisms, as well as the increase in multidrug resistant organisms (MDRO), it is mandatory that hygienic procedures be observed in ENT institutions, in order to prevent transmission of bacteria and infections in patients. General guidelines for hygiene in otorhinolaryngology are presented based on the recommendations published by the German Commission on Hospital Hygiene and Infection Prevention (KRINKO). These encompass hand hygiene, surface disinfection, and reprocessing of medical devices. The correct reprocessing of the various components of ENT treatment units (including endoscopes, water bearing systems) is reported. Although law requires and KRINKO recommends that manufacturers of medical devices publish instructions for reprocessing their products, these reprocessing recommendations are often insufficient. Manufacturers should thus be called upon to improve their recommendations. In this paper, the requirements for handling of ENT treatment units are compared with the observations made by the Public Health Department in 7 ENT clinics and 32 ENT practices in Frankfurt/Main, Germany, in 2014.

  11. A reformulation of the hygiene hypothesis

    DEFF Research Database (Denmark)

    Hersoug, Lars-Georg


    Epidemiological studies have shown an inverse relationship between allergic respiratory diseases and the number of siblings. It was hypothesized that the lower prevalence of allergic respiratory diseases in large sibships was due to cross-infections between siblings. According to this hygiene...

  12. Hygienic Design in the Food Processing Industry

    DEFF Research Database (Denmark)

    Hilbert, Lisbeth Rischel; Hjelm, M.


    Bacterial adhesion and biofilm formation are of major concern in food production and processing industry. In 1998 a Danish co-operation programme under the title Centre for Hygienic Design was funded to combine the skills of universities, research institutes and industry to focus on the following...

  13. Aspects of control measures in occupational hygiene

    NARCIS (Netherlands)

    Lumens, M.


    This thesis focuses on two aspects which are of major importance in the broad field of control measures in occupational hygiene: the selection of control measures in a structured way and the impact of factors modifying the effectiveness of these control measures.

    The main

  14. Domestic hygienic legislation concerning population radiation protection

    International Nuclear Information System (INIS)

    Marej, A.N.


    Problems and principles of domestic sanitary legislation, concerning population radiation protection, are considered. The legislation envisages preventive measures, directed to contamination preventation of the main environmental objects, it regulates their content in the objects, their human intake and ionizing radiation doses, which might affect population. Existing domestic hygienic guides and safety standards for personnel and population are enumerated and characterized

  15. Epidemiology, occupational hygiene and health physics

    International Nuclear Information System (INIS)

    Bonnell, J.A.


    The contribution of radiation protection practices to the practice of occupational medicine and hygiene is discussed. For example, accurate studies of a number of biological systems were stimulated. It is suggested that an accurate epidemiological assessment of workers exposed at or below the recommended radiation dose limits be undertaken. (H.K.)

  16. Space for Hygiene in Housing Architecture

    DEFF Research Database (Denmark)

    Bech-Danielsen, Claus


    In this paper, the author focuses on spaces used for personal hygiene—the bathroom. The paper begins with a description of the hygienic movement in the late 19th century. At that time, urinating took place in semi-public spaces outside the dwelling. Today, the WC has moved well into the dwelling,...... by analyzing the spatial organization of dwellings....

  17. Hygiene and Industrial Security Program: General aspects

    International Nuclear Information System (INIS)


    This Venezuelan standard establishes the aspects that must be included in the elaboration and monitoring of an Hygiene and Industrial Security Program (Prevention of Accidents and Occupational Diseases Program). It is applicable to any type of exploitation company, or any kind of task (in nature or importance) where people work, no matter the number workers [es

  18. Associations of dairy cow behavior, barn hygiene, cow hygiene, and risk of elevated somatic cell count. (United States)

    Devries, T J; Aarnoudse, M G; Barkema, H W; Leslie, K E; von Keyserlingk, M A G


    Poor dairy cow hygiene has been consistently associated with elevated somatic cell count (SCC) and the risk of subclinical mastitis. The objective of this study was to determine the associations between dairy cow standing and lying behavior, barn hygiene, cow hygiene, and the risk of experiencing elevated SCC. Lactating Holstein dairy cows (n=69; 86 ± 51 DIM; parity: 2.0 ± 1.2; means ± SD), kept in 1 of 2 groups, were monitored over a 4-mo period. Each group contained 61 ± 1 (mean ± SD) cows over the study period; complete data were obtained from 37 and 32 animals within each respective group. Cows were housed in a sand-bedded, freestall barn with 2 symmetrical pens, each with a free cow traffic automatic milking system. To vary barn hygiene, in 4 consecutive 28-d periods, alley manure scrapers in each of the 2 pens were randomly assigned to frequencies of operation of 3, 6, 12, and 24 times per day. During the last 7 d of each period, cow hygiene (upper leg/flank, lower legs, and udder; scale of 1 = very clean to 4 = very dirty) and stall hygiene (number of 0.15×0.15-m squares contaminated with manure in a 1.20×1.65-m grid) were recorded. Standing and lying behavior of the cows were collected during those days using data loggers. Individual-cow SCC was recorded at the beginning and end of each 28-d period. Elevated SCC was used as an indicator of subclinical mastitis; incidence of elevated SCC was defined as having a SCC >200,000 cells/mL at the end of each 28-d period, when SCC was <100,000 cells/mL at the beginning of the period. Less frequent scraping of the barn alleys was associated with cows having poorer hygiene. Poor udder hygiene was associated with poor stall hygiene. Longer lying duration was associated with poor hygiene of the upper legs/flank and udder. Greater premilking standing duration was associated with poor udder hygiene and decreased frequency of lying bouts was associated with poor hygiene of the lower legs. Higher milk yield was

  19. Promoting Critical Thinking among Dental Hygiene Students: Strategies for Educators (United States)

    Jordan D'Ambrisi, Kathleen M.


    Dental hygiene education has evolved over the years from dental hygiene professions who provide patient education on oral health care to assuming the responsibility for the assimilation of knowledge that requires judgment, decision making and critical thinking skills. Given that the dental hygiene professions has moved toward evidence-based,…

  20. Menstrual hygiene management: education and empowerment for girls?

    NARCIS (Netherlands)

    Joshi, D.; Buit, G.; González-Botero, D.


    This paper discusses the recent attention of the water, sanitation, and hygiene (WASH) sector to resolving the menstrual hygiene crisis for young girls in developing countries. Menstrual hygiene management (MHM) interventions, including the use of sanitary pads, education, and awareness, and where

  1. Hygienic behaviour in Brazilian stingless bees (United States)

    Alves, Denise A.; Bento, José M. S.; Marchini, Luis C.; Ratnieks, Francis L. W.


    ABSTRACT Social insects have many defence mechanisms against pests and pathogens. One of these is hygienic behaviour, which has been studied in detail in the honey bee, Apis mellifera. Hygienic honey bee workers remove dead and diseased larvae and pupae from sealed brood cells, thereby reducing disease transfer within the colony. Stingless bees, Meliponini, also rear broods in sealed cells. We investigated hygienic behaviour in three species of Brazilian stingless bees (Melipona scutellaris, Scaptotrigona depilis, Tetragonisca angustula) in response to freeze-killed brood. All three species had high mean levels of freeze-killed brood removal after 48 h ∼99% in M. scutellaris, 80% in S. depilis and 62% in T. angustula (N=8 colonies per species; three trials per colony). These levels are greater than in unselected honey bee populations, ∼46%. In S. depilis there was also considerable intercolony variation, ranging from 27% to 100% removal after 2 days. Interestingly, in the S. depilis colony with the slowest removal of freeze-killed brood, 15% of the adult bees emerging from their cells had shrivelled wings indicating a disease or disorder, which is as yet unidentified. Although the gross symptoms resembled the effects of deformed wing virus in the honey bee, this virus was not detected in the samples. When brood comb from the diseased colony was introduced to the other S. depilis colonies, there was a significant negative correlation between freeze-killed brood removal and the emergence of deformed worker bees (P=0.001), and a positive correlation with the cleaning out of brood cells (P=0.0008). This shows that the more hygienic colonies were detecting and removing unhealthy brood prior to adult emergence. Our results indicate that hygienic behaviour may play an important role in colony health in stingless bees. The low levels of disease normally seen in stingless bees may be because they have effective mechanisms of disease management, not because they lack

  2. Hygienic behaviour in Brazilian stingless bees

    Directory of Open Access Journals (Sweden)

    Hasan Al Toufailia


    Full Text Available Social insects have many defence mechanisms against pests and pathogens. One of these is hygienic behaviour, which has been studied in detail in the honey bee, Apis mellifera. Hygienic honey bee workers remove dead and diseased larvae and pupae from sealed brood cells, thereby reducing disease transfer within the colony. Stingless bees, Meliponini, also rear broods in sealed cells. We investigated hygienic behaviour in three species of Brazilian stingless bees (Melipona scutellaris, Scaptotrigona depilis, Tetragonisca angustula in response to freeze-killed brood. All three species had high mean levels of freeze-killed brood removal after 48 h ∼99% in M. scutellaris, 80% in S. depilis and 62% in T. angustula (N=8 colonies per species; three trials per colony. These levels are greater than in unselected honey bee populations, ∼46%. In S. depilis there was also considerable intercolony variation, ranging from 27% to 100% removal after 2 days. Interestingly, in the S. depilis colony with the slowest removal of freeze-killed brood, 15% of the adult bees emerging from their cells had shrivelled wings indicating a disease or disorder, which is as yet unidentified. Although the gross symptoms resembled the effects of deformed wing virus in the honey bee, this virus was not detected in the samples. When brood comb from the diseased colony was introduced to the other S. depilis colonies, there was a significant negative correlation between freeze-killed brood removal and the emergence of deformed worker bees (P=0.001, and a positive correlation with the cleaning out of brood cells (P=0.0008. This shows that the more hygienic colonies were detecting and removing unhealthy brood prior to adult emergence. Our results indicate that hygienic behaviour may play an important role in colony health in stingless bees. The low levels of disease normally seen in stingless bees may be because they have effective mechanisms of disease management, not because

  3. A person-oriented approach to hand hygiene behaviour: Emotional empathy fosters hand hygiene practice. (United States)

    Sassenrath, Claudia; Diefenbacher, Svenja; Siegel, André; Keller, Johannes


    Adopting a social-psychological approach, this research examines whether emotional empathy, an affective reaction regarding another's well-being, fosters hand hygiene as this affects other's health-related well-being extensively. Three studies tested this notion: (a) a cross-sectional study involving a sample of health care workers at a German hospital, (b) an experiment testing the causal effect of empathy on hand hygiene behaviour and (c) an 11-week prospective study testing whether an empathy induction affected disinfectant usage frequency in two different wards of a hospital. Self-reported hand hygiene behaviour based on day reconstruction method was measured in Study 1, actual hand sanitation behaviour was observed in Study 2 and disinfectant usage frequency in two different hospital wards was assessed in Study 3. Study 1 reveals an association of empathy with hand hygiene cross-sectionally, Study 2 documents the causal effect of empathy on increased hand sanitation. Study 3 shows an empathy induction increases hand sanitiser usage in the hospital. Increasing emotional empathy promotes hand hygiene behaviour, also in hospitals. Besides providing new impulses for the design of effective interventions, these findings bear theoretical significance as they document the explanatory power of empathy regarding a distal explanandum (hand hygiene).

  4. A framework for designing hand hygiene educational interventions in schools

    DEFF Research Database (Denmark)

    Appiah-Brempong, Emmanuel; Harris, Muriel J; Newton, Samuel


    OBJECTIVES: Hygiene education appears to be the commonest school-based intervention for preventing infectious diseases, especially in the developing world. Nevertheless, there remains a gap in literature regarding a school-specific theory-based framework for designing a hand hygiene educational...... (normative beliefs and motivation to comply). CONCLUSIONS: A framework underpinned by formalized psychosocial theories has relevance and could enhance the design of hand hygiene educational interventions, especially in schools....... of school-based hand hygiene educational interventions is summarized narratively. RESULTS: School-based hand hygiene educational interventions seeking to positively influence behavioural outcomes could consider enhancing psychosocial variables including behavioural capacity, attitudes and subjective norms...

  5. Strategies for service-learning assessment in dental hygiene education. (United States)

    Burch, Sharlee


    A large body of literature exists on the instructional pedagogy known as service-learning. Service-learning is a teaching and learning approach characterized by the dental hygiene student's practical application of academic studies and occurs within a community setting, to the benefit of both the student and community. Dental hygiene educators use service-learning to enhance student knowledge and application of oral health curriculum. This manuscript reports on the importance of service-learning assessment to the National Dental Hygiene Research Agenda as well as the future of the profession of dental hygiene and the successful strategies in service-learning evaluation available for utilization by dental hygiene educators.

  6. Hand hygiene knowledge and practices of nursing students in Singapore. (United States)

    Nasirudeen, A M A; Koh, Josephine W N; Lau, Adeline Lee Chin; Li, Wenjie; Lim, Lay Seng; Ow, Cynthia Yi Xuan


    Hand hygiene is an important means of preventing nosocomial infections. Studies have shown a hand hygiene among health care workers. A hand hygiene survey was administered to nursing students in a tertiary institution in Singapore. The results of this survey strongly indicate that nursing students understand the importance of hand hygiene compliance and perceive clinical internship programs and practical laboratory sessions to be effective methods of hand hygiene education. Copyright © 2012 Association for Professionals in Infection Control and Epidemiology, Inc. Published by Mosby, Inc. All rights reserved.

  7. Hygiene Knowledge of Food Staff in Catering Industry

    Directory of Open Access Journals (Sweden)

    Hülya Yardımcı


    Full Text Available This study, designed as a cross-sectional study, was carried out to determine the hygiene knowledge of the staff (N = 317 employed in kitchen and service departments of catering firms in Ankara. It was found that the mean scores of the staff with regard to personal hygiene, food hygiene, and kitchen and equipment hygiene were 10.7 ± 1.6, 19.8 ± 4.0, and 13.6 ± 2.0, respectively. Male staff achieved higher mean scores in personal hygiene knowledge test compared with female staff (p < .01. The staff receiving a hygiene training were determined to have higher mean scores in terms of hygiene knowledge tests compared with those who have not received, and the production staff had higher knowledge as to hygiene than the other groups (p < .01. The mean scores for hygiene knowledge tests were found to be increasing with age. Hygiene knowledge scores of the staff were quite lower than what must be taken. For that reason, periodical training programs should be organized to increase the awareness of the staff about hygiene.

  8. Spot-checks to measure general hygiene practice. (United States)

    Sonego, Ina L; Mosler, Hans-Joachim


    A variety of hygiene behaviors are fundamental to the prevention of diarrhea. We used spot-checks in a survey of 761 households in Burundi to examine whether something we could call general hygiene practice is responsible for more specific hygiene behaviors, ranging from handwashing to sweeping the floor. Using structural equation modeling, we showed that clusters of hygiene behavior, such as primary caregivers' cleanliness and household cleanliness, explained the spot-check findings well. Within our model, general hygiene practice as overall concept explained the more specific clusters of hygiene behavior well. Furthermore, the higher general hygiene practice, the more likely children were to be categorized healthy (r = 0.46). General hygiene practice was correlated with commitment to hygiene (r = 0.52), indicating a strong association to psychosocial determinants. The results show that different hygiene behaviors co-occur regularly. Using spot-checks, the general hygiene practice of a household can be rated quickly and easily.

  9. An educational intervention to improve hand hygiene compliance in Vietnam. (United States)

    Phan, Hang Thi; Tran, Hang Thi Thuy; Tran, Hanh Thi My; Dinh, Anh Pham Phuong; Ngo, Ha Thanh; Theorell-Haglow, Jenny; Gordon, Christopher J


    Hand hygiene compliance is the basis of infection control programs. In developing countries models to improve hand hygiene compliance to reduce healthcare acquired infections are required. The aim of this study was to determine hand hygiene compliance following an educational program in an obstetric and gynecological hospital in Vietnam. Health care workers from neonatal intensive care, delivery suite and a surgical ward from Hung Vuong Hospital, Ho Chi Minh City, Vietnam undertook a 4-h educational program targeting hand hygiene. Compliance was monitored monthly for six months following the intervention. Hand hygiene knowledge was assessed at baseline and after six months of the study. There were 7124 opportunities over 370 hand hygiene recording sessions with 1531 opportunities at baseline and 1620 at 6 months following the intervention. Hand hygiene compliance increased significantly from baseline across all sites (43.6% [95% Confidence interval CI: 41.1-46.1] to 63% [95% CI: 60.6-65.3]; p hygiene compliance increased significantly after intervention (p hygiene compliance for an extended period of time. Hand hygiene knowledge increased during the intervention. This hand hygiene model could be used in developing countries were resources are limited.

  10. The effect of improved hand hygiene on nosocomial MRSA control. (United States)

    Marimuthu, Kalisvar; Pittet, Didier; Harbarth, Stephan


    The purpose of this review is to examine studies that have assessed the association between hand hygiene enhancement and methicillin-resistant Staphylococcus aureus (MRSA) rates and to explore controversies surrounding this association. Many studies have been published confirming the link between improved hand hygiene compliance and reduction in MRSA acquisition and infections, including bacteremia. These studies have also shown the cost-beneficial nature of these programmes. Despite considerable research some issues remain unanswered still, including the temporal relationship between hand hygiene enhancement strategies and decrease in MRSA rates, association between hand hygiene enhancement and MRSA-related surgical site infections, diminishing effect of hand hygiene compliance on MRSA rates after reaching a threshold and the role of instituting contact precautions in the setting of low MRSA rates and sufficient hand hygiene compliance. In conclusion, enhancement of hand hygiene compliance has been shown to reduce MRSA rates; however, some open issues warrant further investigation.

  11. Oral Hygiene in Patients with Parkinson's Disease. (United States)

    Batista, Leonardo M; Portela de Oliveira, Millena Teles; Magalhaes, Wilrama B; Bastos, Poliana Lima


    Parkinson's disease is a chronic progressive neurodegenerative disorder with a multifactorial etiology. The symptoms are characterized by motor disorders - tremor, rigidity, bradykinesia and postural instability, which hinder oral hygiene. Oral and dental health in Parkinson's disease has been under-documented and findings are conflicting. Moreover, a number of dentists have limited experience regarding the management of these patients. This article reviews literature published within the last fifteen years, to better understand the impact of this disease in oral health. A literature search (MEDLINE and PUBMED), using keywords Parkinson Disease and Oral Hygiene, yielded 27 articles, from which 20 were selected. All of the articles were published in English in the last 15 years.

  12. Hand hygiene posters: selling the message. (United States)

    Jenner, E A; Jones, F; Fletcher, B C; Miller, L; Scott, G M


    This literature review was undertaken to determine the established theory and research that might be utilized to inform the construction of persuasive messages on hand hygiene posters. It discusses the principles of message framing and the use of fear appeals. Current theory suggests that the most effective messages for health promotion behaviours should be framed in terms of gains rather than losses for the individual. However, as clinical hand hygiene is largely for the benefit of others (i.e. patients), messages should also invoke a sense of personal responsibility and appeal to altruistic behaviour. The use of repeated minimal fear appeals have their place. Posters that simply convey training messages are not effective persuaders.

  13. Evaluation of Two Methods in Food Hygiene


    Rodrigues, Diandra Graciela; Centro Universitário de Votuporanga - UNIFEV; Silva, Nayara Bessa Martins da; Centro Universitário de Votuporanga - UNIFEV; Rezende, Catia; Centro Universitário de Votuporanga - UNIFEV; Jacobucci, Helaine Beatriz; Centro Universitário de Votuporanga - UNIFEV; Fontana, Eloni Aparecida; Centro Universitário de Votuporanga - UNIFEV


    Microorganisms in food may be a risk to human health. Pathogenic microorganisms reach food by several routes, always indicating poor hygiene during production, storage, processing, distribution and handling at the household level. Current analysis investigates two techniques (water and soap and sodium hypochlorite) used in washing fruits and vegetables to remove fecal or total coliforms. Samples of grape, pear, apple, guava, tomato and lettuces were obtained from commercial establishments in ...

  14. [Hygiene, safety and occupational medicine in Niger]. (United States)

    Moussa, F; Sékou, H


    The laws and rules governing hygiene, safety and medicine in the workplace in Niger were evaluated in this study. We used labour administration, health service and Social Security Department reports to review each type of professional activity and the risks associated with it. This enabled us to make recommendations to the authorities and to the organizations representing employers and staff, concerning the prevention of risks at work.

  15. Implementation of directly observed patient hand hygiene for hospitalized patients by hand hygiene ambassadors in Hong Kong. (United States)

    Cheng, Vincent C C; Tai, Josepha W M; Li, W S; Chau, P H; So, Simon Y C; Wong, Lisa M W; Ching, Radley H C; Ng, Modissa M L; Ho, Sara K Y; Lee, Doris W Y; Lee, W M; Wong, Sally C Y; Yuen, K Y


    The importance of compliance with hand hygiene by patients is increasingly recognized to prevent health care-associated infections. This descriptive study observed the effects of an education campaign, targeted to increase patients' self-initiated hand hygiene, and a hand hygiene ambassador-initiated directly observed hand hygiene program on patients' hand hygiene compliance in a university-affiliated hospital. The overall audited compliance of patients' self-initiated hand hygiene was only 37.5%, with a rate of 26.9% (112/416 episodes) before meals and medications, 27.5% (19/69 episodes) after using a urinal or bedpan, and 89.7% (87/97 episodes) after attending toilet facilities. Patients referred from a residential care home for older adults had significantly lower hand hygiene compliance (P = .007). Comparatively, the overall audited compliance of ambassador-initiated directly observed hand hygiene was 97.3% (428/440 episodes), which was significantly higher than patients' self-initiated hand hygiene via a patient education program (37.5%, 218/582 episodes, P hand hygiene can play an important role in improving compliance with hand hygiene by hospitalized patients. Copyright © 2016 Association for Professionals in Infection Control and Epidemiology, Inc. Published by Elsevier Inc. All rights reserved.

  16. Using radioactive tracer technique in municipal hygiene

    International Nuclear Information System (INIS)

    Yurasova, O.I.


    Work of the A. N. Syrsin Institute of General and Municiapl Hygiene using raidoactive tracers is reviewed. The studies include research on protein metabolism in the living organism following action of unfavorable factors of the environment; determination of the paths of introduction into the organism of substances with an alien composition; and study of the rate of resorption of subcutaneous papuli. Results are shown of radioactive-tracer studies on the mechanism of action of poisonous substances on the living organism and of migration of alien chemical compounds in the organism and in objects in the environment. It is concluded that the radioactive tracer method has wide application in municipal hygiene and sanitary microbiology. The absence of laborious operations, economy of time, precision of the experiments, and the possibility of obtaining additional information on the mechanism of action of poisonous substances on the organism and the low cost of such studies compared with other methods makes the radioactive tracer method economically attractive. The studies made show the various types of use of the method in municipal hygiene and sanitary microbiology

  17. Hand hygiene knowledge of college students. (United States)

    Taylor, J Kyle; Basco, Roselyne; Zaied, Aya; Ward, Chelsea


    An observational study was conducted to evaluate hygiene habits of students with fields of study, gender, and understanding of hygiene at a university in Alabama. One hundred students were randomly observed in ten restrooms on campus to determine whether or not students washed their hands. The study was divided into an observational stage, a quiz to ascertain student's knowledge of hygiene and the spread of pathogens, and a survey of self-reported illness rates. Females had a tendency to wash their hands more often than males while visiting the bathroom (p = 0.02, chi2 = 11.6). Science majors were more likely to wash their hands than non-science majors (p < or = 0.001, chi2 = 5.2). Females (p < or = 0.0001, df = 98, F = 21.5) and science majors (p < or = 0.0001, df = 98, F = 81.4) scored significantly higher on the survey than males and nonscience majors, and that those observed not washing their hands reported being sick more often than those observed washing their hands (chi2 = 155.0, df= 3, p < 0.001, Fisher's exact p < 0.001).

  18. Using radioactive tracer technique in municipal hygiene

    Energy Technology Data Exchange (ETDEWEB)

    Yurasova, O I [Institut Obshchej i Kommunal' noj Gigieny, Moscow (USSR)


    Work of the A. N. Syrsin Institute of General and Municiapl Hygiene using raidoactive tracers is reviewed. The studies include research on protein metabolism in the living organism following action of unfavorable factors of the environment; determination of the paths of introduction into the organism of substances with an alien composition; and study of the rate of resorption of subcutaneous papuli. Results are shown of radioactive-tracer studies on the mechanism of action of poisonous substances on the living organism and of migration of alien chemical compounds in the organism and in objects in the environment. It is concluded that the radioactive tracer method has wide application in municipal hygiene and sanitary microbiology. The absence of laborious operations, economy of time, precision of the experiments, and the possibility of obtaining additional information on the mechanism of action of poisonous substances on the organism and the low cost of such studies compared with other methods makes the radioactive tracer method economically attractive. The studies made show the various types of use of the method in municipal hygiene and sanitary microbiology.

  19. Hospitalisation impacts on oral hygiene: an audit of oral hygiene in a metropolitan health service. (United States)

    Danckert, Rachael; Ryan, Anna; Plummer, Virginia; Williams, Cylie


    Poor oral health has been associated with systemic diseases, morbidity and mortality. Many patients in hospital environments are physically compromised and rely upon awareness and assistance from health professionals for the maintenance or improvement of their oral health. This study aimed to identify whether common individual and environment factors associated with hospitalisation impacted on oral hygiene. Data were collected during point prevalence audits of patients in the acute and rehabilitation environments on three separate occasions. Data included demographic information, plaque score, presence of dental hygiene products, independence level and whether nurse assistance was documented in the health record. Data were collected for 199 patients. A higher plaque score was associated with not having a toothbrush (p = 0.002), being male (p = 0.007), being acutely unwell (p = 0.025) and requiring nursing assistance for oral hygiene (p = 0.002). There was fair agreement between the documentation of requiring assistance for oral care and the patient independently able to perform oral hygiene (ICC = 0.22). Oral hygiene was impacted by factors arising from hospitalisation, for those without a toothbrush and male patients of acute wards. Establishment of practices that increase awareness and promote good oral health should be prioritised. © 2015 Nordic College of Caring Science.

  20. Mental hygiene in early Francoism: from racial hygiene to the prevention of mental illness (1939-1960). (United States)

    Campos, Ricardo; Novella, Enric

    In this paper, we study the ideological bases of mental hygiene, understood as racial and moral hygiene, during the first years of Franco's regime and their evolution until 1960. First, we discuss the conceptualization of mental hygiene in the 1940s and its role as a tool for the legitimization of dictatorship, revealing the involvement of orthodox Catholicism and its links with moral and racial hygiene. Second, we assess the transformation of mental hygiene during the 1950s towards modernization and a stronger linkage with the dominant trends of contemporary psychiatry without ever leaving the ideological background of Catholicism. For this purpose, we will focus on analysis of the activities of the Mental Hygiene Week held in Barcelona in 1954 and on the creation in 1955 of the National Board of Psychiatric Care, which took on mental hygiene as one of its functions. This paper shows the close relationship of mental hygiene during the early years of Francoism with the political principles of the Dictatorship. The 1940s witnessed the deployment of a harsh discourse in which mental hygiene was a tool for the (moral and spiritual) education of the Spanish people in the political principles of the "New State", pathologizing political dissent and ideologically purifying the country. In the 1950s, Francoist mental hygiene underwent a process of aggiornamento marked by international political events following the defeat of fascism in World War II, advancing a project for (authoritarian) modernization in an international context already directed towards mental health.

  1. Healthcare worker and family caregiver hand hygiene in Bangladeshi healthcare facilities: results from the Bangladesh National Hygiene Baseline Survey. (United States)

    Horng, L M; Unicomb, L; Alam, M-U; Halder, A K; Shoab, A K; Ghosh, P K; Opel, A; Islam, M K; Luby, S P


    Healthcare facility hand hygiene impacts patient care, healthcare worker safety, and infection control, but low-income countries have few data to guide interventions. To conduct a nationally representative survey of hand hygiene infrastructure and behaviour in Bangladeshi healthcare facilities to establish baseline data to aid policy. The 2013 Bangladesh National Hygiene Baseline Survey examined water, sanitation, and hand hygiene across households, schools, restaurants and food vendors, traditional birth attendants, and healthcare facilities. We used probability proportional to size sampling to select 100 rural and urban population clusters, and then surveyed hand hygiene infrastructure in 875 inpatient healthcare facilities, observing behaviour in 100 facilities. More than 96% of facilities had 'improved' water sources, but environmental contamination occurred frequently around water sources. Soap was available at 78-92% of handwashing locations for doctors and nurses, but just 4-30% for patients and family. Only 2% of 4676 hand hygiene opportunities resulted in recommended actions: using alcohol sanitizer or washing both hands with soap, then drying by air or clean cloth. Healthcare workers performed recommended hand hygiene in 9% of 919 opportunities: more after patient contact (26%) than before (11%). Family caregivers frequently washed hands with only water (48% of 2751 opportunities), but with little soap (3%). Healthcare workers had more access to hand hygiene materials and performed better hand hygiene than family, but still had low adherence. Increasing hand hygiene materials and behaviour could improve infection control in Bangladeshi healthcare facilities. Copyright © 2016 The Authors. Published by Elsevier Ltd.. All rights reserved.

  2. Developing and promoting hygiene in the home and community. (United States)

    Bloomfield, S F; Signorelli, C; Fara, G


    The last two decades have seen infectious diseases (IDs) moving back up the health agenda. If the burden of ID is to be contained, the responsibility must be shared by the public. The International Scientific Forum on Home Hygiene (IFH) is working to raise awareness of the role of home hygiene, and promote understanding of hygiene practice. To develop a strategy for home hygiene, IFH has used the available scientific data to formulate a risk-based approach. This "targeted hygiene" approach maximises protection against infection, whilst minimising any impact on the environment from cleaning and disinfection products, minimising any risks associated antimicrobial resistance, and sustaining interaction with the microbial flora of the environment. IFH has developed a comprehensive range of materials which are being promoted through the IFH website and other channels. Analysis of website traffic indicates significant demand for home hygiene information including scientific material and information in "plain language".

  3. [Hygiene practices for patients with HIV/AIDS]. (United States)

    da Cunha, Gilmara Holanda; de Araujo, Thelma Leite; Lima, Francisca Elisângela Teixeira; Cavalcante, Tahissa Frota; Galvão, Marli Teresinha Gimeniz


    The objective of this study was to analyze the scientific production on health interventions related to hygiene for adults with HIV/AIDS. An integrative literature review was performed using six databases in June 2013. The descriptors AIDS and Hygiene were used, in Portuguese, English or Spanish. A total of 682 articles were found and 16 were selected. Personal hygiene practices were identified, such as hand washing, showers, tooth brushing and quitting smoking. Food hygiene practices involved washing food and kitchen utensils, using treated water, conserving and cooking food. Environmental hygiene took into account raising domestic animals, control of disease vectors, household cleanliness, waste disposal and basic sanitation. In conclusion, these specific hygiene interventions can be applied to the general population and, especially, to people with HIV/AIDS, due to immunosuppression.

  4. Personal hygiene and methicillin-resistant Staphylococcus aureus infection. (United States)

    Turabelidze, George; Lin, Mei; Wolkoff, Barbara; Dodson, Douglas; Gladbach, Stephen; Zhu, Bao-Ping


    Methicillin-resistant Staphylococcus aureus (MRSA) infections outside the healthcare setting are an increasing concern. We conducted a case-control study to investigate an MRSA outbreak during 2002-2003 in a Missouri prison and focused on hygiene factors. Information on sociodemographic characteristics, medical history, and hygiene practices of study participants was collected by interview and medical record review. Logistic regression was used to evaluate MRSA infection in relation to hygiene factors individually and as a composite hygiene score; potential confounding factors were controlled. Selected MRSA isolates were analyzed by pulsed-field gel electrophoresis (PFGE). MRSA infection was significantly associated with a low composite hygiene score. Transmission among prison inmates appeared to be responsible for this outbreak. PFGE analysis showed that isolates were indistinguishable and associated with community-onset MRSA infections in other US prisons. Improving hygiene practices and environmental conditions may help prevent and interrupt future MRSA outbreaks in prison settings.

  5. Hygiene practices for patients with HIV/AIDS

    Directory of Open Access Journals (Sweden)

    Gilmara Holanda da Cunha

    Full Text Available The objective of this study was to analyze the scientific production on health interventions related to hygiene for adults with HIV/AIDS. An integrative literature review was performed using six databases in June 2013. The descriptors AIDS and Hygiene were used, in Portuguese, English or Spanish. A total of 682 articles were found and 16 were selected. Personal hygiene practices were identified, such as hand washing, showers, tooth brushing and quitting smoking. Food hygiene practices involved washing food and kitchen utensils, using treated water, conserving and cooking food. Environmental hygiene took into account raising domestic animals, control of disease vectors, household cleanliness, waste disposal and basic sanitation. In conclusion, these specific hygiene interventions can be applied to the general population and, especially, to people with HIV/AIDS, due to immunosuppression.

  6. Oral hygiene in primary schoolchildren in Benin City, Nigeria.


    Alakija, W


    Oral hygiene was assessed in children from two primary schools in Benin City, Nigeria. Good oral hygiene was not related to the socioeconomic class of the children but to the method of cleaning the teeth. Girls had better oral hygiene than boys. It is suggested that the local method of using chewing sticks should be encouraged, and emphasis placed on frequency and thoroughness of use.

  7. Personal Hygiene Practices among Urban Homeless Persons in Boston, MA


    Leibler, Jessica H.; Nguyen, Daniel D.; Le?n, Casey; Gaeta, Jessie M.; Perez, Debora


    Persons experiencing homelessness in the United States experience significant barriers to self-care and personal hygiene, including limited access to clean showers, laundry and hand washing facilities. While the obstacles to personal hygiene associated with homelessness may increase risk of infectious disease, hygiene-related behaviors among people experiencing homelessness has received limited attention. We conducted a cross-sectional study of individuals experiencing homelessness in Boston,...

  8. Improving adherence to hand hygiene practice: a multidisciplinary approach.


    Pittet, D.


    Hand hygiene prevents cross-infection in hospitals, but health-care workers' adherence to guidelines is poor. Easy, timely access to both hand hygiene and skin protection is necessary for satisfactory hand hygiene behavior. Alcohol- based hand rubs may be better than traditional handwashing as they require less time, act faster, are less irritating, and contribute to sustained improvement in compliance associated with decreased infection rates. This article reviews barriers to appropriate han...

  9. Costing the Australian National Hand Hygiene Initiative. (United States)

    Page, K; Barnett, A G; Campbell, M; Brain, D; Martin, E; Fulop, N; Graves, N


    The Australian National Hand Hygiene Initiative (NHHI) is a major patient safety programme co-ordinated by Hand Hygiene Australia (HHA) and funded by the Australian Commission for Safety and Quality in Health Care. The annual costs of running this programme need to be understood to know the cost-effectiveness of a decision to sustain it as part of health services. To estimate the annual health services cost of running the NHHI; the set-up costs are excluded. A health services perspective was adopted for the costing and collected data from the 50 largest public hospitals in Australia that implemented the initiative, covering all states and territories. The costs of HHA, the costs to the state-level infection-prevention groups, the costs incurred by each acute hospital, and the costs for additional alcohol-based hand rub are all included. The programme cost AU$5.56 million each year (US$5.76, £3.63 million). Most of the cost is incurred at the hospital level (65%) and arose from the extra time taken for auditing hand hygiene compliance and doing education and training. On average, each infection control practitioner spent 5h per week on the NHHI, and the running cost per annum to their hospital was approximately AU$120,000 in 2012 (US$124,000, £78,000). Good estimates of the total costs of this programme are fundamental to understanding the cost-effectiveness of implementing the NHHI. This paper reports transparent costing methods, and the results include their uncertainty. Copyright © 2014 The Healthcare Infection Society. Published by Elsevier Ltd. All rights reserved.

  10. Personal Hygiene and Vulvovaginitis in Prepubertal Children. (United States)

    Cemek, Fatıma; Odabaş, Dursun; Şenel, Ünal; Kocaman, Ayşe Tuba


    To determine and compare clinical and microbiological features of vulvovaginitis in prepubertal girls. Vulvovaginitis is the most common gynecological problem of childhood. DESIGN, SETTING, PARTICIPANTS, INTERVENTIONS, AND MAIN OUTCOME MEASURES: This study involved 45 girls from 2-12 (5.38 ± 2.9) years old; and 26 girls from 3-12 (5.72 ± 3.1) years old as a control group. Anamnesis and physical examination were followed by vaginal smear, urine culture, and stool analyses from both groups, and the personal hygiene status and education level of the mother were determined. The most common symptoms among the patients were vaginal discharge (44.4%, vulvar erythema (37.8%), and vaginal itch (24.4%). Microorganisms, isolated from vaginal smears, were detected in 48.9% of the patients. Escherichia coli was shown in the urine culture of 3 patients with vulvovaginitis (6.70%). In microscopic stool analysis parasites were detected (45.9%). We found some relevant personal hygiene factors, such as wiping back to front (42.9%), cleaning by herself after defecation (89.3%), using toilet paper (60.7%) and wet wipes (21.4%), and bathing standing (14.3%) and sitting (46.4%) among patients. The questionnaire also showed that the children wore tight clothing (35.7%). Our findings suggest that vulvovaginitis in prepubertal girls is related not only to microorganisms but also poor personal hygiene, the educational status of mothers, and specific irritants. Copyright © 2015 North American Society for Pediatric and Adolescent Gynecology. Published by Elsevier Inc. All rights reserved.

  11. Dental hygiene habits and oral health status of seafarers. (United States)

    Mahdi, Syed Sarosh; Sibilio, Fabio; Amenta, Francesco


    This study has assessed the dental hygiene habits and problems of seafarers and their attitudes/ perceptions regarding oral hygiene using a dental hygiene/habits questionnaire. A research questionnaire on oral hygiene habits was prepared along with a summary of all the questions and sent to ships via e-mail by Centro Internazionale Radio Medico (CIRM) networks. CIRM, is the Italian Telemedical Maritime Assistance Service (TMAS), and represents the Centre with the largest number of seafarers assisted on board ships worldwide. CIRM proposed the questionnaire to all ships (n = 1,198) asking for medical advice from 1 July 2014 till 31 October 2014. Two dental professionals were involved in the development and analysis of the questionnaire. Seafarers are at risk of several dental health problems due to their oral hygiene and dietary habits, smoking and alcohol consumption, poor oral hygiene knowledge and motivation. Dietary habits during voyages were also questionable and seafarers consume food rich in fermentable carbohydrates, which is a major risk factor for dental caries. Seafarers need better oral hygiene education and care to enable them to manage their oral health in a better way. Life at the sea, under challenging circumstances is not without stress, that is why it is important that seafarers are given complete information about correct oral hygiene protocols and dental hygiene and the advantages for their health of keeping a healthy mouth.

  12. Hygiene Knowledge of Food Staff in Catering Industry


    Hülya Yardımcı; Gülperi Hakli; Funda Pinar Çakiroğlu; Ayşe Özfer Özçelik


    This study, designed as a cross-sectional study, was carried out to determine the hygiene knowledge of the staff (N = 317) employed in kitchen and service departments of catering firms in Ankara. It was found that the mean scores of the staff with regard to personal hygiene, food hygiene, and kitchen and equipment hygiene were 10.7 ± 1.6, 19.8 ± 4.0, and 13.6 ± 2.0, respectively. Male staff achieved higher mean scores ...

  13. A multifaceted hospital-wide intervention increases hand hygiene compliance. (United States)

    Patel, B; Engelbrecht, H; McDonald, H; Morris, V; Smythe, W


    Hand hygiene is an important and basic practice that should be used by all healthcare staff to protect both themselves and their patients against infection. Unfortunately hand hygiene compliance remains poor. To show an improvement in hand hygiene compliance using a multifaceted approach. This was a quasiexperimental pre-post intervention study design with a number of standardised interventions to promote hand hygiene. The World Health Organization hand hygiene multimodal (five-step) intervention approach was used. The study ran from June 2015 to August 2015 in 11 selected wards of a 975-bed tertiary and quaternary care public hospital (Groote Schuur Hospital, Cape Town, South Africa). The outcome was to assess improvement in hand hygiene compliance monthly over the 3 months, compared with non-intervention wards and compared with the wards' own performance measured in 2014. The study included both descriptive and analytical components. Post intervention, hand hygiene compliance showed a statistically significant improvement for before patient contact from 34% in 2014 to 76% in 2015 (p<0.05) and for after patient contact from 47% in 2014 to 82% in 2015 (p<0.05). The intervention improved hand hygiene compliance and can easily be replicated in other wards, resulting in sustaining a culture of hand hygiene improvement and behavioural change throughout the hospital.

  14. Back to basics: hand hygiene and surgical hand antisepsis. (United States)

    Spruce, Lisa


    Health care-associated infections (HAIs) are a significant issue in the United States and throughout the world, but following proper hand hygiene practices is the most effective and least expensive way to prevent HAIs. Hand hygiene is inexpensive and protects patients and health care personnel alike. The four general types of hand hygiene that should be performed in the perioperative environment are washing hands that are visibly soiled, hand hygiene using alcohol-based products, surgical hand scrubs, and surgical hand scrubs using an alcohol-based surgical hand rub product. Barriers to proper hand hygiene may include not thinking about it, forgetting, skin irritation, a lack of role models, or a lack of a safety culture. One strategy for improving hand hygiene practices is monitoring hand hygiene as part of a quality improvement project, but the most important aspect for perioperative team members is to set an example for other team members by following proper hand hygiene practices and reminding each other to perform hand hygiene. Copyright © 2013 AORN, Inc. Published by Elsevier Inc. All rights reserved.

  15. Waldorf School - the Strategy of Education of Mental Hygiene


    HORÁKOVÁ, Marcela


    This thesis deals with the question, what is the strategy of mental hygiene education at the Waldorf school. The aim was to find out how mental hygiene at the Waldorf school is educated and then compare this strategy with the strategy of mental hygiene education at the school of traditional education system. Another aim of this study was to show whether the correct strategy of mental hygiene education in elementary schools has some influence on the development of the child. The research was m...

  16. The State Institute of Radiation Hygiene

    International Nuclear Information System (INIS)



    The history and organisation of Statens Institutt for Straalehygiene (State Institute for Radiation Hygiene) are briefly described. The main tasks in the medical and industrial sectors are outlined, and the laboratory facilities at the Institute are described. The Institute's work load in personnel dosimetry and monitoring, both medical and industrial is presented and the dosimetry methods used are outlined. Finally the textbook published by the Institute (INIS RN 116369,117419, 117829,124801,117418,118223,117385,117389,117387,117388,117386,117391, 117201,117197,117198,117199,117200) is mentioned. (JIW)

  17. Teledosimetry and its application in radiation hygiene

    International Nuclear Information System (INIS)

    Hajek, J.


    The principle and application is dealt with of teledosimetry, a new method of telemetric transfer of data on the flux density of ionizing radiation. A teledosimetric apparatus is described consisting of a transmitter with a halogen GM tube and a receiver with an evaluation device. Two cases of the application of teledosimetry in radiation hygiene practice are reported. The new method makes possible the monitoring of personnel working with radiation, the testing of the efficiency of radiation protection, and a reduction of doses to personnel in the process studied. (author)

  18. Plaque control and oral hygiene methods

    LENUS (Irish Health Repository)

    Harrison, Peter


    The experimental gingivitis study of Löe et al.1 demonstrated a cause and effect relationship between plaque accumulation and gingival inflammation, and helped to establish plaque\\/biofilm as the primary risk factor for gingivitis. When healthy individuals withdrew oral hygiene efforts, gingival inflammation ensued within 21 days in all subjects. Once effective plaque removal was recommenced, clinical gingival health was quickly re-established – indicating that plaque-associated inflammation is modifiable by plaque control. As current consensus confirms that gingivitis and periodontitis may be viewed as a continuum of disease,2 the rationale for achieving effective plaque control is clear.

  19. [Branches of the National Institute of Hygiene]. (United States)

    Gromulska, Marta


    National Epidemiological Institute (National Institute of Hygiene, from 7th September 1923) was established in 1918 in Warsaw and acted at national level. Its actions in the field of diseases combat were supported by bacteriological stations and vaccine production in voivodeship cities, which were taken charge of by the state, and names "National Epidemiological Institutes". According to the ministers resolution from 6th July 1921,Epidemiological Institutes were merged to National Central Epidemiological Institutes (PZH), the epidemiological institutes outside Warsaw were named branches, which were to be located in every voivodeship city, according to the initial organizational resolutions. There were country branches of NCEI in: Cracow, Lwów, Lódź, Toruń, Lublin, and Wilno in the period 1919-1923. New branches in Poznań (1925), Gdynia(1934), Katowice (Voivodeship Institute of Hygiene (1936), Luck (1937), Stanisławów (1937), Kielce(1938), and Brześć/Bug (Municipal Station acting as branch of National Central Epidemiological Institute. Branches were subordinated to NCEI-PZH) in Warsaw where action plans and unified research and diagnostic method were established and annual meeting of the country branches managers took place. All branches cooperated with hospitals, national health services, district general practitioners and administration structure in control of infectious diseases. In 1938, the post of branch inspector was established, the first of whom was Feliks Przesmycki PhD. Branches cooperated also with University of Cracow, University of Lwów and University of Wilno. In 1935, National Institutes of Food Research was incorporated in PZH, Water Department was established, and these areas of activity began to develop in the branches accordingly. In 1938 there were 13 branches of PZH, and each had three divisions: bacteriological, food research and water research. Three branches in Cracow, Kielce and Lublin worked during World War II under German

  20. Urgency of changing paradigms in radiation hygiene

    International Nuclear Information System (INIS)

    Kudritskij, Yu.K.; Karpov, V.I.; Georgievskij, A.B.


    A problem has been raised on the necessity to substitute the linear-nonthreshold hypothesis as a paradigm of radiation hygiene for the hypothesis of the biological effectiveness of ionizing irradiations. A comparison of the methodological substantiation for both hypotheses and a conception of 'acceptable risk' has been carried out. It is suggested that the possibility of theoretical substantiation of safety standards for the radiational factor on the basis of adatational hypothesis be acknowledged instead of the linear - nonthreshold conception which has lost its historic significance

  1. Dental Hygiene Program Directors' Perceptions of Graduate Dental Hygiene Education and Future Faculty Needs. (United States)

    Wilder, Rebecca S.; Mann, Ginger; Tishk, Maxine


    A survey of 161 dental-hygiene-program directors investigated perceived future needs for faculty, preferences for type of faculty degree for selection and promotion, the extent to which master's programs are meeting those needs in both numbers and skills, and how the programs can better prepare graduates for the millennium. (MSE)

  2. Compliance with hand hygiene: reference data from the national hand hygiene campaign in Germany. (United States)

    Wetzker, W; Bunte-Schönberger, K; Walter, J; Pilarski, G; Gastmeier, P; Reichardt, Ch


    Hand hygiene is a key measure to prevent healthcare-associated infection. To promote hand hygiene nationally the German campaign 'Aktion Saubere Hände' was launched in January 2008, based on the World Health Organization's 'Clean Care is Safer Care' initiative. We report the first results from a full year of data collection on hand hygiene compliance recorded with the help of a renewed observation tool. Data were based on submissions from 109 participating hospitals collected from 576 wards between January 1st and December 31st, 2014. The overall median compliance was 73%, ranging from 55% (10th percentile) to 89% (90th percentile). The results demonstrated only small differences between adult and non-adult intensive care units (ICUs) with neonatal ICUs and paediatric non-ICUs maintaining higher compliance than adult care units. Performance among nurses was better than physicians, and overall rates of hand hygiene performance were significantly higher after patient contact than before. Copyright © 2016 The Healthcare Infection Society. Published by Elsevier Ltd. All rights reserved.

  3. An automated hand hygiene training system improves hand hygiene technique but not compliance. (United States)

    Kwok, Yen Lee Angela; Callard, Michelle; McLaws, Mary-Louise


    The hand hygiene technique that the World Health Organization recommends for cleansing hands with soap and water or alcohol-based handrub consists of 7 poses. We used an automated training system to improve clinicians' hand hygiene technique and test whether this affected hospitalwide hand hygiene compliance. Seven hundred eighty-nine medical and nursing staff volunteered to participate in a self-directed training session using the automated training system. The proportion of successful first attempts was reported for each of the 7 poses. Hand hygiene compliance was collected according to the national requirement and rates for 2011-2014 were used to determine the effect of the training system on compliance. The highest pass rate was for pose 1 (palm to palm) at 77% (606 out of 789), whereas pose 6 (clean thumbs) had the lowest pass rate at 27% (216 out of 789). One hundred volunteers provided feedback to 8 items related to satisfaction with the automated training system and most (86%) expressed a high degree of satisfaction and all reported that this method was time-efficient. There was no significant change in compliance rates after the introduction of the automated training system. Observed compliance during the posttraining period declined but increased to 82% in response to other strategies. Technology for training clinicians in the 7 poses played an important education role but did not affect compliance rates. Crown Copyright © 2015. Published by Elsevier Inc. All rights reserved.

  4. [Guidelines for hygienic classification of learning technologies]. (United States)

    Kuchma, V R; Teksheva, L M; Milushkina, O Iu


    Optimization of the educational environment under the present-day conditions has been in progress, by using learning techwares (LTW) without fail. To organize and regulate an academic process in terms of the safety of applied LTW, there is a need for their classification. The currently existing attempts to structure LTW disregard hygienically significant aspects. The task of the present study was to substantiate a LTW safety criterion ensuring a universal approach to working out regulations. This criterion may be the exposure intensity determined by the form of organization of education and its pattern, by the procedure of information presentation, and the age-related peculiarities of a pupil, i.e. by the actual load that is presented by the product of the intensity exposure and its time. The hygienic classification of LTW may be used to evaluate their negative effect in an educational process on the health status of children and adolescents, to regulate hazardous factors and training modes, to design and introduce new learning complexes. The structuring of a LTW system allows one to define possible deleterious actions and the possibilities of preventing this action on the basis of strictly established regulations.

  5. Hand hygiene compliance rates: Fact or fiction? (United States)

    McLaws, Mary-Louise; Kwok, Yen Lee Angela


    The mandatory national hand hygiene program requires Australian public hospitals to use direct human auditing to establish compliance rates. To establish the magnitude of the Hawthorne effect, we compared direct human audit rates with concurrent automated surveillance rates. A large tertiary Australian teaching hospital previously trialed automated surveillance while simultaneously performing mandatory human audits for 20 minutes daily on a medical and a surgical ward. Subtracting automated surveillance rates from human audit rates provided differences in percentage points (PPs) for each of the 3 quarterly reporting periods for 2014 and 2015. Direct human audit rates for the medical ward were inflated by an average of 55 PPs in 2014 and 64 PPs in 2015, 2.8-3.1 times higher than automated surveillance rates. The rates for the surgical ward were inflated by an average of 32 PPs in 2014 and 31 PPs in 2015, 1.6 times higher than automated surveillance rates. Over the 6 mandatory reporting quarters, human audits collected an average of 255 opportunities, whereas automation collected 578 times more data, averaging 147,308 opportunities per quarter. The magnitude of the Hawthorne effect on direct human auditing was not trivial and produced highly inflated compliance rates. Mandatory compliance necessitates accuracy that only automated surveillance can achieve, whereas daily hand hygiene ambassadors or reminder technology could harness clinicians' ability to hyperrespond to produce habitual compliance. Crown Copyright © 2018. Published by Elsevier Inc. All rights reserved.

  6. Milk hygiene in small ruminants: A review

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalo, C.


    Somatic cell count (SCC), mammary pathogens prevalence, total and specific bacterial counts, antimicrobial residues, macroscopic sediment, water addition, aflatoxins and other contaminants constitute the basis for milk payment-schemes, monitoring and improvement of flock hygiene and health management, and development of analytical surveillance programs in the dairy small ruminants. The present work reviews factors influencing the variation of these variables, including milk analytical methods, storage and preservation, along with management implications during the last two decades. Following farmer and cooperative educational programs, progressive reductions have been reported for total bacterial count and antimicrobial residue occurrence in bulk tank milk. These results were consistent, however, with high values for SCC and specific bacterial populations. Thus, mastitis control programs should be intensified to increase hygiene in milk and economic returns for producers and processors. In addition, the implementation of programs to reduce specific bacterial counts (i.e., psychrotrophs, coliforms, Clostridium spp. spores) and mammary pathogen prevalence (i.e., Staph. aureus, Mycoplasma spp.), as well as the use of combined screening methods for an increased rate of antimicrobial detection, are currently required strategies which are positively valuated by milk processors, industry and consumers. Other contaminants may also be present, but cost-effective screening and analytical systems have not yet been implemented. This review aims to be helpful for troubleshooting milk quality and safety, developing future premium payment systems and industry quality-standards, optimizing management, on-farm risk traceability systems and consumer acceptance.

  7. Milk hygiene in small ruminants: A review

    International Nuclear Information System (INIS)

    Gonzalo, C.


    Somatic cell count (SCC), mammary pathogens prevalence, total and specific bacterial counts, antimicrobial residues, macroscopic sediment, water addition, aflatoxins and other contaminants constitute the basis for milk payment-schemes, monitoring and improvement of flock hygiene and health management, and development of analytical surveillance programs in the dairy small ruminants. The present work reviews factors influencing the variation of these variables, including milk analytical methods, storage and preservation, along with management implications during the last two decades. Following farmer and cooperative educational programs, progressive reductions have been reported for total bacterial count and antimicrobial residue occurrence in bulk tank milk. These results were consistent, however, with high values for SCC and specific bacterial populations. Thus, mastitis control programs should be intensified to increase hygiene in milk and economic returns for producers and processors. In addition, the implementation of programs to reduce specific bacterial counts (i.e., psychrotrophs, coliforms, Clostridium spp. spores) and mammary pathogen prevalence (i.e., Staph. aureus, Mycoplasma spp.), as well as the use of combined screening methods for an increased rate of antimicrobial detection, are currently required strategies which are positively valuated by milk processors, industry and consumers. Other contaminants may also be present, but cost-effective screening and analytical systems have not yet been implemented. This review aims to be helpful for troubleshooting milk quality and safety, developing future premium payment systems and industry quality-standards, optimizing management, on-farm risk traceability systems and consumer acceptance.

  8. an assessment of the hygiene level in animal product processing

    African Journals Online (AJOL)


    Keywords: Hygiene, animal product processing plants, checklists ... Changing lifestyles have brought new demands on the food industry; the ... Inspection is an aspect that needs to be revamped to ensure hygienic ... processing can affect a large number of people. .... trolled and equipment well designed; basic system.

  9. Dental Hygiene Curriculum Model for Transition to Future Roles. (United States)

    Paarmann, Carlene S.; And Others


    The establishment of the baccalaureate degree as the minimum entry level for dental hygiene practice centers around three main concerns: changes in health care delivery, awarding of a degree commensurate with students' educational background, and the credibility of dental hygiene as a profession. A curriculum model is discussed. (MLW)

  10. Requirements and Guidelines for Dental Hygiene Education Programs. (United States)

    American Dental Association, Chicago, IL. Council on Dental Education.

    The purpose of this report is to serve as a guide for dental hygiene education program development, and to serve as a stimulus for improving established programs. The first section of the report discusses the function of the Council on Dental Education and the trends in hygiene program development. In section II the requirements for an accredited…

  11. Use of Case-Based Learning in Dental Hygiene Curricula. (United States)

    Vaughan, Dina Agnone; DeBiase, Christina B.; Gibson-Howell, Joan C.


    A survey investigated the extent of use of case-based learning in 141 dental hygiene programs. A majority of responding schools use the approach, most frequently in clinical dental hygiene, community dental health, and dental science courses. Proportion of instructional time was greatest in the content areas of special needs, ethics, medical…

  12. The Effect of Recent Trends on Dental Hygiene. (United States)

    Douglass, Chester W.


    Six trends affecting dental hygiene practice are discussed: demographic changes; disease pattern changes; higher societal expectations; financing and delivery system changes; technological advancement; and regulatory and legislative trends. It is argued that, though the trends reflect positively on dental hygiene, practitioners need to increase…

  13. Changes in Generic and Degree Completion Dental Hygiene Student Characteristics. (United States)

    Carr, Sandra; Rubinstein, Linda


    A study compared the characteristics of dental hygiene students in two programs (bachelor's degree and two-year professional dental hygiene training) in 1978 and 1987 to assess changes over time. Results are presented and the implications for enrollment management are discussed. (MSE)

  14. Maintenance of an Adequate Dental Hygiene Education System. (United States)

    Ley, Eugene; And Others


    Administrative decisions about the future of dental hygiene programs are often based on inadequate information about employment trends and about the importance of the dental hygienist in dental practices. Studies indicate that demand for dental hygiene services will remain high in the 1980s. (Author/MLW)

  15. Efficiency of Motivation Development Models for Hygienic Skills

    Directory of Open Access Journals (Sweden)

    Alexander V. Tscymbalystov


    Full Text Available The combined influence of a family and a state plays an important role in the development of an individual. This study is aimed at the model effectiveness evaluation concerning the development of oral hygiene skills among children living in families (n = 218 and being under the care of a state (n = 229. The groups were created among the children who took part in the study: the preschoolers of 5-7 years, schoolchildren of 8-11 years and adolescents of 12-15 years. During the initial examination, the hygienic status of the oral cavity before and after tooth brushing was evaluated. After that, subgroups were formed in each age group according to three models of hygienic skills training: 1 computer presentation lesson; 2 one of the students acted as a demonstrator of the skill; 3 an individual training by a hygienist. During the next 48 hours children did not take hygienic measures. Then the children were invited for a control session to demonstrate the acquired skills of oral care and evaluate the effectiveness of a model developing the skills of individual oral hygiene. During the control examination, the hygienic status was determined before and after the tooth cleaning, which allowed to determine the regimes of hygienic measure performance for children with different social status and the effectiveness of hygiene training models.

  16. Denture hygiene knowledge and practice amongst patients in a ...

    African Journals Online (AJOL)

    Aim: To assess patients' knowledge on denture hygiene and the hygiene methods used for cleaning removable partial dentures. Methods: This was a ... Other information obtained were the duration of denture use, frequency of denture cleaning and type of material used for denture cleaning. Results: The age of the ...

  17. 9. School of radiation sterilization and hygienization - Lectures

    International Nuclear Information System (INIS)

    Zimek, Z.; Kaluska, I.; Gluszewski, W.


    During the 9 School of radiation sterilization and hygienization 23 lectures were presented. They were devoted to all aspects of sterilization and hygienization of food, medicinal articles and cosmetics using the ionisation radiation. It was destined to physicians, manufacturers and vendees of spices, pharmaceuticals and cosmetics, personnel of the sanitary-epidemiological stations and even for the art conservators

  18. A multifaceted hospital-wide intervention increases hand hygiene ...

    African Journals Online (AJOL)

    Hospital-acquired infections remain a global concern, with prevalence .... precautionary measures such as hand washing. A baseline audit in. 2014 on hand hygiene at GSH reflected an average performance of. 34% for the hospital. ..... hand hygiene intervention based on WHO and continuous improvement methodology.

  19. Knowledge, attitude towards and practice of oral hygiene among ...

    African Journals Online (AJOL)

    Introduction: Oral hygiene involves the prevention of oral diseases which have been found to be common in pregnancy. Dental care in pregnancy aims at achieving healthy oral environment. This study assessed the knowledge, attitude towards and practice of oral hygiene among antenatal clinic attendees in public ...

  20. Teaching Oral Hygiene Skills to Elementary Students with Visual Impairments (United States)

    Shih, Yeng-Hung; Chang, Chien-Huey Sophie


    This study investigated the effects of a program that taught oral hygiene skills to students with visual impairments using group instruction and individual coaching. The results showed that the program enhanced the oral hygiene skills of the three participants significantly, and its effectiveness lasted for at least two months after the…

  1. Oral hygiene profile of inmates in a correctional home | Braimoh ...

    African Journals Online (AJOL)

    Background: Prisoners are a vulnerable and socially deprived group requiring dental care intervention. They are often neglected with little or no access to health care and poor oral hygiene may be an additional burden. Objectives: To assess the oral hygiene status of prison inmates and investigate its relationship to ...

  2. Hand Hygiene Saves Lives: Patient Admission Video (Short Version)

    Centers for Disease Control (CDC) Podcasts

    This podcast is for hospital patients and visitors. It emphasizes two key points to help prevent infections: the importance of practicing hand hygiene while in the hospital, and that it's appropriate to ask or remind healthcare providers to practice hand hygiene.

  3. 10 CFR 850.27 - Hygiene facilities and practices. (United States)


    ... 10 Energy 4 2010-01-01 2010-01-01 false Hygiene facilities and practices. 850.27 Section 850.27 Energy DEPARTMENT OF ENERGY CHRONIC BERYLLIUM DISEASE PREVENTION PROGRAM Specific Program Requirements § 850.27 Hygiene facilities and practices. (a) General. The responsible employer must assure that in...

  4. 7 CFR 56.77 - Health and hygiene of personnel. (United States)


    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Health and hygiene of personnel. 56.77 Section 56.77 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards... EGGS Grading of Shell Eggs Facility Requirements § 56.77 Health and hygiene of personnel. (a) No person...

  5. The History of the Rhodes State College Dental Hygiene Program (United States)

    Bowers, Denise E.


    The historiography of the Rhodes State College Dental Hygiene Program (Program) presents a historical journey of health care, as it relates to oral health, in the United States, in Ohio, and in Lima. This study bridges the gap between the history of higher education and the history of an academic program, dental hygiene. Prior to this study, there…

  6. 9 CFR 590.560 - Health and hygiene of personnel. (United States)


    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Health and hygiene of personnel. 590.560 Section 590.560 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF..., Processing, and Facility Requirements § 590.560 Health and hygiene of personnel. (a) Personnel facilities...


    DEFF Research Database (Denmark)

    Quitzau, Maj-Britt; Røpke, Inge


    Western bathroom standards, which have long been dominated by ideas of hygiene, seem to be in the process of change. Whereas transformations of kitchens have been well studied, little attention has been directed towards the contemporary development of bathrooms. This article provides a case study....... In particular, the notion of well-being is highlighted as challenging existing hygiene ideas....

  8. Quality approach in hygiene in a nuclear medicine service

    International Nuclear Information System (INIS)

    Plogin, J.


    The activities of nuclear medicine, by their constraints of radiation protection, present difficulties for rules of hygiene protocols. Considering the particular risks of certain techniques, the approach brings to the fore the compromise between radiation protection and hygiene and to adapt the recommendations to local specificities. (N.C.)

  9. The dangers of dirt : household hygiene and health

    NARCIS (Netherlands)

    Curtis, V.


    Encouraging changes in hygiene practices are potentially one of the mosteffective means of reducing the global impact of diarrhoeal diseases, whichkill an estimated 3.3 million children a year. However, efforts to improve hygiene in the developing world have met with limited success. Some

  10. Personal hygienic concerns in long term space flight (United States)


    Data from numerous experiments and hardware inventories were scanned for Skylab personal hygiene use. A computer program was formulated for predicting the degree of man's involvement with personal hygiene needs. A tabulation was kept for such events as water intake, frequency of urination and defecation, accidents or events requiring clean-up, methods of clean-up, microbiological environment and shower water contamination.

  11. Outcomes of dental hygiene baccalaureate degree education in Canada. (United States)

    Kanji, Zul; Sunell, Susanne; Boschma, Geertje; Imai, Pauline; Craig, Bonnie J


    There is little published literature about the outcomes of dental hygiene baccalaureate degree education, particularly in Canada. Since there are various dental hygiene entry-to-practice educational models in Canada, exploring baccalaureate dental hygiene education is becoming an increasingly important subject. The purpose of this study was to explore the personal outcomes and dental hygiene practice outcomes of dental hygiene degree-completion education in Canada from the perspectives of diploma dental hygienists who have continued their education to the bachelor's degree level. This study employed a qualitative phenomenological design, using a maximum variation purposeful sampling strategy. Data generation occurred with sixteen dental hygienists across Canada through individual semistructured interviews. Interviews were audiorecorded, transcribed verbatim, and coded for data analysis, involving pattern recognition and thematic development. Themes that emerged included changes in self-perception, values, and knowledge base. Changes in self-perception were reflected in a reported increase in self-confidence and perceived credibility. Changes in values included a greater appreciation for lifelong learning. Advancements in knowledge strengthened the development of specific abilities that ultimately influenced participants' dental hygiene practice. These abilities included an increased ability to think critically, to make evidence-based decisions, and to provide more comprehensive care. Participants also commented on having more career opportunities available to them outside of the private clinical practice setting. These results reveal important insights into the impact of earning a dental hygiene baccalaureate degree on oneself and one's dental hygiene practice.

  12. Improving Adherence to Hand Hygiene among Health Care Workers (United States)

    Maskerine, Courtney; Loeb, Mark


    Increased adherence to hand hygiene is widely acknowledged to be the most important way of reducing infections in health care facilities. Despite evidence of benefit, adherence to hand hygiene among health care professionals remains low. Several behavioral and organizational theories have been proposed to explain this. As a whole, the success of…

  13. Measuring hand hygiene compliance rates at hospital entrances. (United States)

    Vaidotas, Marina; Yokota, Paula Kiyomi Onaga; Marra, Alexandre R; Camargo, Thiago Zinsly Sampaio; Victor, Elivane da Silva; Gysi, Deisy Morselli; Leal, Flavio; Santos, Oscar Fernando Pavão dos; Edmond, Michael B


    Despite the importance of hand hygiene in the health care setting, there are no studies evaluating hand hygiene compliance at hospital entrances. The study was prospectively performed over a 33-week period from March 30, 2014-November 15, 2014, to evaluate hand hygiene compliance in 2 hospital reception areas. We compared electronic handwash counters with the application of radiofrequency identification (GOJO SMARTLINK) (electronic observer) that counts each activation of alcohol gel dispensers to direct observation (human observer) via remote review of video surveillance. We found low hand hygiene compliance rates of 2.2% (99/4,412) and 1.7% (140/8,277), respectively, at reception areas A and D, detected by direct observation. Using the electronic observer, we measured rates of 17% (15,624/91,724) and 7.1% (51,605/730,357) at reception areas A and D, respectively. For the overall time period of simultaneous electronic and human observation, the human observer captured 1% of the hand hygiene episodes detected by the electronic observer. Our study showed very low hand hygiene compliance in hospital reception areas, and we found an electronic hand hygiene system to be a useful method to monitor hand hygiene compliance. Copyright © 2015 Association for Professionals in Infection Control and Epidemiology, Inc. Published by Elsevier Inc. All rights reserved.

  14. Are hospitals too clean to trigger good hand hygiene?

    NARCIS (Netherlands)

    Vegt, D.S. van der; Voss, A.


    Compliance with hand hygiene in the healthcare setting is generally low. The aim of the present study was to investigate the degree of compliance with hand hygiene after toilet visits inside and outside the hospital. We observed hospital/laboratory staff, participants of the European Congress of

  15. Hand hygiene practices among community Health Officers in Rivers ...

    African Journals Online (AJOL)

    Background: Health care associated infections are most commonly transmitted by the hands of Health care workers and other hospital personnel. Objective: To investigate compliance with hand hygiene guidelines and methods of hand hygiene practice among community health officers in Rivers State Nigeria. Methods: Self ...

  16. Occupational Safety. Hygiene Safety. Pre-Apprenticeship Phase 1 Training. (United States)

    Lane Community Coll., Eugene, OR.

    This self-paced student training module on hygiene safety is one of a number of modules developed for Pre-apprenticeship Phase 1 Training. Purpose of the module is to familiarize students with the different types of airborne contaminants--including noise--which may be health hazards and with the proper hygienic measures for dealing with them. The…

  17. 9. School of radiation sterilization and hygienization - Presentations

    International Nuclear Information System (INIS)

    Zimek, Z.; Kaluska, I.; Gluszewski, W.


    During the 9. School of radiation sterilization and hygienization 23 lectures were presented. They were devoted to all aspects of sterilization and hygienization of food, medicinal articles and cosmetics using the ionisation radiation. It was destined to physicians, manufacturers and vendees of spices, pharmaceuticals and cosmetics, personnel of the sanitary-epidemiological stations and even for the art conservators

  18. Environmental Control Plan for the Industrial Hygiene Field Services Facility

    International Nuclear Information System (INIS)

    Donnelly, J.W.


    This environmental control plan is for the Hanford Site's Industrial Hygiene Field Services Facility, located in the 100-N Area. This facility is used for the maintenance and storage of respirators, respiratory equipment and testing, calibration and testing of industrial hygiene equipment, and asbestos fiber counting

  19. Personal Hygiene Practices among Urban Homeless Persons in Boston, MA. (United States)

    Leibler, Jessica H; Nguyen, Daniel D; León, Casey; Gaeta, Jessie M; Perez, Debora


    Persons experiencing homelessness in the United States experience significant barriers to self-care and personal hygiene, including limited access to clean showers, laundry and hand washing facilities. While the obstacles to personal hygiene associated with homelessness may increase risk of infectious disease, hygiene-related behaviors among people experiencing homelessness has received limited attention. We conducted a cross-sectional study of individuals experiencing homelessness in Boston, MA ( n = 194) to identify hygiene-related self-care practices and risk factors for reduced hygiene in this population. Most participants (72%) reported taking a daily shower. More than 60% reported hand washing with soap five or more times each day, and use of hand sanitizer was widespread (89% reported using sanitizer in the last week). A majority (86%) used a laundromat or laundry machine to wash clothing, while 14% reported washing clothing in the sink. Heavy drinking, injection drug use, and sleeping outdoors were identified as significant risk factors for reduced hygiene practices. People experiencing homelessness who also engage in these activities may be among the most difficult to reach for intervention, yet targeted efforts may decrease illness risk associated with reduced hygiene. Housed friends and family play a critical role in assisting homeless individuals maintain hygiene by providing showers and laundry facilities.

  20. FOOD safety and hygiene - Systematic layout planning of food processes

    NARCIS (Netherlands)

    Van Donk, DP; Gaalman, G


    Hygiene and food safety have been dealt with from different fields of science such as biology and health, and from different angles such as HACCP and GMP. Little systematically ordered knowledge is available for the analysis of a layout, taking hygienic factors into account. HACCP and GMP are

  1. Determinants of good oral hygiene among pregnant women in ...

    African Journals Online (AJOL)

    Abstract. Background and objectives: The need to attain and maintain good oral hygiene among pregnant women cannot be over emphasized as periodontal diseases in pregnancy have been linked with poor pregnancy outcomes. This study assessed the variables that affect oral hygiene status among pregnant women in ...

  2. A multifaceted hospital-wide intervention increases hand hygiene ...

    African Journals Online (AJOL)

    A multifaceted hospital-wide intervention increases hand hygiene compliance. B Patel, H Engelbrecht, H McDonald, V Morris, W Smythe. Abstract. Background. Hand hygiene is an important and basic practice that should be used by all healthcare staff to protect both themselves and their patients against infection.

  3. Cleanliness in context: reconciling hygiene with a modern microbial perspective. (United States)

    Vandegrift, Roo; Bateman, Ashley C; Siemens, Kyla N; Nguyen, May; Wilson, Hannah E; Green, Jessica L; Van Den Wymelenberg, Kevin G; Hickey, Roxana J


    The concept of hygiene is rooted in the relationship between cleanliness and the maintenance of good health. Since the widespread acceptance of the germ theory of disease, hygiene has become increasingly conflated with sterilization. In reviewing studies across the hygiene literature (most often hand hygiene), we found that nearly all studies of hand hygiene utilize bulk reduction in bacterial load as a proxy for reduced transmission of pathogenic organisms. This treatment of hygiene may be insufficient in light of recent microbial ecology research, which has demonstrated that humans have intimate and evolutionarily significant relationships with a diverse assemblage of microorganisms (our microbiota). The human skin is home to a diverse and specific community of microorganisms, which include members that exist across the ecological spectrum from pathogen through commensal to mutualist. Most evidence suggests that the skin microbiota is likely of direct benefit to the host and only rarely exhibits pathogenicity. This complex ecological context suggests that the conception of hygiene as a unilateral reduction or removal of microbes has outlived its usefulness. As such, we suggest the explicit definition of hygiene as "those actions and practices that reduce the spread or transmission of pathogenic microorganisms, and thus reduce the incidence of disease."

  4. Teaching minority children hygiene: investigating hygiene education in kindergartens and homes of ethnic minority children in northern Vietnam. (United States)

    Rheinländer, Thilde; Samuelsen, Helle; Dalsgaard, Anders; Konradsen, Flemming


    Ethnic minority children in Vietnam experience high levels of hygiene- and sanitation-related diseases. Improving hygiene for minority children is therefore vital for improving child health. The study objective was to investigate how kindergarten and home environments influence the learning of hygiene of pre-school ethnic minority children in rural Vietnam. Eight months of ethnographic field studies were conducted among four ethnic minority groups living in highland and lowland communities in northern Vietnam. Data included participant observation in four kindergartens and 20 homes of pre-school children, together with 67 semi-structured interviews with caregivers and five kindergarten staff. Thematic analysis was applied and concepts of social learning provided inputs to the analysis. This study showed that poor living conditions with lack of basic sanitation infrastructures were important barriers for the implementation of safe home child hygiene. Furthermore, the everyday life of highland villages, with parents working away from the households resulted in little daily adult supervision of safe child hygiene practices. While kindergartens were identified as potentially important institutions for improving child hygiene education, essential and well-functioning hygiene infrastructures were lacking. Also, hygiene teaching relied on theoretical and non-practice-based learning styles, which did not facilitate hygiene behaviour change in small children. Minority children were further disadvantaged as teaching was only provided in non-minority language. Kindergartens can be important institutions for the promotion of safe hygiene practices among children, but they must invest in the maintenance of hygiene and sanitation infrastructures and adopt a strong practice-based teaching approach in daily work and in teacher's education. To support highland minority children in particular, teaching styles must take local living conditions and caregiver structures into account

  5. [Personal hygiene and cleanliness in an international comparison]. (United States)

    Bergler, R


    The investigation was intended to analyse the attitude towards hygiene and cleanliness in the Federal Republic of Germany, France, and Spain. On the basis of a theoretical explanatory model and empirically gained qualitative raw data a standardized questionnaire was prepared; in a number of questions comparability with a study carried out in the Federal Republic of Germany in 1968 was ensured. In all countries the population was subjected to representative random tests (Federal Republic of Germany n = 1016; France n = 517; Spain n = 514). The paper presents a review of the hypothesis that quality and intensity of the cleanliness increases with (1) the extent of personal sensitivity to hygiene in the private, professional and public sphere, (2) with increasing physical sensibility, (3) the increase in our knowledge of hygiene and health, (4) with the increase in the personal behavioral standards for measures concerned with prevention, hygiene of the body, household, underwear and environment, (5) with the increasing weight given to hygiene and toilet during the process of development, and (6) with the extent of regular control of education in cleanliness based on established rules of behavior. The spheres of behavior investigated and mentioned below confirmed the validity of the hypothesis for (1) household hygiene (spring-cleaning, window cleaning, cleaning of the home: dusting, vacuum-cleaning, cleaning of the floor), (2) hygiene of the body (frequency of taking a shower, bathing, toothbrushing, intimate hygiene), (3) hygiene of the laundry (frequency of changing underclothes such as panties/underpants, brassieres, nightgowns/pyjamas, stockings/socks, linen, pillows, dish and kitchen towels). The following general findings were established: (1) In the Federal Republic of Germany the attitude towards hygiene and cleanliness has improved over the last 20 years. (2) The level of hygiene and cleanliness in France and Spain is significantly higher than in the FRG. (3

  6. Association between oral and general hygiene behaviours among Iranian adolescents. (United States)

    Ghanbariha, Maryam; Sheiham, Aubrey; Rakhshani, Fatemeh; Dorri, Mojtaba


    To assess the association between oral and general hygiene behaviours in 12-year-old Iranians and the impact of sociodemographic and educational factors on the association. A representative random sample of 550 12-year-old Iranian adolescents from two deprived tribes answered a 41-item questionnaire on sociodemographic background, education and oral and general hygiene behaviours. The association between tooth cleaning frequency and other study outcome variables were tested using binary logistic regression. The sex differences in the study outcome variables were investigated using chi-square and Mann-Whitney tests. The frequency of tooth cleaning was significantly associated with a general hygiene behaviour: frequency of taking a bath (OR 0.5; 95% CI: 0.3, 0.7). This association remained significant when sociodemographic factors and educational factors were added to the model both separately (P Oral and a general hygiene behaviour were strongly associated. Oral, general and environmental hygiene programmes should use integrated approaches.

  7. Understanding the Determinants of Australian Hospital Nurses' Hand Hygiene Decisions Following the Implementation of a National Hand Hygiene Initiative (United States)

    White, Katherine M.; Starfelt, Louise C.; Jimmieson, Nerina L.; Campbell, Megan; Graves, Nicholas; Barnett, Adrian G.; Cockshaw, Wendell; Gee, Phillip; Page, Katie; Martin, Elizabeth; Brain, David; Paterson, David


    Hand hygiene is the primary measure in hospitals to reduce the spread of infections, with nurses experiencing the greatest frequency of patient contact. The "5 critical moments" of hand hygiene initiative has been implemented in hospitals across Australia, accompanied by awareness-raising, staff training and auditing. The aim of this…

  8. The impact of the Hand Hygiene New Zealand programme on hand hygiene practices in New Zealand's public hospitals. (United States)

    Freeman, Joshua; Dawson, Louise; Jowitt, Deborah; White, Margo; Callard, Hayley; Sieczkowski, Christine; Kuriyan, Ron; Roberts, Sally


    To detail the progress made by Hand Hygiene New Zealand (HHNZ) since 2011 and also describe the challenges experienced along the way and the factors required for delivery of a successful hand hygiene programme at a national level. HHNZ is a multimodal culture-change programme based on the WHO '5 moments for hand hygiene' approach. The key components of the programme include clinical leadership, auditing of hand hygiene compliance with thrice yearly reporting of improvement in hand hygiene practice, biannual reporting of the outcome marker, healthcare-associated Staphylococcus aureus bacteraemia (HA-SAB), effective communication with key stakeholders and the use of the front-line ownership (FLO) principles for quality improvement. The nationally aggregated hand hygiene compliance has increased from 62% in June 2012 to 81% in March 2016. There has been improvement across all 'moments', all healthcare worker groups and a range of different clinical specialties. The rate of HA-SAB has remained stable. The HHNZ programme has led to significant improvements in hand hygiene practice in DHBs throughout New Zealand. The principles of FLO are now widely used to drive hand hygiene improvement in New Zealand DHBs.

  9. Quality approach in hygiene in a nuclear medicine service; Demarche qualite en hygiene dans un service de medecine nucleaire

    Energy Technology Data Exchange (ETDEWEB)

    Plogin, J


    The activities of nuclear medicine, by their constraints of radiation protection, present difficulties for rules of hygiene protocols. Considering the particular risks of certain techniques, the approach brings to the fore the compromise between radiation protection and hygiene and to adapt the recommendations to local specificities. (N.C.)


    Directory of Open Access Journals (Sweden)

    R. Adam


    Full Text Available Children’s skin under nappy needs special defense from irritative action of urine and faeces and, therefore, prophylaxis of nappy dermatitis is necessary. It means that disposable nappy absorbing faeces and urine and special staff for skin cleaning should be used. There are several factors conductive to dermatitis: prolonged irritation with excrements, change of skin pH or increase of its hydratation and disorders of skin micro flora. During last decades there is a significant progress in understanding of these factors, and it resulted in production of more and more perfect stuff for defense of children’s skin. Improved design of nappies and development of pH-buffer wipes for babies increased the quality of skin care. Key words: children, skin, hygienic care.(Voprosy sovremennoi pediatrii — Current Pediatrics. 2010;9(5:90-94

  11. Radiation hygienization of raw sewage sludge

    International Nuclear Information System (INIS)

    Shah, M.R.; Lavale, D.S.; Rawat, P.; Benny, P.G.; Sharma, A.K.; Dey, G.R.; Bhave, V.


    'Radiation treatment of municipal sewage sludge can achieve resource conservation and recovery objectives. The liquid sludge irradiator of Sludge Hygienization Research Irradiator at Baroda (India) was operated for generating data on treatment of raw sludge containing 3-4 % solids. The plant system was modified for irradiating raw sludge without affecting basic irradiator initially designed to treat digested sludge. Hourly samples were analysed for estimation of disinfection dose requirement. Sand separated from the sludge was used as in-situ dosimeter by making use of its thermoluminescence property. Investigations are being carried out for regrowth of Total Coliforms in the sludge samples from this irradiator. Possibility of inadequate treatment due to geometric configuration of irradiator is being checked. (author)

  12. Assessing outcomes of industrial hygiene graduate education. (United States)

    Brosseau, Lisa; Fredrickson, Ann


    To ensure that industrial hygiene professionals continue to be prepared for current and future trends, it is important to regularly assess the value of their education. Described here are the results of discussions with employers and a mailed survey of graduates. Comparisons are made with past mailed surveys of both groups. Two sets of discussions were held in late 2005 with employers of industrial hygienists and other health and safety professionals. Twenty-eight participants were asked to discuss current and future needs for professionals in their organization and economic sector, their expectations for knowledge and skills when hiring professionals, methods for finding and hiring, and the importance of ABET accreditation. At the same time, a survey was mailed to 71 industrial hygiene students graduating in the last 15 years. Respondents were asked to rank the value of and their proficiency in 42 competencies. Questions also assessed employment experience, certification, the importance of ABET accreditation, and demographic characteristics. There was a lot of agreement between the two stakeholder groups (employers and graduates) about the most important skill and knowledge areas. Most employers identified communicating effectively and exposure assessment among the most important skills, with designing and initiating research as among the least. Hazard recognition, exposure measurement principles, and personal protective equipment were the most highly ranked knowledge areas. Employers discussed the need for good "business skills" such as teamwork, communication, and project management, and the importance of problem-solving skills. Graduates reported that skills in the areas of recognition, evaluation, and control were most valuable in their first jobs and generally reported high levels of proficiency in these skill areas. There was a similar dichotomy in opinions about accreditation within each stakeholder group. The reputation of the academic program was

  13. Educational technology for millennial dental hygiene students: a survey of U.S. dental hygiene programs. (United States)

    Beebe, Catherine R R; Gurenlian, JoAnn R; Rogo, Ellen J


    A growing body of literature suggests that today's learners have changed and education must change as well since Millennial generation students expect technology to be used in their coursework. This study sought to determine what educational technology is being used in U.S. dental hygiene programs, what student and faculty perceptions are of the effectiveness of technology, and what barriers exist to implementing educational technology. A stratified random sample of 120 entry-level dental hygiene programs nationwide were invited to participate in a survey. Fourteen programs participated, yielding a pool of 415 potential individual participants; out of those, eighty-four student and thirty-eight faculty respondents were included in the analysis, a total of 122. Results were analyzed using descriptive statistics and a Mann-Whitney U test (peducational technology in all areas except clickers and wikis. The faculty members tended to rate the effectiveness of educational technology higher than did the students. The greatest perceived barrier to implementing technology was technical difficulties. This study suggests that support services should be available to faculty and students to ensure successful implementation of technology. Dental hygiene educators have adopted many types of educational technology, but more data are needed to determine best practices.

  14. Factors influencing knowledge and practice of hygiene in Water, Sanitation and Hygiene (WASH) programme areas of Bangladesh Rural Advancement Committee. (United States)

    Akter, Tahera; Ali, Armm Mehrab


    Improved hygiene is one of the most effective means of reducing disease occurrence. However, a complete understanding of the factors that contribute to such improvement are not clear. This study explored factors that facilitate and/or impede hygiene behavior in water, sanitation and hygiene (WASH) intervention areas using qualitative research techniques. The Bangladesh Rural Advancement Committee (BRAC) has been providing WASH intervention to 150 rural upazilas (sub-districts) since 2006. For qualitative data collection, in-depth interviews were conducted with 144 purposively selected women from six upazilas across Bangladesh. A woman in the household was considered as a case and interviewed regarding various aspects of sanitation and hygiene, using a checklist. Some practices, such as cleanliness of latrines, and availability of soap, water, slippers in their designated place were physically verified. The respondents' hygiene behavior was mainly facilitated by improved knowledge and awareness of health and environment-related issues. Latrine ownership increased through financial assistance, resulting in improved privacy, social prestige, and a heightened sense of responsibility towards maintaining a healthy life. However, lack of interest in attending cluster meetings, traditional knowledge, poverty, and lack of will were some of the factors impeding knowledge and hygiene practice. In addition, attitude played a definitive role, with some respondents not practicing hygiene in spite of having the financial ability to do so. They expected full financial support for creating sanitation and hygiene facilities in their household despite BRAC's policy of providing such support only to the 'ultra-poor'. The identified impeding factors often act as barriers to transformation of hygiene-related knowledge into practice and practice into habit. More motivational cluster meetings with large-scale participation and periodic home visits by the programme organizers are

  15. Marketing the dental hygiene program. A public relations approach. (United States)

    Nielsen, C


    Since 1980 there has been a decline in dental hygiene enrollment and graduates. Marketing dental hygiene programs, a recognized component of organizational survival, is necessary to meet societal demands for dental hygiene care now and in the future. The purpose of this article is to examine theories on the marketing of education and to describe a systematic approach to marketing dental hygiene education. Upon examination of these theories, the importance of analysis, planning, implementation, and evaluation/control of a marketing program is found to be essential. Application of the four p's of marketing--product/service, price, place, and promotion--is necessary to achieve marketing's goals and objectives and ultimately the program's mission and goals. Moreover, projecting a quality image of the dental hygiene program and the profession of dental hygiene must be included in the overall marketing plan. Results of an effective marketing plan should increase the number of quality students graduating from the dental hygiene program, ultimately contributing to the quality of oral health care in the community.

  16. Hand hygiene compliance in a universal gloving setting. (United States)

    Kuruno, Noriko; Kasahara, Kei; Mikasa, Keiichi


    The use of gloves for every patient contact (ie, universal gloving) has been suggested as an infection prevention adjunct and alternative to contact precautions. However, gloves may carry organisms unless they are changed properly. In addition, hand hygiene is required before donning and after removing gloves, and there are scarce data regarding glove changing and hand hygiene in a universal gloving setting. This nonrandomized observational before-after study evaluated the effect of education and feedback regarding hand hygiene. Compliance with hand hygiene and glove use was directly observed in a universal gloving setting at a 10-bed intensive care unit in a Japanese tertiary care university teaching hospital. A total of 6,050 hand hygiene opportunities were identified. Overall, hand hygiene compliance steadily increased from study period 1 (16.1%) to period 5 (56.8%), although there were indication-specific differences in the baseline compliance, the degree of improvement, and the reasons for noncompliance. There were decreases in the compliance with universal gloving and the incidence of methicillin-resistant Staphylococcus aureus. It is difficult to properly perform glove use and hand hygiene in a universal gloving setting, given its complexity. Direct observation with specific feedback and education may be effective in improving compliance. Copyright © 2017 Association for Professionals in Infection Control and Epidemiology, Inc. Published by Elsevier Inc. All rights reserved.

  17. A framework for designing hand hygiene educational interventions in schools. (United States)

    Appiah-Brempong, Emmanuel; Harris, Muriel J; Newton, Samuel; Gulis, Gabriel


    Hygiene education appears to be the commonest school-based intervention for preventing infectious diseases, especially in the developing world. Nevertheless, there remains a gap in literature regarding a school-specific theory-based framework for designing a hand hygiene educational intervention in schools. We sought to suggest a framework underpinned by psychosocial theories towards bridging this knowledge gap. Furthermore, we sought to propound a more comprehensive definition of hand hygiene which could guide the conceptualisation of hand hygiene interventions in varied settings. Literature search was guided by a standardized tool and literature was retrieved on the basis of a predetermined inclusion criteria. Databases consulted include PubMed, ERIC, and EBSCO host (Medline, CINAHL, PsycINFO, etc.). Evidence bordering on a theoretical framework to aid the design of school-based hand hygiene educational interventions is summarized narratively. School-based hand hygiene educational interventions seeking to positively influence behavioural outcomes could consider enhancing psychosocial variables including behavioural capacity, attitudes and subjective norms (normative beliefs and motivation to comply). A framework underpinned by formalized psychosocial theories has relevance and could enhance the design of hand hygiene educational interventions, especially in schools.

  18. Evaluation of the effectiveness of a thermal hygienization reactor

    Directory of Open Access Journals (Sweden)

    Daniel Borski


    Full Text Available For reasons of limiting the spread of serious transmissible diseases, with regard to the requirement for reducing landfill of biodegradable waste (which may or contains animal by-products and thus presents a potential risk to human and animal health and with a focus on supporting its separate collection, there has been created a legal framework for processing and hygienization of materials containing animal by-products. For the above reasons new technologies are being developed and implemented. These technologies are able to ensure the processing of biological waste containing animal by-products. As a practical result of the effort to ensure the hygienization of biowaste, a hygienization unit of own design, which uses the thermal way of hygienization, is presented in this work. The general part of the work defines a legislative framework for the assignment and gives technical parameters and minimum requirements for conversion that hygienization unit should be able to perform, including the limits for digestion residues and compost.In the experimental section there are described operational tests which document the technological process of hygienization depending on the aeration of the contents of the reactor. Experiment III outlines the validation process which uses contamination by indicator organisms, including subsequent checking of their occurrence as well as processing of the results of experiments and evaluation of the process of hygienization.

  19. The hand hygiene compliance of student nurses during clinical placements. (United States)

    Sundal, Jorun Saetre; Aune, Anne Grethe; Storvig, Eline; Aasland, Jenny Kristin; Fjeldsaeter, Kaja Linn; Torjuul, Kirsti


    To observe student nurses' overall and moment-specific hand hygiene compliance during clinical placement. Hand hygiene is the single most important measure to prevent healthcare-associated infections. However, research has shown low compliance among healthcare workers. During clinical placements, student nurses perform various nursing tasks and procedures to a large number of patients, requiring extensive patient contact. It is crucial that they practice correct hand hygiene to prevent healthcare-associated infections. Open, standardised and nonparticipating observations. Twenty-nine student nurses were observed three times for 20 ± 10 min during clinical placement in a Norwegian university hospital. To measure compliance, we used WHO's Hand Hygiene Observation tool, based on the model "My five moments for hand hygiene". Overall hand hygiene compliance in the student group was 83.5%. Highest moment-specific compliance was after touching patient surroundings, after touching patients and after body fluid exposure risk. Lowest moment-specific compliance was recorded before touching patients or patient surroundings, and before clean/aseptic procedures. Nurse education needs to be improved both theoretically and during clinical placements in order to advance and sustain compliance among student nurses. Increasing healthcare workers' compliance with hand hygiene guidelines remains a challenge to the clinical community. In order to reduce healthcare-associated infections, it is important to educate student nurses to comply with the guidelines during clinical placements. Identifying student nurses' hand hygiene performance is the first step towards developing teaching methods to improve and sustain their overall and moment-specific compliance. As a measure to ensure student compliance during clinical placements, mentors should be aware of their influence on students' performance, act as hand hygiene ambassadors, encourage students to comply with established guidelines

  20. Why language matters: a tour through hand hygiene literature

    Directory of Open Access Journals (Sweden)

    Daniela Pires


    Full Text Available Abstract Background Hand hygiene has evolved over the last decades and many terminologies emerged. We aimed to analyse the evolution in the frequency of utilization of key hand hygiene terms in the literature along the years. Methods We identified keywords and Medical Subject Headings (MeSH used in MEDLINE® indexation related to hand hygiene by searching international guidelines and the MeSH database. We performed a MEDLINE® search combining the selected keywords and MeSH and analysed the number of publications retrieved yearly. Results The literature search yielded 9019 publications when all hand hygiene related search terms were combined, between 1921 and November 2016. The total number of publications per year increased from a median of 4 (IQR 3, 6 in the 1950’s to 554 (IQR 478, 583 between 2011 and 2015. The most frequently used keywords are hand disinfection, hand hygiene, hand washing, handrub, hand sanitizer and alcohol-based hand rub (ABHR. Until the 1990s, hand disinfection and hand washing were the most frequently used terms. Whilst the last decade has seen a remarkable increase in publications mentioning hand disinfection and hand hygiene and for the first time handrub, hand sanitizers and ABHR were introduced in the literature. Hand disinfection, hand hygiene and hand sanitizers are the main MeSH used by MEDLINE®. Since 2013 hand hygiene is the most frequently used MeSH and keyword. Conclusions The change seen in literature in the last two decades, from hand washing and hand disinfection to hand hygiene, most probably reflect the paradigm shift favouring use of ABHR over soap and water promoted by international guidelines in the early 2000s.

  1. [Hand hygiene: first measure to control nosocomial infection]. (United States)

    Christiaens, G; Barbier, C; Mutsers, J; Warnotte, J; De Mol, P; Bouffioux, C


    Hand hygiene prevents cross infection in hospi tals, however adherence to guidelines is commonly poor. The hand-hygiene promotion programme started on May 2004 at the University Hospital of Liège after a baseline survey of compliance. We attempted to promote hand hygiene and most par ticularly alcohol-based hand disinfection. We measured MRSA transmission rates and consumption of alcohol-based handrub solution and soap in parallel. During the campaign, consump tion of alcohol-based handrub solution and soap increased by 56% and 24% respectively and MRSA transmission rates decreased from 11,04 to 7,07 cases per 1000 admissions.

  2. Utility of electronic hand hygiene counting devices for measuring physicians' hand hygiene adherence applied to outpatient settings. (United States)

    Arai, Akie; Tanabe, Masaki; Nakamura, Akiko; Yamasaki, Daisuke; Muraki, Yuichi; Kaneko, Toshihiro; Kadowaki, Ayako; Ito, Masaaki


    Our objectives were to evaluate the utility of electronic hand hygiene counting devices in outpatient settings and the impact of results feedback on physicians' hand hygiene behaviors. We installed 130 electronic hand hygiene counting devices in our redesigned outpatient department. We remotely monitored physicians' hand hygiene practices during outpatient examinations and calculated the adherence rate as follows: number of hand hygiene counts divided by the number of outpatients examined multiplied by 100. Physician individual adherence rates were also classified into 4 categories. Two hundred and eighty physicians from 28 clinical departments were monitored for 3 months. The overall hand hygiene adherence rate was 10.7% at baseline, which improved significantly after feedback to 18.2% in the third month. Of the clinical departments, 78.6% demonstrated significant improvement in hand hygiene compliance. The change in the percentage of physicians in each category before and after feedback were as follows: very low (84.3% to 72.1%), low (8.6% to 14.3%), moderate (2.9% to 8.9%), and high (4.3% to 4.6%), from the first to third month, respectively. Based on category assessment, 17.1% of physicians were classified as responders. Physicians' adherence to hand hygiene practices during outpatient examinations was successfully monitored remotely using electronic counting devices. Audit and feedback of adherence data may have a positive impact on physicians' hand hygiene compliance. Copyright © 2016 Association for Professionals in Infection Control and Epidemiology, Inc. Published by Elsevier Inc. All rights reserved.

  3. Assessing Interdisciplinary Education in U.S. Dental Hygiene Programs. (United States)

    Holt, Lorie; Bray, Kimberly; Mayberry, Bill; Overman, Pamela


    Survey responses from 136 of 216 dental hygiene programs indicated that 31% included interdisciplinary activities in the curriculum; only 15% included both clinical and instructional interdisciplinary coursework. However, 74% felt that students would benefit from interdisciplinary experiences. (SK)

  4. Task Force on Innovation in Dental Hygiene Curricula. (United States)

    Bader, James; And Others


    The background, origins, functions, and recommendations of the American Association of Dental Schools' task force investigating improvement of access to dental hygiene training programs and of curriculum and program design are presented. (MSE)

  5. Use of Distance Education in Dental Hygiene Programs. (United States)

    Grimes, Ellen B.


    Surveyed dental hygiene programs to determine the prevalence of distance education use. Found that 22 percent have distance education, and that most were satisfied with it as an adequate alternative to traditional approaches. (EV)

  6. Healthy Hands Hygiene (A Cup of Health with CDC)

    Centers for Disease Control (CDC) Podcasts

    Teaching young children personal hygiene can have a positive impact for a lifetime. Encouraging regular handwashing is a good start. In this podcast, Dr. Vincent Hill discusses the importance of regular handwashing.

  7. Hygienic status assessment of dish washing waters, utensils, hands ...

    African Journals Online (AJOL)

    Hygienic status assessment of dish washing waters, utensils, hands and pieces of money from street food processing sites in Ouagadougou (Burkina Faso). N Barro, AR Bello, A Savadogo, CAT Ouattara, AJ Iiboudo, AS Traoré ...

  8. Hygiene Practices among Workers in Local Eateries of Orolu ...

    African Journals Online (AJOL)

    The springing up of fast food shops and local eateries in nooks and crannies of South Western ... hygienic practices employed in this food marketing sector, restaurants and hotels ..... food overnight. 126. 53.6. Use preservative in storing cereal.

  9. How to integrate water, sanitation, and hygiene into HIV programmes

    National Research Council Canada - National Science Library

    Bery, Renuka; Rosenbaum, Julia


    "Water, sanitation and hygiene (WASH) practices are essential for maintaining health, yet most countries and donors have not included WASH in national policies and programmes for human immunodeficiency virus (HIV...

  10. Factors affecting workers' delivery of good hygienic and sanitary ...

    African Journals Online (AJOL)



    Mar 6, 2015 ... adhere to Good Manufacturing Practices (GMP) and. Good Hygiene Practices ... has resulted in meat contamination and poor waste disposal, with ... and other food animals arrive these slaughterhouses from various parts of ...

  11. Potential hazards due to food additives in oral hygiene products. (United States)

    Tuncer Budanur, Damla; Yas, Murat Cengizhan; Sepet, Elif


    Food additives used to preserve flavor or to enhance the taste and appearance of foods are also available in oral hygiene products. The aim of this review is to provide information concerning food additives in oral hygiene products and their adverse effects. A great many of food additives in oral hygiene products are potential allergens and they may lead to allergic reactions such as urticaria, contact dermatitis, rhinitis, and angioedema. Dental practitioners, as well as health care providers, must be aware of the possibility of allergic reactions due to food additives in oral hygiene products. Proper dosage levels, delivery vehicles, frequency, potential benefits, and adverse effects of oral health products should be explained completely to the patients. There is a necessity to raise the awareness among dental professionals on this subject and to develop a data gathering system for possible adverse reactions.

  12. Radiation hygiene aspects of mixed neutron-gamma field dosimetry

    International Nuclear Information System (INIS)

    Nikodemova, O.; Hrabovcova, A.


    Various possibilities are analyzed of determining the dose equivalent of neutrons, as is the reliability of the techniques and the correct interpretation for the purposes of radiation hygiene. (author)

  13. Assessing hygienic behavior and attraction to Varroa mite (Acari ...

    African Journals Online (AJOL)



    Feb 7, 2011 ... treatment and then the selected 5th instar larva were transferred to fundamental colonies with 10 to 12 ... Key words: Varroa mite, hygienic behavior (uncapping and .... into a container containing hot water and detergent.


    African Journals Online (AJOL)


    Apr 1, 2006 ... EAST AFRICAN MEDICAL JOURNAL ... Faculty of Dental Sciences, University of Nairobi, P.O. Box 19676 - 00202, Nairobi, ... Poor oral hygiene is a product of plaque and ..... University of Nairobi and Kenya Medical Research.

  15. Incidence of allergy and atopic disorders and hygiene hypothesis.

    Czech Academy of Sciences Publication Activity Database

    Bencko, V.; Šíma, Petr


    Roč. 2, 6 March (2017), č. článku 1244. ISSN 2474-1663 Institutional support: RVO:61388971 Keywords : allergy disorders * atopic disorders * hygiene hypothesis Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology


    Directory of Open Access Journals (Sweden)



    Full Text Available Food additives used to preserve flavor or to enhance the taste and appearance of foods are also available in oral hygiene products. The aim of this review is to provide information concerning food additives in oral hygiene products and their adverse effects. A great many of food additives in oral hygiene products are potential allergens and they may lead to allergic reactions such as urticaria, contact dermatitis, rhinitis, and angioedema. Dental practitioners, as well as health care providers, must be aware of the possibility of allergic reactions due to food additives in oral hygiene products. Proper dosage levels, delivery vehicles, frequency, potential benefits, and adverse effects of oral health products should be explained completely to the patients. There is a necessity to raise the awareness among dental professionals on this subject and to develop a data gathering system for possible adverse reactions.

  17. Hygienic quality of raw milk with regard to legislation

    Directory of Open Access Journals (Sweden)

    Slavko Kirin


    Full Text Available Hygienic quality of raw milk is basic indicator of hygienic conditionduring processing and handling of milk as well as economical valorisation of animal product as a raw material in dairy products manufacture. Thus, total bacterial count in 1 mL of raw milk is used in modern legislation in milk pricing system. Apart from the economical and technological reasons hygienic quality of raw milk is also important from the health safety issue. In this paper microbiological quality legislation, set down by the EU and Croatian directives, are presented. Apart form the total microorganisms number the normative on the somatic cell number in row milk, as one of the quality indicators, are also presented. Pricing system of raw milk with regard to hygienic quality, current legislation especially from the point of view of a new legislation on row milk quality as well as suggestions to faster association into progressive dairy, legislation are listed.

  18. The status of hygiene and sanitation practice among rural model ...

    African Journals Online (AJOL)

    The status of hygiene and sanitation practice among rural model families of the Health Extension Program (HEP) in Wolayta and Kembata Tembaro Zones of Southern Nations, Nationalities and Peoples' Region of Ethiopia.

  19. A discourse on dental hygiene education in Canada. (United States)

    Kanji, Z; Sunell, S; Boschma, G; Imai, P; Craig, B J


    Over the past decade, the discourse on dental hygiene education has gained momentum in Canada. This review provides insights into the evolution of dental hygiene education in Canada, briefly exploring the history and professional influences for diploma and baccalaureate education within the profession. The profession in Canada has yet to implement a national standardized entry-to-practice educational model, but the recent development of national educational competencies may prove to be a promising beginning. The review also discusses efforts to advance dental hygiene education in recent years, while exploring the political and professional pressures and challenges that remain. Further discourse on education and outcomes-related research can be effective in positively influencing governmental, professional and public opinions of higher entry-level education for dental hygiene which may ultimately result in regulatory change and improved client outcomes. © 2010 John Wiley & Sons A/S.

  20. An assessment of water, sanitation and hygiene (wash) practices ...

    African Journals Online (AJOL)

    An assessment of water, sanitation and hygiene (wash) practices and quality of routinely ... East African Medical Journal ... There was a high uptake of households with treated drinking water (92%), availability of hand washing facilities in ...

  1. Online directed journaling in dental hygiene clinical education. (United States)

    Gwozdek, Anne E; Klausner, Christine P; Kerschbaum, Wendy E


    Reflecting upon and sharing of clinical experiences in dental hygiene education is a strategy used to support the application of didactic material to patient care. The promotion of interactive, clinically focused discussions creates opportunities for students to foster critical thinking and socialization skills in dental hygiene practice. Twenty-eight dental hygiene students in their first semester of patient care utilized online directed journaling via blogging software, as a reflection and sharing strategy. Journal entries found critical thinking and socialization themes including connection of didactic material to clinical experience, student-patient interaction, student-student collaboration, and a vision of the professional role of the dental hygienist. A 7 item evaluation instrument provided data that the online journaling strategy was perceived as effective and valuable by the students. Online directed journaling is a strategy that has the potential to enhance critical thinking and socialization skills in dental hygiene clinical education.

  2. Environmental Sustainability and Mold Hygiene in Buildings. (United States)

    Wu, Haoxiang; Ng, Tsz Wai; Wong, Jonathan Wc; Lai, Ka Man


    Environmental sustainability is one of the key issues in building management. In Hong Kong, one of the initiatives is to reduce the operation hours of air-conditioning in buildings to cut down energy consumption. In this study, we reported a mold contamination case in a newly refurbished laboratory, in which the air-conditioner was switched from 24- to 18-h mode after refurbishment. In order to prevent mold recurrence, the air-conditioner was switched back to 24-h mode in the laboratory. During the mold investigation, visible mold patches in the laboratory were searched and then cultured, counted and identified. Building and environmental conditions were recorded, and used to deduce different causes of mold contamination. Eight contaminated sites including a wall, a bench, some metal and plastic surfaces and seven types of molds including two Cladosporium spp., two Aspergillus spp., one Rhizopus sp., one Trichoderma sp., and one Tritirachium sp. were identified. Cladosporium spp. were the most abundant and frequently found molds in the laboratory. The contaminated areas could have one to five different species on them. Based on the mold and environmental conditions, several scenarios causing the mold contamination were deduced, and different mold control measures were discussed to compare them with the current solution of using 24-h air-conditioning to control mold growth. This study highlights the importance of mold hygiene in sustainable building management.

  3. Environmental Sustainability and Mold Hygiene in Buildings

    Directory of Open Access Journals (Sweden)

    Haoxiang Wu


    Full Text Available Environmental sustainability is one of the key issues in building management. In Hong Kong, one of the initiatives is to reduce the operation hours of air-conditioning in buildings to cut down energy consumption. In this study, we reported a mold contamination case in a newly refurbished laboratory, in which the air-conditioner was switched from 24- to 18-h mode after refurbishment. In order to prevent mold recurrence, the air-conditioner was switched back to 24-h mode in the laboratory. During the mold investigation, visible mold patches in the laboratory were searched and then cultured, counted and identified. Building and environmental conditions were recorded, and used to deduce different causes of mold contamination. Eight contaminated sites including a wall, a bench, some metal and plastic surfaces and seven types of molds including two Cladosporium spp., two Aspergillus spp., one Rhizopus sp., one Trichoderma sp., and one Tritirachium sp. were identified. Cladosporium spp. were the most abundant and frequently found molds in the laboratory. The contaminated areas could have one to five different species on them. Based on the mold and environmental conditions, several scenarios causing the mold contamination were deduced, and different mold control measures were discussed to compare them with the current solution of using 24-h air-conditioning to control mold growth. This study highlights the importance of mold hygiene in sustainable building management.

  4. Hand hygiene knowledge and perceptions among anesthesia providers. (United States)

    Fernandez, Patrick G; Loftus, Randy W; Dodds, Thomas M; Koff, Matthew D; Reddy, Sundara; Heard, Stephen O; Beach, Michael L; Yeager, Mark P; Brown, Jeremiah R


    Health care worker compliance with hand hygiene guidelines is an important measure for health care-associated infection prevention, yet overall compliance across all health care arenas remains low. A correct answer to 4 of 4 structured questions pertaining to indications for hand decontamination (according to types of contact) has been associated with improved health care provider hand hygiene compliance when compared to those health care providers answering incorrectly for 1 or more questions. A better understanding of knowledge deficits among anesthesia providers may lead to hand hygiene improvement strategies. In this study, our primary aims were to characterize and identify predictors for hand hygiene knowledge deficits among anesthesia providers. We modified this previously tested survey instrument to measure anesthesia provider hand hygiene knowledge regarding the 5 moments of hand hygiene across national and multicenter groups. Complete knowledge was defined by correct answers to 5 questions addressing the 5 moments for hand hygiene and received a score of 1. Incomplete knowledge was defined by an incorrect answer to 1 or more of the 5 questions and received a score of 0. We used a multilevel random-effects XTMELOGIT logistic model clustering at the respondent and geographic location for insufficient knowledge and forward/backward stepwise logistic regression analysis to identify predictors for incomplete knowledge. The survey response rates were 55.8% and 18.2% for the multicenter and national survey study groups, respectively. One or more knowledge deficits occurred with 81.6% of survey respondents, with the mean number of correct answers 2.89 (95% confidence interval, 2.78- 2.99). Failure of providers to recognize prior contact with the environment and prior contact with the patient as hand hygiene opportunities contributed to the low mean. Several cognitive factors were associated with a reduced risk of incomplete knowledge including providers responding

  5. Hand Hygiene Saves Lives: Patient Admission Video (Short Version)

    Centers for Disease Control (CDC) Podcasts


    This podcast is for hospital patients and visitors. It emphasizes two key points to help prevent infections: the importance of practicing hand hygiene while in the hospital, and that it's appropriate to ask or remind healthcare providers to practice hand hygiene.  Created: 5/1/2008 by National Center for Preparedness, Detection, and Control of Infectious Diseases (NCPDCID).   Date Released: 4/26/2010.

  6. Effect of hygiene communication on emptying of urine diversion toilets

    CSIR Research Space (South Africa)

    Moilwa, N


    Full Text Available is dependent on microbial species present and their count per gram. According to Austin (2000) pathogens die-off in a urine diversion toilet in South Africa, in other words the presence of microbial species and their count per gram is determined by storage... during the implementation of this project. The purpose was to determine the effectiveness of the vault emptying education given during the health and hygiene education programme. The external consultant that implemented the health and hygiene...

  7. The first step in infection control is hand hygiene. (United States)

    Canham, Leslie


    A dental health care worker (DHCW) has an obligation to prevent the spread of health care associated infections. Adhering to proper hand hygiene procedures, selecting appropriate hand hygiene products and the use of gloves are all important elements of infection control. The CDC Guidelines for Hand Hygiene state that improved hand hygiene practices can reduce transmission of pathogenic microorganisms to patients and personnel in health care settings. DHCWs must also protect themselves by recognizing pitfalls such as irritants or allergies that may pose obstacles to proper hand hygiene. Occupational irritants and allergies can be caused by frequent hand washing, exposure to hand hygiene products, exposure to chemicals and shear forces associated with wearing or removing gloves. Since the primary defense against infection and transmission of pathogens is healthy, unbroken skin, DHCWs must take steps to ensure that their skin remains healthy and intact. These steps include evaluating different types of hand hygiene products, lotions and gloves for the best compatibility. If the DHCW sees a breakdown of his or her skin barrier, steps should be taken to determine the cause and remedy. Remedies can include the use of alcohol-based hand sanitizers containing emollients and moisturizers and regular use of a medical grade hand lotion. The bottom line: healthy skin protects you at work and at home. Selection and use of appropriate hand hygiene products, including moisturizers, are an essential part ofa dental office infection control program. My coworker lost the use of her thumb for several months due to complications of a staph infection. She was unable to work and found even simple tasks such as closing a button hard to do. Think of how difficult your work would be if something happened to your hands. Injury, irritation or allergies could alter your ability to work or even perform routine tasks. Our hands provide us with the ability to work in clinical dentistry. It makes

  8. Patient empowerment and hand hygiene, 1997-2012. (United States)

    McGuckin, M; Govednik, J


    Multi-modal hand hygiene programmes that include patient empowerment are promoted as a necessary component of hand hygiene compliance. However, the question still remains, do we have enough information to determine if, and under what conditions, patients will be able to play an immediate role in healthcare workers' hand hygiene behaviour? To review the current literature on patient willingness to be empowered, barriers to empowerment, and hand hygiene programmes that include patient empowerment and hand hygiene improvement. A Medline (Ovid) search of all English-language papers for 1997-2007 and 2008-2012 was conducted using the following keywords alone and in various combinations: 'patient participation', 'involvement', 'empowerment', 'education', 'decision-making', 'professional-patient relations', 'behavioural change', 'culture of safety', 'social marketing', 'consumer awareness', 'leadership', 'institutional climate', 'hand hygiene' and 'patient reminders'. The 1997-2007 review was conducted as part of the World Health Organization's Guidelines on Hand Hygiene in Health Care, and updated with the 2008-2012 review. Several studies show that, in principle, patients are willing to be empowered. However, there is variation in the actual number of patients that practice empowerment for hand hygiene, ranging from 5% to 80%. The actual performance of patient empowerment can be increased when a patient is given explicit permission by a healthcare worker. There is ongoing support from patients that they are willing to be empowered. There is a need to develop programmes that empower both healthcare workers and patients so that they become more comfortable in their roles. Copyright © 2013 The Healthcare Infection Society. Published by Elsevier Ltd. All rights reserved.

  9. The effect of improved hand hygiene on nosocomial MRSA control


    Marimuthu, Kalisvar; Pittet, Didier; Harbarth, Stephan


    The purpose of this review is to examine studies that have assessed the association between hand hygiene enhancement and methicillin-resistant Staphylococcus aureus (MRSA) rates and to explore controversies surrounding this association. Many studies have been published confirming the link between improved hand hygiene compliance and reduction in MRSA acquisition and infections, including bacteremia. These studies have also shown the cost-beneficial nature of these programmes. Despite consider...

  10. Poor Oral Hygiene and Middle Ear Infections: Any Relationship?


    Esra, Eryaman; Banu, Oter Ilhan; Erdinc, Aydin


    The purpose of this study is to evaluate the relationship between poor oral hygiene and middle ear infections. 59 children between 3–12 age intervals were included in this study. The ears were examined by microscope. The findings were marked according to Kempthorne clinical scale and tympanograms were performed. For data analysis of dental caries, dft and DMFT indexes were used in accordance with WHO (World Health Organization) criteria for oral health surveys. The oral hygiene status was det...

  11. [Cell phone communication: hygienic characteristics, biological action, standardization (a review)]. (United States)

    Gudina, M V; Volkotrub, L P


    The paper considers the topical issues concerning the functioning of the cellular communication system. It provides the hygienic characteristics of its individual elements. The factors influencing the size of an electromagnetic field generated by mobile phones are stated. Research data on the impact of electromagnetic radiation from a mobile phone on users' health are reviewed. The pivots of present-day Russian hygienic rating regarding the permissible exposures to nonionizing electromagnetic energy generated by the elements of the cellular communication system are identified.

  12. Job Burnout Reduces Hand Hygiene Compliance Among Nursing Staff. (United States)

    Manomenidis, Georgios; Panagopoulou, Efharis; Montgomery, Anthony


    Health professional burnout has been associated with suboptimal care and reduced patient safety. However, the extent to which burnout influences hand hygiene compliance among health professionals has yet to be explored. The aim of the study was to examine whether job burnout reduces hand washing compliance among nursing staff. A diary study was conducted. Forty registered nurses working in a general city hospital in Thessaloniki, Greece, completed a questionnaire, while they were monitored for hand hygiene compliance following the World Health Organization protocol for hand hygiene assessment. Burnout was measured using validated items from the Maslach Burnout Inventory. Data were collected from September to October 2015. Multiple regression analysis showed that controlling for years in practice, burnout was negatively associated with hand hygiene compliance (R = 0.322, F(3,36) = 5.704, P compliance to hand hygiene among nurses. Given the crucial role of hand hygiene compliance for the prevention of in-hospital infections, this study highlights the need for interventions targeting the prevention of burnout among nursing staff.

  13. Evaluation of parental awareness regarding their child's oral hygiene. (United States)

    Shaghaghian, S; Savadi, N; Amin, M


    To determine parental awareness about their child's oral hygiene and its associated factors. In this cross-sectional study, 396 parents and their 3- to 6-year-old children were selected by randomized cluster sampling from Shiraz kindergartens in 2013. Parents completed a questionnaire on their perception of their child's oral hygiene. The children received a dental examination, and their dental cleaning status was determined using Simplified Debris Index. Parental awareness was determined by comparing parents' perception of their child's oral hygiene with the results of the dental examination. Associations between demographic factors and parental awareness were evaluated. Sixty per cent of the parents were aware of their child's teeth cleaning status. Higher percentage of parents with university degree (P parents whose child did not have a previous dental visit (P parents had lower dmft (P oral hygiene (P = 0.001) than those of unaware parents. Parents who perceived overall oral health status of their child as good (P parents were not aware of their child's oral hygiene. Educational interventions should be provided to young families to increase parental knowledge and skills that help them recognize their child's dental needs. The interventions are more necessary for low socioeconomic parents and for the parents of children with poor oral hygiene. © 2016 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  14. [Infection control and hand hygiene in nursing homes in Oslo]. (United States)

    Sie, Ingrid; Thorstad, Margrete; Andersen, Bjørg Marit


    Nosocomial infections and transmission can be substantially reduced by good infection control. The laws and regulations for infection control in heath care institutions emphasize establishment of infection control programs and improved hand hygiene. Our study reviews some factors that are important for practicing adequate hand hygiene (knowledge about infection control and hand-washing facilities). Health care workers (HCW) in nursing homes in Oslo participated in this study in 2006-2007. A questionnaire was made and SPSS was used to analyse the data . 70.7% of 324 HCW (in 42 nursing homes) answered the questionnaires. Nearly all of the respondents (95.6%) knew about the written procedures for hygiene and infection control; 88.5% knew that an infection control program was in place and about 50% had received information through internal education. Three of four had read the National guidelines for hand hygiene, 77.5% thought that hand disinfection was more effective than hand washing, and 97% reported hand hygiene after contact with a patient having an infection. Dispensers for hand disinfection were situated at central work places. At the same time, 17.9% informed that they worked in more than one place at the same time. This study confirms that most nursing homes in Oslo have an infection control program and training that improves the knowledge and awareness of hand hygiene among HCWs. However, the fact that nursing homes in Oslo have the resources, knowledge and education, is not the same as compliance.

  15. Impact of INICC Multidimensional Hand Hygiene Approach in ICUs in Four Cities in Argentina. (United States)

    Rosenthal, Victor D; Viegas, Mónica; Sztokhamer, Daniel; Benchetrit, Guillermo; Santoro, Beatriz; Lastra, Carlos Esteban; Romani, Adriana; Di Núbila, Beatriz Marta Alicia; Lanzetta, Diana; Fernández, Leonardo J; Rossetti, María Adelaida; Migazzi, Claudia; Barolin, Clarisa; Martínez, Estela; Bonaventura, Claudio; Caridi, Maria de Los Ángeles; Messina, Adriana; Ricci, Beatriz; Soroka, Luisa C; Frías, María Laura


    We evaluated the impact of the International Nosocomial Infection Control Consortium multidimensional approach to hand hygiene in 11 intensive care units in 4 cities in Argentina and analyzed predictors of poor hand hygiene compliance. We had a baseline period and a follow-up period. We observed 21 100 hand hygiene opportunities. Hand hygiene compliance increased from 28.3% to 64.8% (P = .0001). Males versus females (56.8% vs 66.4%; P hand hygiene compliance.

  16. California Dental Hygiene Educators' Perceptions of an Application of the ADHA Advanced Dental Hygiene Practitioner (ADHP) Model in Medical Settings. (United States)

    Smith, Lauren; Walsh, Margaret


    To assess California dental hygiene educators' perceptions of an application of the American Dental Hygienists' Association's (ADHA) advanced dental hygiene practitioner model (ADHP) in medical settings where the advanced dental hygiene practitioner collaborates in medical settings with other health professionals to meet clients' oral health needs. In 2014, 30 directors of California dental hygiene programs were contacted to participate in and distribute an online survey to their faculty. In order to capture non-respondents, 2 follow-up e-mails were sent. Descriptive analysis and cross-tabulations were analyzed using the online survey software program, Qualtrics™. The educator response rate was 18% (70/387). Nearly 90% of respondents supported the proposed application of the ADHA ADHP model and believed it would increase access to care and reduce oral health disparities. They also agreed with most of the proposed services, target populations and workplace settings. Slightly over half believed a master's degree was the appropriate educational level needed. Among California dental hygiene educators responding to this survey, there was strong support for the proposed application of the ADHA model in medical settings. More research is needed among a larger sample of dental hygiene educators and clinicians, as well as among other health professionals such as physicians, nurses and dentists. Copyright © 2015 The American Dental Hygienists’ Association.

  17. Dental hygiene intervention to prevent nosocomial pneumonias. (United States)

    Barnes, Caren M


    Nosocomial and ventilator associated pneumonias that plague critically ill, elderly and long-term care residents could be reduced with effective oral hygiene practices facilitated collaboratively between nurses and dental hygienists. Nosocomial pneumonias, specifically aspiration pneumonias and ventilator-associated pneumonias in the elderly and infirm have become a major health care issue, The provision of oral care in hospital and hospital-like facilities presents challenges that can prevent patients from receiving optimal oral care One sequela can be aspiration pneumonia which ranks first in mortality and second in morbidity among all nosocomial infections. Since aspiration pneumonia is linked to the colonization of oral bacteria in dental plaque and biofilm, it is time to look for creative solutions to integrating the expertise of dental hygienists into health care teams in these institutional settings. A comprehensive review of the literature was conducted regarding the etiology and prevalence of health care related pneumonias. Evidence describing the challenges and barriers that the nurses, nursing staff, and dental hygienists face in the provision of oral care in hospitals and long-term care facilities is provided. Intercollaborative solutions to providing optimal oral care in hospitals and long-term care facilities are suggested. Dental hygienists have the expertise and practice experience to provide oral care in hospitals, long-term care and residential facilities. They can contribute to solving oral care challenges through intercollaboration with other health care team members. Yet, there are long-standing systemic barriers that must be addressed in order to provide this optimal care. Dental hygienists becoming better assimilated within the total health care team in hospital and residential facilities can positively impact the suffering, morbidity and mortality associated with aspiration pneumonias. Copyright © 2014 Elsevier Inc. All rights reserved.

  18. Hygiene assessment of sheep slaughter cycle

    Directory of Open Access Journals (Sweden)

    Pyz-Łukasik Renata


    Full Text Available The purpose of the study was to determine microbial contamination of mutton carcass surface with regard to the number of the slaughtered animals. The total bacterial load and Enterobacteriaceae and enterococci counts were determined. Sampling for microbiological analysis as well as detection and enumeration of each microorganism group were performed according to the Polish Standards. No significant effect of the order of the slaughtering animals during the slaughter day on total bacterial count on mutton carcass surfaces was found. The overall bacterial contamination of mutton carcasses were between 1.0 × 103 cfu/cm2 (3.0 log - stage I and 2.5 × 103 cfu/cm2 (3.4 log - stage III. No significant difference among the slaughter cycles, as indicated by total microbial numbers was observed. The obtained daily mean log values ranged from 4.7 × 102 (2.67 log and 7.6 × 103 (3.88 log cfu/cm2. The daily log mean values were lower than the maximal bacteria count (M set out for hygiene standard of sheep slaughter process by the Commission Regulation 2073/2005. Bacteria belonging to the Enterobacteriaceae family were recovered from 21 (65.6% samples while enterococci were identified in 28 (87.5% samples. In most cases, significant differences in the level of contamination with bacteria isolated from the carcasses at each stage of a daily slaughter cycle, were not observed. At stage III, significantly higher levels of bacterial contamination (0.86 and 1.31 log cfu/cm2 respectively were established as compared to stage I (0.37 and 0.58 log cfu/cm2 respectively. There were no Salmonella-positive samples determined. Importantly, the number of slaughtered animals during a slaughter day did not influence bacterial contamination on carcass surface if the successful application of HACCP control system was combined with the implementation of optimal sanitary supervision.

  19. Occupational hygiene of windrow composting. Aumakompostoinnin tyoehygienia

    Energy Technology Data Exchange (ETDEWEB)

    Haenninen, K; Wihersaari, M [Technical Research Centre of Finland, Jyvaeskylae (Finland). Combustion and Thermal Engineering Lab.; Huvio, T; Lundstroem, Y [Helsingin kaupungin vesi- ja viemaerilaitos, Helsinki (Finland); Veijalainen, A [Jyvaeskylae Univ. (Finland). Dept. of Chemistry


    The occupational air in windrow composting of digested sewage sludge, raw sludge and source separated biowaste was investigated for microbe, endotoxin and dust concentrations and for odour level during turning and sieving of composts. The normal parameters of composting were investigated at the same time. The composting of the source separated biowaste was so vigorous that the drying due to heat generation may have slowed the process. Composting of the digested and the raw sludge took place much more slowly. In all composts, the measured values for heavy metals stayed well below specified norms. The composts were hygienic: no Salmonella bacteria were found in a single sample. The formation of odorous compounds was measured in small composters: more such compounds were formed in the thermophile stage of biowaste composts than in the digested sludge composts. Among the gases that were released, dimethyl sulphide, dimethyl disulphide, e-pinene and limonene clearly exceeded the odour threashould. Endotoxins and dust concentrations in the occupational air were small. Total dust concentrations in the cabs of composting machines at times exceeded the eight-hour HTP concentration for organic dust. Especially in the occupational air of the biowaste and raw sludge composts, the concentrations of bacteria and fungi exceeded 10[sup 2]-10[sup 5] cfu/m[sup 3] during turning. This concentration level may cause respiratory ailments. The identified fungi included members of the genera Aspergillus, Penicillum and Cladosporum, which are associated with allergies. The microbes and dust concentrations measured in this study of windrow composting are comparable to the findings of corresponding studies from other composting plants, landfills and waste treatment plants.

  20. Atopic dermatitis and the hygiene hypothesis revisited. (United States)

    Flohr, Carsten; Yeo, Lindsey


    We published a systematic review on atopic dermatitis (AD) and the hygiene hypothesis in 2005. Since then, the body of literature has grown significantly. We therefore repeated our systematic review to examine the evidence from population-based studies for an association between AD risk and specific infections, childhood immunizations, the use of antibiotics and environmental exposures that lead to a change in microbial burden. Medline was searched from 1966 until June 2010 to identify relevant studies. We found an additional 49 papers suitable for inclusion. There is evidence to support an inverse relationship between AD and endotoxin, early day care, farm animal and dog exposure in early life. Cat exposure in the presence of skin barrier impairment is positively associated with AD. Helminth infection at least partially protects against AD. This is not the case for viral and bacterial infections, but consumption of unpasteurized farm milk seems protective. Routine childhood vaccinations have no effect on AD risk. The positive association between viral infections and AD found in some studies appears confounded by antibiotic prescription, which has been consistently associated with an increase in AD risk. There is convincing evidence for an inverse relationship between helminth infections and AD but no other pathogens. The protective effect seen with early day care, endotoxin, unpasteurized farm milk and animal exposure is likely to be due to a general increase in exposure to non-pathogenic microbes. This would also explain the risk increase associated with the use of broad-spectrum antibiotics. Future studies should assess skin barrier gene mutation carriage and phenotypic skin barrier impairment, as gene-environment interactions are likely to impact on AD risk. Copyright © 041_ S. Karger AG, Basel.

  1. Mental Hygienic Aspects of Animal Assisted Education

    Directory of Open Access Journals (Sweden)

    Takács István


    Full Text Available The Institution for Special Education at the Faculty of Pedagogic of the University of Kaposvár has been engaged in animal assisted activities for about three years. Our most recent research program was conducted for over two month in the Spring of 2014 with the involvement of 66 children - all kindergarten and elementary school age -, 11 special educators, physicians, psychologists, special educators, teachers, ethologists. The primary focus of our research was the development (and examination of memory however observations with ethological and mental hygiene angles were a natural segment of our work. A significant part of the observations pointed to factors that both the children and their educators have experienced: the acceptance of each-other, an increased level of tolerance, an increased attention level towards the partner (human and animal. The teachers gave account of their respective observations in a small conference at the end of the last school year. Researches were offered a glimpse into the unique world of the relationship between a part of “living nature” - the pygmy rabbit in our case - and humans. During the 12 sessions of the training our colleagues have made observations that could serve as basis for a new system of paradigms of animal assisted pedagogics in the future. Our experience can also be re-considered with aspects of remedial pedagogics: we are convinced that animal assistance can become an accentuated part of the care of children and students with impairments. This is also implied by the fact that preparatory works for the continuation of this research at a kindergarten and at a school are already in progress.


    Directory of Open Access Journals (Sweden)

    Verena Widya Pertiwi


    Full Text Available Abstract - Application of hygiene and sanitation in Hilton Hotel Bandung is important thing to note in the process of implementation. This is done to prevent food contamination of food that cab be caused by several factors such as, human, work area, kitchen utensil, material strorage systems and product. Because of this determination of standarts personal hygiene, area and utensil must be done correcly so that each product is safe for consumption. Authors on the basis of these issues are very keen to examine and make a final project with the title “application of hygiene and sanitation in the Hilton Hotel Bandung”. Research carried out by several methode of observation, interview and the latter is the study of documents. The research was conducted at the Hilton Hotel Bandung, for 6 months. The study was conducted as one of the requiremants for the final session of college exams Bina Sarana Informatika university Bandung. Based on the result of research and discussion conducted, authors concluded that the presence of load application staandard of hygiene and sanitation in hotel can improve the standard of health, hygiene and quality of a product when it is done in accordance with existing procedures. Key word : Hygiene and sanitation pastry hotel. Abstraksi - Penerapan hygiene dan sanitasi di Hotel Hilton Bandung merupakan upaya penting yang harus diperhatikan dalam proses pelaksanannya. Hal ini dilakukan untuk mencegah terjadinya kontaminasi makanan yang dapat disebabkan oleh beberapa faktor seperti manusia, area kerja, peralatan, sistem penyimpanan bahan dan produk. Penentuan standar kebersihan personal, area kerja maupun peralatan harus dilakukan dengan tepat dan benar agar setiap produk yang dihasilkan oleh bagian pastry hotel aman untuk dikonsumsi. Atas dasar persoalan di atas penulis sangat tertarik untuk menelitinya dan membuat tugas akhir dengan judul “ Penerapan Hygiene dan Sanitasi di Hotel Hilton Bandung ”. Metode penelitian

  3. Career choice and perceptions of dental hygiene students and applicants. (United States)

    DeAngelis, Susan; Dean, Kim; Pace, Cherin


    As the number of dental hygiene programs across the country continues to increase, educational opportunities for prospective students have flourished, resulting in increased competition among dental hygiene programs for qualified applicants. The purpose of this study was to provide a current description of dental hygiene students and applicants, assess the reasons for choosing the career, and evaluate the perceptions of both applicants and enrolled students with regard to specific aspects of the profession. A questionnaire was mailed to 142 prospective dental hygiene students who met the minimal requirements for admission to either of the two dental hygiene programs in Arkansas. The prospective students had been invited for an admissions interview. The questionnaire also was administered during class to 80 students currently enrolled in one of the two programs. An overall response rate of 71% (n = 157) was achieved. The average respondent was 22 years old, female, and Caucasian with a grade point average of 3.5 and a composite ACT score of 23. Dental hygiene was also the first career choice and most respondents had prior dental assisting experience. Dental hygienists and dentists were reported as providing the most career guidance, while high school and college guidance counselors were least influential. Respondents chose the profession in order to work with and help people, have flexible work schedules, and receive good salaries. Respondents typically viewed dental hygiene as offering a bright future in terms of job security, good salaries, flexible work schedules, diverse career opportunities, and personal responsibility. No significant difference in overall perceptions of the profession was found between applicants and those enrolled in dental hygiene programs, although the strength of individual perceptions of the profession differed between applicant and first-year students compared to second-year students. Dental hygiene programs can use the findings of this

  4. Interventions to improve hand hygiene compliance in patient care. (United States)

    Gould, Dinah J; Moralejo, Donna; Drey, Nicholas; Chudleigh, Jane H


    Health care-associated infection is a major cause of morbidity and mortality. Hand hygiene is regarded as an effective preventive measure. To update the review done in 2007, to assess the short and longer-term success of strategies to improve hand hygiene compliance and to determine whether a sustained increase in hand hygiene compliance can reduce rates of health care-associated infection. We conducted electronic searches of: the Cochrane Central Register of Controlled Trials; the Cochrane Effective Practice and Organisation of Care Group specialised register of trials; MEDLINE; PubMed; EMBASE; CINAHL; and the BNI. Originally searched to July 2006, for the update databases were searched from August 2006 until November 2009. Randomised controlled trials, controlled clinical trials, controlled before and after studies, and interrupted time series analyses meeting explicit entry and quality criteria used by the Cochrane Effective Practice and Organisation of Care Group were eligible for inclusion. Studies reporting indicators of hand hygiene compliance and proxy indicators such as product use were considered. Self-reported data were not considered a valid measure of compliance. Studies to promote hand hygiene compliance as part of a care bundle approach were included, providing data relating specifically to hand hygiene were presented separately. Studies were excluded if hand hygiene was assessed in simulations, non-clinical settings or the operating theatre setting. Two reviewers independently extracted data and assessed data quality. Four studies met the criteria for the review: two from the original review and two from the update. Two studies evaluated simple education initiatives, one using a randomized clinical trial design and the other a controlled before and after design. Both measured hand hygiene compliance by direct observation. The other two studies were both interrupted times series studies. One study presented three separate interventions within the

  5. Menstrual Hygiene Practices and Sources of Menstrual Hygiene Information among Adolescent Secondary School Girls in Abakaliki Education Zone of Ebonyi State (United States)

    Ilo, Cajetan I.; Nwimo, Ignatius O.; Onwunaka, Chinagorom


    Menstruation is clouded by socio-cultural restrictions resulting in adolescent girls remaining ignorant of hygienic practices. The study was designed to ascertain the menstrual hygiene practices and sources of menstrual hygiene information among 1200 adolescent secondary school girls, who completed the questionnaire designed for the study. Out of…

  6. A randomized trial to determine the impact of a 5 moments for patient hand hygiene educational intervention on patient hand hygiene. (United States)

    Rai, Herleen; Knighton, Shanina; Zabarsky, Trina F; Donskey, Curtis J


    We conducted a randomized trial of a simple educational intervention encouraging patients to perform hand hygiene at 5 specific moments, including on entry of health care personnel into their room as a reminder of the importance of hand hygiene. The intervention resulted in a significant increase in patient hand hygiene. Published by Elsevier Inc.

  7. Adherence to hand hygiene guidelines - significance of measuring fidelity. (United States)

    Korhonen, Anne; Ojanperä, Helena; Puhto, Teija; Järvinen, Raija; Kejonen, Pirjo; Holopainen, Arja


    The aim was to evaluate the usability of fidelity measures in compliance evaluation of hand hygiene. Adherence to hand hygiene guidelines is important in terms of patient safety. Compliance measures seldom describe how exactly the guidelines are followed. A cross-sectional observation study in a university hospital setting was conducted. Direct observation by trained staff was performed using a standardised observation form supplemented by fidelity criteria. A total of 830 occasions were observed in 13 units. Descriptive statistics (frequency, mean, percentages and range) were used as well as compliance rate by using a standard web-based tool. In addition, the binomial standard normal deviate test was conducted for comparing different methods used in evaluation of hand hygiene and in comparison between professional groups. Measuring fidelity to guidelines was revealed to be useful in uncovering gaps in hand hygiene practices. The main gap related to too short duration of hand rubbing. Thus, although compliance with hand hygiene guidelines measured using a standard web-based tool was satisfactory, the degree of how exactly the guidelines were followed seemed to be critical. Combining the measurement of fidelity to guidelines with the compliance rate is beneficial in revealing inconsistency between optimal and actual hand hygiene behaviour. Evaluating fidelity measures is useful in terms of revealing the gaps between optimal and actual performance in hand hygiene. Fidelity measures are suitable in different healthcare contexts and easy to measure according to the relevant indicators of fidelity, such as the length of hand rubbing. Knowing the gap facilitates improvements in clinical practice. © 2015 John Wiley & Sons Ltd.

  8. Hand hygiene prior to contact lens handling is problematical. (United States)

    McMonnies, Charles W


    To establish guidelines for contact lens wearers' hand hygiene practices which achieve a balance between minimising risk of infection and reasonable expectations on the ability of patients to follow them. Evidence has been obtained from publications via PubMed, Advanced Medline Search, Cochrane Reviews, Google Scholar and using the key words hand hygiene, washing and contact lens. Guidelines for effective hand washing and the bother involved vary according to the level of hygiene required. High levels of non-compliance with hand hygiene practices, even among healthcare workers, gives an indication of how important the level of bother involved when following guidelines can be in contributing to non-compliance. Better patient education to improve hand washing techniques as well as patient attitudes toward hand hygiene are needed to reduce high non-compliance levels. Better hand hygiene techniques and higher frequency of their application give the prospect of reduced risk of infection and of any discomfort that arises from increased lens and ocular bioburden. In order that adoption rates might be maximised, the guidelines which have been distilled from this review attempt to strike a balance between technique redundancy and the associated higher levels of hygiene achieved and the possibility that the perception of too much bother involved could reduce participation rates. The guidelines have been expanded by the inclusion of suggested explanatory information in the expectation that helping patients to understand why the recommendations are made will have the effect of increasing their adoption. Copyright © 2011 British Contact Lens Association. Published by Elsevier Ltd. All rights reserved.

  9. Dicty_cDB: VSH706 [Dicty_cDB

    Lifescience Database Archive (English)


  10. Dicty_cDB: VSH879 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vegetative cDNA clone:VS... 58 3e-04 1 ( FG283397 ) 1108770600507 New World Screwworm Egg 9261 ESTs C... 38... 0.012 2 ( FG301147 ) 1108799260169 New World Screwworm Larvae 9387 EST... 38 0.013 2 ( FG297431 ) 1108793286826 New World

  11. Dicty_cDB: VSH111 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tskrnrclk*ihqk y*igr*it*rgrkeskin*rdsft*nlfhlkrkiksktfinh*rsfn*ikitnftkfy*y vnlifrvvlsssaynnnnnnnyvpk*lifkkl...nklkn**i*kk--- ---ksti**ccy*tkigsn*ryh**ft*r*psl*rlysls*rg*rlkiitskrnrclk*i hqky*igr*it*rgrkeskin*rdsft*nlfh

  12. Dicty_cDB: VSH682 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gsnyrvslglpvgavmnsadnsgaknlyviavkgikgrlnrlpsagvgdmv matvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgnil...iavkgikgrlnrlpsagvg dmvmatvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgnilg pvakecsdlwpkvatnagtiv*inthk

  13. The impact of an oral hygiene education module on patient practices and nursing documentation. (United States)

    Coke, Lola; Otten, Karine; Staffileno, Beth; Minarich, Laura; Nowiszewski, Candice


    Oral hygiene is inconsistent among patients with cancer and is a national patient care issue. To promote comfort and nutritional status, oral hygiene for patients with cancer is important. The purpose of this study was to develop an evidence-based oral hygiene educational module (EM) for nursing and patient care technician (PCT) staff to promote consistent oral hygiene patient education; evaluate patient understanding of oral hygiene practices post-EM; and determine staff documentation frequency of oral hygiene care. Pre- and post-EM data were collected using a developed oral hygiene assessment tool; nursing documentation data were collected by chart review. Post-EM data were collected eight weeks post-EM. Data were analyzed using frequencies and the Mann-Whitney U test. Twenty-two patient documentation pairs were collected. Compared to pre-EM, admission teaching, patient education, and patient oral hygiene practices improved post-EM. Post-EM oral hygiene documentation and PCT teaching increased.

  14. Compliance and Subjective Patient Responses to Eyelid Hygiene. (United States)

    Alghamdi, Yousef A; Camp, Andrew; Feuer, William; Karp, Carol L; Wellik, Sarah; Galor, Anat


    Lid hygiene is a commonly prescribed first-line therapy in patients with lid margin disease, yet compliance with therapy is not well characterized. The goals of this study were to assess patient compliance with lid hygiene and evaluate which factors predict a favorable symptomatic response to treatment. This was a cross-sectional study of patients seen in the Miami Veterans Affairs eye clinic between August and December 2014. An evaluation was performed to assess dry eye symptoms and lid margin signs. All patients were then instructed to perform warm compresses and lid scrubs. A follow-up phone survey assessed compliance and subjective therapeutic response 6 weeks later. Two hundred seven of 211 (98%) patients (94% male, 60% white) completed the survey. Of the 207 patients, 188 (91%) completed the follow-up survey. Compliance with therapy was reported in 104 patients (55%); 66 reported complete improvement, 30 partial improvement, and 8 no improvement in symptoms. Patients who self-reported dry eye symptoms at first visit (n=86, 74%) were more likely to be compliant with lid hygiene than those who did not report symptoms (n=18, 25%) (Phygiene was longer time of self-reported dry eye symptoms. None of the other signs studied, including the presence of skin rosacea and lid margin telangiectasia, were associated with a differential response to lid hygiene. Patients with dry eye symptoms were moderately compliant with lid hygiene, and patients who performed the routine noted improvement in symptoms.

  15. Effect of hand sanitizer location on hand hygiene compliance. (United States)

    Cure, Laila; Van Enk, Richard


    Hand hygiene is the most important intervention to prevent infection in hospitals. Health care workers should clean their hands at least before and after contact with patients. Hand sanitizer dispensers are important to support hand hygiene because they can be made available throughout hospital units. The aim of this study was to determine whether the usability of sanitizer dispensers correlates with compliance of staff in using the sanitizer in a hospital. This study took place in a Midwest, 404-bed, private, nonprofit community hospital with 15 inpatient care units in addition to several ambulatory units. The usability and standardization of sanitizers in 12 participating inpatient units were evaluated. The hospital measured compliance of staff with hand hygiene as part of their quality improvement program. Data from 2010-2012 were analyzed to measure the relationship between compliance and usability using mixed-effects logistic regression models. The total usability score (P = .0046), visibility (P = .003), and accessibility of the sanitizer on entrance to the patient room (P = .00055) were statistically associated with higher observed compliance rates. Standardization alone showed no significant impact on observed compliance (P = .37). Hand hygiene compliance can be influenced by visibility and accessibility of dispensers. The sanitizer location should be part of multifaceted interventions to improve hand hygiene. Copyright © 2015 Association for Professionals in Infection Control and Epidemiology, Inc. Published by Elsevier Inc. All rights reserved.

  16. Relationship between oral hygiene and gingival condition of Malaysian students

    Directory of Open Access Journals (Sweden)

    Muhammad Arif Mohd Marsin


    Full Text Available The primary etiologic agent of gingival disease was dental plaque which also involving the oral hygiene. The oral hygiene can be affected by individuals knowledge, attitude, practice, environment, and others. The purpose of this study was to assess the relationship between oral hygiene and gingival condition of Malaysian students. The type of this study was cross-sectional study. The study was conducted on a total of 66 Malaysian students. The data were collected by using an examination form and clinical examination using the Loe & Sillness gingival index followed by the Loe & Sillness plaque index. The results showed that 100% of students have gingivitis with the gingival index average of 1.25 and the plaque index average of 1.85. The relationship of gingival and plaque index was analyzed by using Spearman’s Rank Correlation Coefficient test, and the score was 0.623. It is concluded that the oral hygiene status of Malaysian students was in the fair category, and all Malaysian students had a moderate gingivitis. Also, there was a relationship between the oral hygiene status and gingival condition of Malaysian students.

  17. Dirt, disgust and disease: a natural history of hygiene. (United States)

    Curtis, Valerie A


    Hygiene has been studied from multiple perspectives, including that of history. I define hygiene as the set of behaviours that animals, including humans, use to avoid infection. I argue that it has an ancient evolutionary history, and that most animals exhibit such behaviours because they were adaptive. In humans, the avoidance of infectious threats is motivated by the emotion of disgust. Intuition about hygiene, dirt and disease can be found underlying belief about health and disease throughout history. Purification ritual, miasma, contagion, zymotic and germ theories of disease are ideas that spread through society because they are intuitively attractive, because they are supported by evidence either from direct experience or from authoritative report and because they are consistent with existing beliefs. In contrast to much historical and anthropological assertion, I argue that hygiene behaviour and disgust predate culture and so cannot fully be explained as its product. The history of ideas about disease thus is neither entirely socially constructed nor an "heroic progress" of scientists leading the ignorant into the light. As an animal behaviour the proper domain of hygiene is biology, and without this perspective attempts at explanation are incomplete. The approaches of biological anthropology have much to offer the practice of cultural history.

  18. Hand hygiene in hospital environments: use of conformity indicators

    Directory of Open Access Journals (Sweden)

    Thaíne Cristina Romualdo dos SANTOS

    Full Text Available An exploratory descriptive study with a quantitative approach whose objective was to use indicators to evaluate the frequency and infrastructure for hand hygiene, as well as the nursing team's knowledge about the subject. Systematized observation was carried out at hospital in the state of São Paulo, Brazil of the routine activities of 33 participating professionals (nurses and technicians as well as the application of an individual questionnaire about the subject.1206 opportunities for hand hygiene were identified, though it was effected in only 481 (39.9% of them. Alcohol solution was not used at any opportunity. The infrastructure indicator for hand hygiene was close to the ideal value (83.3%. The professionals reported a high frequency of hand hygiene, demonstrating knowledge in relation to its importance, yet contradicting the findings of the observation. It was concluded that, despite the adequate infrastructure, hand hygiene was below that expected, requiring actions and strategies to overcomes these barrier and increase the use of alcohol solution.

  19. New technology markedly improves hand-hygiene performance among healthcare workers after restroom visits. (United States)

    Møller-Sørensen, H; Korshin, A; Mogensen, T; Høiby, N


    The risks to patients from pathogens present on healthcare workers' (HCWs') hands are high; however, compliance with hand hygiene among HCWs is low. We devised a prospective intervention trial of a new hand-hygiene dispensing technology to improve HCWs' compliance with hand hygiene. Baseline hand-hygiene compliance was observed for three months before and after an intervention consisting of implementation of an electronic device that reminds people to comply with hand hygiene after restroom visits. Compliance in hand-hygiene performance after restroom visits increased among HCWs from 66% to 91% after the intervention. Copyright © 2016 The Healthcare Infection Society. Published by Elsevier Ltd. All rights reserved.

  20. An elicitation study of critical care nurses' salient hand hygiene beliefs. (United States)

    Piras, Susan E; Lauderdale, Jana; Minnick, Ann


    To describe critical care nurses' hand hygiene attitudinal, normative referent, and control beliefs. Hand hygiene is the primary strategy to prevent healthcare-associated infections. Social influence is an underdeveloped hand hygiene strategy. This qualitative descriptive study was conducted with 25 ICU nurses in the southeastern United States. Data were collected using the Nurses' Salient Belief Instrument. Thematic analysis generated four themes: Hand Hygiene is Protective; Nurses look to Nurses; Time-related Concerns; and Convenience is Essential. Nurses look to nurses as hand hygiene referents and believe hand hygiene is a protective behaviour that requires time and functional equipment. Copyright © 2017 Elsevier Ltd. All rights reserved.

  1. Self-reported oral hygiene practices among adults in Denmark

    DEFF Research Database (Denmark)

    Christensen, Lisa Bøge; Petersen, Poul Erik; Krustrup, Ulla


    OBJECTIVES: To assess the present level of oral hygiene practices in the Danish adult population aged 16 or above, in particular to analyse how self-care practices in terms of oral hygiene habits and cleaning of dentures are affected by socio-economic factors, dental status, actual dental visiting...... habits, and the experience of oral health care during school years. BASIC RESEARCH DESIGN AND PARTICIPANTS: A cross-sectional study of 5802 persons, randomly sampled amongst the Danish population aged 16 years or above. Data were collected by means of personal interviews and self......-administered questionnaires. The response rate was 66%. RESULTS: Toothbrushing twice-a-day was reported by 68% of the dentates while 32% brushed their teeth once-a-day or less frequent. Daily use of toothpicks was reported by 28% while daily use of dental floss was reported by 11%. Oral hygiene habits were more frequent...

  2. Impact of Oral Hygiene Discontinuation on Supragingival and Salivary Microbiomes

    DEFF Research Database (Denmark)

    Belstrøm, D; Sembler-Møller, M L; Grande, M A


    of oral hygiene. Supragingival and salivary microbiotas were processed by next-generation sequencing (Human Oral Microbe Identification using Next Generation Sequencing) and microbial community profiles were compared. Microbial composition of supragingival plaque samples collected after 4, 7, and 10 d......The purpose of the present study was to characterize and compare supragingival and salivary microbiotas during a 10-d period of oral hygiene discontinuation. We tested the hypothesis that the composition of the salivary microbiota will reflect local microbial changes associated with accumulated...... biofilm formation and maturation. Pooled supragingival plaque (n = 145) and stimulated saliva (n = 145) samples were collected and plaque and gingival indices were recorded from 29 orally healthy individuals at baseline, during oral hygiene discontinuation (days 4, 7, and 10), and 14 d after resumption...

  3. Effects of materials containing antimicrobial compounds on food hygiene. (United States)

    Møretrø, Trond; Langsrud, Solveig


    Surfaces with microorganisms may transfer unwanted microorganisms to food through cross-contamination during processing and preparation. A high hygienic status of surfaces that come in contact with food is important in order to reduce the risk of cross-contamination. During the last decade, products containing antimicrobial compounds, such as cutting boards, knives, countertops, kitchen utensils, refrigerators, and conveyor belts, have been introduced to the market, claiming hygienic effects. Such products are often referred to as "treated articles." Here we review various aspects related to treated articles intended for use during preparation and processing of food. Regulatory issues and methods to assess antibacterial effects are covered. Different concepts for treated articles as well as their antibacterial activity are reviewed. The effects of products with antimicrobials on food hygiene and safety are discussed. Copyright ©, International Association for Food Protection

  4. Oral hygiene in patients with chronic obstructive pulmonary disease

    DEFF Research Database (Denmark)

    Pedersen, Preben Ulrich; Uhrenfeldt, Lisbeth; Larsen, Palle


    SCOPING REVIEW OBJECTIVE: It is hypothesized that systematic oral hygiene may reduce airway infections in patients with chronic obstructive pulmonary disease (COPD). Before considering doing a systematic review, a scoping review is necessary to explore and map literature on the subject and identify......-invasive interventions that have been carried out to improve oral hygiene and relieve and/or reduce respiratory tract infections, exacerbation and/or hospital readmission in patients with diagnosed with COPD. A further objective is to undertake a comprehensive search to identify qualitative literature reporting...... on the experiences of oral hygiene in people diagnosed with COPD and/or their relatives and/or healthcare providers (HCPs).Specifically, the scoping review questions are as follows....

  5. Looking for evidence that personal hygiene precautions prevent traveler's diarrhea. (United States)

    Shlim, David R


    In the 50 years during which traveler's diarrhea has been studied, it has always been assumed that personal hygiene precautions can prevent or reduce the likelihood of developing traveler's diarrhea. However, 7 of 8 studies that specifically addressed this issue showed no correlation between the types of food selected and the risk of acquiring traveler's diarrhea. The eighth study showed a correlation between a few dietary mistakes and a decreased risk of acquiring traveler's diarrhea. A further increase in the number of dietary mistakes, however, did not continue to increase the risk of acquiring traveler's diarrhea. Personal hygiene precautions, when performed under the direct supervision of an expatriate operating his or her own kitchen, can prevent traveler's diarrhea, but poor restaurant hygiene in most developing countries continues to create an insurmountable risk of acquiring traveler's diarrhea.

  6. Sleep hygiene use in a psychiatry outpatient setting.

    LENUS (Irish Health Repository)

    Lyne, J


    Non-pharmacological measures are recommended prior to use of hypnotics in the latest NICE guidance. This study investigated if non-pharmacological measures are utilised prior to hypnotic prescribing in a general adult psychiatry outpatient setting, and further reviewed patient\\'s sleep quality following implementation of sleep hygiene education. Interviews were conducted with 85 patients, and poor adherence with NICE guidance was found among the 74 (87%) patients previously prescribed a hypnotic. Just five (6.8%) patients recalled use of non-pharmacological measures prior to hypnotic prescription, 47 (63.5%) indicated non-pharmacological measures had not been discussed, while a further 22 (29.7%) could not remember. Improvement in Pittsburgh Sleep Quality Index scores following implementation of sleep hygiene education was also noted (P = 0.03). These findings suggest that increased awareness of sleep hygiene education for clinicians may be beneficial.

  7. Radiation hygiene of animal production in normal and emergency situations

    International Nuclear Information System (INIS)

    Stajicj, J.; Petrovicj, B.; Draganovicj, B.


    Radiation hazards imposed by contemporary development and peaceful and military uses of nuclear energy have implied the introduction of radiational control in animal production, and radiation-hygienic expertize of animal products and animal foodstuffs. Various treatments in scientific research, education and uses of relevant equipment, undertaken in right time, enabled our Veterinary services to start successfully to solve problems of radiation control and protection of animal production in normal and emergency situations. An important role in this context has the Section of Radiation Hygiene Yugoslav Veterinary Association, as an initiator of many activities that are intended to affirme Radiation Hygiene in the domain of scientific research and in the field of national defence and self-protection

  8. Safety, security, hygiene and privacy in migrant farmworker housing. (United States)

    Arcury, Thomas A; Weir, Maria M; Summers, Phillip; Chen, Haiying; Bailey, Melissa; Wiggins, Melinda F; Bischoff, Werner E; Quandt, Sara A


    Safety, security, hygiene, and privacy in migrant farmworker housing have not previously been documented, yet these attributes are important for farmworker quality of life and dignity. This analysis describes the safety, security, hygiene, and privacy of migrant farmworker housing and delineates camp characteristics that are associated with these attributes, using data collected in 183 eastern North Carolina migrant farmworker camps in 2010. Migrant farmworker housing is deficient. For example, 73.8 percent of housing had structural damage and 52.7 percent had indoor temperatures that were not safe. Farmworkers in 83.5 percent of the housing reported that they did not feel they or their possessions were secure. Bathing or toileting privacy was absent in 46.2 percent of the housing. Camps with residents having H-2A visas or North Carolina Department of Labor certificates of inspection posted had better safety, security, and hygiene. Regulations addressing the quality of migrant farmworker housing are needed.

  9. Comparison of hand hygiene procedures for removing Bacillus cereus spores. (United States)

    Sasahara, Teppei; Hayashi, Shunji; Hosoda, Kouichi; Morisawa, Yuji; Hirai, Yoshikazu


    Bacillus cereus is a spore-forming bacterium. B. cereus occasionally causes nosocomial infections, in which hand contamination with the spores plays an important role. Therefore, hand hygiene is the most important practice for controlling nosocomial B. cereus infections. This study aimed to determine the appropriate hand hygiene procedure for removing B. cereus spores. Thirty volunteers' hands were experimentally contaminated with B. cereus spores, after which they performed 6 different hand hygiene procedures. We compared the efficacy of the procedures in removing the spores from hands. The alcohol-based hand-rubbing procedures scarcely removed them. The soap washing procedures reduced the number of spores by more than 2 log10. Extending the washing time increased the spore-removing efficacy of the washing procedures. There was no significant difference in efficacy between the use of plain soap and antiseptic soap. Handwashing with soap is appropriate for removing B. cereus spores from hands. Alcohol-based hand-rubbing is not effective.

  10. Hand hygiene for the prevention of nosocomial infections. (United States)

    Kampf, Günter; Löffler, Harald; Gastmeier, Petra


    The WHO regards hand hygiene as an essential tool for the prevention of nosocomial infection, but compliance in clinical practice is often low. The relevant scientific literature and national and international evidence-based recommendations (Robert Koch Institute [Germany], WHO) were evaluated. Hygienic hand disinfection has better antimicrobial efficacy than hand-washing and is the procedure of choice to be performed before and after manual contact with patients. The hands should be washed, rather than disinfected, only when they are visibly soiled. Skin irritation is quite common among healthcare workers and is mainly caused by water, soap, and prolonged wearing of gloves. Compliance can be improved by training, by placing hand-rub dispensers at the sites where they are needed, and by physicians setting a good example for others. Improved compliance in hand hygiene, with proper use of alcohol-based hand rubs, can reduce the nosocomial infection rate by as much as 40%.

  11. Psychometric properties of the Adolescent Sleep Hygiene Scale. (United States)

    Storfer-Isser, Amy; Lebourgeois, Monique K; Harsh, John; Tompsett, Carolyn J; Redline, Susan


    This study evaluated the psychometric properties of the Adolescent Sleep Hygiene Scale (ASHS), a self-report measure assessing sleep practices theoretically important for optimal sleep. Data were collected on a community sample of 514 adolescents (16-19; 17.7 ± 0.4 years; 50% female) participating in the late adolescent examination of a longitudinal study on sleep and health. Sleep hygiene and daytime sleepiness were obtained from adolescent reports, behavior from caretaker reports, and sleep-wake estimation on weekdays from wrist actigraphy. Confirmatory factor analysis indicated the empirical and conceptually based factor structure were similar for six of the eight proposed sleep hygiene domains. Internal consistency of the revised scale (ASHSr) was α = 0.84; subscale alphas were: physiological: α = 0.60; behavioural arousal: α = 0.62; cognitive/emotional: α = 0.81; sleep environment: α = 0.61; sleep stability: α = 0.68; daytime sleep: α = 0.78. Sleep hygiene scores were associated positively with sleep duration (r = 0.16) and sleep efficiency (r = 0.12) and negatively with daytime sleepiness (r = -0.26). Results of extreme-groups analyses comparing ASHSr scores in the lowest and highest quintile provided further evidence for concurrent validity. Correlations between sleep hygiene scores and caretaker reports of school competence, internalizing and externalizing behaviours provided support for convergent validity. These findings indicate that the ASHSr has satisfactory psychometric properties for a research instrument and is a useful research tool for assessing sleep hygiene in adolescents. © 2013 European Sleep Research Society.

  12. Assessment of tobacco dependence curricula in Italian dental hygiene schools. (United States)

    Pizzo, Giuseppe; Davis, Joan M; Licata, Maria E; Giuliana, Giovanna


    The aim of this study was to assess the level of tobacco dependence education offered by Italian dental hygiene programs. A fifty-question survey was mailed to the thirty-one active public and private dental hygiene programs in Italy during the 2008-09 academic year. The survey assessed faculty confidence in teaching tobacco treatment, which courses contained tobacco dependence content, the number of minutes spent on specific content areas, and the level of clinical competence that dental hygiene graduates should be able to demonstrate. Surveys were returned by sixteen programs for a response rate of 52 percent. Respondents indicated tobacco dependence education was included in clinic or clinic seminar (56 percent), periodontics (44 percent), oral pathology (31 percent), and prevention (19 percent). All programs reported including the effects of tobacco on general and oral diseases in courses. However, more in-depth topics received less curriculum time; these included tobacco treatment strategies (63 percent) and discussion of cessation medications (31 percent). Interestingly, 62 percent of the respondents indicated they expected dental hygiene graduates to demonstrate a tobacco treatment competency level of a moderate intervention or higher (counseling, discussion of medications, follow-up) rather than a brief intervention in which patients are advised to quit then referred to a quitline. The results of this study indicated that Italian dental hygiene students are not currently receiving adequate instruction in tobacco treatment techniques nor are they being adequately assessed. This unique overview of Italian dental hygiene tobacco dependence education provides a basis for further discussion towards a national competency-based curriculum.

  13. Hand hygiene in the nursery during diaper changing. (United States)

    Phang, Koh Ni; Maznin, Nur Liyanna; Yip, Wai Kin


    This project aimed to improve hand hygiene practice during diaper changing among nurses working in the nursery. This project was conducted in one of the nurseries in a 935-bed acute care hospital with a sample of 15 nurses. A pre- and post-intervention audit was conducted utilising the Joanna Briggs Institute Practical Application of Clinical Evidence System and Getting Research into Practice module. A revised written workflow, which specified the occasions and process for hand hygiene during diaper changing, was introduced. Modifications to the baby bassinets and nursery were made after barriers to good hand hygiene were identified. The project was carried out over 4 months, from March to June 2011. The post-intervention audit results show an improvement in performing hand washing after changing diapers (20%) and performing the correct steps of hand rubbing (25%). However, the compliance rates decreased for the other criteria that measured whether hand rubbing or hand washing was performed prior to contacting the infant and after wrapping the infant, and whether hand washing was performed correctly. The improvement in compliance with hand washing--the main focus of the new workflow--after changing diapers was especially significant. The results indicated that having a workflow on the occasions and process for hand hygiene during diaper changing was useful in standardising practice. Pre- and post-implementation audits were effective methods for evaluating the effect of translating evidence into practice. However, this project had limited success in improving compliance with hand hygiene. This suggested that more effort is needed to reinforce the importance of hand hygiene and compliance to the proposed workflow. In addition, this project showed that for change to take place successfully, environmental modifications, increased awareness and adequate communication to every staff member are essential. © 2012 The Authors. International Journal of Evidence

  14. The hygienic quality of raw reindeer milk

    Directory of Open Access Journals (Sweden)

    Joanna Kurki


    Full Text Available The somatic cell count (SCC and total bacterial count (TBC as well as the presence of major food-borne pathogens and udder pathogens in reindeer raw milk were studied. Two groups of 4 female reindeer were milked on alternate days for six weeks. A milk sample from each quarter was taken before milking and of the bulk milk at the end of milking. Micrococcus sp. was observed in one, Staphylococcus aureus in one and coagulase-negative staphylococci in five of the quarter samples (n=318. In the bulk milk (n=19 TBC varied between 700 and 1 700 000 cfu (colony forming units/ml and SCC between 52 000 and 183 000 cells/ml. No Bacillus cereus, S. aureus or Listeria monocytogenes were detected in the bulk milk, but Escherichia coli and Enterobacteriaceae were found in 5 bulk milk samples. According to the bacteriological examination the udder health of the reindeer was good. Indicative information on the SCC of healthy reindeer was obtained. None of the common potential food-poisoning bacteria were found in raw milk. There was great variation in the bulk milk TBC and the average TBC was rather high (ca. 300 000 cfu/ml. The hygienic quality of raw reindeer milk makes it well suited for food manufacture. However, the results indicate that the milking conditions may be crucial for the quality of raw milk.Abstract in Finnish / Yhteenveto:Tutkimuksen kohteena oli poron raakamaidon solupitoisuus ja kokonaispesäkeluku sekä tärkeimpien elintarvike- ja utarepatogeenien esiintyminen raakamaidossa. Kaksi 4 vaatimen ryhmää lypsettiin vuoropäivinä 6 viikon ajan. Ennen lypsyä vaatimista otettiin vedinkohtaiset näytteet ja lypsyn päätyttyä näyte yhteismaidosta. Micrococcus sp. todettiin yhdessä, Staphylococcus aureus yhdessä ja koagulaasinegatiivisia stafylokokkeja viidessä vedinkohtaisessa näytteessä (n=318. Yhteismaitonäytteiden (n=19 kokonaispesäkeluvut vaihtelivat välillä 700-1 700 000 pmy (pesäkkeitä muodostava yksikkö/ml ja somaattisten

  15. Hygienic significance of radiostability as measures of adaptive feasibilities

    International Nuclear Information System (INIS)

    Kudritskij, Yu.K.


    An attempt is made to substantiate hygienic significance of radiostability analysis as measures of adaptive feasibilities variation under the low dose ionizing radiation effect (IR). Examples of this substantiation are presented. Not only biological radiation effects but social adaptivity problems may be analysed. With more information adaptive feasibilities of human body to radiation factor are extended, its radiostability increases. Analysis of the state of adaptive feasibilities and their development estimation are vital problems of radiation hygiene, the basis for regulation and normalization of radiation factor

  16. Industrial hygiene survey. IMC, Agricultural Operation Division, Bartow, Florida

    International Nuclear Information System (INIS)

    Stephenson, F.; Cassady, M.


    An industrial hygiene survey was conducted at the Agricultural Operations Division, IMC, Bartow, Florida, on July 19-22, 1976, as part of the industry-wide study of the phosphate fertilizer industry. The phosphate ore mining operations, the plant, and the medical, safety, and industrial hygiene programs are described. The beneficiation plant was surveyed to determine the 8-hour time weighted averages of cadmium, chromium, vanadium, fluoride, arsenic, and silica. General area samples were taken for uranium and alpha-radiation. With the exception of uranium in the grinding area, all other elements analyzed came within the OSHA standards. However, several results exceed the NIOSH recommended standard

  17. Industrial hygiene survey. CF Chemicals, Inc., Bartow, Florida

    International Nuclear Information System (INIS)

    Stephenson, F.; Cassady, M.


    An industrial hygiene survey was conducted by NIOSH at CF Chemicals, Bartow, Florida on August 9-12, 1976 as part of a study of the phosphate industry. A description is given of the plant, and the medical, safety, and industrial hygiene programs. During the study, 8-hour time weighted averages were determined for exposure to arsenic, cadmium, chromium, vanadium, phosphoric acid, and sulfuric acid for workers involved in cleaning out phosphoric acid reactor vessels. General area samples were collected for fluorides, radon, and uranium. The results came within the OSHA standards except for two fluoride samples

  18. Industrial hygiene survey. IMC, Phosphate Chemical Complex, New Wales, Florida

    International Nuclear Information System (INIS)

    Stephenson, F.; Cassady, M.


    An industrial hygiene survey was conducted by NIOSH at IMC Phosphate Chemical Complex, New Wales, Florida, on June 7-11, 1976, as part of a study of the phosphate industry. Phosphate fertilizer manufacturing, the plant, and the medical, safety, and industrial hygiene programs are described. During the study 8-hour time weighted averages were determined for exposure to arsenic, cadmium, chromium, vanadium, phosphoric acid, and sulfuric acid for workers involved in cleaning out phosphoric acid reactor vessels. General area samples were collected for fluorides, radon, and uranium. Several samples were above the NIOSH recommended levels for arsenic and chromium

  19. Hygienic training of population being victims of the Chernobyl accident

    International Nuclear Information System (INIS)

    Terman, A.V.; Mozgovaya, A.V.; Polesskij, V.A.


    Study results on the role of social factors in formation of attitude to own health and its self-evaluation by the population of the regions, subjected to impact of the Chernobyl NPP accident. An extremely important component block is determined in the programs on hygienic training of the population being victims of the accident, namely, adequate information of the public on dose-effect dependencies, on radionuclide behaviour in the environmental objects, on possible measures for reduction of undesirable effects. Necessity is noted of transfer from universal programs of hygienic training to differential ones up to individual training

  20. Manual of analytical methods for the Industrial Hygiene Chemistry Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Greulich, K.A.; Gray, C.E. (comp.)


    This Manual is compiled from techniques used in the Industrial Hygiene Chemistry Laboratory of Sandia National Laboratories in Albuquerque, New Mexico. The procedures are similar to those used in other laboratories devoted to industrial hygiene practices. Some of the methods are standard; some, modified to suit our needs; and still others, developed at Sandia. The authors have attempted to present all methods in a simple and concise manner but in sufficient detail to make them readily usable. It is not to be inferred that these methods are universal for any type of sample, but they have been found very reliable for the types of samples mentioned.

  1. [A photographic competition on hand hygiene in a nursing home]. (United States)

    Guerre, Graziella; Aho-Glele, Ludwig-Serge; Astruc, Karine


    Hand hygiene is often considered as the attribute of caregivers. However, it is the patient who is increasingly targeted by improved communication around hygiene in care notably in the framework of the "Clean Hands Mission". In this sense, the French regional centres for the fight against nosocomial infections in Burgundy has proved itself innovative on two levels by organising a photo competition in nursing homes. The aim was to show residents how to prevent care-related infections through the simple act of handwashing. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  2. Manual of analytical methods for the Industrial Hygiene Chemistry Laboratory

    International Nuclear Information System (INIS)

    Greulich, K.A.; Gray, C.E.


    This Manual is compiled from techniques used in the Industrial Hygiene Chemistry Laboratory of Sandia National Laboratories in Albuquerque, New Mexico. The procedures are similar to those used in other laboratories devoted to industrial hygiene practices. Some of the methods are standard; some, modified to suit our needs; and still others, developed at Sandia. The authors have attempted to present all methods in a simple and concise manner but in sufficient detail to make them readily usable. It is not to be inferred that these methods are universal for any type of sample, but they have been found very reliable for the types of samples mentioned

  3. Eat dirt and avoid atopy: the hygiene hypothesis revisited. (United States)

    Patki, Anil


    The explosive rise in the incidence of atopic diseases in the Western developed countries can be explained on the basis of the so-called "hygiene hypothesis". In short, it attributes the rising incidence of atopic dermatitis to reduced exposure to various childhood infections and bacterial endotoxins. Reduced exposure to dirt in the clean environment results in a skewed development of the immune system which results in an abnormal allergic response to various environmental allergens which are otherwise innocuous. This article reviews the historical aspects, epidemiological and immunological basis of the hygiene hypothesis and implications for Indian conditions.


    Evdokimov, V I; Popov, V I; Rut, A N


    There was analyzed the array of 1548 dissertations on the scientific specialty 14.02.01 (former specification 14.00.07) "Hygiene". Over period of 2000-2014 to the Dissertation Committee in Russia there were annually submitted (103 ± 10) theses, which include (21 ± 3) doctoral dissertations and (83 ± 8) candidate dissertations. Doctoral dissertations accounted for 20,1%, dissertations in medicine--89.3%. There was established not only the decline in the number of theses in hygiene, but the reduction of their proportion in the total array of all medical and biological dissertations in Russia. The conjugacy of the trend curves of the total stream of dissertations in medicine and biology in Russia and in hygiene is considered to be not very high (r = 0.54). In the total structure of dissertation works on General Hygiene accounted for 22.7%, Community Hygiene--15.45%, Occupational Hygiene--19.6%, Children's and Adolescents' Hygiene--24.7%, Nutrition Hygiene--8.2%, Radiation Hygiene--2.3%, in Rural Hygiene--1.2%, Hospital Hygiene-- 3.4%, Military Hygiene--2.3% correspondingly. There is pointed the development gap between the research studies in hygiene and tendency in training of high class health care professionals' in Russia.

  5. A Prospective Controlled Trial of an Electronic Hand Hygiene Reminder System. (United States)

    Ellison, Richard T; Barysauskas, Constance M; Rundensteiner, Elke A; Wang, Di; Barton, Bruce


    Background.  The use of electronic hand hygiene reminder systems has been proposed as an approach to improve hand hygiene compliance among healthcare workers, although information on efficacy is limited. We prospectively assessed whether hand hygiene activities among healthcare workers could be increased using an electronic hand hygiene monitoring and reminder system. Methods.  A prospective controlled clinical trial was conducted in 2 medical intensive care units (ICUs) at an academic medical center with comparable patient populations, healthcare staff, and physical layout. Hand hygiene activity was monitored concurrently in both ICUs, and the reminder system was installed in the test ICU. The reminder system was tested during 3 administered phases including: room entry/exit chimes, display of real-time hand hygiene activity, and a combination of the 2. Results.  In the test ICU, the mean number of hand hygiene events increased from 1538 per day at baseline to 1911 per day (24% increase) with the use of a combination of room entry/exit chimes, real-time displays of hand hygiene activity, and manager reports (P performance returned to baseline (1473 hand hygiene events per day) during the follow-up phase. There was no significant change in hand hygiene activity in the control ICU during the course of the trial. Conclusions.  In an ICU setting, an electronic hand hygiene reminder system that provided real-time feedback on overall unit-wide hand hygiene performance significantly increased hand hygiene activity.

  6. Advocacy for the Provision of Dental Hygiene Services Within the Hospital Setting: Development of a Dental Hygiene Student Rotation. (United States)

    Juhl, Jacqueline A; Stedman, Lynn


    Educational preparation of dental hygiene students for hospital-based practice, and advocacy efforts promote inclusion of dental hygienists within hospital-based interdisciplinary health care teams. Although the value of attending to the oral care needs of patients in critical care units has been recognized, the potential impact of optimal oral health care for the general hospital population is now gaining attention. This article describes a hospital-based educational experience for dental hygiene students and provides advocacy strategies for inclusion of dental hygienists within the hospital interdisciplinary team. The dental hygienist authors, both educators committed to evidence-based oral health care and the profession of dental hygiene, studied hospital health care and recognized a critical void in oral health care provision within that setting. They collaboratively developed and implemented a hospital-based rotation within the curriculum of a dental hygiene educational program and used advocacy skills to encourage hospital administrators to include a dental hygiene presence within hospital-based care teams. Hospital-based dental hygiene practice, as part of interprofessional health care delivery, has the potential to improve patient well-being, shorten hospital stays, and provide fiscal savings for patients, institutions, and third party payers. Advocacy efforts can promote dental hygienists as members of hospital-based health care teams. Further research is needed to document: (1) patient outcomes resulting from optimal oral care provision in hospitals; (2) best ways to prepare dental hygienists for career opportunities within hospitals and other similar health care settings; and (3) most effective advocacy strategies to promote inclusion of dental hygienists within care teams. Copyright © 2016 Elsevier Inc. All rights reserved.

  7. A Survey of Hygiene Practices of Bakers in Amuwo Odofin Local ...

    African Journals Online (AJOL)

    A Survey of Hygiene Practices of Bakers in Amuwo Odofin Local Government ... pest control, hygiene of personnel, storage and waste management. Important as this strategy is in the food industry, little has been reported on the practice of ...

  8. ERC Safety and Hygiene Programs functional organization structure and mission statement

    International Nuclear Information System (INIS)

    Coleman, S.R.


    This document provides a description of the functions, structure, commitments, and goals of the Environmental Restoration Contractor Safety and Hygiene Program. The current structure of the ERC Safety and Hygiene organization is described herein

  9. Effectiveness of a multimodal hand hygiene campaign and obstacles to success in Addis Ababa, Ethiopia (United States)


    Background Hand hygiene is the cornerstone of infection control and reduces rates of healthcare associated infection. There are limited data evaluating hand hygiene adherence and hand hygiene campaign effect in resource-limited settings, especially in Sub-Saharan Africa. This study assessed the impact of implementing a World Health Organization (WHO)-recommended multimodal hand hygiene campaign at a hospital in Ethiopia. Methods This study included a before-and-after assessment of health care worker (HCW) adherence with WHO hand hygiene guidelines. It was implemented in three phases: 1) baseline evaluation of hand hygiene adherence and hospital infrastructure; 2) intervention (distribution of commercial hand sanitizer and implementation of an abbreviated WHO-recommended multimodal hand hygiene campaign); and 3) post-intervention evaluation of HCW hand hygiene adherence. HCWs’ perceptions of the campaign and hand sanitizer tolerability were assessed through a survey performed in the post-intervention period. Results At baseline, hand washing materials were infrequently available, with only 20% of sinks having hand-washing materials. There was a significant increase in hand hygiene adherence among HCWs following implementation of a WHO multimodal hand hygiene program. Adherence increased from 2.1% at baseline (21 hand hygiene actions/1000 opportunities for hand hygiene) to 12.7% (127 hand hygiene actions /1000 opportunities for hand hygiene) after the implementation of the hand hygiene campaign (OR = 6.8, 95% CI 4.2-10.9). Hand hygiene rates significantly increased among all HCW types except attending physicians. Independent predictors of HCW hand hygiene compliance included performing hand hygiene in the post-intervention period (aOR = 5.7, 95% CI 3.5-9.3), in the emergency department (aOR = 4.9, 95% CI 2.8-8.6), during patient care that did not involve Attending Physician Rounds (aOR = 2.4, 95% CI 1.2-4.5), and after patient contact (aOR = 2

  10. Effectiveness of a multimodal hand hygiene campaign and obstacles to success in Addis Ababa, Ethiopia. (United States)

    Schmitz, Karen; Kempker, Russell R; Tenna, Admasu; Stenehjem, Edward; Abebe, Engida; Tadesse, Lia; Jirru, Ermias Kacha; Blumberg, Henry M


    Hand hygiene is the cornerstone of infection control and reduces rates of healthcare associated infection. There are limited data evaluating hand hygiene adherence and hand hygiene campaign effect in resource-limited settings, especially in Sub-Saharan Africa. This study assessed the impact of implementing a World Health Organization (WHO)-recommended multimodal hand hygiene campaign at a hospital in Ethiopia. This study included a before-and-after assessment of health care worker (HCW) adherence with WHO hand hygiene guidelines. It was implemented in three phases: 1) baseline evaluation of hand hygiene adherence and hospital infrastructure; 2) intervention (distribution of commercial hand sanitizer and implementation of an abbreviated WHO-recommended multimodal hand hygiene campaign); and 3) post-intervention evaluation of HCW hand hygiene adherence. HCWs' perceptions of the campaign and hand sanitizer tolerability were assessed through a survey performed in the post-intervention period. At baseline, hand washing materials were infrequently available, with only 20% of sinks having hand-washing materials. There was a significant increase in hand hygiene adherence among HCWs following implementation of a WHO multimodal hand hygiene program. Adherence increased from 2.1% at baseline (21 hand hygiene actions/1000 opportunities for hand hygiene) to 12.7% (127 hand hygiene actions /1000 opportunities for hand hygiene) after the implementation of the hand hygiene campaign (OR = 6.8, 95% CI 4.2-10.9). Hand hygiene rates significantly increased among all HCW types except attending physicians. Independent predictors of HCW hand hygiene compliance included performing hand hygiene in the post-intervention period (aOR = 5.7, 95% CI 3.5-9.3), in the emergency department (aOR = 4.9, 95% CI 2.8-8.6), during patient care that did not involve Attending Physician Rounds (aOR = 2.4, 95% CI 1.2-4.5), and after patient contact (aOR = 2.1, 95% CI 1.4-3.3). In the

  11. Hygiene behaviour and hospitalized severe childhood diarrhoea: a case-control study.


    Baltazar, J. C.; Tiglao, T. V.; Tempongko, S. B.


    The relationship between personal and domestic hygiene behaviour and hospitalized childhood diarrhoea was examined in a case-control study of 356 cases and 357 controls from low-income families in metropolitan Manila. Indices of hygiene behaviour were defined for overall cleanliness, kitchen hygiene, and living conditions. Only the indices for overall cleanliness and kitchen hygiene were significantly associated with diarrhoea. An increasing excess risk of hospitalization with severe diarrhoe...



    Dimas Setio Kresnadi; Rian Andriani


    Abstract - Kitchen is a food processing center at the hotel. Good and bad food products in hotel determined on Personal hygiene, sanitation food, sanitation equipment, and sanitary environment in the hotel kitchen is well organized. Hygiene and sanitation in the kitchen is essential to produce healthy food and clean, this study found that poor personal hygiene are employees who are less aware of hand hygiene, food storage facilities that do not match the standard, not the availability of ultr...

  13. Effectiveness of a multimodal hand hygiene campaign and obstacles to success in Addis Ababa, Ethiopia


    Schmitz, Karen; Kempker, Russell R; Tenna, Admasu; Stenehjem, Edward; Abebe, Engida; Tadesse, Lia; Jirru, Ermias Kacha; Blumberg, Henry M


    Background Hand hygiene is the cornerstone of infection control and reduces rates of healthcare associated infection. There are limited data evaluating hand hygiene adherence and hand hygiene campaign effect in resource-limited settings, especially in Sub-Saharan Africa. This study assessed the impact of implementing a World Health Organization (WHO)-recommended multimodal hand hygiene campaign at a hospital in Ethiopia. Methods This study included a before-and-after assessment of health care...

  14. Cross-contamination in the kitchen: effect of hygiene measures

    NARCIS (Netherlands)

    Jong, de A.E.I.; Verhoeff-Bakkenes, L.; Nauta, M.J.; Jonge, de R.


    Aims: To determine the effect of hygiene measures on cross-contamination of Campylobacter jejuni at home and to select a safe tracer organism for C. jejuni. Methods and Results: Comparative tests were conducted with nonpathogenic Escherichia coli and Lactobacillus casei and L. casei was chosen as

  15. The Use of Gaming in a Dental Hygiene Review Course. (United States)

    Peterson, Charlotte A.; Mauriello, Sally M.; Caplan, Daniel J.


    Evaluated the effectiveness of gaming to create an interactive, stimulating learning environment as a review format for the Dental Hygiene National Board examination. Students (n=28) participated in either the gaming or a lecture review format. The gaming group scored higher on the exam on eight of 12 topics as well as on the case-based learning…

  16. Mandatory Clinical Practice for Dental and Dental Hygiene Faculty. (United States)

    Cameron, Cheryl A.; And Others


    Dental and dental hygiene faculty should maintain their clinical skills through regular practice, to improve their ability to relate to students through instruction, provide an additional source of income, and improve their image in the community. Institutional policies fostering and regulating faculty practice plans are suggested. (Author/MSE)

  17. Curricular Guidelines for Dental Hygiene Care for the Handicapped. (United States)

    Journal of Dental Education, 1984


    The American Association of Dental Schools' guidelines for dental hygiene curriculum cover the scope and definitions of care for the handicapped, interrelationships between disciplines and courses, a curriculum overview, primary educational goals, prerequisites, a core content outline, specific behavioral objectives, sequencing, faculty, and…

  18. Curriculum Guidelines for Periodontics for Dental Hygiene Programs. (United States)

    Journal of Dental Education, 1986


    American Association of Dental Schools guidelines consist of an introduction to the field and its interrelationships with other fields of dental hygiene; an overview of the curriculum; outlines of primary educational goals, prerequisites, and specific content-related and clinical behavioral objectives; and recommendations concerning sequencing,…

  19. Bulimia and Anorexia Nervosa in Dental and Dental Hygiene Curricula. (United States)

    Gross, Karen B. W.; And Others


    Dentists and dental hygienists are in a unique position to identify an eating disorder patient from observed oral manifestations and to refer the patient for psychological therapy. The inclusion of information on general and oral complications of bulimia and anorexia nervosa in dental and dental hygiene curriculum was examined. (MLW)

  20. Assessment of hygiene habits and attitudes among removable ...

    African Journals Online (AJOL)

    Aims: The aim of this study was conducting a survey of hygiene habits and use of removable partial dentures (RPDs) and correlate them with the social conditions of the interviewees. Methods: A total of 145 RPD wearers were interviewed by experienced clinical staff using a structured questionnaire. A Chi‑squared test was ...

  1. Evaluation of Potential Effect of Menthol Solution on Oral Hygiene ...

    African Journals Online (AJOL)

    Purpose: To test the effect of menthol extract on the oral hygiene status of dental students of Faculty of Dentistry, Al- Mustansiriya University, Baghdad, Iraq. Methods: A solution (18 mg %) of menthol was prepared by dissolving menthol crystals in absolute ethanol. Chlorhexidine (CHX, 0.2 %) and deionized water were used ...

  2. Oral hygiene practices and risk of oral leukoplakia | Macigo | East ...

    African Journals Online (AJOL)

    Objective: To determine the influence of oral hygiene habits and practices on the risk of developing oral leukoplakia. Design: Case control study. Setting: Githongo sublocation in Meru District. Subjects: Eighty five cases and 141 controls identified in a house-to-house screening. Results: The relative risk (RR) of oral ...

  3. Oral fecal parasites and personal hygiene of food handlers in ...

    African Journals Online (AJOL)

    Background: Ingestion of infective eggs and cysts of faecal orally transmissible parasites has been linked with the level of environmental and personal hygiene. The possibility of contamination of food with eggs and cysts by infected food vendors has also been recorded. Objectives and methods: This study was aimed at ...

  4. Expanding the Oral Hygiene Curriculum in a Nursing Program. (United States)

    Briggs, Susan; Griego, Elizabeth

    A program was implemented to expand the curriculum materials within the Licensed Practical Nursing (LPN) Program at Clark County Community College (CCCC) which relate to oral hygiene care for the hospital patient. The instructional materials included a video tape and a written instructional packet which were researched, prepared, and presented by…

  5. Assessment Of Hygienic Quality Of Camel ( Camelus dromedarius ...

    African Journals Online (AJOL)

    A total of 112 individual camel milk samples were collected during the period from. December 2004 to June 2005 to evaluate the hygienic quality of raw camel milk in two locations of Khartoum State, Sudan. To achieve this the following microbiological counts were done: total bacterial counts, mesophilic counts, ...

  6. Hand hygiene practices among community Health Officers in Rivers ...

    African Journals Online (AJOL)


    Hand washing with soap and water or alcohol-based hand rub has long been considered one of the most important infection control measures to prevent healthcare-associated infections. However, compliance by healthcare workers with recommended hand hygiene procedures is unacceptably low, with compliance rates ...

  7. Critical Thinking Skills of United States Dental Hygiene Students (United States)

    Notgarnie, Howard M.


    The complexity of decision-making in dental hygienists' practice requires critical thinking skills. Interest in raising educational standards for entry into the dental hygiene profession is a response to the demand for enhanced professional skills, including critical thinking skills. No studies found in the course of literature review compared…

  8. Promoting oral hygiene behavior in recruits in the Dutch army.

    NARCIS (Netherlands)

    Buunk-Werkhoven, Yvonne A. B.; Dijkstra, Arie; van der Wal, Henk; Basic, Nina; Loomans, Steven A.; van der Schans, Cees P.; van der Meer, Brig-Gen Rob

    Objectives: To make practical recommendations for improving oral hygiene behavior (OHB) potential predictors based on the Theory of Planned Behavior (TPB) were assessed. Measurements of oral health knowledge (OHK) and the expected social effect for having healthy teeth were included. Methods: 216

  9. Relation of Sociodemographics and Personal Hygiene on Different Childhood Dermatoses. (United States)

    Gauchan, E; Kumar, A; Bk, G; Thapa, P; Pun, J


    Skin diseases in children contribute to significant morbidity and psychological distress. Infective dermatoses are one of the major dermatoses in children. Low socioeconomic status, overcrowding and poor personal hygiene has been linked to skin diseases. To find out the prevalence of infectious skin disease in children, rate of transmissible skin disease and association of sociodemographic factors and personal hygiene on infective childhood dermatoses. This was a cross-sectional study conducted in the Pediatric and Dermatology Department, Manipal Teaching Hospital, Pokhara, Nepal. A total of 226 patients were examined over a period of one year. Relation of sociodemographics, crowding and personal hygiene on skin disease were assessed. The most common category was Infections and Infestations (51.3%) followed by Dermatitis (27.9%). Transmissible skin disease was seen in 49.6%. Low socioeconomic status and overcrowding were associated with increased risk for infective dermatoses. Skin disease in children constitutes a public health problem. Improving the socioeconomic status and personal hygiene can help to reduce the incidence of skin disease in children.

  10. [Refusal of personal hygiene care and nursing responsibility]. (United States)

    Peyé, Anne


    Situations of patients refusing personal hygiene care are frequent. Sources of difficulties and questioning for caregivers, they can lead to maltreatment. In order to avoid this pitfall, it is essential to support the teams in their approach around representations of caregiving and nursing responsibility.

  11. Guidance on maintaining personal hygiene in nail care. (United States)

    Malkin, Bridget; Berridge, Pat

    Nail care is important in the maintenance of personal hygiene and is an essential aspect of patient care. Confusion about who should perform nail care for patients has resulted in poor practice and cycles of non-activity. This article provides guidance for nurses on performing routine nail care.

  12. Feminine hygiene practices among female patients and nurses in Lebanon. (United States)

    Attieh, Elie; Maalouf, Samer; Roumieh, Dina; Abdayem, Pamela; AbiTayeh, Georges; Kesrouani, Assaad


    Inappropriate feminine hygiene practices are related to vulvovaginitis. We investigated the prevalence of personal hygiene habits among Lebanese women as well as their awareness of adequate practices. Consists of a cross-sectional observational study. Female patients and nurses at Hotel-Dieu de France University Hospital in Beirut- Lebanon filled a questionnaire about their intimate hygiene habits and knowledge of proper practices. The study included 249 women. 21.3 % of the 136 nurses and 38.9 % of the 113 patients reported a history of vulvovaginitis. The majority of women took an intimate bath at least twice daily. 14 % of nurses and 17 % of patients douched.20. Seven percent of the nurses and 43.4 % of the patients used wet wipes. 1.5 % of nurses and 4.4 % of patients used feminine deodorant sprays. There was a significant lack of awareness mainly among patients about suitable hygiene practices as well for their adverse effects. Education provided by nurses, and other healthcare providers is essential to promote reproductive health among Lebanese women.

  13. Healthy Hands Hygiene (A Cup of Health with CDC)

    Centers for Disease Control (CDC) Podcasts


    Teaching young children personal hygiene can have a positive impact for a lifetime. Encouraging regular handwashing is a good start. In this podcast, Dr. Vincent Hill discusses the importance of regular handwashing.  Created: 10/12/2017 by MMWR.   Date Released: 10/12/2017.

  14. Production hygiene and training influences on rural small-scale

    African Journals Online (AJOL)


    Data analysis. Questionnaire data were coded using coding sheets. The coding sheets assigned numerical values to the answers, which had been captured on the spread sheets ... equipment was used as a proxy for hygiene practices. Farmers with ..... age as an indicator of life-cycle stage: the case for a farm family age ...

  15. Assessment of hygiene habits and attitudes among removable ...

    African Journals Online (AJOL)


    Dec 1, 2014 ... The importance of proper plaque control and its relation with the long term ... U Cakan, E Yuzbasioglu, H Kurt, HB Kara, R Turunç, A Akbulut, KC Aydın1. Departments of .... significantly higher among cigarette or any other tobacco consumers than .... limited knowledge of denture cleansing and oral hygiene.

  16. Adherence to hand hygiene protocol by clinicians and medical ...

    African Journals Online (AJOL)

    Background: While communicable diseases are the leading causes of morbidity and mortality in Malawi, the contribution of nosocomial or hospital-acquired infections (HAIs) is unknown but could be substantial. The single most important method of preventing nosocomial infections is hand hygiene. We report a study which ...

  17. Knowledge, attitude and practice of hygiene and sanitation in a ...

    African Journals Online (AJOL)

    Introduction: A Salmonella typhi outbreak was reported in a Burundian refugee camp in Rwanda in October 2015. Transmission persisted despite increased hygiene promotion activities and hand-washing facilities instituted to prevent and control the outbreak. A knowledge, attitude and practice (KAP) study was carried out ...

  18. Accession strategy to hand hygiene by healthcare professionals

    Directory of Open Access Journals (Sweden)

    Danielle Galdino de Paula


    Full Text Available Background and Objective: Healthcare-associated infections are serious health threat to hospitalized patients and contribute to increased mortality and morbidity. Hand hygiene is the simplest individual measure and lower cost in order to prevent the spread of infections in health care services. The study seeks to analyze the publications related to the strategies used to improve adherence of health professionals to hand hygiene in hospital. Contents: Integrative literature review. The descriptors were used in isolation and the associated descriptor AND;OR, by the following inclusion criteria: work full text of Article kind, published in the period 2008-2015, in Portuguese and English and used the electronic databases MEDLINE , LILACS and SCIELO. The analysis determined eleven strategies most used to improve adherence to hand hygiene in hospital. Conclusion: The availability of better resources and the use of a single strategy sometimes was not enough to increase membership, and often necessary to apply various strategies together with health professionals. KEYWORDS: Cross infection. Hand hygiene. Health personnel.

  19. Use of a patient empowerment tool for hand hygiene. (United States)

    Lastinger, Allison; Gomez, Kayeromi; Manegold, Ellen; Khakoo, Rashida


    Patient empowerment is recognized as an important component of a multimodal strategy to improve hand hygiene adherence. We examined the attitudes of adult patients and parents of pediatric patients toward a new patient empowerment tool (PET) at our hospital. We also surveyed physicians to determine their perceptions about the PET. A cross-sectional survey was performed of hospitalized children's parents and adult patients in a 531-bed tertiary care teaching hospital in West Virginia. Surveys were anonymous and self-administered. A separate survey was administered via e-mail to resident and attending physicians from the departments of internal medicine, pediatrics, and family medicine. Most parents and adult patients felt it was their role to speak up if a provider did not perform hand hygiene, but a smaller number actually felt comfortable using the PET. Only 54.9% of physicians felt that patients should be involved in reminding providers to perform hand hygiene. Overall, physicians indicated that they would prefer a patient to use words rather than the PET to remind them to perform hand hygiene. In our study, parents and adult patients supported use of the PET, but physicians were less supportive. As the patient empowerment movement grows, we should work to improve physician acceptance of patient involvement if it is to be successful. Copyright © 2017 Association for Professionals in Infection Control and Epidemiology, Inc. Published by Elsevier Inc. All rights reserved.

  20. Descriptive survey of personal hygiene and knowledge of exposure ...

    African Journals Online (AJOL)

    Majority of the poultry workers have adequate personal hygiene while use of antiseptics as part of hand washing practices is relatively low. Forty-three percent of poultry workers have some knowledge of occupational exposure factors and 27.3% have some knowledge of non-occupational exposure factors to zoonotic ...

  1. Prediction of hygiene in food processing equipment using flow modelling

    DEFF Research Database (Denmark)

    Friis, Alan; Jensen, Bo Boye Busk


    Computational fluid dynamics (CFD) has been applied to investigate the design of closed process equipment with respect to cleanability. The CFD simulations were validated using the standardized cleaning test proposed by the European Hygienic Engineering and Design Group. CFD has been proven as a ...

  2. Healthcare personnel perceptions of hand hygiene monitoring technology. (United States)

    Ellingson, Katherine; Polgreen, Philip M; Schneider, Amy; Shinkunas, Laura; Kaldjian, Lauris C; Wright, Donald; Thomas, Geb W; Segre, Alberto M; Herman, Ted; McDonald, L Clifford; Sinkowitz-Cochran, Ronda


    To assess healthcare personnel (HCP) perceptions regarding implementation of sensor-based electronic systems for automated hand hygiene adherence monitoring. Using a mixed-methods approach, structured focus groups were designed to elicit quantitative and qualitative responses on familiarity, comfort level, and perceived impact of sensor-based hand hygiene adherence monitoring. A university hospital, a Veterans Affairs hospital, and a community hospital in the Midwest. Focus groups were homogenous by HCP type, with separate groups held for leadership, midlevel management, and frontline personnel at each hospital. Overall, 89 HCP participated in 10 focus groups. Levels of familiarity and comfort with electronic oversight technology varied by HCP type; when compared with frontline HCP, those in leadership positions were significantly more familiar with ([Formula: see text]) and more comfortable with ([Formula: see text]) the technology. The most common concerns cited by participants across groups included lack of accuracy in the data produced, such as the inability of the technology to assess the situational context of hand hygiene opportunities, and the potential punitive use of data produced. Across groups, HCP had decreased tolerance for electronic collection of spatial-temporal data, describing such oversight as Big Brother. While substantial concerns were expressed by all types of HCP, participants' recommendations for effective implementation of electronic oversight technologies for hand hygiene monitoring included addressing accuracy issues before implementation and transparent communication with frontline HCP about the intended use of the data.

  3. Attitudes of Dental Hygiene Students toward Individuals with AIDS. (United States)

    Haring, Joen Iannucci; Lind, Laura J.


    At Ohio State University, 81 dental hygiene students' attitudes toward homosexual and heterosexual patients with acquired immune deficiency syndrome (AIDS) or leukemia were assessed using ratings of prejudice, social interaction, and interpersonal interaction. Negative bias toward individuals with AIDS and unwillingness to engage in everyday…

  4. Sanitation facilities and hygiene practices in a semi-urban ...

    African Journals Online (AJOL)

    Alasia Datonye

    Department of Community Medicine, University of Port Harcourt Teaching Hospital, Port. Harcourt, Nigeria. ... and they formed 87.95% of the 83 facilities found to be in ... Hygiene education and social marketing of sanitation facilities are ..... India and Brazil . ... sanitation facility; it has to be reiterated that greater emphasis.

  5. Dysphagia screening and intensified oral hygiene reduce pneumonia after stroke

    DEFF Research Database (Denmark)

    Sørensen, Rikke Terp; Rasmussen, Rune Skovgaard; Overgaard, Karsten


    Dysphagia occurs in approximately 51%-78% of patients with acute stroke. The incidence of pneumonia caused by aspiration in dysphagic patients increases both mortality and the need for hospitalization. The aim of this study was to investigate whether the incidence of aspiration pneumonia could...... be reduced in such patients by an early screening for dysphagia and intensified oral hygiene....

  6. Menstrual hygiene among students of a tertiary institution in Benin ...

    African Journals Online (AJOL)

    Menstrual hygiene refers to a constellation of personal sanitation during menstruation and it involves use of appropriate sanitary pads, regular bathing and changing of clothes. The sustenance of menstruation related monthly sanitation, places an extra burden on the socioeconomic status and academic activity of females.

  7. An assessment of food hygiene and safety at farmers' markets. (United States)

    Worsfold, D; Worsfold, P M; Griffith, C J


    Farmers' markets are becoming a more significant part of the food-retailing sector. A survey of farmers' markets was conducted to assess aspects of food hygiene and safety. The views of the public using the markets were also examined. The range of farm products was wide and the methods utilised varied. The markets were usually temporary outdoor events with few facilities. Traders had received elementary food hygiene training and rated their hygiene standards highly. Less than half had risk management procedures in place, most did not perceive their produce as high-risk. They believed consumers to be mainly interested in food quality and to regard food safety issues highly. Consumers shopped at the markets because of the quality of the products sold. Their overall satisfaction with the markets was high and they raised no concerns about food safety. Given the restricted facilities at farmers' markets and the early phase of implementation of hygiene management systems by market traders, it may be precautionary to restrict the sale of farm products at farmers markets to those that are regarded as low-risk.

  8. Hand hygiene practices post ebola virus disease outbreak in a ...

    African Journals Online (AJOL)

    Introduction: Ebola virus disease (EVD) is a highly contagious viral infection that requires a high risk perception and practice of good hand hygiene by regular hand washing or use of hand sanitizers for infection control at all time. The declaration of Nigeria as an Ebola-free country by the World Health Organization on the ...

  9. Oral hygiene teaching in clinical activities at the department of ...

    African Journals Online (AJOL)

    The aim of this study was to assess the attitudes and practices of students related to oral hygiene teaching by mean of a questionnaire submitted to patients attending the clinics of the Department of Dentistry of Dakar. Method: A KPC study (Knowledge, Practices and Coverage) focusing on dental students was conducted ...

  10. Prevalence of Skin Infections and Hygiene Practices among Pupils ...

    African Journals Online (AJOL)

    Practices in the treatment of infections like the use of herbal soap (31.5%), brake oil (4.2%), Baby oil (3.9%), chicken's egg (2.7%) were reported by respondents. Poor personal hygiene and housing conditions are contributing factors to skin infections in the study area. Early introduction of health education in schools would ...

  11. Perceived stressors of oral hygiene students in the dental environment

    African Journals Online (AJOL)

    Perceived stressors of oral hygiene students in the dental environment. ... with patients and communities, which may add to the stressors inherent to university life. ... (ii) perceived sources of stress, using a modified Dental Environment Stress (DES) questionnaire; and (iii) burnout, using the Maslach Burnout Inventory (MBI).

  12. Prevention of gingival trauma : Oral hygiene devices and oral piercings

    NARCIS (Netherlands)

    Hoenderdos, N.L.


    Maintaining healthy teeth and soft oral tissues for life is important. Oral hygiene devices and oral piercings can damage the soft oral tissues. This thesis investigates the safety of manual toothbrushes, interdental brushes and rubber bristles interdental cleaners by analysing the gingival abrasion

  13. Guidelines for indoor air hygiene in school buildings

    Energy Technology Data Exchange (ETDEWEB)

    Moriske, Heinz-Joern; Szewzyk, Regine (eds.)


    The new guidelines for indoor air hygiene in school buildings are intended as a response to current requirements in school practice. The recommendations aim to help to avoid mistakes in modernising school buildings and to provide hygiene-specific support in planning of new school buildings. The guidelines are laid out as follows: (a) In the general section the targets of the guidelines and the target groups are addressed. The current indoor hygiene situation in German schools is described, followed by the parameters with regard to peripheral issues which will not be dealt with further; (b) Part A deals with the hygiene requirements in the practical running of schools. Besides general requirements for maintenance and operation the important issues of cleaning and ventilation are considered, as well as minor building works; (c) Part B provides an overview of important chemical and biological contaminants in schools; (d) Part C looks at building and air conditioning requirements. The important issues of acoustic requirements is also addressed; (e) Part D shows how to deal practically with problem cases and list case studies with 'typical' procedures; (f) Part E provides a brief overview of existing renovation guidelines.

  14. Periodontal Disease and Oral Hygiene Among Children. United States. (United States)

    National Center for Health Statistics (DHEW/PHS), Hyattsville, MD.

    Statistical data presented on periodontal disease and oral hygiene among noninstitutionalized children, aged 6-11, in the United States are based on a probability sample of approximately 7,400 children involved in a national health survey during 1963-65. The report contains estimates of the Periodontal Index (PI) and the Simplified Oral Hygiene…

  15. Water, sanitation and hygiene in community based care ...

    African Journals Online (AJOL)

    Majority of the HIV/AIDS patients in South Africa receive health care services at home. However, limited studies have been conducted to examine the water, sanitation and hygiene (WASH) situation in the homes of the care receivers and its impact on community-based care. The main objective of this study was to explore ...

  16. Hygiene and sanitation risk factors of diarrhoeal disease among ...

    African Journals Online (AJOL)

    Background: Diarrhoea diseases are among the leading causes of morbidity and mortality in under-five-children (U-5C) in Nigeria. Inadequate safe water, sanitation, and hygiene account for the disease burden. Cases of diarrhoea still occur in high proportion in the study area despite government-oriented interventions.

  17. Design and implementation of participatory hygiene and sanitation ...

    African Journals Online (AJOL)

    Background: The study is a continuation of a research carried out in Luweero district in Uganda1. It investigated whether PHAST was a suitable tool for reducing transmission of soil transmitted helminths. PHAST means Participatory Hygiene and Sanitation Transformation; a participatory approach that uses visual tools to ...

  18. Feasibility: An important but neglected issue in patient hand hygiene. (United States)

    Knighton, Shanina C; McDowell, Cherese; Rai, Herleen; Higgins, Patricia; Burant, Christopher; Donskey, Curtis J


    Patient hand hygiene may be a useful strategy to prevent acquisition of pathogens and to reduce the risk for transmission by colonized patients. Several studies demonstrate that patients and long-term-care facility (LTCF) residents may have difficulty using hand hygiene products that are provided; however, none of them measure feasibility for patients to use different hand hygiene products. A convenience sample of 42 hospitalized patients and 46 LTCF residents was assessed for their ability to use 3 hand sanitizer products (8-oz pushdown pump bottle, 2-oz pocket-sized bottle with a reclosable lid, and alcohol-impregnated hand wipes). The time (seconds) required for accessing each product was compared among acute-care patients and LTCF residents. Participants provided feedback on which product they preferred and found easiest to use. Of 88 participants, 86 (97.7%) preferred the pushdown pump, 2 (2.3%) preferred the bottle with the reclosable lid, and none preferred the hand wipes. For both hospitalized patients and LTCF residents, the average time required to access the pushdown pump was significantly less than the time required to access the other products (pushdown pump, 0.45 seconds; bottle with reclosable lid, 3.86 seconds; and wipes, 5.66 seconds; P hand hygiene products for patients and LTCF residents. Copyright © 2017 Association for Professionals in Infection Control and Epidemiology, Inc. Published by Elsevier Inc. All rights reserved.

  19. Hand hygiene management among nurses: collective health challenges

    Directory of Open Access Journals (Sweden)

    João Manuel Graveto

    Full Text Available ABSTRACT Objective: To describe the determining factors in hand hygiene management among nurses and identify associated collective health challenges. Method: Cross-sectional descriptive study. Data were collected using a questionnaire that was applied in four internal medicine units of a hospital of reference in Portugal. Results: The sample was composed of 50 nurses aged 26 to 55 years (mean age of 34.88 years; 80% were women, 58% had a Bachelor’s degree, and had 5-30 years of nursing practice (X̄ =11.94;±5.92. The vast majority of nurses (90% reported complying with the existing recommendations on hand hygiene in pre-established moments. However, none of the nurses were able to identify all the moments for hand hygiene using water and soap or alcohol-based handrub. Conclusion: This study shows that continuous training, adequate materials/structures in the units, and redesigned administration/supervision practices are determining factors to achieve higher levels of adherence to hand hygiene among nurses, as well as increased quality and safety in care delivery, which is a current collective health challenge.

  20. Evaluation of Potential Effect of Menthol Solution on Oral Hygiene ...

    African Journals Online (AJOL)

    Tropical Journal of Pharmaceutical Research April 2015; 14 (4): 687-692 ... Pharmacotherapy Group, Faculty of Pharmacy, University of Benin, Benin City, ... Keywords: Menthol mouth rinse, Chlorhexidine, Dental plaque, Gingivitis, Oral hygiene ... International Pharmaceutical Abstract, Chemical Abstracts, Embase, Index ...

  1. Assessment of hygiene habits and attitudes among removable ...

    African Journals Online (AJOL)


    Dec 1, 2014 ... Key words: Denture cleanser, hygiene, overnight wearing, removable partial denture ... Fabrication of RPD is still a valid treatment modality for ... Doctor instructed me to wear overnight. 21 (30.9). I prefer to wear overnight. 47 (69.1). Leaving denture. Dry. 24 (16.6). Soaking in water. 121 (63.4). Resource of ...

  2. Standard of hygiene and immune adaptation in newborn infants

    NARCIS (Netherlands)

    Kallionpaa, Henna; Laajala, Essi; Oling, Viveka; Harkonen, Taina; Tillmann, Vallo; Dorshakova, Natalya V.; Ilonen, Jorma; Landesmaki, Harri; Knip, Mikael; Lahesmaa, Riitta; Koski, Katriina; Koski, Matti; Ryhanen, Samppa; Siljander, Heli; Hamalainen, Anu-Maaria; Ormisson, Anne; Peet, Aleksandr; Ulich, Valentina; Kuzmicheva, Elena; Mokurov, Sergei; Markova, Svettana; Pylova, Svetlana; Isakova, Marina; Shakurova, Elena; Petrov, Vladimir; Karapetyan, Tatyana; Varlamova, Tatyana; Ilonen, Jorma; Kiviniemi, Minna; Alnek, Kristi; Janson, Helis; Uibo, Raivo; Salum, Tiit; von Mutius, Erika; Weber, Juliane; Ahlfors, Helena; Moulder, Robert; Nieminen, Janne; Ruohtula, Terhi; Vaarala, Outi; Honkanen, Hanna; Hyoty, Heikki; Kondrashova, Anita; Oikarinen, Sami; Harmsen, Hermie J. M.; De Goffau, Marcus C.; Welling, Gjalt; Alahuhta, Kirsi; Korhonen, Tuuli; Virtanen, Suvi M.


    The prevalence of immune-mediated diseases, such as allergies and type 1 diabetes, is on the rise in the developed world. In order to explore differences in the gene expression patterns induced in utero in infants born in contrasting standards of living and hygiene, we collected umbilical cord blood

  3. Evaluation of Oral Hygiene in Patients with Visual Disabilities

    Directory of Open Access Journals (Sweden)

    Roberto Carlos Mourão Pinho


    Full Text Available Introduction: Patients with visual impairment present greater difficulty in achieving adequate oral hygiene due to restricted eyesight. Therefore, oral hygiene motivation and instruction methods should be adapted to these patients to understand the importance of bacterial plaque control, both for the health of dental tissues and periodontal tissues Objective: The objective of the present study was to compare the plaque index (PI of patients with and without visual impairment before and after the institution of oral hygiene instructions through a Randomized Clinical Trial. Twenty patients with visual impairment (Group 1 from the Instituto dos Cegos and 20 without visual impairment (Group 2 from the ASCES Periodontia Clinic were selected. Data were collected through the IP of O'Leary and reevaluated every 21 days for four sessions. Results: in both groups, the mean of PI decreased with the time of evaluation, with a significant difference between the evaluations (p 0.05. As for the mean of the PI assessments, group 2 presented a mean higher than group 1, but without significant difference (p> 0.05. Conclusion: The study therefore suggests that there is no difference in PI in patients with or without visual impairment, and that the guidelines stimulate and motivate an improvement in oral hygiene conditions.

  4. Representation sociale de l'hygiene chez les populations riveraines ...

    African Journals Online (AJOL)

    Mots clés: Représentation sociale, hygiène, populations riveraines, décharge, environnement, pollution. English Title: Social representation of hygiene in the populations living in the vicinity of Akouedo-Cocody dump (Abidjan-Ivory Coast). English Abstract. Landfills are generally the common option for the final deposit of ...

  5. sequential low cost interventions double hand hygiene rates among

    African Journals Online (AJOL)


    Feb 2, 2014 ... Request for reprints to: Onyema Ogbuagu, Yale University School of Medicine, Address – 135 College Street, suite 323, ... Objective: To assess the impact of multimodal low-cost interventions on hand hygiene ... system change including investment in provision ... Statistical software used was IBM SPSS.

  6. Outcomes assessment of dental hygiene clinical teaching workshops. (United States)

    Wallace, Juanita S; Infante, Taline D


    Faculty development courses related to acquiring clinical teaching skills in the health professions are limited. Consequently, the Department of Dental Hygiene at the University of Texas Health Science Center at San Antonio conducted a series of clinical teaching workshops to address clinical teaching methodology. The goal of these workshops was to promote a problem-solving learning atmosphere for dental hygiene faculty to acquire and share sound clinical teaching strategies. To determine the value of the annual workshops on clinical teaching and evaluation, a web-based qualitative program assessment was developed using software by Survey Tracker. Four open-ended questions were designed to elicit perceptions regarding what significant changes in teaching strategies were achieved, what barriers or challenges were encountered in making these changes, and what strategies were used to overcome the barriers. The assessment was sent to dental hygiene educators representing thirty-eight dental hygiene programs who had participated in two or more of these workshops. Twenty-eight programs provided collective responses to the questions, and the narrative data were analyzed, using a qualitative methodology. Responses revealed that programs had made productive changes to their clinical education curricula and the information gained from the workshops had a positive effect on clinical teaching.

  7. [Hygienic evaluation of risk factors on powder metallurgy production]. (United States)


    Complex hygienic, clinical, sociologic and epidemiologic studies revealed reliable relationship between work conditions and arterial hypertension, locomotory system disorders, monocytosis in powder metallurgy production workers. Findings are more probable cardiovascular and respiratory diseases, digestive tract diseases due to influence of lifestyle factors.

  8. Assessing hygienic behavior and attraction to Varroa mite (Acari ...

    African Journals Online (AJOL)

    Three days later, the number of female Varroa in the capped cells were counted as attraction criteria for each treatment separately. ... The negative correlation between 2 major resistance traits (hygienic behavior and attraction traits) in the breeding stock deems that selection for resistance against Varroa mite and improved ...

  9. Guidelines for indoor air hygiene in school buildings

    Energy Technology Data Exchange (ETDEWEB)

    Moriske, Heinz-Joern; Szewzyk, Regine [eds.


    The new guidelines for indoor air hygiene in school buildings are intended as a response to current requirements in school practice. The recommendations aim to help to avoid mistakes in modernising school buildings and to provide hygiene-specific support in planning of new school buildings. The guidelines are laid out as follows: (a) In the general section the targets of the guidelines and the target groups are addressed. The current indoor hygiene situation in German schools is described, followed by the parameters with regard to peripheral issues which will not be dealt with further; (b) Part A deals with the hygiene requirements in the practical running of schools. Besides general requirements for maintenance and operation the important issues of cleaning and ventilation are considered, as well as minor building works; (c) Part B provides an overview of important chemical and biological contaminants in schools; (d) Part C looks at building and air conditioning requirements. The important issues of acoustic requirements is also addressed; (e) Part D shows how to deal practically with problem cases and list case studies with 'typical' procedures; (f) Part E provides a brief overview of existing renovation guidelines.

  10. Hygiene inspections on passenger ships in Europe - an overview (United States)


    Background Hygiene inspections on passenger ships are important for the prevention of communicable diseases. The European Union (EU) countries conduct hygiene inspections on passenger ships in order to ensure that appropriate measures have been taken to eliminate potential sources of contamination which could lead to the spread of communicable diseases. This study was implemented within the framework of the EU SHIPSAN project and it investigates the legislation applied and practices of hygiene inspections of passenger ships in the EU Member States (MS) and European Free Trade Association countries. Methods Two questionnaires were composed and disseminated to 28 countries. A total of 92 questionnaires were completed by competent authorities responsible for hygiene inspections (n = 48) and the creation of legislation (n = 44); response rates were 96%, and 75.9%, respectively. Results Out of the 48 responding authorities responsible for hygiene inspections, a routine programme was used by 19 (39.6%) of these to conduct inspections of ships on national voyages and by 26 (54.2%) for ships on international voyages. Standardised inspection forms are used by 59.1% of the authorities. A scoring inspection system is applied by five (11.6%) of the 43 responding authorities. Environmental sampling is conducted by 84.1% of the authorities (37 out of 44). The inspection results are collected and analysed by 54.5% (24 out of 44) of the authorities, while 9 authorities (20.5%) declared that they publish the results. Inspections are conducted during outbreak investigations by 75% and 70.8% of the authorities, on ships on national and international voyages, respectively. A total of 31 (64.6%) and 39 (81.3%) authorities conducted inspections during complaint investigations on ships on international and on national voyages, respectively. Port-to-port communication between the national port authorities was reported by 35.4% (17 out of 48) of the responding authorities and 20.8% (10 out

  11. Hygiene inspections on passenger ships in Europe - an overview. (United States)

    Mouchtouri, Varvara A; Westacott, Sandra; Nichols, Gordon; Riemer, Tobias; Skipp, Mel; Bartlett, Christopher L R; Kremastinou, Jenny; Hadjichristodoulou, Christos


    Hygiene inspections on passenger ships are important for the prevention of communicable diseases. The European Union (EU) countries conduct hygiene inspections on passenger ships in order to ensure that appropriate measures have been taken to eliminate potential sources of contamination which could lead to the spread of communicable diseases. This study was implemented within the framework of the EU SHIPSAN project and it investigates the legislation applied and practices of hygiene inspections of passenger ships in the EU Member States (MS) and European Free Trade Association countries. Two questionnaires were composed and disseminated to 28 countries. A total of 92 questionnaires were completed by competent authorities responsible for hygiene inspections (n = 48) and the creation of legislation (n = 44); response rates were 96%, and 75.9%, respectively. Out of the 48 responding authorities responsible for hygiene inspections, a routine programme was used by 19 (39.6%) of these to conduct inspections of ships on national voyages and by 26 (54.2%) for ships on international voyages. Standardised inspection forms are used by 59.1% of the authorities. A scoring inspection system is applied by five (11.6%) of the 43 responding authorities. Environmental sampling is conducted by 84.1% of the authorities (37 out of 44). The inspection results are collected and analysed by 54.5% (24 out of 44) of the authorities, while 9 authorities (20.5%) declared that they publish the results. Inspections are conducted during outbreak investigations by 75% and 70.8% of the authorities, on ships on national and international voyages, respectively. A total of 31 (64.6%) and 39 (81.3%) authorities conducted inspections during complaint investigations on ships on international and on national voyages, respectively. Port-to-port communication between the national port authorities was reported by 35.4% (17 out of 48) of the responding authorities and 20.8% (10 out of 48) of the port

  12. Hygiene inspections on passenger ships in Europe - an overview

    Directory of Open Access Journals (Sweden)

    Bartlett Christopher LR


    Full Text Available Abstract Background Hygiene inspections on passenger ships are important for the prevention of communicable diseases. The European Union (EU countries conduct hygiene inspections on passenger ships in order to ensure that appropriate measures have been taken to eliminate potential sources of contamination which could lead to the spread of communicable diseases. This study was implemented within the framework of the EU SHIPSAN project and it investigates the legislation applied and practices of hygiene inspections of passenger ships in the EU Member States (MS and European Free Trade Association countries. Methods Two questionnaires were composed and disseminated to 28 countries. A total of 92 questionnaires were completed by competent authorities responsible for hygiene inspections (n = 48 and the creation of legislation (n = 44; response rates were 96%, and 75.9%, respectively. Results Out of the 48 responding authorities responsible for hygiene inspections, a routine programme was used by 19 (39.6% of these to conduct inspections of ships on national voyages and by 26 (54.2% for ships on international voyages. Standardised inspection forms are used by 59.1% of the authorities. A scoring inspection system is applied by five (11.6% of the 43 responding authorities. Environmental sampling is conducted by 84.1% of the authorities (37 out of 44. The inspection results are collected and analysed by 54.5% (24 out of 44 of the authorities, while 9 authorities (20.5% declared that they publish the results. Inspections are conducted during outbreak investigations by 75% and 70.8% of the authorities, on ships on national and international voyages, respectively. A total of 31 (64.6% and 39 (81.3% authorities conducted inspections during complaint investigations on ships on international and on national voyages, respectively. Port-to-port communication between the national port authorities was reported by 35.4% (17 out of 48 of the responding authorities

  13. 21 CFR 872.6650 - Massaging pick or tip for oral hygiene. (United States)


    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Massaging pick or tip for oral hygiene. 872.6650 Section 872.6650 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... hygiene. (a) Identification. A massaging pick or tip for oral hygiene is a rigid, pointed device intended...

  14. The Effect of Teaching Experience on Service-Learning Beliefs of Dental Hygiene Educators (United States)

    Burch, Sharlee Shirley


    The purpose of this non-experimental causal-comparative study was to determine if service-learning teaching experience affects dental hygiene faculty perceptions of service-learning benefits and barriers in the United States. Dental hygiene educators from entry-level dental hygiene education programs in the United States completed the Web-based…

  15. Dental Hygiene Entry-Level Program Administrators' Strategies for Overcoming Challenges of Distance Education (United States)

    Buchanan, Bette A.


    The use of distance education by entry-level dental hygiene programs is increasing. The focus of this study was to determine the number of entry-level dental hygiene program administrators with experience developing and/or maintaining dental hygiene education by distance, the challenges encountered, and the strategies used to overcome the…



    Sandriana; Ibnu, Indra Fajarwati; Rachman, Watief A.


    Salah satu akibat kurangnya pemahaman personal hygiene genitalia yaitu terjadinya gangguan kesehatan organ reproduksi seperti keputihan, infeksi saluran kemih (ISK), penyakit radang panggul (PRP) dan kemungkinan terjadi kanker leher rahim sehingga dibutuhkan pemahaman yang baik mengenai personal hygiene genitalia pada remaja agar dapat terhindar dari ancaman penyakit reproduksi. Studi kualitatif dengan rancangan fenomenologi dilakukan untuk mengetahui perilaku personal hygiene genitalia santr...

  17. New technology markedly improves hand-hygiene performance among healthcare workers after restroom visits

    DEFF Research Database (Denmark)

    Møller-Sørensen, H; Korshin, A; Mogensen, T


    The risks to patients from pathogens present on healthcare workers' (HCWs') hands are high; however, compliance with hand hygiene among HCWs is low. We devised a prospective intervention trial of a new hand-hygiene dispensing technology to improve HCWs' compliance with hand hygiene. Baseline hand...

  18. Oral hygiene practices and dental service utilization among pregnant women. (United States)

    Boggess, Kim A; Urlaub, Diana M; Massey, Katie E; Moos, Merry-K; Matheson, Matthew B; Lorenz, Carol


    Daily oral hygiene and regular dental visits are important components of oral health care. The authors' objective in this study was to examine women's oral hygiene practices and use of dental services during pregnancy. The authors developed a written oral health questionnaire and administered it to 599 pregnant women. They collected demographic information, as well as data on oral hygiene practices and use of dental services during pregnancy. They used chi2 and multivariable logistic regression models to assess associations between oral hygiene practice and dental service use during pregnancy and to identify maternal predictor variables. Of the 599 participants, 83 percent (n=497) reported brushing once or twice per day. Twenty-four percent (n=141) reported flossing at least once daily; Hispanic women were more likely to floss than were white or African American women (28 percent [52 of 183] versus 22 percent [54 of 248] versus 19 percent [23 of 121], respectively, Pdental care during pregnancy. Hispanic women were significantly less likely than were black or white women to receive routine dental care during pregnancy (13 percent versus 21 percent versus 36 percent, respectively, Pdental care when not pregnant were significantly associated with lack of routine dental care during pregnancy (adjusted odds ratios, 95 percent confidence intervals: 2.56 [1.33-4.92]; 2.19 [1.11-4.29]; 2.02 [1.12-3.65]; 1.86 [1.13-3.07]; and 4.35 [2.5-7.69], respectively). A woman's lack of receiving routine dental care when not pregnant was the most significant predictor of lack of receiving dental care during pregnancy. Racial, ethnic and economic disparities related to oral hygiene practices and dental service utilization during pregnancy exist. Medical and dental care providers who treat women of reproductive age and pregnant women need to develop policy strategies to address this population's access barriers to, and use of, dental care services.

  19. Exploration of critical thinking in dental hygiene education. (United States)

    Beistle, Kimberly S; Palmer, Louann Bierlein


    This qualitative study explores the perceptions of dental hygiene faculty regarding issues surrounding critical thinking skills integration within their associate degree dental hygiene programs. Twenty faculty participated in the study, as drawn from 11 accredited associate degree dental hygiene programs in one Midwest state. Multiple sources of data were collected, including email questionnaires, individual follow-up phone interviews and artifacts. Interpretive analysis was conducted. Data analysis revealed that faculty generally understood critical thinking, but interpretations varied. Most do not use varied teaching strategies to promote critical thinking skills, and focus on one particular strategy--that of case studies. The participants identified the need for allied health-focused faculty development opportunities, and noted that calibration of instruction was needed. Despite challenges, faculty felt responsible for teaching critical thinking skills, and identified the need for time to build critical thinking skills into the curriculum. This study was conducted in response to the American Dental Education Association Commission on Change and Innovation's challenge for dental hygiene educators to comprehend their own knowledge on the concept of critical thinking related to research-based pedagogical approaches to teaching and learning. Findings revealed a strong desire among the dental hygiene faculty in this study to incorporate critical thinking into their work. They want to do what they believe is the right thing, but their actual knowledge of the definitional and application theories about critical thinking is still in the early stages of development. Regular and targeted faculty development opportunities are needed. Copyright © 2014 The American Dental Hygienists’ Association.

  20. Compliance with hygiene procedures among medical faculty students

    Directory of Open Access Journals (Sweden)

    Anna Kawalec


    Full Text Available Background: Many of the healthcare-associated infections (HCAIs are transmitted by healthcare workers’ hands, which actively contributes to transferring pathogens from patient to patient and within the healthcare environment. Hand hygiene is the easiest and cheapest method for preventing HCAIs. The article presents the compliance with hygiene procedures in a group of medical students of the Wroclaw Medical University. Material and Methods: The anonymous survey was conducted among 112 students. The survey included questions about the frequency of disinfection of hands and stethoscopes, changing clothes into clean ones, compliance with recommendations for healthcare workers, as well as subjective assessment of the availability of disinfectants in the hospital. Results: The results of the survey revealed that 35.7% of students did not disinfect their hands before each patient’s examination, 90% of them indicated limited access to disinfectants as the most important reason. The majority (93.8% of respondents were trained in hand hygiene. In 34.82% the availability of disinfectants in hospitals was assesed as good, 62.5% of respondents drew attention to the fact that the dispensers were often empty. Compliance with recommendations for healthcare workers: 66.9% posessed white coat with short sleeves, 52.68% wore wristwatch or jewelery on their hands, 50% of students laundered white coat less frequently than once a week, 9.82% did not disinfect their stethoscope at all, 15.18% did that before each patient’s examination. Conclusions: Students compliance with hand hygiene now and in their future work as doctors is the easiest method for preventing HCAIs. Providing easy access to disinfectants in the hospital environment and shaping hygiene habits during clinical activities play an essential role. Med Pr 2014;65(5:593–599

  1. Theory analysis of the Dental Hygiene Human Needs Conceptual Model. (United States)

    MacDonald, L; Bowen, D M


    Theories provide a structural knowing about concept relationships, practice intricacies, and intuitions and thus shape the distinct body of the profession. Capturing ways of knowing and being is essential to any professions' practice, education and research. This process defines the phenomenon of the profession - its existence or experience. Theory evaluation is a systematic criterion-based assessment of a specific theory. This study presents a theory analysis of the Dental Hygiene Human Needs Conceptual Model (DH HNCM). Using the Walker and Avant Theory Analysis, a seven-step process, the DH HNCM, was analysed and evaluated for its meaningfulness and contribution to dental hygiene. The steps include the following: (i) investigate the origins; (ii) examine relationships of the theory's concepts; (iii) assess the logic of the theory's structure; (iv) consider the usefulness to practice; (v) judge the generalizability; (vi) evaluate the parsimony; and (vii) appraise the testability of the theory. Human needs theory in nursing and Maslow's Hierarchy of Need Theory prompted this theory's development. The DH HNCM depicts four concepts based on the paradigm concepts of the profession: client, health/oral health, environment and dental hygiene actions, and includes validated eleven human needs that evolved overtime to eight. It is logical, simplistic, allows scientific predictions and testing, and provides a unique lens for the dental hygiene practitioner. With this model, dental hygienists have entered practice, knowing they enable clients to meet their human needs. For the DH HNCM, theory analysis affirmed that the model is reasonable and insightful and adds to the dental hygiene professions' epistemology and ontology. © 2016 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  2. Can theoretical intervention improve hand hygiene behavior among nurses?

    Directory of Open Access Journals (Sweden)

    Baghaei R


    Full Text Available Rahim Baghaei,1 Elham Sharifian,1 Aziz Kamran2 1Inpatient Safety Research Center, Nursing and Midwifery School, Urmia University of Medical Sciences, Urmia, 2Public Health Department, Khalkhal Faculty of Medical Sciences, Ardabil University of Medical Sciences, Ardabil, IranBackground: Hand washing is the best strategy to prevent known nosocomial infections but the nurses' hand hygiene is estimated to be poor in Iran.Objective: This study aimed to determine the effectiveness of BASNEF (Behavior, Attitude, Subjective Norms, and Enabling Factors model on hand hygiene adherence education.Methods: This controlled quasi-experimental study was conducted on 70 hemodialysis unit nurses (35 case and 35 control in the health and educational centers of the University of Medical Sciences of Urmia, Iran. To collect the data, a six-part validated and reliable questionnaire was used. The data were analyzed using SPSS version18, using Wilcoxon, Mann–Whitney, chi-square, and Fisher's exact tests. The significance level was considered P<0.05.Results: The mean age was 38.4±8.1 years for the intervention group and 40.2±8.0 years for the control group. There was no significant difference between the two groups for any demographic variables. Also, before the intervention, there was no significant difference between the two groups for any components of the BASNEF model. Post-intervention, the attitude, subjective norms, enabling factors, and intention improved significantly in the intervention group (P<0.001, but hand hygiene behavior did not show any significant change in the intervention group (P=0.16.Conclusion: Despite the improving attitudes and intention, the intervention had no significant effect on hand hygiene behavior among the studied nurses.Keywords: hand hygiene, adherence, education nurse, behavior

  3. Is Cognitive Status Related to Oral Hygiene Level and Appropriate for Determining Need for Oral Hygiene Assistance? (United States)

    Steinmassl, Patricia-Anca; Steinmassl, Otto; Kraus, Gabriela; Dumfahrt, Herbert; Grunert, Ingrid


    With declining general health, the maintenance of oral health becomes increasingly difficult. Unfortunately, health care resources are limited. An assessment tool for detecting a patient's need for oral health care assistance would promote its adequate distribution. The aim of this study is to evaluate if the Shulman clock-drawing test score is a suitable assessment tool for determining the need for oral hygiene assistance. Data collected from recent dental checkups of 126 inhabitants of five Austrian residential care facilities were analyzed. The Shulman clock-drawing test score was used as a measure for cognitive abilities and related to tooth and denture hygiene indices, which were assessed using the approximal space plaque index (API) and the denture plaque index (DPI). Shulman score values were distributed almost evenly in the study population. The mean API was 83.6% (SD 20.2%) for the maxilla and 94.9% (SD 15.6%) for the mandible. The mean DPI was 43.9% (SD 31.4%). Cognitive impairment was not statistically related to the dental or denture hygiene index. A high Shulman clock-drawing test score indicates the need for oral hygiene assistance, but it is not suitable as a single tool to assess this need. Patients with other disabilities might equally qualify for assistance. Dentures, however, can be cleaned quickly and efficiently independently of patient compliance; therefore, cleaning the patients' dentures should be part of nursing personnel's daily care routine for every patient.

  4. Materials of research-practical conference dedicated to 70-anniversary of sanitation, hygiene and occupational diseases research institute 'Actual problems of hygiene, sanitation and ecology'

    International Nuclear Information System (INIS)

    Iskandarov, T.I.; Kamil'dzhanov, A.Kh.


    The Research-practical conference dedicated to 70-anniversary of sanitation, hygiene and occupational diseases research institute 'Actual problems of hygiene, sanitation and ecology' was held on 2004 in Tashkent, Uzbekistan. Specialists discussed various aspects of actual problems of sanitation, hygiene, occupational diseases and ecology. They discussed also some aspects of radiology and nuclear medicine, radiation protection and dosimetry, radiation and other environmental pollutant effect on living organisms and biological materials. More than 250 talks were presented in the meeting. (k.m.)

  5. Application of the human needs conceptual model of dental hygiene to the role of the clinician : part II. (United States)

    Walsh, M M; Darby, M


    In summary, the theories of Maslow and of Yura and Walsh have been highlighted as background for understanding the human needs conceptual model of dental hygiene. In addition, 11 human needs have been identified and defined as being especially related to dental hygiene care, and a sample evaluation tool for their clinical assessment and a dental hygiene care plan have been presented. The four concepts of client, environment, health/oral health, and dental hygiene actions explained in terms of human need theory, and the 11 human needs related to dental hygiene care constitute the human needs conceptual model of dental hygiene. Within the framework of the human needs conceptual model of dental hygiene, the dental hygiene process is a systematic approach to dental hygiene care that involves assessment of the 11 human needs related to dental hygiene care; analysis of deficits in these needs; determination of the dental hygiene care plan based on identified deficits; implementation of dental hygiene interventions stated in the care plan; and evaluation of the effectiveness of dental hygiene interventions in achieving specific goals, including subsequent reassessment and revision of the dental hygiene care plan. This human needs conceptual model for dental hygiene provides a guide for comprehensive and humanistic client care. This model allows the dental hygienist to view each client (whether an individual or a group) holistically to prevent oral disease and to promote health and wellness. Dental hygiene theorists are encouraged to expand this model or to develop additional conceptual models based on dental hygiene's paradigm.

  6. Interventions to improve hand hygiene compliance in patient care. (United States)

    Gould, Dinah J; Moralejo, Donna; Drey, Nicholas; Chudleigh, Jane H; Taljaard, Monica


    Health care-associated infection is a major cause of morbidity and mortality. Hand hygiene is regarded as an effective preventive measure. This is an update of a previously published review. To assess the short- and long-term success of strategies to improve compliance to recommendations for hand hygiene, and to determine whether an increase in hand hygiene compliance can reduce rates of health care-associated infection. We conducted electronic searches of the Cochrane Register of Controlled Trials, PubMed, Embase, and CINAHL. We conducted the searches from November 2009 to October 2016. We included randomised trials, non-randomised trials, controlled before-after studies, and interrupted time series analyses (ITS) that evaluated any intervention to improve compliance with hand hygiene using soap and water or alcohol-based hand rub (ABHR), or both. Two review authors independently screened citations for inclusion, extracted data, and assessed risks of bias for each included study. Meta-analysis was not possible, as there was substantial heterogeneity across studies. We assessed the certainty of evidence using the GRADE approach and present the results narratively in a 'Summary of findings' table. This review includes 26 studies: 14 randomised trials, two non-randomised trials and 10 ITS studies. Most studies were conducted in hospitals or long-term care facilities in different countries, and collected data from a variety of healthcare workers. Fourteen studies assessed the success of different combinations of strategies recommended by the World Health Organization (WHO) to improve hand hygiene compliance. Strategies consisted of the following: increasing the availability of ABHR, different types of education for staff, reminders (written and verbal), different types of performance feedback, administrative support, and staff involvement. Six studies assessed different types of performance feedback, two studies evaluated education, three studies evaluated cues such

  7. Prevalence of dental caries and oral hygiene status among school going children: an epidemiological study. (United States)

    Ravishankar, P L; Jayapalan, C S; Gondhalekar, Rajesh V; Krishna, B Jaya; Shaloob, K M Muhamed; Ummer, P Fajar


    Oral health is an important part of general health of body. Oral hygiene determines oral health status. Thus, oral hygiene is most important for good health in general. Poor oral hygiene can be source of many diseases. By maintaining the good oral hygiene, we can prevent occurrence of many disease. A survey was carried out to assess oral hygiene status and to find out caries prevalence rate among school going children of age 6 to 12 years. 957 healthy subjects including 567 boys and 390 girls from four different schools were examined in broad day light with the help of mouth mirror and explorer.

  8. Oral Hygiene Levels in Children of Tribal Population of Eastern Ghats: An Epidemiological Study


    Raju, P Krishnam; Vasanti, D; Kumar, J Raghavendra; Niranjani, K; Kumar, M S Saravana


    Background: Oral hygiene has been given due importance since ages. Different cultures have been using different methods for the maintenance of good oral hygiene. The study was done to find out the oral hygiene levels in children of tribal population and to correlate the brushing methods used and the oral hygiene levels. Methodology: A total of 5129 children of 5-12 years age (boys 2778, girls 2351) were checked for the simplified oral hygiene index in the study. Results: The overall oral hygi...

  9. Hygiene behaviour and hospitalized severe childhood diarrhoea: a case-control study. (United States)

    Baltazar, J C; Tiglao, T V; Tempongko, S B


    The relationship between personal and domestic hygiene behaviour and hospitalized childhood diarrhoea was examined in a case-control study of 356 cases and 357 controls from low-income families in metropolitan Manila. Indices of hygiene behaviour were defined for overall cleanliness, kitchen hygiene, and living conditions. Only the indices for overall cleanliness and kitchen hygiene were significantly associated with diarrhoea. An increasing excess risk of hospitalization with severe diarrhoea was noted as the ratings for standards of hygiene became lower, and this excess risk persisted even after controlling for confounding variables. The implications of our findings for the control of diarrhoeal disease are discussed.

  10. Efficacy of an extended theory of planned behaviour model for predicting caterers' hand hygiene practices. (United States)

    Clayton, Deborah A; Griffith, Christopher J


    The main aim of this study was to determine the factors which influence caterers' hand hygiene practices using social cognitive theory. One hundred and fifteen food handlers from 29 catering businesses were observed carrying out 31,050 food preparation actions in their workplace. Caterers subsequently completed the Hand Hygiene Instrument (HHI), which ascertained attitudes towards hand hygiene using constructs from the Theory of Planned Behaviour (TPB) and the Health Belief Model. The TPB provided a useful framework for understanding caterers' implementation of hand hygiene practices, explaining 34% of the variance in hand hygiene malpractices (p behavioural control and intention (p food safety culture.

  11. The relationship between oral hygiene and oral colonisation with Candida species. (United States)

    Muzurovic, Selma; Babajic, Emina; Masic, Tarik; Smajic, Rubina; Selmanagic, Aida


    The aim of this study is to determine relationship between oral hygiene and colonisation of Candia species in oral cavity. Maintenance oral hygiene is reducing pathological agents in the mouth and preventing violation of oral health. Study included 140 patients. For oral hygiene assessement were used the dental plaque index, oral hygiene index and dental calculus index. Ph test strips were used to determine pH of saliva. For isolation of Candida species oral swabs were taken to all patients. It was found out that pH of oral cavity does not varies notably, no matter of oral hygiene level. Candida species were identified in 28.6% respondents. The most present were Candida albicans, in 85% cases. The presence of plaque, tartar and high index oral hygiene (IOH) in patients with Candida is statistically significant. It was found that 83.4% of patients with Candida poorly maintained oral hygiene. Poor oral hygiene is associated with a significantly higher score in the presence of tartar, plaque and high IOH. In total patient's population 67% has amalgam fillings. Presence of amalgam fillings in patients with identified Candida was statistically significant. This study indicates low level of oral hygiene. Correlation between presence of Candida species and poor oral hygiene was proved. Also Candida was more present among patients with amalgam fillings. Improvement of oral hygiene is necessery for oral health and health in general, as well.

  12. Knowledge of and Adherence to Hygiene Guidelines among Medical Students in Austria

    Directory of Open Access Journals (Sweden)

    Verena G. Herbert


    Full Text Available Background. Adherence to hygiene guidelines is of utmost importance for healthcare professionals. The aim of this study was to evaluate the knowledge on and the adherence to hygiene guidelines among medical students in Austria. Additionally, a possible difference between female and male students was investigated. Methods. An open paper-based survey among third-year medical students at the Medical University of Graz was conducted. The questionnaire consisted of 20 single-choice questions covering compliance with basic hygiene standards, self-rated knowledge of hygiene guidelines, and satisfaction with current hygiene education, equipment, and quality standards. Results. Of 192 medical students, 70% judged their knowledge of hygiene standards as “excellent” or “good”; however, only 49% reported adherence to hygiene guidelines and only 43% performed hygienic hand disinfection according to WHO guidelines. Of the respondents, 79% voted for a mandatory course on hygiene standards in medical education. No significant gender differences were observed. Conclusion. While the knowledge on hygiene guidelines appears to be good among medical students, adherence is limited and requires improvement. The need for an optimum education in hygiene is high.

  13. Determinants of hand hygiene compliance in Egypt: building blocks for a communication strategy. (United States)

    Lohiniva, A-L; Bassim, H; Hafez, S; Kamel, E; Ahmed, E; Saeed, T; Talaat, M


    Hand hygiene of health-care staff is one of the most important interventions in reducing transmission of nosocomial infections. This qualitative study aimed to understand the behavioural determinants of hand hygiene in order to develop sustainable interventions to promote hand hygiene in hospitals. Fourteen focus group discussions were conducted with nurses in 2 university hospitals in Egypt. The interviews were tape recorded and transcribed. Thematic analysis was conducted by 2 independent investigators. The findings highlighted that nurses did not perceive the benefits of hand hygiene, and that they linked the need to wash hands to a sense of dirtiness. Knowledge of hand hygiene and related products was limited and preference for water and soap was obvious. Environmental constraints, lack of role models and social control were identified as barriers for compliance with hand hygiene. A multi-faceted hand hygiene strategy was developed based on existing cultural concepts valued by the hospital staff.

  14. A Prospective Controlled Trial of an Electronic Hand Hygiene Reminder System (United States)

    Ellison, Richard T.; Barysauskas, Constance M.; Rundensteiner, Elke A.; Wang, Di; Barton, Bruce


    Background. The use of electronic hand hygiene reminder systems has been proposed as an approach to improve hand hygiene compliance among healthcare workers, although information on efficacy is limited. We prospectively assessed whether hand hygiene activities among healthcare workers could be increased using an electronic hand hygiene monitoring and reminder system. Methods. A prospective controlled clinical trial was conducted in 2 medical intensive care units (ICUs) at an academic medical center with comparable patient populations, healthcare staff, and physical layout. Hand hygiene activity was monitored concurrently in both ICUs, and the reminder system was installed in the test ICU. The reminder system was tested during 3 administered phases including: room entry/exit chimes, display of real-time hand hygiene activity, and a combination of the 2. Results. In the test ICU, the mean number of hand hygiene events increased from 1538 per day at baseline to 1911 per day (24% increase) with the use of a combination of room entry/exit chimes, real-time displays of hand hygiene activity, and manager reports (P hand hygiene to room entry/exit events also increased from 26.1% to 36.6% (40% increase, P hand hygiene events per day) during the follow-up phase. There was no significant change in hand hygiene activity in the control ICU during the course of the trial. Conclusions. In an ICU setting, an electronic hand hygiene reminder system that provided real-time feedback on overall unit-wide hand hygiene performance significantly increased hand hygiene activity. PMID:26430698

  15. A systematic review on hand hygiene knowledge and compliance in student nurses. (United States)

    Labrague, L J; McEnroe-Petitte, D M; van de Mortel, T; Nasirudeen, A M A


    Hand hygiene competence is one of the critical outcomes in nursing education. Ensuring nursing students recognize the what, when and how of hand hygiene is critical in the light of the increasing rates of healthcare-associated infections. To systematically appraise and synthesize articles on hand hygiene knowledge and compliance among nursing students. This is a systematic review of scientific articles published from 2006 to 2016. The primary databases used were as follows: PubMed, Embase, Cumulative Index to Nursing & Allied Health Literature, Proquest and PsychINFO. Key search terms utilized were as follows: 'handwashing', 'hand hygiene', 'compliance', 'knowledge', 'practice' and 'nursing students'. Nineteen studies met the review criteria. The findings revealed a low-to-moderate knowledge of and compliance with hand hygiene among nursing students. In addition, there were significantly higher rates of hand hygiene compliance in nursing students when compared to medical students. Relatively few studies attempted to identify predictors of hand hygiene knowledge and compliance. This review demonstrated suboptimal knowledge and compliance to hand hygiene among student nurses. In addition, this review also highlighted the paucity of studies that examined individual and organizational factors, which influence nursing students hand hygiene knowledge and compliance. The findings of this review emphasized the role of nurse educators in enhancing hand hygiene competence in nursing students. Implementation of empirically tested strategies such as utilizing multidimensional interventions, scenario-based hand hygiene simulation activities and hand hygiene education programmes that would enhance nursing students' hand hygiene knowledge and compliance is an asset. Hospital and nursing administrators should ensure continuous support and monitoring to guarantee that hand hygiene programmes are institutionalized in every healthcare setting by every healthcare worker. © 2017

  16. Quantitative impact of direct, personal feedback on hand hygiene technique. (United States)

    Lehotsky, Á; Szilágyi, L; Ferenci, T; Kovács, L; Pethes, R; Wéber, G; Haidegger, T


    This study investigated the effectiveness of targeting hand hygiene technique using a new training device that provides objective, personal and quantitative feedback. One hundred and thirty-six healthcare workers in three Hungarian hospitals participated in a repetitive hand hygiene technique assessment study. Ultraviolet (UV)-labelled hand rub was used at each event, and digital images of the hands were subsequently taken under UV light. Immediate objective visual feedback was given to participants, showing missed areas on their hands. The rate of inadequate hand rubbing reduced from 50% to 15% (P < 0.001). However, maintenance of this reduced rate is likely to require continuous use of the electronic equipment. Copyright © 2015 The Healthcare Infection Society. Published by Elsevier Ltd. All rights reserved.

  17. [Ergonomics, hygiene and rationality: the "electric house" of Monza (1930)]. (United States)

    Colombo, A; Porro, A; Franchini, A F


    The "Electric House" of Monza is seen as one of the early example of rationalist architecture produced in Italy. Sponsored by the Italian Edison General Company for Electricity and produced by the Group 7, it was built for the "IV International Triennial Exhibition of Decorative and Modern Industry Arts", held in Monza in 1930. It was conceived as an environment in which the designers showed their interest towards new concepts of rationalist hygiene. Special care was taken to select the environments in relation to the surrounding nature and the needs of life of the house inhabitants: new materials more comfortable, hygienic and rational were inserted. In the kitchen, for example, the architect P. Bottoni, created a space in which the housewife's work was marked by lower energy expenditure, thanks to a careful study of the actions and movements according to the principles of taylorism, here applied to domestic work.

  18. [Oral hygiene customs in 6-12 year old schoolchildren]. (United States)

    Hernández-Martínez, César Tadeo; Medina-Solís, Carlo Eduardo; Robles-Bermeo, Norma Leticia; Mendoza-Rodríguez, Martha; Veras-Hernández, Miriam; De la Rosa-Santillana, Rubén; Escoffié-Ramírez, Mauricio; Márquez-Rodríguez, Sonia


    OBJECTIVE. To characterize utilization of oral hygiene devices and customs in schoolchildren. MATERIAL AND METHODS. We performed a cross-sectional study in 1,404 schoolchildren (6- 12 year olds) from 14 public schools in Pachuca, Hidalgo, México, using a questionnaire for sociodemographic variables and 1) Tooth brushing frequency (customs were 85.5% tooth brushing, 90.9% toothpaste, 19.4% flossing, and 28.2% mouthwash. Only 11.8% of participants reported utilization in all 4 categories. We observed differences (p < 0.05) across sexes only in the use of toothpaste, as women used it more often. Differences across age were observed (p < 0.05) for tooth brushing (younger children brushed more often) and flossing (older children flossed more often). CONCLUSIONS. Tooth brushing was the oral hygiene practice more often performed in this sample, with other frequencies being relatively low. There were differences by age and sex across some variables.

  19. Questions about hygiene and work safety in operation of lasers

    Energy Technology Data Exchange (ETDEWEB)

    Kashuba, V A; Semenov, A M


    Lasers have found very wide use in science and technology. The USSR now uses several laser type instruments. Korund has tremendously accelerated output in a watch factory (jewel-drilling), freed hundreds of sq. meter space, and lowered personnel numbers by 470 workers (a photo is presented of an automated Korund-laser watch production section). Research by the F. F. Erisman Scientific Research Institute of Hygiene, in Moscow, demonstrated the positive effect of laser introduction in plants. The familiar hazards of use are noted, as are attending dangers from ir and uv, noise, and aerosols. Safety measures must include isolation of instruments shielding and protective goggles; hygienic, physiological, and ergonomic requirements of laser units must be met. Medical control of workers is said to be more intensive than in the USA.

  20. Hygiene, sport and humanism in the Spanish Renaissance

    Directory of Open Access Journals (Sweden)



    Full Text Available Starting with the medieval canon of the six non-natural things that maintain and prolong health, this paper analyses some of the hygienic aspects (air and life in the towns, the body and bathing, noble sports, the physic exercises, moderation in diet and way of life, the passions of the soul and spiritual exercises that were considered important during the Late Middle Ages and Renaissance. Furthermore, viewing the history of teaching as a process that spansmany centuries, the author argues that education has perpetuated, from Antiquity to the modern period, a series of commonplaces about bodily health that extol - in line with Aristotelian and Galenic tradition - the importance of a balanced, moderate life, which aligns with the virtue of temperance. It is also stated that hygiene ?in its public and private dimensions? has a history that goes back before the Enlightenment and the liberalism of the 19th century.

  1. Sexual discrimination in academia. Implications for dental hygiene faculty. (United States)

    Shuman, D; Tolle, S L


    Despite anti-discriminatory legislation, academic women in the 1980s have not achieved equality, and continue to face diverse problems advancing in an academic system based on a patriarchal paradigm. The purpose of this paper is to provide dental hygiene faculty with insight, awareness, and understanding into four major problem areas that influence women's academic success: values and attitudes learned through socialization; blocks to administrative positions; the male locus of decision making; and double standards of performance evaluation. Additionally, examples of solutions to these problems are discussed in three categories: individual, internal to the university, and external to the university; in an effort to better prepare women in dental hygiene education to succeed in academia despite discriminatory practices.

  2. Dental Hygiene Students' Self-Assessment of Ergonomics Utilizing Photography. (United States)

    Partido, Brian B


    Due to postural demands, dental professionals are at high risk for developing work-related musculoskeletal disorders (WMSDs). Dental clinicians' lack of ergonomic awareness may impede the clinical application of recommendations to improve their posture. The aim of this study was to determine whether feedback involving photography and self-assessment would improve dental hygiene students' ergonomic scores and accuracy of their ergonomic self-assessments. The study involved a randomized control design and used a convenience sample of all 32 junior-year dental hygiene students enrolled in the autumn 2016 term in The Ohio State University baccalaureate dental hygiene program. Sixteen students were randomly assigned to each of two groups (control and training). At weeks one and four, all participants were photographed and completed ergonomic self-evaluations using the Modified-Dental Operator Posture Assessment Instrument (M-DOPAI). During weeks two and three, participants in the training group were photographed again and used those photographs to complete ergonomic self-assessments. All participants' pre-training and post-training photographs were given ergonomic scores by three raters. Students' self-assessments in the control group and faculty evaluations of the training group showed significant improvement in scores over time (F(1,60)=4.25, p<0.05). In addition, the accuracy of self-assessment significantly improved for students in the training group (F(1,30)=8.29, p<0.01). In this study, dental hygiene students' self-assessments using photographs resulted in improvements in their ergonomic scores and increased accuracy of their ergonomic self-assessments. Any improvement in ergonomic score or awareness can help reduce the risks for WMSDs, especially among dental clinicians.

  3. Collaborative Dental Hygiene Practice in New Mexico and Minnesota. (United States)

    Hodges, Kathleen O; Rogo, Ellen J; Cahoon, Allison C; Neill, Karen


    This descriptive, comparative study was conducted to examine characteristics, services, models and opinions among collaborative dental hygiene practitioners in New Mexico and Minnesota. A self-designed online questionnaire, distributed via SurveyMonkey®, was utilized to collect data from 73 subjects who met the inclusion criteria. A multi-phase administration process was followed. Content validity and reliability was established. Descriptive statistics were used for analysis of 6 research questions. The Mann-Whitney U, Pearson Chi-Square and Fisher's Exact tests were employed to analyze 4 null hypotheses (p=0.05). Most participants (n=36) were experienced clinicians who chose to work in an alternative setting after 28 years or more in the field and reported increased access to care as the reason for practicing collaboratively. A variety of services were offered and private insurance and Medicaid were accepted, although many practitioners did not receive direct reimbursement. The majority of New Mexico participants worked in private dental hygiene practices, earned advanced degrees and serviced Health Provider Shortage Areas. The majority of Minnesota respondents worked in various facilities, earned associate's degrees and were uncertain if Health Provider Shortage Areas were served. There were no significant differences in the variables between practitioners in both states. New Mexico and Minnesota collaborative dental hygiene practitioners are similar in characteristics, services, and opinions although models of practice vary. Collaborative dental hygiene practice is a viable answer to increasing access to care and is an option for patients who might otherwise go without care, including the unserved, underserved, uninsured and underinsured. Copyright © 2016 The American Dental Hygienists’ Association.

  4. [Food hygiene training of members of corporate public catering committees]. (United States)

    Quaranta, Gianluigi; Laurenti, Patrizia; Gerardo Cairo, Antonio; Ricciardi, Gualtiero


    A food hygiene training course was offered to 25 members of the public catering committees of seven corporate restaurants. In order to evaluate the effectiveness of the course and identify critical topics, participants were asked to complete a questionnaire before and after completing the training course. Results are presented in this article and underscore the importance of training members of public catering committees in addition to food handlers.

  5. Hygiene intervention reduces contamination of weaning food in Bangladesh. (United States)

    Islam, Mohammad Sirajul; Mahmud, Zahid Hayat; Gope, Partha Sarathi; Zaman, Rokon Uz; Hossain, Zakir; Islam, Mohammad Shafiqul; Mondal, Dinesh; Sharker, Mohammad Abu Yushuf; Islam, Khairul; Jahan, Hasin; Bhuiya, Abbas; Endtz, Hubert P; Cravioto, Alejandro; Curtis, Valerie; Touré, Ousmane; Cairncross, Sandy


    This study was conducted to measure the impact of a hygiene intervention on the contamination of weaning food in Bangladesh. Sixty households were selected: 30 study and 30 control households. Samples of weaning food were collected from all the 60 households at baseline and examined for faecal coliforms (FC), faecal streptococci (FS) and Clostridium perfringens (CP) following standard procedures. After cooking, food samples were collected on three occasions before feeding. Following Hazard Analysis Critical Control Point (HACCP) procedures, critical control points were determined. The mothers in the 30 study households were then trained for 4 weeks in how to attain the control point conditions. Then, again the food samples were collected and analysed. At baseline, weaning foods from study and control households were heavily contaminated with FC and FS. The FC and FS counts were 1.84 log(10) and 1.92 log(10) colony-forming unit (cfu)/g, respectively, in the study households, and 0.86 log(10) and 1.33 log(10)  cfu/g, respectively, in the control households in the first feeding. After the intervention, the FC and FS counts in study households had dropped to 0.10 log(10) and 0.09 log(10)  cfu/g, respectively, a statistically significant reduction (P food hygiene. A hygiene intervention following the HACCP approach reduced the weaning food contamination significantly. Awareness building among mothers about weaning food hygiene could be an important intervention for preventing weaning food-related diarrhoea in Bangladesh. © 2012 Blackwell Publishing Ltd.

  6. Relationship Between Personal Hygiene of Elementary School and Helminthiasis


    Mukono, J; Rusmanto, Dwi


    Environmental conditions and poor personal hygiene as one of the causes of the high incidence of helminthiasis in Indonesia, affectingthe status of health, nutrition, intelligence and economic productivity. This study aims to determine the relationship between personal hygieneand the incidence of helminthiasis among primary school students. A cross sectional research was conduct at Omben Regency, District ofSampang, Madura island. Study sample were 57 students at 4th, 5th, and 6th grade from ...

  7. Use of social networking for dental hygiene program recruitment. (United States)

    Ennis, Rachel S


    Social networking has become a popular and effective means of communication used by students in the millennial generation. Academic admissions officers are beginning to utilize social networking methods for recruitment of students. However, the dental hygiene literature has reported little information about the use of social networking for recruitment strategies. This paper describes one institutions' process of creating and implementing a social network site for prospective and current students.

  8. Collaborative learning in pre-clinical dental hygiene education. (United States)

    Mueller-Joseph, Laura J; Nappo-Dattoma, Luisa


    Dental hygiene education continues to move beyond mastery of content material and skill development to learning concepts that promote critical-thinking and problem-solving skills. The purpose of this research was to evaluate the effectiveness of collaborative learning and determine the growth in intellectual development of 54 first-year dental hygiene students. The control group used traditional pre-clinical teaching and the experimental group used collaborative pedagogy for instrument introduction. All students were subjected to a post-test evaluating their ability to apply the principles of instrumentation. Intellectual development was determined using pre- and post-tests based on the Perry Scheme of Intellectual Development. Student attitudes were assessed using daily Classroom Assessment Activities and an end-of-semester departmental course evaluation. Findings indicated no significant difference between collaborative learning and traditional learning in achieving pre-clinical competence as evidenced by the students' ability to apply the principles of instrumentation. Advancement in intellectual development did not differ significantly between groups. Value added benefits of a collaborative learning environment as identified by the evaluation of student attitudes included decreased student reliance on authority, recognition of peers as legitimate sources of learning and increased self-confidence. A significant difference in student responses to daily classroom assessments was evident on the 5 days a collaborative learning environment was employed. Dental hygiene students involved in a pre-clinical collaborative learning environment are more responsible for their own learning and tend to have a more positive attitude toward the subject matter. Future studies evaluating collaborative learning in clinical dental hygiene education need to investigate the cost/benefit ratio of the value added outcomes of collaborative learning.

  9. Comparative evaluation of different methods of setting hygienic standards

    International Nuclear Information System (INIS)

    Ramzaev, P.V.; Rodionova, L.F.; Mashneva, N.I.


    Long-term experiments were carried out on white mice and rats to study the relative importance of various procedures used in setting hygienic standards for exposure to adverse factors. A variety of radionuclides and chemical substances were tested and the sensitivities to them of various indices of the bodily state were determined. For each index, statistically significant minimal effective concentrations of substances were established

  10. Attitudes towards students who plagiarize: a dental hygiene faculty perspective. (United States)

    Patel-Bhakta, Hemali G; Muzzin, Kathleen B; Dewald, Janice P; Campbell, Patricia R; Buschang, Peter H


    The purpose of this study was to examine baccalaureate dental hygiene faculty members' attitudes and practices regarding student plagiarism. An email containing a link to a thirty-two-item survey was sent to fifty-two baccalaureate dental hygiene program directors in the United States; thirty of those agreed for their faculty members to participate. Of the 257 faculty members who received the survey link, 106 completed the survey, for a response rate of 41.2 percent. The responding faculty members reported thinking plagiarism is a rising concern in their dental hygiene programs (54.5 percent, 54/99). The majority said they check for plagiarism on student class assignment/projects (67.1 percent, 53/79). For those who did not check for plagiarism, 45.8 percent (11/24) stated it took "too much time to check" or it was "too hard to prove" (16.6 percent, 4/24). The most frequent form of student plagiarism observed by the respondents was "copying directly from a source electronically" (78.0 percent, 39/50). Most respondents reported checking for plagiarism through visual inspection (without technological assistance) (73.0 percent, 38/52). Of those who said they use plagiarism detection software/services, 44.4 percent (16/36) always recommended their students use plagiarism detection software/services to detect unintentional plagiarism. For those faculty members who caught students plagiarizing, 52.9 percent (27/51) reported they "always or often" handled the incident within their dental hygiene department, and 76.5 percent (39/51) said they had never reported the student's violation to an academic review board.

  11. Radiation-Hygienic control of animal food in 1996

    International Nuclear Information System (INIS)

    Vicentijevic, M.; Vukovic, D.; Mitrovic, R.


    Radiation-hygienic control of animal food (concentrated fodder, row material for making fodder and food for pets) was done through the first and second circle of radiation biotechnology monitoring system (BIMOS) in 1996. The gamma-spectrometry determined activity of 137 Cs was less than 2,65 Bq/kg with one sample of fish flour exception (23,9 Bq/kg), so the completely radiation safety for animal food was confirmed. (author)

  12. Hygienic aspects of physical education and health of schoolchildren


    J.D. Svystun; V.M. Trach; Kh.E. Shavel; J.M. Kukujuk


    Aim: to analyze the state of physical education in secondary schools of Ukraine and to observe hygienic requirements during physical education lessons. Material: the study was attended by schoolchildren (n=40, age - 12-13 years) and schoolchildren of specialized sports classes (n=40, age - 14-16 years). Studied: the level of physical health; functional state of the respiratory and cardiovascular systems; the state of energy supply of children’s organism; the influence of mobile games on the f...





    Objectives:to determine the level of oral hygiene for prosthetic denture user, especially for full-denture in Kodingareng Island. This researchincluded the distribution level of prosthetic denture user based on age and education.Methods: the method that used in this research is observational descriptive withcross sectional-studyas the research design. Variable result of the research determined in to 3, those are bad, middle, and good. Result:the highest percentage o...

  14. Chitosan-based polyherbal toothpaste: As novel oral hygiene product

    Directory of Open Access Journals (Sweden)

    Mohire Nitin


    Full Text Available Objective: The objective of the present work was to develop chitosan-based polyherbal toothpaste and evaluate its plaque-reducing potential and efficacy in reduction of dental pathogens. Materials and Methods: Antimicrobial activity of herbal extracts against dental pathogens were performed by using disk diffusion method. The pharmaceutical evaluation of toothpaste was carried out as per the US Government Tooth Paste Specifications. A 4-week clinical study was conducted in patients with oro-dental problems to evaluate the plaque removing efficacy of chitosan-based polyherbal toothpaste with commercially available chlorhexidine gluconate (0.2% w/v mouthwash as positive control. Total microbial count was carried out to determine the percentage decrease in the oral bacterial count over the period of treatment. Result: Herbal extracts were found to possess satisfactory antimicrobial activity against most of the dental pathogens. Chitosan-containing polyherbal toothpaste significantly reduces the plaque index by 70.47% and bacterial count by 85.29%, and thus fulfills the majority of esthetic and medicinal requirements of oral hygiene products. Conclusion: Chitosan-based polyherbal toothpaste proves itself as a promising novel oral hygiene product as compared with currently available oral hygiene products. A further study to confirm the exact mechanism and active constituents behind antiplaque and antimicrobial activity of chitosan-based polyherbal toothpaste and its efficacy in large number of patient population is on high demand.

  15. Cultivating professional responsibility in a dental hygiene curriculum. (United States)

    Blue, Christine M


    To prepare dental hygienists for future roles in the health care system, dental hygiene education must prepare graduates with skills, ethics, and values that align with professional responsibility. The objective of this study was to determine the effectiveness of curricular changes designed to develop professional identity and responsibility over the entire span of the dental hygiene curriculum. Twenty-four dental hygiene students at the University of Minnesota were surveyed about their attitudes toward access to dental care, society's and health professionals' responsibility to care for the underserved, and their personal efficacy to provide care for the underserved. Surveys were conducted at three time points in the curriculum. The Attitudes Toward Health Care instrument adapted by Holtzman for dental use was used to survey the students. The findings indicate that this institution's curricular changes were effective in cultivating professional responsibility among these students. Their attitude scores increased across the six-semester curriculum, and students in their last semester of the program believed that all individuals have a right to dental care and that society has an obligation to provide dental care. These students' sense of obligation to care for the needy became stronger and their perceptions of their own ability to impact the community and act as an agent of change also increased.

  16. Dental hygiene student experiences in external placements in Australia. (United States)

    Taylor, Jane A; Hayes, Melanie J; Wallace, Linda


    While placements in external locations are being increasingly used in dental education globally, few studies have explored the student learning experience at such placements. The purpose of this study was to investigate student experiences while on external placement in a baccalaureate dental hygiene program. A self-reporting questionnaire was distributed to final-year dental hygiene students (n=77) at the University of Newcastle, Australia, in 2010. The questionnaire included questions regarding the type of placement, experiences offered, supervision, resources available, and lasting impressions. Responding students were generally positive about their external placement experience and indicated that the majority of facilities provided them with the opportunity to provide direct patient care and perform clinical tasks typical of a practicing hygienist. However, there was a statistically significant difference in their opinions about discipline-focused and community placements. Students indicated that their external placement experience provided opportunities to learn more about time and patient management, including hands-on experience with specific clinical tasks. Ongoing evaluations are necessary to ensure that external placements meet both student needs and intended learning outcomes within dental hygiene programs.


    Directory of Open Access Journals (Sweden)

    T. B. Baltrukova


    Full Text Available Modification of attitude to labor in the society, in professional communities and among people is necessary for further development of society and national economy. This goal may be achieved if the system of professional training is modified: switched to competence approach which should include training of experts, including those in radiation hygiene, with a set of general cultural and professional competences. The system of future experts training should be based on traditions of domestic and international education; it should use modern forms of active and interactive education (computer simulations, business games and role-playing, analysis of concrete situations, portfolio, psychological and other trainings, remote education, etc. It should consider actuality of knowledge and skills and develop independence and responsibility that will enable the young expert to be competitive at the modern labor market and to meet employers’ expectations. Under the new federal educational standard on radiation hygiene accepted in 2014 at present primary specialization in radiation hygiene takes place in internship. At training of experts the new standard provides great use of on-the-job training, independent work, scientific and practical work. Employers should play an important role in training of experts.

  18. Revisiting the hygiene hypothesis for allergy and asthma. (United States)

    Liu, Andrew H


    The hygiene hypothesis, which describes the protective influence of microbial exposures in early life on the development of allergy and asthma, has continued its swell of academic interest, investigation, and evolution. This article is focused on studies published in the past 3 years that have furthered the substance and shape of hygiene theory, primarily as it relates to allergic airways and asthma. Recent investigations have furthered an overarching "microbiome hypothesis" to home features, medical practices, and cleanliness behaviors that are suspects in the hygiene effect. Relatively crude markers of the protective microbial environment have been supplanted by culture-independent microbiome science, distinguishing the characteristics of potentially protective microbiomes from pathologic features. Understanding how the microbiome is shaped and affects healthful versus harmful outcomes in the human host is relatively nascent. Good clues are emerging that give mechanistic substance to the theory and could help guide microbe-based therapeutics to fill the allergy and asthma management gap in prevention and disease modification. Copyright © 2015 American Academy of Allergy, Asthma & Immunology. Published by Elsevier Inc. All rights reserved.

  19. Magnified Bacteria Powerful Motivator for Hand Hygiene Compliance. (United States)

    Gregory, Ashley


    Infection prevention specialists at Henry Ford Hospital in Detroit have found that showing healthcare workers magnified pictures of bacteria found ontheir hands and in their surrounding units can be a powerful motivator for improved hand hygiene compliance. When tested in four units during a one-month period, the intervention boosted hand hygiene compliance by an average of 24%. Investigators note that to be successful, the intervention must be paired with an effective compliance monitoring program. For the study, investigators visited each unit twice per week, during which they would swab various items as well as employees' hands using and adenosine triphosphate (ATP) meter, a hand-held device that measures living organisms. During each unit visit, infection prevention specialists would show unit personnel pictures from a compilation of 12 magnified images of bacteria that had been lifted from the unit. This was to demonstrate what the bacteria would look like under a microscope. The unsavory pictures produced immediate increases in had hygiene compliance, and prompted healthcare workers to see who could produce the best ATP meter readings on subsequent infection prevention specialist visits.

  20. Effect of magnification loupes on dental hygiene student posture. (United States)

    Maillet, J Peggy; Millar, A Michele; Burke, Jillian M; Maillet, Michelle A; Maillet, Wayne A; Neish, Nancy R


    The chair-side work posture of dental hygienists has long been a concern because of health-related problems potentially caused or exacerbated by poor posture. The purpose of this study was to investigate if using magnification loupes improved dental hygiene students' posture during provision of treatment. The treatment chosen was hand-scaling, and the effect of the timing of introduction of the loupes to students was also examined. Thirty-five novice dental hygiene students took part in the study. Each student was assessed providing dental hygiene care with and without loupes, thus controlling for innate differences in natural posture. Students were randomized into two groups. Group one used loupes in the first session and did not use them for the second session. Group two reversed this sequence. At the end of each session, all students were videotaped while performing scaling procedures. Their posture was assessed using an adapted version of Branson et al.'s Posture Assessment Instrument (PAI). Four raters assessed students at three time periods for nine posture components on the PAI. A paired t-test compared scores with and without loupes for each student. Scores showed a significant improvement in posture when using loupes (ppostural benefit is realized by requiring students to master the use of magnification loupes as early as possible within the curriculum.

  1. Hand Hygiene and Tuberculosis Risk in Korea: An Ecological Association. (United States)

    Han, Mi Ah


    Hand hygiene is a basic but effective strategy against infectious disease. This study investigated an ecological association between hand hygiene and tuberculosis (TB) risk in Korea. Hand hygiene data were obtained from the 2015 Community Health Survey. Information on TB incidence and mortality in 2015 were obtained from the National Infectious Diseases Surveillance System and death monitoring database, respectively. In multiple linear regression analysis, frequent hand washing rates after using the restroom (B = -0.78, P = .037), after returning from the outdoors (B = -0.28, P = .049), and with soap or hand sanitizer (B = -0.54, P = .018) were negatively associated with TB incidence. TB mortality were associated with frequent hand washing rates after returning from the outdoors (B = -0.05, P = .035), and with soap or hand sanitizer (B = -0.10, P = .010), respectively. Hand washing was associated with lower TB incidence and mortality at the community level. These results could contribute to develop community-based health promotion strategies.

  2. Oral Health and Hygiene Content in Nursing Fundamentals Textbooks

    Directory of Open Access Journals (Sweden)

    Rita A. Jablonski


    Full Text Available The purpose of this paper is to describe the quantity and quality of oral hygiene content in a representative sample of before-licensure nursing fundamentals textbooks. Seven textbooks were examined. Quantity was operationalized as the actual page count and percentage of content devoted to oral health and hygiene. Quality of content was operationalized as congruency with best mouth care practices. Best mouth care practices included evidence-based and consensus-based practices as published primarily by the American Dental Association and supported by both published nursing research and review articles specific to mouth care and published dental research and review articles specific to mouth care. Content devoted to oral health and hygiene averaged 0.6%. Although the quality of the content was highly variable, nearly every textbook contained some erroneous or outdated information. The most common areas for inaccuracy included the use of foam sponges for mouth care in dentate persons instead of soft toothbrushes and improper denture removal.

  3. Strengths and Weaknesses of the Current Dental Hygiene Educational System. (United States)

    Theile, Cheryl Westphal


    The state of the dental hygiene educational system in the United States is evolving. The numbers of programs, extent of curricula, and diversity of students, faculty, and practice settings vary significantly across the country. New trends in workforce utilization and delivery models are challenging current educational foundations and mandating an interprofessional approach to both the education and practice of dental hygienists. This article presents an overview of the current state of dental hygiene education to create a baseline for discussion of desired educational models for 2040. The strengths and weaknesses are defined to motivate change. Limitations of the current two-year associate degree are emphasized, along with the need to add expanded content and development of new skills. The developing non-traditional practice settings bring both a challenge to dental hygiene education and a promise of increasing potential in primary care interprofessional settings for the 21 st century. This article was written as part of the project "Advancing Dental Education in the 21 st Century."

  4. The Dental Hygiene Aptitude Tests and the American College Testing Program Tests as Predictors of Scores on the National Board Dental Hygiene Examination. (United States)

    Longenbecker, Sueann; Wood, Peter H.


    Scores from the National Board Dental Hygiene Examination (NBDHE) served as the criterion variable in a comparison of the predictive validity of the Dental Hygiene Aptitude Tests (DHAT) and the ACT Assessment tests. The DHAT-Science and Verbal tests combined to produce the highest multiple correlation with NBDHE scores. (Author/DWH)

  5. Effects of hand hygiene education and individual feedback on hand hygiene behaviour, MRSA acquisition rate and MRSA colonization pressure among intensive care unit nurses. (United States)

    Chun, Hee-Kyung; Kim, Kyung-Mi; Park, Ho-Ran


    This study was conducted to increase the frequency and level of thoroughness of hand hygiene practice by nurses, and to assess the influence of the methicillin-resistant Staphylococcus aureus (MRSA) acquired incidence rate and the MRSA colonization pressure in a medical intensive care unit (MICU). A total of 24 MICU nurses received hand hygiene education and individual feedback of hand hygiene frequency and method after a session of education, and two posteducation evaluations were followed. The frequency of hand hygiene (P = 0.001) and the methodology score of hand hygiene increased significantly (P = 0.001). The MRSA acquisition rate decreased significantly, from 11.1% before the education to 0% after (P = 0.014). The MRSA colonization pressure decreased significantly from 39.5% to 8.6% after the education sessions (P = 0.001). This indicates that providing individual feedback after hand hygiene education was very effective in increasing nurses' hand hygiene frequency and improving hand hygiene method; furthermore, it was expected to decrease health care-associated infections. © 2014 Wiley Publishing Asia Pty Ltd.

  6. Improving healthcare worker hand hygiene adherence before patient contact: A multimodal intervention of hand hygiene practice in Three Japanese tertiary care centers. (United States)

    Sakihama, Tomoko; Honda, Hitoshi; Saint, Sanjay; Fowler, Karen E; Kamiya, Toru; Sato, Yumiko; Iuchi, Ritsuko; Tokuda, Yasuharu


    Though hand hygiene is an important method of preventing healthcare-associated infection, we found suboptimal hand hygiene adherence among healthcare workers in 4 diverse Japanese hospitals (adherence rates of 11%-25%). Our goal was to assess multimodal hand hygiene intervention coupled with a contest to improve hand hygiene adherence. A total of 3 to 4 inpatient wards in 3 Japanese hospitals. Pre-post intervention study. The intervention was a multimodal hand hygiene intervention recommended by the World Health Organization that was tailored to each facility. The hospital with the highest adherence after the intervention was given $5000 US dollars and a trophy, provided by an American coinvestigator unaffiliated with any of the Japanese hospitals. We tracked hand hygiene adherence rates before patient contact for each unit and hospital and compared these to pre-intervention adherence rates. We observed 2982 postintervention provider-patient encounters in 10 units across 3 hospitals. Hand hygiene adherence rates were improved overall after the intervention (18% pre- to 33% postintervention; P hand hygiene rates among Japanese healthcare workers. Given the overall low rates, however, further improvement is necessary. © 2015 Society of Hospital Medicine.

  7. Review series on helminths, immune modulation and the hygiene hypothesis: the broader implications of the hygiene hypothesis. (United States)

    Rook, Graham A W


    Man has moved rapidly from the hunter-gatherer environment to the living conditions of the rich industrialized countries. The hygiene hypothesis suggests that the resulting changed and reduced pattern of exposure to microorganisms has led to disordered regulation of the immune system, and hence to increases in certain inflammatory disorders. The concept began with the allergic disorders, but there are now good reasons for extending it to autoimmunity, inflammatory bowel disease, neuroinflammatory disorders, atherosclerosis, depression associated with raised inflammatory cytokines, and some cancers. This review discusses these possibilities in the context of Darwinian medicine, which uses knowledge of evolution to cast light on human diseases. The Darwinian approach enables one to correctly identify some of the organisms that are important for the 'Hygiene' or 'Old Friends' hypothesis, and to point to the potential exploitation of these organisms or their components in novel types of prophylaxis with applications in several branches of medicine.

  8. Hand Hygiene Adherence Among Health Care Workers at Japanese Hospitals: A Multicenter Observational Study in Japan. (United States)

    Sakihama, Tomoko; Honda, Hitoshi; Saint, Sanjay; Fowler, Karen E; Shimizu, Taro; Kamiya, Toru; Sato, Yumiko; Arakawa, Soichi; Lee, Jong Ja; Iwata, Kentaro; Mihashi, Mutsuko; Tokuda, Yasuharu


    Although proper hand hygiene among health care workers is an important component of efforts to prevent health care-associated infection, there are few data available on adherence to hand hygiene practices in Japan. The aim of this study was to examine hand hygiene adherence at teaching hospitals in Japan. An observational study was conducted from July to November 2011 in 4 units (internal medicine, surgery, intensive care, and/or emergency department) in 4 geographically diverse hospitals (1 university hospital and 3 community teaching hospitals) in Japan. Hand hygiene practice before patient contact was assessed by an external observer. In a total of 3545 health care worker-patient observations, appropriate hand hygiene practice was performed in 677 (overall adherence, 19%; 95% confidence interval, 18%-20%). Subgroup rates of hand hygiene adherence were 15% among physicians and 23% among nurses. The ranges of adherence were 11% to 25% between hospitals and 11% to 31% between units. Adherence of the nurses and the physicians to hand hygiene was correlated within each hospital. There was a trend toward higher hand hygiene adherence in hospitals with infection control nurses, compared with hospitals without them (29% versus 16%). The hand hygiene adherence in Japanese teaching hospitals in our sample was low, even lower than reported mean values from other international studies. Greater adherence to hand hygiene should be encouraged in Japan.

  9. Automated monitoring: a potential solution for achieving sustainable improvement in hand hygiene practices. (United States)

    Levchenko, Alexander I; Boscart, Veronique M; Fernie, Geoff R


    Adequate hand hygiene is often considered as the most effective method of reducing the rates of hospital-acquired infections, which are one of the major causes of increased cost, morbidity, and mortality in healthcare. Electronic monitoring technologies provide a promising direction for achieving sustainable hand hygiene improvement by introducing the elements of automated feedback and creating the possibility to automatically collect individual hand hygiene performance data. The results of the multiphase testing of an automated hand hygiene reminding and monitoring system installed in a complex continuing care setting are presented. The study included a baseline Phase 1, with the system performing automated data collection only, a preintervention Phase 2 with hand hygiene status indicator enabled, two intervention Phases 3 and 4 with the system generating hand hygiene reminding signals and periodic performance feedback sessions provided, and a postintervention Phase 5 with only hand hygiene status indicator enabled and no feedback sessions provided. A significant increase in hand hygiene performance observed during the first intervention Phase 3 was sustained over the second intervention Phase 4, with the postintervention phase also indicating higher hand hygiene activity rates compared with the preintervention and baseline phases. The overall trends observed during the multiphase testing, the factors affecting acceptability of the automated hand hygiene monitoring system, and various strategies of technology deployment are discussed.

  10. A discourse on the nature of dental hygiene knowledge and knowing. (United States)

    Cobban, S J; Edgington, E M; Myrick, F; Keenan, L


    Historically, dental hygiene has adopted theory and research from other health disciplines, without adequately modifying these concepts to reflect the unique dental hygiene practice context, leaving dental hygiene's research and theory base underdeveloped. Dental hygiene has yet to articulate its epistemological assumptions--the nature, scope and object of dental hygiene knowledge--or to fully describe the patterns of knowing that are brought to practice. This paper uses a method of inquiry from philosophy to begin the discourse about dental hygiene ways of knowing. In nursing, Carper identified four fundamental patterns of knowing: empirics or the science of nursing; aesthetics or the art of nursing; personal knowledge and ethical or moral knowledge. These patterns were used to explore this concept within dental hygiene. There is more to the nature of dental hygiene knowledge and knowing than rote application of technique-related or research-based information in practice, including judgements about when and how to use different types of information that are used. Currently, empirical forms of knowledge seem to be disproportionately valued, yet evidence was found for all of Carper's four patterns of knowing. Carper's work on patterns of knowing in nursing provided a useful framework to initiate the discourse on ways of knowing in dental hygiene. These results are submitted for others to challenge, refine and extend, for continuing the discussion. Dental hygiene leaders and scholars need to engage in discourse about extending the epistemological assumptions to reflect reality.

  11. Interventions to improve patient hand hygiene: a systematic review. (United States)

    Srigley, J A; Furness, C D; Gardam, M


    Nosocomial pathogens may be acquired by patients via their own unclean hands, but there has been relatively little emphasis on patient hand hygiene as a tool for preventing healthcare-associated infections (HCAIs). The aim of this systematic review was to determine the efficacy of patient hand hygiene interventions in reducing HCAIs and improving patient hand hygiene rates compared to usual care. Electronic databases and grey literature were searched to August 2014. Experimental and quasi-experimental studies were included if they evaluated a patient hand hygiene intervention conducted in an acute or chronic healthcare facility and included HCAI incidence and/or patient hand hygiene rates as an outcome. All steps were performed independently by two investigators. Ten studies were included, most of which were uncontrolled before-after studies (N=8). The majority of interventions (N=7) were multi-modal, with components similar to healthcare worker hand hygiene programmes, including education, reminders, audit and feedback, and provision of hand hygiene products. Six studies reported HCAI outcomes and four studies assessed patient hand hygiene rates; all demonstrated improvements but were at moderate to high risk of bias. In conclusion, interventions to improve patient hand hygiene may reduce the incidence of HCAIs and improve hand hygiene rates, but the quality of evidence is low. Future studies should use stronger designs and be more selective in their choice of outcomes. Copyright © 2016 The Healthcare Infection Society. Published by Elsevier Ltd. All rights reserved.

  12. Determining next steps in a hand hygiene improvement initiative by examining variation in hand hygiene compliance rates. (United States)

    Homa, Karen; Kirkland, Kathryn B


    Health care worker hand hygiene (HH) is a major quality and safety concern since poor hand hygiene has been linked with hospital associated infections. Dartmouth-Hitchcock Medical Center has been involved in a 4-year initiative to improve hand hygiene. In 2006, HH compliance occurred 41% of the time and by 2009, it had improved to 91%. We wanted to understand some of the unexplained variability in HH to help determine where to target more specific strategies. To help determine where some of the variability in HH compliance rates occurred, an analysis of means chart was used to determine whether role type of the health care worker and hospital areas had significantly different HH rates compared with the overall HH rate. The overall HH rate between March 2008 and December 2009 was 87%. There was a wide and significant variation between the 16 groups of 2 types of health care workers in 8 hospital areas from the lowest rate of 64% to a high of 96%. Analysis of means revealed significant differences in HH rates relative to the type of worker and hospital areas. Although the method does not inform the organization of what type of intervention will work where and why, it allows high and low performing groups to be identified, so that organizations can learn from them to generate and test theories.

  13. Implementation of the WHO multimodal Hand Hygiene Improvement Strategy in a University Hospital in Central Ethiopia. (United States)

    Pfäfflin, Frieder; Tufa, Tafese Beyene; Getachew, Million; Nigussie, Tsehaynesh; Schönfeld, Andreas; Häussinger, Dieter; Feldt, Torsten; Schmidt, Nicole


    The burden of health-care associated infections in low-income countries is high. Adequate hand hygiene is considered the most effective measure to reduce the transmission of nosocomial pathogens. We aimed to assess compliance with hand hygiene and perception and knowledge about hand hygiene before and after the implementation of a multimodal hand hygiene campaign designed by the World Health Organization. The study was carried out at Asella Teaching Hospital, a university hospital and referral centre for a population of about 3.5 million in Arsi Zone, Central Ethiopia. Compliance with hand hygiene during routine patient care was measured by direct observation before and starting from six weeks after the intervention, which consisted of a four day workshop accompanied by training sessions and the provision of locally produced alcohol-based handrub and posters emphasizing the importance of hand hygiene. A second follow up was conducted three months after handing over project responsibility to the Ethiopian partners. Health-care workers' perception and knowledge about hand hygiene were assessed before and after the intervention. At baseline, first, and second follow up we observed a total of 2888, 2865, and 2244 hand hygiene opportunities, respectively. Compliance with hand hygiene was 1.4% at baseline and increased to 11.7% and 13.1% in the first and second follow up, respectively (p hand hygiene was consistent across professional categories and all participating wards and was independently associated with the intervention (adjusted odds ratio, 9.18; 95% confidence interval 6.61-12.76; p hand hygiene actions. The median hand hygiene knowledge score overall was 13 (interquartile range 11-15) at baseline and increased to 17 (15-18) after training (p hand hygiene is feasible and sustainable in a resource-constrained setting using a multimodal improvement strategy. However, absolute compliance remained low. Strong and long-term commitment by hospital management and

  14. Video observation of hand hygiene practices during routine companion animal appointments and the effect of a poster intervention on hand hygiene compliance (United States)


    Background Hand hygiene is considered one of the most important infection control measures in human healthcare settings, but there is little information available regarding hand hygiene frequency and technique used in veterinary clinics. The objectives of this study were to describe hand hygiene practices associated with routine appointments in companion animal clinics in Ontario, and the effectiveness of a poster campaign to improve hand hygiene compliance. Results Observation of hand hygiene practices was performed in 51 clinics for approximately 3 weeks each using 2 small wireless surveillance cameras: one in an exam room, and one in the most likely location for hand hygiene to be performed outside the exam room following an appointment. Data from 38 clinics were included in the final analysis, including 449 individuals, 1139 appointments before and after the poster intervention, and 10894 hand hygiene opportunities. Overall hand hygiene compliance was 14% (1473/10894), while before and after patient contact compliance was 3% (123/4377) and 26% (1145/4377), respectively. Soap and water was used for 87% (1182/1353) of observed hand hygiene attempts with a mean contact time of 4 s (median 2 s, range 1-49 s), while alcohol-based hand rub (ABHR) was used for 7% (98/1353) of attempts with a mean contact time of 8 s (median 7 s, range 1-30 s). The presence of the posters had no significant effect on compliance, although some staff reported that they felt the posters did increase their personal awareness of the need to perform hand hygiene, and the posters had some effect on product contact times. Conclusions Overall hand hygiene compliance in veterinary clinics in this study was low, and contact time with hand hygiene products was frequently below current recommendations. Use of ABHR was low despite its advantages over hand washing and availability in the majority of clinics. The poster campaign had a limited effect on its own, but could still be used as a

  15. Effect of different oral hygiene measures on oral malodor in children aged 7-15 years. (United States)

    Patil, Piyusha S; Pujar, Pallavi; Subbareddy, V V


    To evaluate the effect of various oral hygiene measures individually and in combination in reducing oral malodor. A total number of 120 children diagnosed as having oral malodor (oral malodor scores 2 and above) were included in the study. Children were then grouped under four oral hygiene categories (tooth brushing, tongue cleaning, mouth rinsing, and a combination group). There were 30 children in each group. The children were asked to perform oral hygiene methods individually and in combination. The children were then reassessed for oral malodor 2 h later. The results were analyzed and compared. Both individual oral hygiene measure or in combination of tooth brushing, tongue cleaning, and mouth rinsing; all were effective in reducing oral malodor. Significant reduction (P oral malodor was seen when all three oral hygiene measures performed together. Oral malodor was significantly reduced after performing oral hygiene measures individually, but reduced more when used in combination.

  16. Child care hygiene practices of women migrating from rural to urban areas of bangladesh. (United States)

    Begum, Housne Ara; Moneesha, Shanta Shyamolee; Sayem, Amir Mohammad


    Children's hygiene is very important for better health but there is a paucity of studies in this area. This questionnaire study examined the child care hygiene practices of mothers of young children. A total of 354 women from slum areas of Dhaka city, Bangladesh, who migrated from rural to urban areas were selected for this study. The mean score on hygiene practice was 6.21 of 10 items (SD = 2.113). Low (score = 3) and high hygiene practice (score = 7-10) were practiced by 12.4% and 45.8% of participants, respectively. Multivariate regression analysis indicated that independent variables explained 39.9% of variance in hygiene practices. Eight variables have significant effect: participant's education (0.108; P hygiene practice indicates the necessity of awareness building initiatives.

  17. Patient-centered hand hygiene: the next step in infection prevention. (United States)

    Landers, Timothy; Abusalem, Said; Coty, Mary-Beth; Bingham, James


    Hand hygiene has been recognized as the most important means of preventing the transmission of infection, and great emphasis has been placed on ways to improve hand hygiene compliance by health care workers (HCWs). Despite increasing evidence that patients' flora and the hospital environment are the primary source of many infections, little effort has been directed toward involving patients in their own hand hygiene. Most previous work involving patients has included patients as monitors or auditors of hand hygiene practices by their HCWs. This article reviews the evidence on the benefits of including patients more directly in hand hygiene initiatives, and uses the framework of patient-centered safety initiatives to provide recommendations for the timing and implementation of patient hand hygiene protocols. It also addresses key areas for further research, practice guideline development, and implications for training of HCWs. Copyright © 2012 Association for Professionals in Infection Control and Epidemiology, Inc. Published by Mosby, Inc. All rights reserved.

  18. Hand hygiene compliance before and after wearing gloves among intensive care unit nurses in Iran. (United States)

    Ghorbani, Azam; Sadeghi, Leila; Shahrokhi, Akram; Mohammadpour, Asghar; Addo, Mary; Khodadadi, Esmail


    Nosocomial infections are considered a major risk factor in hospital wards, and hand hygiene is the first step in their control. An observational study was conducted in 2015 with 200 nurses working in intensive care units in teaching hospitals of Tabriz, Iran. Data were collected by using the Hand Hygiene Observation Tool questionnaire. The researchers monitored nurses' opportunities for hand hygiene during the 8-week period from February 3-April 4, 2015. A total of 1,067 opportunities occurred for hand hygiene before and after wearing gloves. The results show that hand hygiene compliance before wearing gloves is poor among nurses who work in intensive care units (14.8%). Therefore it is necessary to conduct effective interventions through continuing education programs to improve hand hygiene compliance. Copyright © 2016 Association for Professionals in Infection Control and Epidemiology, Inc. Published by Elsevier Inc. All rights reserved.

  19. Computer games to teach hygiene: an evaluation of the e-Bug junior game


    Farrell, D.; Kostkova, P.; Weinberg, J.; Lazareck, L.; Weerasinghe, D.; Lecky, D. M.; McNulty, C. A.


    Handwashing, respiratory hygiene and antibiotic resistance remain major public health concerns. In order to facilitate an effective outcome when teaching the basic principles of hand and respiratory hygiene, educational interventions should first target school children. As computer games are ubiquitous in most children's lives, e-Bug developed computer games targeted at teaching children handwashing, respiratory hygiene and antibiotic resistance. The games were designed for two target audienc...

  20. Systemic mistakes in hand hygiene practice in Ukraine: detection, consequences and ways of elimination (United States)

    Klymenko, Iryna; Kampf, Günter


    Aim: Every year, millions of people around the world suffer from different infectious diseases, considerable part of which are hospital-acquired infections. WHO considers hand hygiene as a priority measure aimed to reduce the level of infection. We evaluated various aspects related to the situational behavior and prioritization regarding hand hygiene measures among the healthcare workers of Ukraine. Method: Identification of system mistakes in hand hygiene was carried out first of all by direct and indirect observation of the activities of medical and pharmaceutical personnel in their everyday practice as well as during their participation in trainings on routine hand hygiene. Questionnaires also were used to estimate the level of hand hygiene compliance of participants of the study. During this period 112 training courses, 315 master-classes and presentations on proper hand hygiene were realized. The target audience included health care workers of medical centers, clinics, maternity hospitals, health care organizations and staff of pharmacies and pharmaceutical manufacturing enterprises in all regions of Ukraine. 638 respondents took part in anonymous survey on hand hygiene practice. Results: The most common mistakes were to regard hand washing and hand disinfection equally, to wash hands before doing a hand disinfection, to neglect the five moments for hand hygiene and to ignore hand hygiene before and after wearing protective gloves. Practitioners, medical attendants, pharmacy and pharmaceutical industry workers highlighted the need for practical and understandable instructions of various hand hygiene procedures, including the clarification of the possible technical mistakes. This became a ground for us to create individual master classes on hand hygiene for each cluster of healthcare workers. Conclusions: Changing hand hygiene behavior and attitude is possible by beginning to observe clinical practice and by involving healthcare workers in teaching and training

  1. Comparison of ethanol hand sanitizer versus moist towelette packets for mealtime patient hand hygiene. (United States)

    Rai, Herleen; Knighton, Shanina; Zabarsky, Trina F; Donskey, Curtis J


    To facilitate patient hand hygiene, there is a need for easy-to-use products. In a survey of 100 patients, a single-use ethanol hand sanitizer packet took less time to access than a single-use moist towelette packet (3 vs 23 seconds) and was preferred by 74% of patients for mealtime hand hygiene. Performance of patient hand hygiene increased when a reminder was provided at the time of meal tray delivery. Published by Elsevier Inc.

  2. [Investigation of the safety of microbial biotechnological products and their hygienic regulation]. (United States)

    Omel'ianets', T H; Kovalenko, N K; Holovach, T M


    Peculiarities of influence of microbial preparations based on microorganisms of different taxonomic groups on the warm-blooded organisms are considered, that is necessary to take into account when developing the strategy of toxico-hygienic studying of these preparations and when substanting hygienic standards in industrial objects and in the environment. The possibility to simplify the methodical scheme of the toxicological estimation and the hygienic regulation of microbial preparations on the basis of soil nitrogen-fixing microorganisms is discussed.

  3. Menstrual hygiene management among adolescent schoolgirls in low- and middle-income countries: research priorities


    Phillips-Howard, Penelope; Caruso, Bethany; Torondel, Belen; Zulaika, Garazi; Sahin, Murat; Sommer, Marni


    Background: A lack of adequate guidance on menstrual management; water, disposal, and private changing facilities; and sanitary hygiene materials in low- and middle-income countries leaves schoolgirls with limited options for healthy personal hygiene during monthly menses. While a plethora of observational studies have described how menstrual hygiene management (MHM) barriers in school impact girls’ dignity, well-being, and engagement in school activities, studies have yet to confirm if inade...

  4. Hand hygiene to reduce community transmission of influenza and acute respiratory tract infection: a systematic review.


    Warren-Gash, C; Fragaszy, E; Hayward, AC


    : Please cite this paper as: Warren-Gash et al. (2012) Hand hygiene to reduce community transmission of influenza and acute respiratory tract infection: a systematic review. Influenza and Other Respiratory Viruses DOI: 10.1111/irv.12015. Hand hygiene may be associated with modest protection against some acute respiratory tract infections, but its specific role in influenza transmission in different settings is unclear. We aimed to review evidence that improving hand hygiene reduces primary an...

  5. Behaviour change for better health: nutrition, hygiene and sustainability (United States)


    As the global population grows there is a clear challenge to address the needs of consumers, without depleting natural resources and whilst helping to improve nutrition and hygiene to reduce the growth of noncommunicable diseases. For fast-moving consumer goods companies, like Unilever, this challenge provides a clear opportunity to reshape its business to a model that decouples growth from a negative impact on natural resources and health. However, this change in the business model also requires a change in consumer behaviour. In acknowledgement of this challenge Unilever organised a symposium entitled ‘Behaviour Change for Better Health: Nutrition, Hygiene and Sustainability’. The intention was to discuss how consumers can be motivated to live a more healthy and sustainable lifestlye in today’s environment. This article summarises the main conclusions of the presentations given at the symposium. Three main topics were discussed. In the first session, key experts discussed how demographic changes – particularly in developing and emerging countries – imply the need for consumer behaviour change. The second session focused on the use of behaviour change theory to design, implement and evaluate interventions, and the potential role of (new or reformulated) products as agents of change. In the final session, key issues were discussed regarding the use of collaborations to increase the impact and reach, and to decrease the costs, of interventions. The symposium highlighted a number of key scientific challenges for Unilever and other parties that have set nutrition, hygiene and sustainability as key priorities. The key challenges include: adapting behaviour change approaches to cultures in developing and emerging economies; designing evidence-based behaviour change interventions, in which products can play a key role as agents of change; and scaling up behaviour change activities in cost-effective ways, which requires a new mindset involving public

  6. Perceived stressors of oral hygiene students in the dental environment

    Directory of Open Access Journals (Sweden)

    Chrisleen Rayner


    Full Text Available Background. University students are exposed to a multitude of stressors that may impact on their performance. The nature of health sciences education generally involves early engagement with patients and communities, which may add to the stressors inherent to university life. There is sparse information on stressors in the oral hygiene educational environment. Objective. To determine perceived stressors and the level of burnout among oral hygiene students at the University of the Western Cape, Cape Town, South Africa. Method. A descriptive, cross-sectional study design was used. The study sample included all students in the Bachelor of Oral Health (BOH degree during 2012 (N=89. A self-administered questionnaire was used to gather data. Three parameters were measured, i.e. (i demographic characteristics; (ii perceived sources of stress, using a modified Dental Environment Stress (DES questionnaire; and (iii burnout, using the Maslach Burnout Inventory (MBI. Results. Respondents were mostly female (74% and primarily in the 18 - 25-year age group (92%. First- and 2nd-year students identified fear of failing and study load as major stressors. Stressors related to a lack of basic needs were identified as major stressors by 25% of 1st-year students. Third-year students identified clinical quotas, supervision and patients being late as major stressors. MBI scores indicated that students were not at risk for burnout; however, most students (66.2% scored high on emotional exhaustion (EE. Conclusion. Oral hygiene students identified stressors in their learning environment. There was a progressive increase in EE across academic years. The results suggest that interventions should be tailored for specific academic year groups.

  7. Oral hygiene of hospitalised older patients with lower limb fracture. (United States)

    Ewan, Victoria; Newton, Julia L; Rushton, Steven; Walls, Angus W G


    good oral hygiene is important for eating, talking and improved quality of life, and is part of basic patient care, but there are few observational studies in hospitalised older patients. The aim of this study is to investigate dental plaque load in older patients over time in hospital. we examined the mouths of 93 patients with lower limb fracture prospectively at day 1, 7 and 14 after admission in a Newcastle upon Tyne Hospital. We assessed dental and denture plaque load, dry mouth symptoms and tooth number, along with demographic and frailty variables. We used univariate generalised linear modelling and mixed effects models to investigate associations between increased plaque and patient characteristics. in dentate patients, plaque score increased with time in hospital (P = 0.007, odds ratio (OR): 1.02; 95% confidence of interval (CI): 1.01-1.04). Frailty (P = 0.015, OR: 1.19; 95% CI: 1.04-1.37), dementia (P < 0.001, OR: 4.30; 95% CI: 2.03-9.12), residence in an institution (P < 0.001, OR: 4.61; 95% CI: 2.18-9.74), decreased mobility (P = 0.013, OR: 0.97; 95% CI: 0.96-0.99), but not Charlson comorbidity index (P = 0.102, OR: 1.08; 95% CI: 0.99-1.19), were associated with increased plaque scores at every time point. oral hygiene deteriorated in dentate patients in hospital. Plaque scores were significantly higher in patients who were more likely to be dependent on others for their oral hygiene. © The Author 2016. Published by Oxford University Press on behalf of the British Geriatrics Society. All rights reserved. For Permissions, please email:

  8. Hygienic-sanitary profile and microbiological dangers in public slaughterhouses

    Directory of Open Access Journals (Sweden)

    Edinaidy Suianny Rocha de Moura


    Full Text Available ABSTRACT. Moura E.S.R., Abrantes M.R., Mendes C.G., Oliveira A.R.M, Souza E.S. & Silva J.B.A. [Hygienic-sanitary profile and microbiological dangers in public slaughterhouses.] Perfil higiênico-sanitário e perigos microbiológicos em abatedouros públicos. Revista Brasileira de Medicina Veterinária, 37(3:203-208, 2015. Departamento de Ciência Animal, Universidade Federal Rural do Semi-Árido, Avenida Francisco Mota, 572, Bairro Costa e Silva, Mossoró, RN 59625-900, Brasil. E-mail: The aim of this study was to evaluate hygienic and sanitary conditions of municipal slaughterhouses in Rio Grande do Norte. Through a check list, hygienic conditions of establishments and handlers were observed and the percentage of compliance was rated excellent (≥ 80%, good (60 to 79.9%, regular (40 to 59.9% and poor (<40%, according to official standards established by Brazilian legislation. Ten water samples were collected to analyze total and thermotolerant coliforms; and 200 swab samples, including 150 from the utensils, equipment, handlers, and cattle carcasses were investigated for Staphylococcus aureus and Enterobacteria, and 50 from the environment for Listeria sp. research. It was noted, through the check list, the existence of various inadequate parameters when compared to those established, and required by law. According to the percentage of compliance found in abattoirs during the assessment visits, no slaughterhouse was rated as excellent, only one was considered good, one was classified as regular and three were considered poor. As for the microbiological analyzes, the presence of coliforms was confirmed in water from two slaughterhouses. High bacteria counts were found in swabs from tools, handlers, and cattle carcasses, and the presence of Listeria sp. was observed in three slaughterhouses. Therefore, the precarious sanitary conditions of the municipal slaughterhouses studied in Rio Grande do Norte represent a risk to

  9. Biological evaluation of nanosilver incorporated cellulose pulp for hygiene products

    Energy Technology Data Exchange (ETDEWEB)

    Kavitha Sankar, P.C.; Ramakrishnan, Reshmi; Rosemary, M.J., E-mail:


    Cellulose pulp has a visible market share in personal hygiene products such as sanitary napkins and baby diapers. However it offers good surface for growth of microorganisms. Huge amount of research is going on in developing hygiene products that do not initiate microbial growth. The objective of the present work is to produce antibacterial cellulose pulp by depositing silver nanopowder on the cellulose fiber. The silver nanoparticles used were of less than 100 nm in size and were characterised using transmission electron microscopy and X-ray powder diffraction studies. Antibacterial activity of the functionalized cellulose pulp was proved by JIS L 1902 method. The in-vitro cytotoxicity, in-vivo vaginal irritation and intracutaneous reactivity studies were done with silver nanopowder incorporated cellulose pulp for introducing a new value added product to the market. Cytotoxicity evaluation suggested that the silver nanoparticle incorporated cellulose pulp is non-cytotoxic. No irritation and skin sensitization were identified in animals tested with specific extracts prepared from the test material in the in-vivo experiments. The results indicated that the silver nanopowder incorporated cellulose pulp meets the requirements of the standard practices recommended for evaluating the biological reactivity and has good biocompatibility, hence can be classified as a safe hygiene product. - Highlights: • Different amounts of silver nanoparticles (0.2 g–0.4 g/napkin) were added to cellulose pulp. • The silver nanoparticle incorporated cellulose pulp was proved to be antibacterial by JIS L 1902 method. • The minimum concentration of silver required for antibacterial activity with no cytotoxicity has been found out. • In-vivo vaginal irritation and intracutaneous reactivity studies confirmed the biocompatibility of the material.

  10. Biological evaluation of nanosilver incorporated cellulose pulp for hygiene products

    International Nuclear Information System (INIS)

    Kavitha Sankar, P.C.; Ramakrishnan, Reshmi; Rosemary, M.J.


    Cellulose pulp has a visible market share in personal hygiene products such as sanitary napkins and baby diapers. However it offers good surface for growth of microorganisms. Huge amount of research is going on in developing hygiene products that do not initiate microbial growth. The objective of the present work is to produce antibacterial cellulose pulp by depositing silver nanopowder on the cellulose fiber. The silver nanoparticles used were of less than 100 nm in size and were characterised using transmission electron microscopy and X-ray powder diffraction studies. Antibacterial activity of the functionalized cellulose pulp was proved by JIS L 1902 method. The in-vitro cytotoxicity, in-vivo vaginal irritation and intracutaneous reactivity studies were done with silver nanopowder incorporated cellulose pulp for introducing a new value added product to the market. Cytotoxicity evaluation suggested that the silver nanoparticle incorporated cellulose pulp is non-cytotoxic. No irritation and skin sensitization were identified in animals tested with specific extracts prepared from the test material in the in-vivo experiments. The results indicated that the silver nanopowder incorporated cellulose pulp meets the requirements of the standard practices recommended for evaluating the biological reactivity and has good biocompatibility, hence can be classified as a safe hygiene product. - Highlights: • Different amounts of silver nanoparticles (0.2 g–0.4 g/napkin) were added to cellulose pulp. • The silver nanoparticle incorporated cellulose pulp was proved to be antibacterial by JIS L 1902 method. • The minimum concentration of silver required for antibacterial activity with no cytotoxicity has been found out. • In-vivo vaginal irritation and intracutaneous reactivity studies confirmed the biocompatibility of the material.

  11. Improving the hygienic quality of chicken through radiation processing

    International Nuclear Information System (INIS)

    Torgby-Tetteh, W.


    Irradiation is considered one of the most efficient technological processes for the reduction of microorganisms in food, It can be used to improve the safety of food products, and to extend their shelf lives. The aim of this study was to improve the hygienic quality of chicken through radiation processing. As part of the study a microbial assessment of broiler chicken thighs from three retail outlets (supermarket, local markets and farms) was conducted. The total viable count and total coliform counts were determined. Hygienic quality indicator organisms such as Escherichia coli, Salmonella and Staphylococcus aureus were isolated and microbial counts made. Radiation sensitivity test to determine the D 10 (decimal reduction does) of E. coli on chicken at refrigeration and frozen temperature were conducted. D 10 values were 0.22 ± 0.02 and 0.32 ± 0.03 kGy at refrigerated and frozen temperatures respectively. A storage test consisting of an uninoculated pack experiment and a challenge test to explore the effect of irradiation and frozen food storage on the total viable count and survival of E. coli was conducted. Chicken thigh samples were treated with 0 (non irradiated), 2.0, 4.0, 6.0 and 8.0 kGy of gamma irradiation and held frozen for 56 days. The control and irradiated samples were stored at -18 o C and underwent microbial analysis and sensory evaluation at 7 days intervals. It was observed that irradiation and frozen storage reduced microbial loads. There were significant differences in sensory quality characteristics during freezing storage in chicken meat. The combination of irradiation and frozen storage resulted in greater overall reductions on microbial loads thus improving hygienic quality. (au)

  12. Hygiene factors associated with childhood food allergy and asthma. (United States)

    Gupta, Ruchi S; Singh, Anne Marie; Walkner, Madeline; Caruso, Deanna; Bryce, Paul J; Wang, Xiaobin; Pongracic, Jacqueline A; Smith, Bridget M


    Childhood food allergy and asthma rates are increasing. The hygiene hypothesis has been proposed as an explanation for the increased incidence of allergic disease. To describe the association of childhood food allergy and asthma with hygiene factors, such as the number of siblings, antibiotic use, infection history, pet exposure, child care exposure, and maternalchild factors. Children ages 021 years old (N = 1359) were recruited for a cross-sectional family-based study, including children with food allergy and children without food allergy, and their siblings. We assessed the associations between childhood food allergy and asthma with hygiene factors. Of the 1359 children, 832 (61.2%) had food allergy, and 406 (30%) had asthma. In the adjusted analysis, the prevalence of food allergy was increased if there was a history of skin infection (prevalence ratio [RRR] 1.12 [95% confidence interval {CI}, 1.011.24]) or eczema (RRR 1.89 [95% CI, 1.702.10]). The prevalence of asthma was increased with a history of respiratory syncytial virus infection (RRR 1.60 [95% CI, 1.341.90]) or eczema (RRR 1.54 [95% CI, 1.271.86]). A greater number of siblings were associated with a decreased prevalence of food allergy (RRR 0.79 [95% CI, 0.750.84]) and asthma (RRR 0.82 [95% CI, 0.740.91]). Our findings supported the accumulating evidence of an association between skin infections and eczema with food allergy. Because these results could be subject to recall bias, additional prospective studies are needed to substantiate these findings.


    Hernández-García, Ignacio; Cardoso-Muñoz, Antonio Manuel


    A key element to promote the compliance of hand hygiene (HH) among health care workers (HCWs) is to analyze their perceptions of it. Our objective was to evaluate the beliefs and perceptions that nursing students have on HH. A cross-sectional study was performed during the 2011-2012 school year. It included all enrolled nursing students from a Spanish University. The information was obtained by a self-administered questionnaire, which assessed the importance of HH to control nosocomial infections (NI), beliefs (by Hand Hygiene Beliefs Scale-HHBS) and perceptions of the importance given to HH in the curriculum (by Hand Hygiene Importance Scale-HHIS). Associations were analyzed using logistic regression. 146 students of the 270 (54.1%) completed the questionnaire. Assessing the importance of HH as NI control measure ranged from 4 to 10 points (median = 9). The more agreement HHIS item was to consider HH as an important part of the curriculum (76.1%), while HHBS item was to believe that hands washing after going to the toilet reduces the transmission of infectious diseases (100%). Importance of HH to control NI valued with > 9 points was associated with the agreement to consider it as an relevant part of the curriculum (OR:2.5), and to believe that HCWs play an important role in preventing NI (OR: 4.3). HH was rated as an important NI control measure. Educational programs should be carried out at universities to students do HH, whether they observe poor compliance among HCWs in their practices.

  14. Behaviour change for better health: nutrition, hygiene and sustainability. (United States)

    Newson, Rachel S; Lion, Rene; Crawford, Robert J; Curtis, Valerie; Elmadfa, Ibrahim; Feunekes, Gerda I J; Hicks, Cheryl; van Liere, Marti; Lowe, C Fergus; Meijer, Gert W; Pradeep, B V; Reddy, K Srinath; Sidibe, Myriam; Uauy, Ricardo


    As the global population grows there is a clear challenge to address the needs of consumers, without depleting natural resources and whilst helping to improve nutrition and hygiene to reduce the growth of noncommunicable diseases. For fast-moving consumer goods companies, like Unilever, this challenge provides a clear opportunity to reshape its business to a model that decouples growth from a negative impact on natural resources and health. However, this change in the business model also requires a change in consumer behaviour. In acknowledgement of this challenge Unilever organised a symposium entitled 'Behaviour Change for Better Health: Nutrition, Hygiene and Sustainability'. The intention was to discuss how consumers can be motivated to live a more healthy and sustainable lifestlye in today's environment. This article summarises the main conclusions of the presentations given at the symposium. Three main topics were discussed. In the first session, key experts discussed how demographic changes - particularly in developing and emerging countries - imply the need for consumer behaviour change. The second session focused on the use of behaviour change theory to design, implement and evaluate interventions, and the potential role of (new or reformulated) products as agents of change. In the final session, key issues were discussed regarding the use of collaborations to increase the impact and reach, and to decrease the costs, of interventions. The symposium highlighted a number of key scientific challenges for Unilever and other parties that have set nutrition, hygiene and sustainability as key priorities. The key challenges include: adapting behaviour change approaches to cultures in developing and emerging economies; designing evidence-based behaviour change interventions, in which products can play a key role as agents of change; and scaling up behaviour change activities in cost-effective ways, which requires a new mindset involving public-private partnerships.

  15. Use of a verbal electronic audio reminder with a patient hand hygiene bundle to increase independent patient hand hygiene practices of older adults in an acute care setting. (United States)

    Knighton, Shanina C; Dolansky, Mary; Donskey, Curtis; Warner, Camille; Rai, Herleen; Higgins, Patricia A


    We hypothesized that the addition of a novel verbal electronic audio reminder to an educational patient hand hygiene bundle would increase performance of self-managed patient hand hygiene. We conducted a 2-group comparative effectiveness study randomly assigning participants to patient hand hygiene bundle 1 (n = 41), which included a video, a handout, and a personalized verbal electronic audio reminder (EAR) that prompted hand cleansing at 3 meal times, or patient hand hygiene bundle 2 (n = 34), which included the identical video and handout, but not the EAR. The primary outcome was alcohol-based hand sanitizer use based on weighing bottles of hand sanitizer. Participants that received the EAR averaged significantly more use of hand sanitizer product over the 3 days of the study (mean ± SD, 29.97 ± 17.13 g) than participants with no EAR (mean ± SD, 10.88 ± 9.27 g; t 73  = 5.822; P ≤ .001). The addition of a novel verbal EAR to a patient hand hygiene bundle resulted in a significant increase in patient hand hygiene performance. Our results suggest that simple audio technology can be used to improve patient self-management of hand hygiene. Future research is needed to determine if the technology can be used to promote other healthy behaviors, reduce infections, and improve patient-centered care without increasing the workload of health care workers. Published by Elsevier Inc.

  16. The status of oral hygiene in cleft lip, palate patients after surgical correction

    Directory of Open Access Journals (Sweden)

    Pandey S


    Full Text Available The cleft lip and palate patients usually present a number of problems viz. altered oral anatomy leading to changes in oral physiology diminishing the self-cleansing ability of individual. The handicapped children are unable to maintain their oral hygiene properly. The present study was formulated with the aim that does normalization of oral anatomy have its effect on improvement of oral hygiene? An assessment of oral hygiene index-simplified was performed between preoperative and postoperative values in the same patient at KGMU and KGDU. A total of 50 cases were recorded in two groups of 25 each: (i < 6 years old and (ii > 6 years. The observations are statistically analyzed by paired ′t′ test to get the significance of results. Results: The data analyzed showed the significant decrease in oral hygiene indices observed in both groups. A relative significance in oral hygiene status following surgery was observed. Both groups expressed greater significance when compared pre and postoperatively which is indicative of considerable improvement of oral hygiene after surgical correction. The study concludes that oral hygiene improves more in older cleft lip-palate cases following reconstruction of palatal vault, premaxilla and anterior lip seal by secondary bone grafting method when compared with oral hygiene indices results in primary periosteoplasty cases. The surgical correction of cleft lip palate enhances self-cleaning ability and better compliance to maintain oral hygiene in children as the age advances.

  17. Evaluation of Oral Hygiene in Patients with Generalized Periodontitis of II Degree and Stage II Hypertension

    Directory of Open Access Journals (Sweden)

    Tetiana Vivcharenko


    Conclusions. The level of oral hygiene in patients of both groups was low due to incorrect selection of personal hygiene products or their untimely replacement. In patients with generalized periodontitis of II degree and stage II hypertension, the level of oral hygiene was lower than in somatically healthy persons: the worse status of oral cavity hygiene – the more pronounced changes in the periodontal tissues. We can suppose that high blood pressure affects the status of the oral cavity, creates a higher risk and exacerbates the periodontal diseases.

  18. Personal hygiene among primary school children living in a slum of Kolkata, India. (United States)

    Sarkar, M


    For children, maintenance of personal hygiene helps to improve the quality of life and longevity. This is of particular importance in a slum community with compromised living situation. This study was undertaken to find out the knowledge and practice of personal hygiene among the primary school children living in a slum area, to identify any misconception among them regarding the maintenance of personal hygiene, to find out their morbidity pattern, and also to elicit the relationship between practice of personal hygiene among the children and the literacy status of their mother. A cross-sectional observational study was conducted among 104 primary school children of a primary school situated in the slum area of Chetla, Kolkata, India with the help of a predesigned, pre-tested and structured questionnaire. Data were analyzed statistically by simple proportions and tests of significance. It was found that the female students were more knowledgeable than the male students regarding the maintenance of personal hygiene. There was a wide gap between practice and knowledge of personal hygiene among the primary school children living in the slum area. Even, misconceptions do exist on certain indicators of personal hygiene among the students. Statistically significant association was observed between practices of personal hygiene among the primary school children and the literacy status of their mother. Future of a society depends considerably on the health of its children. The parents and the school teachers, as constructive shapers of children's health behaviors, should play a responsible role in early education of children on personal hygiene.

  19. Influence of Institutional Guidelines on Oral Hygiene Practices in Intensive Care Units. (United States)

    Kiyoshi-Teo, Hiroko; Blegen, Mary


    Maintaining oral hygiene is a key component of preventing ventilator-associated pneumonia; however, practices are inconsistent. To explore how characteristics of institutional guidelines for oral hygiene influence nurses' oral hygiene practices and perceptions of that practice. Oral hygiene section of a larger survey study on prevention of ventilator-associated pneumonia. Critical care nurses at 8 hospitals in Northern California that had more than 1000 ventilator days in 2009 were recruited to participate in the survey. Twenty-one questions addressed oral hygiene practices and practice perceptions. Descriptive statistics, analysis of variance, and Spearman correlations were used for analyses. A total of 576 critical care nurses (45% response rate) responded to the survey. Three types of institutional oral hygiene guidelines existed: nursing policy, order set, and information bulletin. Nursing policy provided the most detail about the oral hygiene care; however, adherence, awareness, and priority level were higher with order sets (P hygiene do influence the oral hygiene practices of critical care nurses. Future studies examining how institutional guidelines could best be incorporated into routine workflow are needed. ©2015 American Association of Critical-Care Nurses.

  20. Industrial hygiene support of underground operations at the Nevada Test Site

    International Nuclear Information System (INIS)

    Porter, P.F.


    The Industrial Hygiene Section of the Health Protection Department provides industrial hygiene support of underground operations at the Nevada Test Site. This report describes support operations and summarizes the industrial hygiene data collected from July 31, 1989 through June 30, 1991. Air quality data were collected by means of personnel sampling by active and passive techniques using various kinds of industrial hygiene instrumentation and through localized and general area monitoring. The data collected were used to evaluate underground air quality and quantity requirements; evaluate worker exposures to a variety of air contaminants; determine the applicability and effectiveness of personal protective equipment

  1. Evaluation of a hand hygiene campaign in outpatient health care clinics. (United States)

    Kukanich, Kate Stenske; Kaur, Ramandeep; Freeman, Lisa C; Powell, Douglas A


    To improve hand hygiene in two outpatient health care clinics through the introduction of a gel sanitizer and an informational poster. In this interventional study, health care workers at two outpatient clinics were observed for frequency of hand hygiene (attempts versus opportunities). Gel sanitizer and informational posters were introduced together as an intervention. Direct observation of the frequency of hand hygiene was performed during baseline, intervention, and follow-up. A poststudy survey of health care workers was also distributed and collected. In both clinics, the frequency of hand hygiene was poor at baseline (11% and 21%) but improved significantly after intervention (36% and 54%) and was maintained through the follow-up period (32% and 51%). Throughout the study, postcontact hand hygiene was observed significantly more often than precontact hand hygiene. In both clinics, health care workers reported a preference for soap and water; yet observations showed that when the intervention made gel sanitizer available, sanitizer use predominated. Fifty percent of the surveyed health care workers considered the introduction of gel sanitizer to be an effective motivating tool for improving hand hygiene. Hand hygiene performance by health care workers in outpatient clinics may be improved through promoting the use of gel sanitizer and using informational posters. Compared with surveys, direct observation by trained observers may provide more accurate information about worker preferences for hand hygiene tools.

  2. The role of sleep hygiene in promoting public health: A review of empirical evidence. (United States)

    Irish, Leah A; Kline, Christopher E; Gunn, Heather E; Buysse, Daniel J; Hall, Martica H


    The ineffectiveness of sleep hygiene as a treatment in clinical sleep medicine has raised some interesting questions. If it is known that, individually, each specific component of sleep hygiene is related to sleep, why wouldn't addressing multiple individual components (i.e., sleep hygiene education) improve sleep? Is there still a use for sleep hygiene? Global public health concern over sleep has increased demand for sleep promotion strategies accessible to the population. However, the extent to which sleep hygiene strategies apply outside clinical settings is not well known. The present review sought to evaluate the empirical evidence for sleep hygiene recommendations regarding exercise, stress management, noise, sleep timing, and avoidance of caffeine, nicotine, alcohol, and daytime napping, with a particular emphasis on their public health utility. Thus, our review is not intended to be exhaustive regarding the clinical application of these techniques, but rather to focus on broader applications. Overall, though epidemiologic and experimental research generally supported an association between individual sleep hygiene recommendations and nocturnal sleep, the direct effects of individual recommendations on sleep remains largely untested in the general population. Suggestions for clarification of sleep hygiene recommendations and considerations for the use of sleep hygiene in nonclinical populations are discussed. Copyright © 2014 Elsevier Ltd. All rights reserved.

  3. Analysis of portable gamma flaw detectors concerning radiation hygiene

    International Nuclear Information System (INIS)

    Makarova, T.V.


    Design and shields of gamma flaw detectors as one of the main factors responsible for personnel dose were studied. The analysis was conducted using the results of radiation hygienic surveys of gamma flaw detection laboratories functioning constantly in Estonia. It is shown that recently the replacement of GUP apparatuses by flaw detectors of RID and ''Gamma-RID'' (types which have design and shielding advantages is observed. However personnel doses have not reduced considerably for the last 10 years. This fact is attributed to design disadvantages of the RID and ''Gamma-RID'' apparatuses the removing of which will give the decreasing of annual personnel dose by 80 %

  4. [Notes for a History of Hygiene taken from the Bible]. (United States)

    Ledermann, Walter


    Reading once more the Gospels, we found a discussion between Jesus and the Pharisee about the hand washing, this golden rule of medicine, and then, with the help of Thomas Mann, we began a search for other notes on hygiene in the Bible. For the return from Egypt to the Promised Land, Moses established several rules for his people, some of them disguised as religious principles, concerning elimination of excreta, healthy and poisonous foods, isolation in case of contagious diseases (leprosy, gonorrhea), decontamination of clothes and houses, and many others that now seem to us ahead his time.

  5. Sanitary-hygienic and ecological aspects of beryllium production

    Energy Technology Data Exchange (ETDEWEB)

    Dvinskykh, E.M.; Savchuk, V.V.; Sidorov, V.L.; Slobodin, D.B.; Tuzov, Y.V. [Ulba Metallurgical Plant, Ust-Kamenogorsk (Kazakhstan)


    The Report describes An organization of sanitary-hygienic and ecological control of beryllium production at Ulba metallurgical plant. It involves: (1) the consideration of main methods for protection of beryllium production personnel from unhealthy effect of beryllium, (2) main kinds of filters, used in gas purification systems at different process areas, (3) data on beryllium monitoring in water, soil, on equipment. This Report also outlines problems connected with designing devices for a rapid analysis of beryllium in air as well as problems of beryllium production on ecological situation in the town. (author)

  6. Hand hygiene in preventing nosocomial infections:a nursing research. (United States)

    Di Muzio, M; Cammilletti, V; Petrelli, E; Di Simone, E


    To verify whether there is some correlation between the nursing workload and the occurrence of healthcare-associated infections. An anonymous questionnaire made up of 20 items has been drafted for this specific purpose and delivered to a sample of 70 participants, including 33 nurses and 37 nursing students of a well-known University Hospital in Rome. The study is supported by extensive documental research, and a specific literature review. Hand hygiene is a mandatory daily practice, simple but critical, but not always clear enough for both nurses and students. The investigation demonstrated inconsistencies between nurses' and students' behaviour and what is recommended by the new WHO international guidelines. The documented correlation between the workload and the occurrence of healthcare-associated infections may be explained by the negative effect of nursing workload on correct hand-washing procedures. Out of the total sample, 58.6% answered affirmatively to both the presence of healthcare-associated infections within their unit and an excessive daily workload. Indeed, the remaining 41.4% of the sample do not report an excessive workload and states that "there are no healthcare-associated infections within their operational reality, at least not in the time period covered by the present investigation". Although limited to a small sample, this study may reveal that the correct practice of hand washing, prompted and considered fundamental by WHO, is still much underrated. Hand hygiene should be better understood and practiced in all healthcare facilities, through a series of interventions such as: specific training courses, the presence of a gel sanitizer next to each patient's bed or in each patient's room, as well as the adoption of the new international guidelines in all units. The analysis of other correlations found the presence of a protective factor (RRinfections. In fact, we found no statistically significant values to support such considerations (p>0

  7. Analysis of hygienic critical control points in boar semen production. (United States)

    Schulze, M; Ammon, C; Rüdiger, K; Jung, M; Grobbel, M


    The present study addresses the microbiological results of a quality control audit in artificial insemination (AI) boar studs in Germany and Austria. The raw and processed semen of 344 boars in 24 AI boar studs were analyzed. Bacteria were found in 26% (88 of 344) of the extended ejaculates and 66.7% (18 of 24) of the boar studs. The bacterial species found in the AI dose were not cultured from the respective raw semen in 95.5% (84 of 88) of the positive samples. These data, together with the fact that in most cases all the samples from one stud were contaminated with identical bacteria (species and resistance profile), indicate contamination during processing. Microbiological investigations of the equipment and the laboratory environment during semen processing in 21 AI boar studs revealed nine hygienic critical control points (HCCP), which were addressed after the first audit. On the basis of the analysis of the contamination rates of the ejaculate samples, improvements in the hygiene status were already present in the second audit (P = 0.0343, F-test). Significant differences were observed for heating cabinets (improvement, P = 0.0388) and manual operating elements (improvement, P = 0.0002). The odds ratio of finding contaminated ejaculates in the first and second audit was 1.68 (with the 95% confidence interval ranging from 1.04 to 2.69). Furthermore, an overall good hygienic status was shown for extenders, the inner face of dilution tank lids, dyes, and ultrapure water treatment plants. Among the nine HCCP considered, the most heavily contaminated samples, as assessed by the median scores throughout all the studs, were found in the sinks and/or drains. High numbers (>10(3) colony-forming units/cm(2)) of bacteria were found in the heating cabinets, ejaculate transfer, manual operating elements, and laboratory surfaces. In conclusion, the present study emphasizes the need for both training of the laboratory staff in monitoring HCCP in routine semen

  8. Sociodemographic factors associated with oral hygiene habits in Brazilian adolescents


    Freire, MDCM; Sheiham, A.; Bino, Y. A.


    Objective: To investigate the oral hygiene habits of Brazilian adolescents and their relation with gender and socioeconomic status. Methods: Secondary data analyzed were from a cross-sectional study using self-completion questionnaires among 664 15-year-old schoolchildren randomly selected from public and private schools and their mothers, in Goiânia-GO, Brazil. Results: 51.8% of the sample comprised girls and 48.2% boys; 48.9% were from a high social class and 51.1% from a low social class. ...

  9. Herd Protection from Drinking Water, Sanitation, and Hygiene Interventions. (United States)

    Fuller, James A; Eisenberg, Joseph N S


    Herd immunity arises when a communicable disease is less able to propagate because a substantial portion of the population is immune. Nonimmunizing interventions, such as insecticide-treated bednets and deworming drugs, have shown similar herd-protective effects. Less is known about the herd protection from drinking water, sanitation, and hand hygiene (WASH) interventions. We first constructed a transmission model to illustrate mechanisms through which different WASH interventions may provide herd protection. We then conducted an extensive review of the literature to assess the validity of the model results and identify current gaps in research. The model suggests that herd protection accounts for a substantial portion of the total protection provided by WASH interventions. However, both the literature and the model suggest that sanitation interventions in particular are the most likely to provide herd protection, since they reduce environmental contamination. Many studies fail to account for these indirect effects and thus underestimate the total impact an intervention may have. Although cluster-randomized trials of WASH interventions have reported the total or overall efficacy of WASH interventions, they have not quantified the role of herd protection. Just as it does in immunization policy, understanding the role of herd protection from WASH interventions can help inform coverage targets and strategies that indirectly protect those that are unable to be reached by WASH campaigns. Toward this end, studies are needed to confirm the differential role that herd protection plays across the WASH interventions suggested by our transmission model. © The American Society of Tropical Medicine and Hygiene.

  10. An integrated occupational hygiene consultation model for the catering industry. (United States)

    Lin, Yi-Kuei; Lee, Lien-Hsiung


    Vegetable oil used in food processing, during high-temperature exposure, will generate particulate matter (PM) and polycyclic aromatic hydrocarbons (PAHs), which are carcinogenic chemical compounds, with the potential to cause lung disease for restaurant kitchen staff. This study's design includes a three-stage consultation process with eight major consultation items, in order to build an integrated consultation model for occupational hygiene. This model combines inspection and consultation, targeting Chinese restaurants in the catering industry. Characteristics of the integrated consultation model include cooperation between different government departments and collaboration with nongovernmental, professional consulting organizations. An additional benefit of the model is the building of a good partnership relationship with the Catering Trade Association. The consultation model helps Chinese restaurants attain improvements in their work environments with minimal investment. Postconsultation, results show a 63.35% and 61.98% (P < 0.001) decrease in the mean time-weighted concentration of exposure to PM and PAHs, respectively. The overall regulation compliance rate of Chinese restaurants significantly increased from 34.3% to 89.6%. These results show that the integrated consultation model for occupational hygiene not only helps small and medium enterprises reduce exposure concentrations in the workplace but also has specific potential for successful implementation in Taiwan.

  11. Industrial Hygiene Group annual research report, FY 1981

    International Nuclear Information System (INIS)

    Jackson, J.O.; Ettinger, H.J.


    Field studies have been performed at several oil shale facilities to identify unique industrial hygiene problems and provide input to inhalation toxicology studies aimed at evaluating the hazards of materials associated with this developing technology. Aerosol physics support has also been provided to develop aerosol generation and animal exposure techniques for evaluating the toxicity of oil shale materials and manmade mineral fibers. As part of the effort to assure a safe, orderly, and timely development of various synfuels, field evaluation of indicator-sampling procedures was perfomed, and industrial hygiene work practices for two synfuel technologies are being prepared. Respirator studies are used to evaluate the performances of special devices (some of which are not in the existing government approval schedules) and of a proposed test procedures for self-contained breathing apparatus. An approval procedure is being developed for air-purifying respirators required for protection against radioiodine, evaluating the adequacy of respirator programs at the Nuclear Regulatory Commission licensee facilities, and developing a program for respirator use under emergency situations. A new aerosol size-characterization stack sampler has been designed, and potential instrument changes to aerosol size monitoring for filter testing are being evaluated. Material permeability tests have identified the protection afforded by protective clothing materials, and improved analytical procedures have been developed for pentachlorophenol and plutonium

  12. Status of the International Space Station Waste and Hygiene Compartment (United States)

    Walker, Stephanie; Zahner, Christopher


    The Waste and Hygiene Compartment (WHC) serves as the primary system for removal and containment of metabolic waste and hygiene activities on board the United States segment of the International Space Station (ISS). The WHC was launched on ULF 2 and is currently in the U.S. Laboratory and is integrated into the Water Recovery System (WRS) where pretreated urine is processed by the Urine Processor Assembly (UPA). The waste collection part of the WHC system is derived from the Service Module system and was provided by RSC-Energia along with additional hardware to allow for urine delivery to the UPA. The System has been integrated in an ISS standard equipment rack structure for use on the U.S. segment of the ISS. The system has experienced several events of interest during the deployment, checkout, and operation of the system during its first year of use and these will be covered in this paper. Design and on-orbit performance will also be discussed.

  13. International Space Station USOS Waste and Hygiene Compartment Development (United States)

    Link, Dwight E., Jr.; Broyan, James Lee, Jr.; Gelmis, Karen; Philistine, Cynthia; Balistreri, Steven


    The International Space Station (ISS) currently provides human waste collection and hygiene facilities in the Russian Segment Service Module (SM) which supports a three person crew. Additional hardware is planned for the United States Operational Segment (USOS) to support expansion of the crew to six person capability. The additional hardware will be integrated in an ISS standard equipment rack structure that was planned to be installed in the Node 3 element; however, the ISS Program Office recently directed implementation of the rack, or Waste and Hygiene Compartment (WHC), into the U.S. Laboratory element to provide early operational capability. In this configuration, preserved urine from the WHC waste collection system can be processed by the Urine Processor Assembly (UPA) in either the U.S. Lab or Node 3 to recover water for crew consumption or oxygen production. The human waste collection hardware is derived from the Service Module system and is provided by RSC-Energia. This paper describes the concepts, design, and integration of the WHC waste collection hardware into the USOS including integration with U.S. Lab and Node 3 systems.

  14. Rhamnolipids and lactonic sophorolipids: natural antimicrobial surfactants for oral hygiene. (United States)

    Elshikh, M; Moya-Ramírez, I; Moens, H; Roelants, S; Soetaert, W; Marchant, R; Banat, I M


    To assess the efficacy of rhamnolipid (mixture of monorhamnolipid and dirhamnolipid congeners), purified monorhamnolipid, dirhamnolipid and lactonic sophorolipid biosurfactants against pathogens important for oral hygiene. Acquired and produced biosurfactants were fully characterized to allow the antimicrobial activity to be assigned to the biosurfactant congeners. Antimicrobial activity was assessed using the resazurin-aided microdilution method. Mixed rhamnolipid JBR425 (MR) and lactonic sophorolipids (LSLs) demonstrated the lowest minimum inhibitory concentration (MIC) which ranged between 100 and 400 μg ml -1 against Streptococcus mutans, Streptococcus oralis, Actinomyces naeslundii, Neisseria mucosa and Streptococcus sanguinis. Combining these biosurfactants with standard antimicrobial agents namely chlorhexidine, sodium lauryl sulphate, tetracycline HCl and ciprofloxacin showed a dramatic drop in the MIC values. In addition, in vitro studies demonstrated the biosurfactants' ability to prevent and disrupt oral pathogens biofilms. The increased permeability of microorganisms treated with biosurfactant, as shown using bisbenzimide dye, in part explains the inhibition effect. The results demonstrate that rhamnolipids and LSLs have the ability to inhibit oral pathogens both in planktonic and oral biofilm states. The findings indicate the potential value of biosurfactants for both oral hygiene and the pharmaceutical industries since there is a serious need to reduce the reliance on synthetic antimicrobials and antibiotics. © 2017 The Society for Applied Microbiology.

  15. Dental hygiene education in Germany: Between economics and emotions. (United States)

    Offermanns, B; Petersilka, G J


    To date, there is still no IFDH approved dental hygienist (DH) education model in Germany. Nevertheless, opportunities to complete vocational DH education courses have substantially increased within the last two decades. However, the content and quality of these courses vary greatly and are difficult to survey. The purpose of this article therefore was to present an overview of the education programmes offered in Germany as of March 2017. A formal request was sent to all education establishments for details of such courses, and a systematic internet search was performed covering the DH education topic in Germany. Ten vocational education programmes were found, most of them organized by local dental chambers. One private provider offers a Bachelor Degree in Dental Hygiene on completion of a course which runs over 2 or 3 ys. Details of contents, objectives and concise ratings or comparisons of the various courses are scarce, although in principle all should meet the same quality standards. For dental hygiene students, patients and dentists, it is hard and unsatisfactory to get a clear overview of the types and the quality of DH education which can be achieved in Germany. A solution for this dilemma would appear to be essential. However, due to the peculiarities of German legislation as well as the complex sphere of vested interests, it is impossible to predict if or when the situation will change for the better. © 2017 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  16. Hand hygiene: Back to the basics of infection control (United States)

    Mathur, Purva


    Health care associated infections are drawing increasing attention from patients, insurers, governments and regulatory bodies. This is not only because of the magnitude of the problem in terms of the associated morbidity, mortality and cost of treatment, but also due to the growing recognition that most of these are preventable. The medical community is witnessing in tandem unprecedented advancements in the understanding of pathophysiology of infectious diseases and the global spread of multi-drug resistant infections in health care set-ups. These factors, compounded by the paucity of availability of new antimicrobials have necessitated a re-look into the role of basic practices of infection prevention in modern day health care. There is now undisputed evidence that strict adherence to hand hygiene reduces the risk of cross-transmission of infections. With “Clean Care is Safer Care” as a prime agenda of the global initiative of WHO on patient safety programmes, it is time for developing countries to formulate the much-needed policies for implementation of basic infection prevention practices in health care set-ups. This review focuses on one of the simplest, low cost but least accepted from infection prevention: hand hygiene. PMID:22199099

  17. Preparing the Future Dental Hygiene Workforce: Knowledge, Skills, and Reform. (United States)

    Fried, Jacquelyn L; Maxey, Hannah L; Battani, Kathryn; Gurenlian, JoAnn R; Byrd, Tammi O; Brunick, Ann


    With the health care delivery system in transition, the way in which oral health care services are delivered in 2040 will inevitably change. To achieve the aims of reduced cost, improved access, and higher quality and to advance population wellness, oral health care will likely become a more integrated part of medical care. An integrated primary care system would better meet the needs of an increasingly diverse and aging U.S. population with uneven access to health care services. By 2040, trends suggest that a smaller proportion of dental hygienists will work in traditional solo dental offices; many more will practice with multidisciplinary health care teams in large-group dental and medical practices and in a variety of non-traditional community settings. This integration will require changes in how dental hygienists are educated. To shape the skill sets, clinical judgment, and knowledge of future practitioners, current dental hygiene curricula must be reexamined, redirected, and enhanced. This article examines some of the factors that are likely to shape the future of dental hygiene practice, considers the strengths and weaknesses of current curricula, and proposes educational changes to prepare dental hygienists for practice in 2040. This article was written as part of the project "Advancing Dental Education in the 21 st Century."

  18. Evaluation of the level of domestic hygiene in household kitchens. (United States)

    Sanna, A; Carraro, V; Sanna, C; Cabiddu, C; Brandas, V; Coroneo, V


    Each year in industrialized countries, 30-40% or more cases of food poisoning occur in the household. The aims of this study are to describe the aspects related to food safety in households by carrying out a microbiological characterization of the kitchens in residential dwellings and to increase consumers' awareness concerning the importance of good hygienic practices, which are required for preventing foodborne diseases at household level. The collection of data involved taking 760 analytical samples of kitchen-counter tops and food from 80 kitchens of private dwellings; the manner in which food was treated was evaluated from the moment of purchase to its transformation and storage by means of a checklist; the questionnaire enabled us to determine the extent of consumers' knowledge concerning the food sector. Overall, the results showed a good level of hygiene concerning both food and kitchen-counter top food surfaces. The respondents of the questionnaire did not appear to be aware of various health risks especially concerning the management of the temperature and compartments of refrigerators as well as food storage times and the cooking or heating of food. The data indicate that final consumers should take more care when cleaning kitchen-counter tops and washing salad; special training programmes should be included in school curricular in order to increase citizens' awareness and knowledge concerning food risks within the household.

  19. The Effects of Social Influence on Nurses' Hand Hygiene Behaviors. (United States)

    Piras, Susan E; Minnick, Ann; Lauderdale, Jana; Dietrich, Mary S; Vogus, Timothy J


    The aim of this article is to describe the associations of nurses' hand hygiene (HH) attitudes, subjective norms, and perceived behavioral control with observed and self-reported HH behavior. Hand hygiene is an essential strategy to prevent healthcare-associated infections. Despite tremendous efforts, nurses' HH adherence rates remain suboptimal. This quantitative descriptive study of ICU nurses in the southeastern United States was guided by the theory of planned behavior. The self-administered Patient Safety Opinion Survey and iScrub application, which facilitates observation, comprised the data set. Nurses' observed HH median was 55%; tendency to self-report was a much higher 90%. Subjective norm and perceived control scores were associated with observed and self-reported HH (P < .05) but not attitude scores or reports of intention. Nurses' subjective norm and perceived control are associated with observed and self-reported HH performance. Healthcare workers overestimate their HH performance. Findings suggest future research to explore manipulators of these variables to change nurses' HH behavior.

  20. Research on Hygiene Based on Fieldwork and Experimental Studies. (United States)

    Yajima, Ichiro


    Several experimental studies on hygiene have recently been performed and fieldwork studies are also important and essential tools. However, the implementation of experimental studies is insufficient compared with that of fieldwork studies on hygiene. Here, we show our well-balanced implementation of both fieldwork and experimental studies of toxic-element-mediated diseases including skin cancer and hearing loss. Since the pollution of drinking well water by toxic elements induces various diseases including skin cancer, we performed both fieldwork and experimental studies to determine the levels of toxic elements and the mechanisms behind the development of toxic-element-related diseases and to develop a novel remediation system. Our fieldwork studies in several countries including Bangladesh, Vietnam and Malaysia demonstrated that drinking well water was polluted with high concentrations of several toxic elements including arsenic, barium, iron and manganese. Our experimental studies using the data from our fieldwork studies demonstrated that these toxic elements caused skin cancer and hearing loss. Further experimental studies resulted in the development of a novel remediation system that adsorbs toxic elements from polluted drinking water. A well-balanced implementation of both fieldwork and experimental studies is important for the prediction, prevention and therapy of toxic-element-mediated diseases.