WorldWideScience

Sample records for variable ux ursae

  1. KQ Mon and the nature of the UX Ursa Majoris Nova-like variables

    Science.gov (United States)

    Sion, E. M.; Guinan, E. F.

    1983-01-01

    The UX Ursa Majoris stars form a group of nova-like variables with common photometric and spectroscopic properties. These objects appear to be related to the cataclysmic variables. However, there is no information that they have undergone major outbursts. The present investigation is concerned with a new object, KQ Mon, which has been included in a program of study conducted with the IUE satellite. A description of observations of KQ Mon is presented, and the relationship of this star to other UX UMa stars is examined. Attention is given to the nature of the UX Ursa Majoris stars. It is argued that the accretion rates of the UX UMa stars are higher than, for example, the dwarf novae during quiescence and that the higher accretion rates of the UX UMa stars are responsible for their lack of major outbursts.

  2. The nova-like variable KQ Mon and the nature of the UX Ursa Majoris stars

    Science.gov (United States)

    Sion, E. M.; Guinan, E. F.

    1982-01-01

    The KQ Mon is a UX UMa type nova-like variable discovered by Howard Bond. Optical spectra taken by Bond in 1978 reveal very shallow Balmer absorption lines and He I absorption. Bond also did UBV and high speed photometry in 1978 and early 1981. There has been no evidence of orbital variations but the appearance of the optical spectrum and the presence of low amplitude flickering suggested a strong similarity to CD-42-14462 (=V3885 Sgr) and other members of the UX UMa class. Low dispersion observations of KQ Mon were made with the International Ultraviolet Explorer satellite. Six spectra taken with the shot wavelength prime camera are dominated by strong broad absorption lines due to N V, O I, Si III, Si IV, C IV, He II, N IV, and Al III. There is little evidence of orbital phase modulation over the time baseline of the observations. Unlike UV observations of other UX UMa type objects, KQ Mon exhibits no emission lines or P Cygni type profiles and the velocity displacements appear to be smaller, suggesting the absence of a hot, high velocity wind characterizing other UX UMa stars. The relationship of KQ Mon to other UX UMa disk stars is discussed and a model is suggested to explain their observed properties and the lack of major outbursts.

  3. Hubble Space Telescope Eclipse Observations of the Nova Like Cataclysmic Variable UX Ursae Majoris

    Science.gov (United States)

    Knigge, Christian; Long, Knox S.; Wade, Richard A.; Baptista, Raymundo; Horne, Keith; Hubeny, Ivan; Rutten, Rene G. M.

    1998-01-01

    We present and analyze Hubble Space Telescope observations of the eclipsing nova-like cataclysmic variable UX UMa obtained with the Faint Object Spectrograph. Two eclipses each were observed with the G160L grating (covering the ultraviolet waveband) in 1994 August and with the PRISM (covering the near-ultraviolet to near-infrared) in November of the same year. The system was about 50% brighter in November than in August, which, if due to a change in the accretion rate, indicates a fairly substantial increase in Mass accretion by about 50%. The eclipse light curves are qualitatively consistent with the gradual occultation of an accretion disk with a radially decreasing temperature distribution. The light curves also exhibit asymmetries about mideclipse that are likely due to a bright spot at the disk edge. Bright-spot spectra have been constructed by differencing the mean spectra observed at pre- and posteclipse orbital phases. These difference spectra contain ultraviolet absorption lines and show the Balmer jump in emission. This suggests that part of the bright spot may be optically thin in the continuum and vertically extended enough to veil the inner disk and/or the outflow from UX UMa in some spectral lines. Model disk spectra constructed as ensembles of stellar atmospheres provide poor descriptions of the observed posteclipse spectra, despite the fact that UX UMa's light should be dominated by the disk at this time. Suitably scaled single temperature model stellar atmospheres with T(sub eff) approximately equals 12,500-14,500 K actually provide a better match to both the ultraviolet and optical posteclipse spectra. Evidently, great care must be taken in attempts to derive accretion rates from comparisons of disk models to observations. One way to reconcile disk models with the observed posteclipse spectra is to postulate the presence of a significant amount of optically thin material in the system. Such an optically thin component might be associated with the

  4. Spectral eclipse mapping of the accretion disk in the nova-like variable UX Ursae Majoris

    Science.gov (United States)

    Rutten, R. G. M.; Dhillon, V. S.; Horne, K.; Kuulkers, E.

    1994-01-01

    We analyze narrow-band eclipse light curves of the nova-like cataclysmic variable UX UMa, obtained from low-resolution spectra spanning lambda lambda 3600-9800 A . The light curves for narrow bands in the continuum as well as those for individual spectral lines are treated independently, and are used to construct images of the accretion disk's brightness distribution using the maximum-entropy eclipse-mapping technique. Particular attention is paid to the propagation of statistical uncertainties in the data and to how the analysis may introduce systematic errors in the final result. From the many narrrow band images we have reconstructed the spectra from isolated parts of the accretion disk. These spectra reveal that the inner disk radiates a continuum spectrum which peaks in the near UV and has the hydrogen Balmer lines in absorption (with the exception of H-alpha), whereas the outer disk is much fainter, has a much redder spectrum, and has Balmer emission lines. Our analysis reveals the presence of an uneclipsed component of the total light, whose spectrum is very red and has Balmer lines in emission. This unexpected feature of the eclipse mapping technique offers a new tool for an independent assessment of the secondary star's spectrum in eclipsing cataclysmic variables.

  5. On the nature of the UX Ursa Majoris-type nova-like variables - CPD-48 deg 1577

    Science.gov (United States)

    Sion, E. M.

    1985-01-01

    A series of low-dispersion spectra and one high-dispersion spectrum have been obtained of the catacylsmic variable CPD-48 deg 1577. Like other UX UMa stars, this variable exhibits the flat continuum of a luminous, thick, steady state accretion disk dominating its light from the far UV to the infrared. A wind mass loss rate of less than about 10 to the -9th solar mass/yr and an accretion rate of roughly 5 x 10 to the -9th solar mass/yr is roughly consistent with the range which characterizes other UX UMa stars. An SWP echelle spectrum reveals detailed line profile information on the N V, Si IV, and C IV resonance lines. He II 1640 A is remarkably weak and even absent in two of the spectra. The known properties and evolutionary status of CPD-48 deg 1577 and the other UX UMa stars are summarized.

  6. HST Spatially Resolved Spectra of the Accretion Disc and Gas Stream of the Nova-Like Variable UX Ursae Majoris

    Science.gov (United States)

    Baptista, Raymundo; Horne, Keith; Wade, Richard A.; Hubeny, Ivan; Long, Knox S.; Rutten, Rene G. M.

    1998-01-01

    Time-resolved eclipse spectroscopy of the nova-like variable UX UMa obtained with the Hubble Space Telescope/Faint Object Spectrograph (HST/FOS) on 1994 August and November is analysed with eclipse mapping techniques to produce spatially resolved spectra of its accretion disk and gas stream as a function of distance from the disk centre. The inner accretion disk is characterized by a blue continuum filled with absorption bands and lines, which cross over to emission with increasing disk radius, similar to that reported at optical wavelengths. The comparison of spatially resolved spectra at different azimuths reveals a significant asymmetry in the disk emission at ultraviolet (UV) wavelengths, with the disk side closest to the secondary star showing pronounced absorption by an 'iron curtain' and a Balmer jump in absorption. These results suggest the existence of an absorbing ring of cold gas whose density and/or vertical scale increase with disk radius. The spectrum of the infalling gas stream is noticeably different from the disc spectrum at the same radius suggesting that gas overflows through the impact point at the disk rim and continues along the stream trajectory, producing distinct emission down to 0.1 R(sub LI). The spectrum of the uneclipsed light shows prominent emission lines of Lyalpha, N v lambda1241, SiIV Lambda 1400, C IV Lambda 1550, HeII Lambda 1640, and MgII Lambda 2800, and a UV continuum rising towards longer wavelengths. The Balmer jump appears clearly in emission indicating that the uneclipsed light has an important contribution from optically thin gas. The lines and optically thin continuum emission are most probably emitted in a vertically extended disk chromosphere + wind. The radial temperature profiles of the continuum maps are well described by a steady-state disc model in the inner and intermediate disk regions (R greater than or equal to 0.3R(sub LI) ). There is evidence of an increase in the mass accretion rate from August to November

  7. Recovery of 29 Second Oscillations in Hubble Space Telescope Eclipse Observations of the Cataclysmic Variable UX Ursae Majoris

    Science.gov (United States)

    Knigge, Christian; Drake, Nick; Long, Knox S.; Wade, Richard A.; Horne, Keith; Baptista, Raymundo

    1998-01-01

    Low-amplitude (approximately 0.5%) 29 s oscillations have been detected in Hubble Space Telescope Faint Object Spectrograph eclipse observations of the nova-like cataclysmic variable UX UMa. These are the same dwarf nova-type oscillations that were originally discovered in this system in 1972. The 29 s oscillations are seen in one pair of eclipse sequences obtained with the FOS/PRISM in 1994 November but not in a similar pair obtained with the FOS/GI60L grating in August of the same year. The oscillations in the PRISM data are sinusoidal to within the small observational errors and undergo an approximately - 360' phase shift during eclipses (i.e., one cycle is lost). The amplitudes are highest at pre-eclipse orbital phases and exhibit a rather gradual eclipse whose shape is roughly similar to, although perhaps slightly narrower than, LTX UMa's overall light curve in the PRISM bandpass (2000-8000 A). Spectra of the oscillations have been constructed from pre-, mid, and post-eclipse data segments of the November observations. The spectra obtained from the out-of-eclipse segments are extremely blue, and only lower limits can be placed on the temperature of the source that dominates the modulated flux at these orbital phases. Lower limits derived from blackbody (stellar atmosphere) model fits to these data are >or equal to 95,000 K (> or equal to 85,000 K); the corresponding upper limits on the projected area of this source are all less than 2% of the white dwarf (WD) surface area. By contrast, oscillation spectra derived from mid- eclipse data segments are much redder. Fits to these spectra yield temperature estimates in the range 20,000 K approximately greater T and T approximately less than 30,000 K for both blackbody and stellar atmosphere models and corresponding projected areas of a few percent of the WD surface area. These estimates are subject to revision if the modulated emission is optically thin. We suggest that the ultimate source of the oscillations is a

  8. Accretion-disc precession in UX Ursae Majoris

    Science.gov (United States)

    de Miguel, E.; Patterson, J.; Cejudo, D.; Ulowetz, J.; Jones, J. L.; Boardman, J.; Barret, D.; Koff, R.; Stein, W.; Campbell, T.; Vanmunster, T.; Menzies, K.; Slauson, D.; Goff, W.; Roberts, G.; Morelle, E.; Dvorak, S.; Hambsch, F.-J.; Starkey, D.; Collins, D.; Costello, M.; Cook, M. J.; Oksanen, A.; Lemay, D.; Cook, L. M.; Ogmen, Y.; Richmond, M.; Kemp, J.

    2016-04-01

    We report the results of a long campaign of time series photometry on the nova-like variable UX Ursae Majoris during 2015. It spanned 150 nights, with ˜ 1800 h of coverage on 121 separate nights. The star was in its normal `high state' near magnitude V = 13, with slow waves in the light curve and eclipses every 4.72 h. Remarkably, the star also showed a nearly sinusoidal signal with a full amplitude of 0.44 mag and a period of 3.680 ± 0.007 d. We interpret this as the signature of a retrograde precession (wobble) of the accretion disc. The same period is manifest as a ±33 s wobble in the timings of mid-eclipse, indicating that the disc's centre of light moves with this period. The star also showed strong `negative superhumps' at frequencies ωorb + N and 2ωorb + N, where ωorb and N are, respectively, the orbital and precession frequencies. It is possible that these powerful signals have been present, unsuspected, throughout the more than 60 yr of previous photometric studies.

  9. Spectrally resolved eclipse maps of the accretion disk in UX Ursae Majoris

    Science.gov (United States)

    Rutten, Rene G. M.; Dhillon, V. S.; Horne, Keith; Kuulkers, E.; Van Paradijs, J.

    1993-01-01

    An effort is made to observationally constrain accretion disks on the basis of light curves from the eclipsing cataclysmic variable UX Ursae Majoris, reconstructing the spectral energy distribution across the face of an accretion disk. The spectral resolution obtained suffices to reveal not only the radial dependence of absorption and emission line features within the disk, but also the spectral details of the bright spot that is formed where the accretion stream from the secondary star collides with the disk. The importance of such constraints for theoretical models is noted.

  10. UX Ori Variables in the Cluster IC 348

    Science.gov (United States)

    Barsunova, O. Yu.; Grinin, V. P.; Sergeev, S. G.; Semenov, A. O.; Shugarov, S. Yu.

    2015-06-01

    Results are presented from many years of photometric (VRCIC) observations of three variable T Tauri type stars in the cluster IC 348: V712 Per, V719 Per, and V909 Per. All three stars have photometric activity characteristic of UX Ori stars. The activity of V719 Per has increased significantly over the last 10 years: the amplitude of its Algol-like minima has increased by roughly a factor of 4 and has reached three stellar magnitudes in the I band. Periodograms of the light curves do not confirm the periods found previously by other authors on the basis of shorter series of observations. The slope of the color tracks on "color-magnitude" diagrams is used to determine the reddening law for these stars owing to selective absorption by circumstellar dust. Modelling of these parameters by the Mie theory shows that the maximum size amax of the dust particles in the protoplanetary disks of these stars is 1.5-2 times greater than in the interstellar medium. In V712 Per and V909 Per, the bulk of the mass of the dust particles is concentrated near amax, while in V719 Per the average mass of the dust particles is determined by the minimum size of the particles. It should be emphasized that these conclusions rely on an analysis of the optical variability of these stars.

  11. Optical and Infrared Variability of UX Ori-Type Stars

    Science.gov (United States)

    Rostopchina-Shakhovskaya, A.; Grinin, V.; Shenavrin, V.; Shakhovskoy, D.; Demidova, T.; Belan, S.

    2017-06-01

    Analyzing data of the long-term simultaneous NIR and optical photometry of five UX Ori type stars we estimate intrinsic NIR luminosity of their circumstellar disks in I, J, H bands. The H to J flux ratio for WW Vul, CQ Tau, RR Tau, UX Ori is consistent with 1500 K blackbody radiation, a typical temperature of dust sublimation. For the same stars except RR Tau, J to I flux ratio suggests much hotter source with T>2000 K, probably the inner dust-free disk. In case of RR Tau this value is close to 1500 K, implying sublimating dust as a main contributor in all three bands. The SED for BF Ori differs from the rest of objects, with flux density peaking in J band, probably due to an unresolved cool companion.

  12. FUSE Observations of the Bright, Eclipsing Nova-like Cataclysmic Variable, UX UMa (FUSE 2000)

    Science.gov (United States)

    Long, Knox; Froning, Cynthia

    2004-01-01

    This was a project to study the disk and wind of the eclipsing nova-like variable UX UMa, in order to better define the wind geometry of the system, including the nature of the transition region between the disk photosphere and the supersonic wind. We proposed to use phase resolved spectroscopy of the system, taking advantage of the fact that UX UMa is an eclipsing system, to isolate different regions of the wind and to use a Monte Carlo radiative transfer code to simulate the spectra through the eclipse.

  13. A 16-yr photometric campaign on the eclipsing novalike variable DW Ursae Majoris

    Science.gov (United States)

    Boyd, D. R. S.; de Miguel, E.; Patterson, J.; Wood, M. A.; Barrett, D.; Boardman, J.; Brettman, O.; Cejudo, D.; Collins, D.; Cook, L. M.; Cook, M. J.; Foote, J. L.; Fried, R.; Gomez, T. L.; Hambsch, F.-J.; Jones, J. L.; Kemp, J.; Koff, R.; Koppelman, M.; Krajci, T.; Lemay, D.; Martin, B.; McClusky, J. V.; Menzies, K.; Messier, D.; Roberts, G.; Robertson, J.; Rock, J.; Sabo, R.; Skillman, D.; Ulowetz, J.; Vanmunster, T.

    2017-04-01

    We present an analysis of photometric observations of the eclipsing novalike variable DW UMa made by the CBA consortium between 1999 and 2015. Analysis of 372 new and 260 previously published eclipse timings reveals a 13.6 yr period or quasi-period in the times of minimum light. The seasonal light curves show a complex spectrum of periodic signals: both positive and negative 'superhumps', likely arising from a prograde apsidal precession and a retrograde nodal precession of the accretion disc. These signals appear most prominently and famously as sidebands of the orbital frequency; but the precession frequencies themselves, at 0.40 and 0.22 cycles per day, are also seen directly in the power spectrum. The superhumps are sometimes seen together, and sometimes separately. The depth, width and skew of eclipses are all modulated in phase with both nodal and apsidal precession of the tilted and eccentric accretion disc. The superhumps, or more correctly the precessional motions that produce them, may be essential to understanding the mysterious 'SW Sextantis' syndrome. Disc wobble and eccentricity can both produce Doppler signatures inconsistent with the true dynamical motions in the binary, and disc wobble might boost the mass-transfer rate by enabling the hot white dwarf to directly irradiate the secondary star.

  14. Anatomy of Ursa Majoris

    Science.gov (United States)

    Karachentsev, I. D.; Nasonova, O. G.; Courtois, H. M.

    2013-03-01

    A nearby friable cloud in Ursa Majoris contains 270 galaxies with radial velocities 500 Z-wave' effect caused by infall towards a massive attractor. This constrains the total amount of dark matter between the UMa groups within the cloud volume.

  15. UX Professionals’ Definitions of Usability and UX

    DEFF Research Database (Denmark)

    Rajanen, Dorina; Clemmensen, Torkil; Iivari, Netta

    2017-01-01

    This paper examines the views of user experience (UX) professionals on the definitions of usability and UX, and compares the findings between countries and within different socio-cultural groups. A mixed-method analysis was employed on data gathered on 422 professionals through a survey in Turkey......, Finland, Denmark, France, and Malaysia. Usability appears to be an established concept, respondents across all countries agreeing on the importance of the ISO 9241-11 definition. There is also a tendency that UX professionals attach organizational perspective to usability. UX professionals diverge when...... defining UX, and there are systematic differences related to socio-cultural conditions. UX professionals in Finland and France incline more towards the definition highlighting the experiential qualities, when compared to Turkey and Malaysia that incline towards the definition reflecting the ease of use...

  16. reflux

    African Journals Online (AJOL)

    manifestation of gastroesophageal reflux. bile reflux. (causing gastritis). peptic ulcer disease (PUD) or gallstones. Peptic ulcer is uncommon in pregnancy because of the decreased acid secretion that occurs in pregnancy. However. Helicobacter pylori gastritis. cigarette smoking. alcoholism and stress are risk factors for PUD ...

  17. UX Research is Dead. Long live UX Research!

    OpenAIRE

    Dogan, H.; Giff, S.

    2016-01-01

    This paper critically discusses the future of User Experience (UX) research across the tech industry and hence the shift from classic usability research towards design-led approaches, quantitative research discipline, A/B testing and telemetry. Likely causes for this shift are addressed to empower the UX research discipline to remain relevant. The areas covered include the identity crisis and democratization of UX research; evolvement and sustainability of the UX discipline; and fusion of UX ...

  18. UX for dummies

    CERN Document Server

    Nichols, Kevin

    2014-01-01

    Get up to speed quickly on the latest in user experience strategy and design UX For Dummies is a hands-on guide to developing and implementing user experience strategy. Written by globally-recognized UX consultants, this essential resource provides expert insight and guidance on using the tools and techniques that create a great user experience, along with practical advice on implementing a UX strategy that aligns with your organisation's business goals and philosophy. You'll learn how to integrate web design, user research, business planning and data analysis to focus your company's web prese

  19. Understanding Teen UX

    DEFF Research Database (Denmark)

    Fitton, Daniel; Iversen, Ole Sejer; Bell, Beth

    2014-01-01

    UX is a widely explored topic within HCI and has a large practitioners' community. However, the users considered in research and practice, are most often adults -- since adults represent the largest technology market share. However teenagers represent a growing market of unique users, and more...... needs to be understood about this population, from a UX perspective. The theme of this workshop is Building a Bridge to the Future and the aim is to gather together academics and UX practitioners, interested in teen users specifically, in order to discuss experiences, understandings, insights...... and methods that we can use to comprehend teen UX now and explore how this may lead to the creation of better interactive products in the future. The workshop will also foster new collaborations, and define new research agendas to grow the research and literature in this area....

  20. How to Design Experiences: Macro UX versus Micro UX Approach

    OpenAIRE

    von Saucken, Constantin;Michailidou, Ioanna;Lindemann, Udo

    2014-01-01

    User Experience (UX) can be achieved by a user-related product’s purpose (Macro UX) as well as by pleasant embodiment design in detail concerning material, usability and interface (Micro UX). Existing approaches mostly represent the Macro UX approach and therefore demand influencing the whole development process, in particular the early stage of goal setting. Furthermore, they are often psychology-driven. For that reason they are hardly implemented in industrial practice. We observe that most...

  1. UX Design Innovation

    DEFF Research Database (Denmark)

    Dove, Graham; Halskov, Kim; Forlizzi, Jodi

    2017-01-01

    Machine learning (ML) is now a fairly established technology, and user experience (UX) designers appear regularly to integrate ML services in new apps, devices, and systems. Interestingly, this technology has not experienced a wealth of design innovation that other technologies have, and this might...... a part of their UX design education, on how they work to create new things with developers, and on the challenges they have faced working with this material. We use the findings from this survey and our review of related literature to present a series of challenges for UX and interaction design research...... and education. Finally, we discuss areas where new research and new curriculum might help our community unlock the power of design thinking to re-imagine what ML might be and might do....

  2. UX-15 Reaches LEP

    CERN Multimedia

    2001-01-01

    The creation of the world's largest sandstone cavern, not a small feat! At the bottom, cave-in preventing steel mesh can be seen clinging to the top of the tunnel. The digging of UX-15, the cavern that will house ATLAS, reached the upper ceiling of LEP on October 10th. The breakthrough which took place nearly 100 metres underground occurred precisely on schedule and exactly as planned. But much caution was taken beforehand to make the LEP breakthrough clean and safe. To prevent the possibility of cave-ins in the side tunnels that will eventually be attached to the completed UX-15 cavern, reinforcing steel mesh was fixed into the walls with bolts. Obviously no people were allowed in the LEP tunnels below UX-15 as the breakthrough occurred. The area was completely evacuated and fences were put into place to keep all personnel out. However, while personnel were being kept out of the tunnels below, this has been anything but the case for the work taking place up above. With the creation of the world's largest...

  3. UX Tau A

    Science.gov (United States)

    2007-01-01

    This is an artist's rendition of the one-million-year-old star system called UX Tau A, located approximately 450 light-years away. Observations from NASA's Spitzer Space Telescope showed a gap in the dusty planet-forming disk swirling around the system's central sun-like star. Spitzer saw a gap in UX Tau A's disk that extends from 0.2 to 56 astronomical units (an astronomical unit is the distance between the sun and Earth). The gap extends from the equivalent of Mercury to Pluto in our solar system, and is sandwiched between thick inner and outer disks on either side. Astronomers suspect that the gap was carved out by one or more forming planets. Such dusty disks are where planets are thought to be born. Dust grains clump together like snowballs to form larger rocks, and then the bigger rocks collide to form the cores of planets. When rocks revolve around their central star, they act like cosmic vacuum cleaners, picking up all the gas and dust in their path and creating gaps. Although gaps have been detected in disks swirling around young stars before, UX Tau A is special because the gap is sandwiched between two thick disks of dust. An inner thick dusty disk hugs the central star, then, moving outward, there is a gap, followed by another thick doughnut-shaped disk. Other systems with gaps contain very little to no dust near the central star. In other words, those gaps are more like big holes in the centers of disks. Some scientists suspect that these holes could have been carved out by a process called photoevaporation. Photoevaporation occurs when radiation from the central star heats up the gas and dust around it to the point where it evaporates away. The fact that there is thick disk swirling extremely close to UX Tau A's central star rules out the photoevaporation scenario. If photoevaporation from the star played a role, then large amounts of dust would not be floating so close to the star.

  4. UX Ori-Type Stars

    Science.gov (United States)

    Grinin, V.

    2017-06-01

    The brief review of the properties of the UX Ori type stars is presented. A special attention is given to the results of the Crimean program of the multi-year photometric and polarimetric observations of these stars.

  5. Resolving the inner disk of UX Orionis

    Science.gov (United States)

    Kreplin, A.; Madlener, D.; Chen, L.; Weigelt, G.; Kraus, S.; Grinin, V.; Tambovtseva, L.; Kishimoto, M.

    2016-05-01

    Aims: The cause of the UX Ori variability in some Herbig Ae/Be stars is still a matter of debate. Detailed studies of the circumstellar environment of UX Ori objects (UXORs) are required to test the hypothesis that the observed drop in photometry might be related to obscuration events. Methods: Using near- and mid-infrared interferometric AMBER and MIDI observations, we resolved the inner circumstellar disk region around UX Ori. Results: We fitted the K-, H-, and N-band visibilities and the spectral energy distribution (SED) of UX Ori with geometric and parametric disk models. The best-fit K-band geometric model consists of an inclined ring and a halo component. We obtained a ring-fit radius of 0.45 ± 0.07 AU (at a distance of 460 pc), an inclination of 55.6 ± 2.4°, a position angle of the system axis of 127.5 ± 24.5°, and a flux contribution of the over-resolved halo component to the total near-infrared excess of 16.8 ± 4.1%. The best-fit N-band model consists of an elongated Gaussian with a HWHM ~ 5 AU of the semi-major axis and an axis ration of a/b ~ 3.4 (corresponding to an inclination of ~72°). With a parametric disk model, we fitted all near- and mid-infrared visibilities and the SED simultaneously. The model disk starts at an inner radius of 0.46 ± 0.06 AU with an inner rim temperature of 1498 ± 70 K. The disk is seen under an nearly edge-on inclination of 70 ± 5°. This supports any theories that require high-inclination angles to explain obscuration events in the line of sight to the observer, for example, in UX Ori objects where orbiting dust clouds in the disk or disk atmosphere can obscure the central star. Based on observations made with ESO telescopes at Paranal Observatory under program IDs: 090.C-0769, 074.C-0552.

  6. Ursa Major: ot losya do medvedya %t Ursa Major: from elk to bear

    Science.gov (United States)

    Lushnikova, A. V.

    In the article material from various cultural and linguistic sources (Indo-European - Slavic, Indo-Iranian; Uralo-Altaic, Tungus, Ancient Egyptian, Babylonian) is used in order to trace up the chronology of the designation of Ursa Majopr, a constellation which has been playing an important role for people different regions since ancient times. It was used for observing of the visible yearly motion of the Sun, for working out seasonal changes; being a circumpolar and non-hiding behind the horizon it has been perceived as a symbol of immortality, its peculiar positional change during a year lay down in plot of the Uralo-Siberian myths about a cosmic hunt for the Elk, myths about deluge. Data from Uralo-Siberian mythology are analyzed. Designations of Ursa Major in the form of a horned hoofed animal such as elk, deer, cow (Uralo-Altaic, Tungus, Slavic, Indo-Iranian languages; Ancient Greece, Crete, Ancient Egypt) and connected with it (or derived from it) denominations and images of "enclosed space" - "vehicle for travelling and carrying goods" (a wagon, a boat) - "instrument for hunting-fishing, a ritual thing" - "household construction" are taken in consideration. The conclusion is made that the transition of the Ursa Major designation from elk to bear could follow the general tendency to shift from so-called matriarchy to patriarchy, to substitute female deities with male ones, which was reflected "in the rise" of the predatory animal cults (not earlier than II mil. B.C.). To prove this, lexical examples of resemblance and coincidences in designation of homed hoofed (elk, deer) and predatory (bear, wolf) animals should be analyzed. Such a goal-directed investigation of the chronology of Ursa Major designations has never been carried out.

  7. Gas Removal in the Ursa Minor Galaxy: Linking Hydrodynamics and Chemical Evolution Models

    Energy Technology Data Exchange (ETDEWEB)

    Caproni, Anderson; Lanfranchi, Gustavo Amaral; Baio, Gabriel Henrique Campos; Kowal, Grzegorz [Núcleo de Astrofísica Teórica, Universidade Cruzeiro do Sul, R. Galvão Bueno 868, Liberdade, 01506-000, São Paulo, SP (Brazil); Falceta-Gonçalves, Diego, E-mail: anderson.caproni@cruzeirodosul.edu.br [Escola de Artes, Ciências e Humanidades, Universidade de São Paulo, Rua Arlindo Bettio 1000, CEP 03828-000 São Paulo (Brazil)

    2017-04-01

    We present results from a non-cosmological, three-dimensional hydrodynamical simulation of the gas in the dwarf spheroidal galaxy Ursa Minor. Assuming an initial baryonic-to-dark-matter ratio derived from the cosmic microwave background radiation, we evolved the galactic gas distribution over 3 Gyr, taking into account the effects of the types Ia and II supernovae. For the first time, we used in our simulation the instantaneous supernovae rates derived from a chemical evolution model applied to spectroscopic observational data of Ursa Minor. We show that the amount of gas that is lost in this process is variable with time and radius, being the highest rates observed during the initial 600 Myr in our simulation. Our results indicate that types Ia and II supernovae must be essential drivers of the gas loss in Ursa Minor galaxy (and probably in other similar dwarf galaxies), but it is ultimately the combination of galactic winds powered by these supernovae and environmental effects (e.g., ram-pressure stripping) that results in the complete removal of the gas content.

  8. User experience (UX) design for libraries

    CERN Document Server

    Schmidt, Aaron

    2012-01-01

    This book shows you how to get there by providing hands-on steps and best practices for UX design principles, practices, and tools to engage with patrons online and build the best web presence for your library.

  9. UX výskum digitálnych produktov

    OpenAIRE

    Dziaková, Barbora

    2015-01-01

    Thesis deals with the UX research from the perspective of UX professionals. The main objective of this thesis is to determine the point of view these professionals on UX research. The first partial objective of this thesis is to identify problem areas and the causes of problems in the context of UX research. The second objective is to identify how the experts assess the impact of efforts carried out in connection with the UX. The third objective is to identify the benefits of conducting UX re...

  10. An Intensive CCD Photometry Campaign to Observe DW Ursae Majoris

    Science.gov (United States)

    Boyd, David; Gaensicke, Boris

    2009-05-01

    We report on a coordinated observing campaign in April and May 2008 to study the eclipsing dwarf nova DW Ursae Majoris. This belongs to the group of SW Sex stars, nova-like variables containing accretion disks which exhibit superhumps in their light curves suggesting that their accretion disks are elliptical and precessing on time scales of a few days due to tidal interactions with the companion star. It has been suggested that the changing geometry will cause the depth of eclipses to be modulated on the accretion disk precession period. The aim of this campaign was to provide for the first time sufficient continuous photometric coverage of an eclipsing super-humper to test this hypothesis. 26 experienced amateur CCD photometrists in 7 countries participated in the project and altogether made almost 55,000 magnitude measurements over a 4 week period, keeping DW UMa under observation for more than 50% of the time. The results provide direct measurements of the orbital, super-hump and disk precession periods, confirming unambiguously that the superhump signal is a beat between the orbital and precession periods. They also reveal modulation not only of the eclipse depth but also of the eclipse time of minimum and width on the accretion disk precession period. The project is a good example of cooperation between the amateur and professional communities to address an open research issue.

  11. Teaching Software Developers to Perform UX Tasks

    DEFF Research Database (Denmark)

    Øvad, Tina; Bornoe, Nis; Larsen, Lars Bo

    2015-01-01

    Good UX design is becoming important within the industry when developing new products. This entails that UX skills have to be available in the development processes. This paper investigates the opportunities of using software developers as a UX work resource in the day-to-day working practice....... This is done via an action research study where the developers were provided with material concerning a modified AB usability test, by training them in performing this type of work, and by using their feedback to improve the method and the material. The overall result of the study is positive and it is found...... that by using the developers' feedback in the modification process, the method has truly become applicable within an agile, industrial setting. In combination with a guideline and template this has induced the developers to feel confident in independently performing this type of work....

  12. The ursa major cluster of galaxies - IV. HI synthesis observations

    NARCIS (Netherlands)

    Verheijen, MAW; Sancisi, R

    In this data paper we present the results of an extensive 21 cm-line synthesis imaging survey of 43 spiral galaxies in the nearby Ursa Major cluster using the Westerbork Synthesis Radio Telescope. Detailed kinematic information in the form of position-velocity diagrams and rotation curves is

  13. Tallinna ülikool ehitab uue Ursa maja / Mihkel Tamm

    Index Scriptorium Estoniae

    Tamm, Mihkel

    2017-01-01

    2018. a. veebruaris kavatseb Tallinna Ülikool hakata lammutama loodus- ja terviseteaduste õppehoonet ehk Ursa maja. Amortiseerunud hoone asemele ehitatakse uus, mille uksed loodetakse tudengitele avada 2019. aasta sügissemestriks. Selgitusi uue hoone kahta jagab TLÜ kantsler Peep Jonas ning kavandatava õueala kohta keskkonnakorralduse professor Helen Sooväli-Sepping

  14. How to create a UX story

    OpenAIRE

    Michailidou, Ioanna; von Saucken, Constantin; Kremer, Simon; Lindemann, Udo

    2014-01-01

    Narratives are a tool used in many disciplines. In the area of User Experience Design (UXD), in particular, a storytelling approach can be applied during the whole design process to improve the quality of developed concepts regarding user experience (UX). Furthermore stories support designers in ex-ploring and communicating their new concept ideas. However, the guidelines on how to create a story are either too abstract or do not focus on the experience elements of the interaction. This paper...

  15. Data of evolutionary structure change: 2UXML-2UX3M [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 2UXML-2UX3M 2UXM 2UX3 L M -----ALLSFE--------------RKYRVPGG--TLVG.../alignment> 0 2UXM L 2UX...U CA 253 VAL CA 231 GLY CA 185 GLY CA 184 2UX...3 M 2UX3M 1 2UXM L 2UXML

  16. Optical flare events on the RS Canum Venaticorum star UX Arietis

    Science.gov (United States)

    Cao, Dong-Tao; Gu, Sheng-Hong

    2017-05-01

    Based on long-term high-resolution spectroscopic observations obtained during five observing runs from 2001 to 2004, we study optical flare events and chromospheric activity variability of the very active RS CVn star UX Ari. By means of the spectral subtraction technique, several optical chromospheric activity indicators (including the He i D3, Na i D1, D2 doublet, Hα and Ca ii IRT lines) covered in our echelle spectra were analyzed. Four large optical flare events were detected on UX Ari during our observations, which show prominent He i D3 line emission together with great enhancement in emission of the Hα and Ca ii IRT lines and strong filled-in or emission reversal features in the Na i D1, D2 doublet lines. The newly detected flares are much more energetic than previous discoveries, especially for the flare identified during the 2002 December observing run. Optical flare events on UX Ari are more likely to be observed around two quadratures of the system, except for our optical flares detected during the 2004 November observing run. Moreover, we have found rotational modulation of chromospheric activity in the Hα and Ca ii IRT lines, which suggests the presence of chromospherically active longitudes over the surface of UX Ari. The change in chromospherically active longitudes among our observing runs, as well as the variation in chromospheric activity level from 2001 to 2004, indicates a long-term evolution of active regions.

  17. Swift/BAT detects an outburst from UX Ari

    Science.gov (United States)

    Krimm, H. A.; Barthelmy, S. D.; Baumgartner, W.; Cummings, J.; Gehrels, N.; Lien, A. Y.; Markwardt, C. B.; Palmer, D.; Sakamoto, T.; Stamatikos, M.; Ukwatta, T.

    2014-02-01

    The RS Canum Venaticorum type variable star UX Ari is currently in outburst as detected in the Swift/BAT hard X-ray transient monitor in the 15-50 keV band. The current outburst began on 2014 February 14 (MJD 56702) when it had a count rate of 0.004 +/- 0.002 ct/s/cm^2 (~20 mCrab). It continued to brighten, reaching a rate of 0.013 +/- 0.003 ct/s/cm^2 (~60 mCrab) on 2014 February 17. It has since faded somewhat, with a rate of 0.005 +/- 0.002 ct/s/cm^2 (~20 mCrab) on 2014 February 19.

  18. Multiple wavelength microwave observations of the RS Canum Venaticorum stars UX Arietis, HR 1099, HR 5110, and II Pegasi

    Science.gov (United States)

    Willson, Robert F.; Lang, Kenneth R.

    1987-01-01

    The variabilities, core size and magnetic field of the RS CVn star UX Arietis was measured with the VLA at pairs of frequencies near 1415 MHz and 4835 MHz on June 10, 1985. Data were also gathered on HR 1099, HR 5110 and II Peg. UX Arietis exhibited variability on time scales ranging from 30 sec to 1 hr at 4835 MHz, but no detectable variations at 1415 MHz. An upper limit of 900 billion cm was placed on the size of the core emitting region, which is estimated to have a magnetic field strength of 15 G. The 30 sec variations are attributed to absorption by thermal plasma between the G5 and K1 companions of the UX Arietis system.

  19. Pediatric Urinary Tract Infections and Vesicoureteral Refl ux: What ...

    African Journals Online (AJOL)

    It has been nearly 50 years since Victor Politano and Wyland Leadbetter developed the first reliable operation for the surgical correction of vesicoureteral refl ux (VUR). It dispelled the notion of bladder outlet obstruction as the primary cause of refl ux. One might argue, however, since the operation was so reproducible that ...

  20. Photometric activity of UX orionis stars and related objects in the near infrared and optical: CO Ori, RR Tau, UX Ori, and VV Ser

    Science.gov (United States)

    Shenavrin, V. I.; Rostopchina-Shakhovskaya, A. N.; Grinin, V. P.; Demidova, T. V.; Shakhovskoi, D. N.; Belan, S. P.

    2016-08-01

    This paper continues a study of the photometric activity of UX Ori stars in the optical and near-infrared ( JHKLM bands) initiated in 2000. For comparison, the list of program stars contains two Herbig Ae stars that are photometrically quiet in the optical: MWC480 andHD179218. Fadings ofUXOri stars in the optical ( V band) due to sporadic increases of the circumstellar extinction are also observed in the infrared (IR), but with decreasing amplitude. Two stars, RR Tau and UX Ori, displayed photometric events when V -band fadings were accompanied by an increase in IR fluxes. Among the two Herbig Ae stars that are photometrically quiet in the optical, MWC 480 proved to be fairly active in the IR. Unlike the UX Ori stars, the variation amplitude of MWC 480 increases from the J band to the M band. In the course of the observations, no deep fadings in the IR bands were detected. This indicates that eclipses of the program stars have a local nature, and are due to extinction variations in the innermost regions of the circumstellar disks. The results presented testify to an important role of the alignment of the circumstellar disks relative to the direction towards the observer in determining the observed IR variability of young stars.

  1. A Curious Milky Way Satellite in Ursa Major

    Science.gov (United States)

    Zucker, D. B.; Belokurov, V.; Evans, N. W.; Kleyna, J. T.; Irwin, M. J.; Wilkinson, M. I.; Fellhauer, M.; Bramich, D. M.; Gilmore, G.; Newberg, H. J.; Yanny, B.; Smith, J. A.; Hewett, P. C.; Bell, E. F.; Rix, H.-W.; Gnedin, O. Y.; Vidrih, S.; Wyse, R. F. G.; Willman, B.; Grebel, E. K.; Schneider, D. P.; Beers, T. C.; Kniazev, A. Y.; Barentine, J. C.; Brewington, H.; Brinkmann, J.; Harvanek, M.; Kleinman, S. J.; Krzesinski, J.; Long, D.; Nitta, A.; Snedden, S. A.

    2006-10-01

    In this Letter, we study a localized stellar overdensity in the constellation of Ursa Major, first identified in Sloan Digital Sky Survey (SDSS) data and subsequently followed up with Subaru imaging. Its color-magnitude diagram (CMD) shows a well-defined subgiant branch, main sequence, and turnoff, from which we estimate a distance of ~30 kpc and a projected size of ~250×125 pc2. The CMD suggests a composite population with some range in metallicity and/or age. Based on its extent and stellar population, we argue that this is a previously unknown satellite galaxy of the Milky Way, hereby named Ursa Major II (UMa II) after its constellation. Using SDSS data, we find an absolute magnitude of MV~-3.8, which would make it the faintest known satellite galaxy. UMa II's isophotes are irregular and distorted with evidence for multiple concentrations; this suggests that the satellite is in the process of disruption. Based in part on data collected at Subaru Telescope, which is operated by the National Astronomical Observatory of Japan.

  2. A blind HI survey in the Ursa Major region

    Science.gov (United States)

    Wolfinger, K.; Kilborn, V. A.; Koribalski, B. S.; Minchin, R. F.; Boyce, P. J.; Disney, M. J.; Lang, R. H.; Jordan, C. A.

    2013-01-01

    We have conducted the first blind HI survey covering 480 deg2 and a heliocentric velocity range from 300 to 1900 km s-1 to investigate the HI content of the nearby spiral-rich Ursa Major region and to look for previously uncatalogued gas-rich objects. Here we present the catalogue of HI sources. The HI data were obtained with the four-beam receiver mounted on the 76.2-m Lovell telescope [full width at half-maximum (FWHM) 12 arcmin] at the Jodrell Bank Observatory (UK) as part of the HI Jodrell All Sky Survey (HIJASS). We use the automated source finder duchamp and identify 166 H i sources in the data cubes with HI masses in the range of 107-1010.5 M⊙. Our Ursa Major HI catalogue includes 10 first-time detections in the 21-cm emission line. We identify optical counterparts for 165 HI sources (99 per cent). For 54 HI sources (˜33 per cent) we find numerous optical counterparts in the HIJASS beam, indicating a high density of galaxies and likely tidal interactions. Four of these HI systems are discussed in detail. We find only one HI source (1 per cent) without a visible optical counterpart out of the 166 HI detections. Green Bank Telescope (FWHM 9 arcmin) follow-up observations confirmed this HI source and its HI properties. The nature of this detection is discussed and compared to similar sources in other HI surveys.

  3. Bridging UX and web development better results through team integration

    CERN Document Server

    Moffett, Jack

    2014-01-01

    The divide between UX and Web development can be stifling. Bridging UX and Web Development prepares you to break down those walls by teaching you how to integrate with your team's developers. You examine the process from their perspective, discovering tools and coding principles that will help you bridge the gap between design and implementation. With these tried and true approaches, you'll be able to capitalize on a more productive work environment. Whether you're a novice UX professional finding your place in the software industry and looking to nail down your technical skills, or a seasone

  4. Heuristics Considering UX and Quality Criteria for Heuristics

    Directory of Open Access Journals (Sweden)

    Frederik Bader

    2017-12-01

    Full Text Available Heuristic evaluation is a cheap tool with which one can take qualitative measures of a product’s usability. However, since the methodology was first presented, the User Experience (UX has become more popular but the heuristics have remained the same. In this paper, we analyse the current state of heuristic evaluation in terms of heuristics for measuring the UX. To do so, we carried out a literature review. In addition, we had a look at different heuristics and mapped them with the UX dimensions of the User Experience Questionnaire (UEQ. Moreover, we proposed a quality model for heuristic evaluation and a list of quality criteria for heuristics.

  5. Smashing UX design foundations for designing online user experiences

    CERN Document Server

    Allen, Jesmond

    2012-01-01

    The ultimate guide to UX from the world's most popular resource for web designers and developers Smashing Magazine is the world's most popular resource for web designers and developers and with this book, the authors provide the pinnacle resource to becoming savvy with User Experience Design (UX). The authors first provide an overview of UX and chart its rise to becoming a valuable and necessary practice for narrowing the gap between Web sites, applications, and users in order to make a user's experience a happy, easy, and successful one.Examines the essential aspects of User Experience Design

  6. Comparison of automated devices UX-2000 and SediMAX/AutionMax for urine samples screening: A multicenter Spanish study.

    Science.gov (United States)

    Sánchez-Mora, Catalina; Acevedo, Delia; Porres, Maria Amelia; Chaqués, Ana María; Zapardiel, Javier; Gallego-Cabrera, Aurelia; López, Jose María; Maesa, Jose María

    2017-08-01

    In this study we aim to compare UX2000 (Sysmex Corp, Japan) and SediMAX/AutionMax (Arkray Factory Inc., Japan), totally automatized analyzers, against Fuchs-Rosenthal counting chamber, the gold standard technique for sediment analysis. Urine samples of 1454 patients from three Spanish hospitals were assessed for red and white blood cells (RBC; WBC) using three different techniques: flow cytometry, image-based method and Fuchs-Rosenthal counting chamber. Test strip results were subjected to concordance evaluation. Agreement was assessed by Cohen's weighted kappa for multinomial results. Sensitivity (SE) and specificity (SP) were calculated. The categorization of the results showed that UX-2000 had higher concordance over SediMAX for WBC (0.819 vs. 0.546) and similar for RBC (0.573 vs. 0.630). For RBC, UX-2000 had higher SE (92.7% vs. 80.3%) but lower SP (77.1% vs. 87.4%), and showed higher both SE (94.3% vs. 76.7%) and SP (94.7% vs. 88.2%) for WBC. Inter-devices test strip agreement was substantial (kappa>0.600) for all variables except for bilirubin (kappa: 0.598). Intra-device test strip agreement was similar for UX2000 and SediMAX with regard to RBC (kappa: 0.553 vs. 0.482) but better for UX2000 with regard to WBC (0.688 vs. 0.465). Both analyzers studied are acceptable for daily routine lab work, even though SediMAX is easier to use in laboratories thanks to its lower maintenance procedure. UX-2000 has shown to have better concordance with the gold standard method. However, it needs some improvements such as an image module in order to decrease manual microscopy review for urine samples. Copyright © 2017 The Canadian Society of Clinical Chemists. Published by Elsevier Inc. All rights reserved.

  7. mUX: the journal of mobile user experience

    National Research Council Canada - National Science Library

    Mobile user experience (mUX) encompasses a broad sweep of technology, social and business research - from new interaction techniques for mobile devices, through location-based applications, to mobile services in entertainment...

  8. Multiple Data Stream Measurement of UX in a Work Context

    DEFF Research Database (Denmark)

    Yadav, Mohit; Clemmensen, Torkil

    In this paper we discuss the emergence of a redefined human work interaction design environment due to Internet of Things. The change in paradigm challenges designers to re-think the category of the user/worker to include their trusted IT devices/cognitive objects while designing for work......) data-streams of UX in a work setting. This may give a holistic view of UX in the smart workplace....

  9. The Human-Computer Domain Relation in UX Models

    DEFF Research Database (Denmark)

    Clemmensen, Torkil

    This paper argues that the conceptualization of the human, the computer and the domain of use in competing lines of UX research have problematic similarities and superficial differences. The paper qualitatively analyses concepts and models in five research papers that together represent two...... domains, give little details about users, and treat human-computer interaction as perception. The conclusion gives similarities and differences between the approaches to UX. The implications for theory building are indicated....

  10. Efflux pump-mediated drug resistance in Burkholderia

    Science.gov (United States)

    Podnecky, Nicole L.; Rhodes, Katherine A.; Schweizer, Herbert P.

    2015-01-01

    Several members of the genus Burkholderia are prominent pathogens. Infections caused by these bacteria are difficult to treat because of significant antibiotic resistance. Virtually all Burkholderia species are also resistant to polymyxin, prohibiting use of drugs like colistin that are available for treatment of infections caused by most other drug resistant Gram-negative bacteria. Despite clinical significance and antibiotic resistance of Burkholderia species, characterization of efflux pumps lags behind other non-enteric Gram-negative pathogens such as Acinetobacter baumannii and Pseudomonas aeruginosa. Although efflux pumps have been described in several Burkholderia species, they have been best studied in Burkholderia cenocepacia and B. pseudomallei. As in other non-enteric Gram-negatives, efflux pumps of the resistance nodulation cell division (RND) family are the clinically most significant efflux systems in these two species. Several efflux pumps were described in B. cenocepacia, which when expressed confer resistance to clinically significant antibiotics, including aminoglycosides, chloramphenicol, fluoroquinolones, and tetracyclines. Three RND pumps have been characterized in B. pseudomallei, two of which confer either intrinsic or acquired resistance to aminoglycosides, macrolides, chloramphenicol, fluoroquinolones, tetracyclines, trimethoprim, and in some instances trimethoprim+sulfamethoxazole. Several strains of the host-adapted B. mallei, a clone of B. pseudomallei, lack AmrAB-OprA, and are therefore aminoglycoside and macrolide susceptible. B. thailandensis is closely related to B. pseudomallei, but non-pathogenic to humans. Its pump repertoire and ensuing drug resistance profile parallels that of B. pseudomallei. An efflux pump in B. vietnamiensis plays a significant role in acquired aminoglycoside resistance. Summarily, efflux pumps are significant players in Burkholderia drug resistance. PMID:25926825

  11. Autonomous Operation of the Nanosatellite URSA MAIOR Micropropulsion System

    Science.gov (United States)

    Santoni, F.

    Università degli Studi di Roma "La Sapienza", Scuola di Ingegneria Aerospaziale, Via Eudossiana 16, 00184 At Università di Roma "La Sapienza" a nanosatellite bus is under development, with one liter target volume and one kilogram target weight. This nanosatellite, called URSA MAIOR (Università di Roma "la SApienza" Micro Autonomous Imager in ORbit) has a micro camera on board to take pictures of the Earth. The nanosatellite is three axis stabilized, using a micro momentum wheel, with magnetic coils for active nutation damping and pointing control. An experimental micropropulsion system is present on-board, together with the magnetic attitude control system. The design, construction and testing of the satellite is carried on by academic personnel and by students, which are directly involved in the whole process, as it is in the spirit of in the microsatellite program at Università di Roma "La Sapienza". Few technological payloads are present on-board: an Earth imaging experiment, using a few grams commercial-off-the-shelf microcamera; commercial Li-Ion batteries are the only energy storage device; a microwheel developed at our University laboratories provides for attitude stabilization. In addition, a micropropulsion experiment is planned on-board. The Austrian Company Mechatronic, and INFM, an Italian Research Institute at Trieste are developing a microthruster for nanosatelite applications. In the frame of a cooperation established between these two Institutions and Università di Roma "La Sapienza", this newly developed hardware will be tested in orbit. The thruster is made basically of an integrated microvalve, built on a silicon chip, and a micronozzle, etched on the same silicon chip, to get supersonic expansion of the gas flow. The nominal thrust of the system is about 100microN. The throat section is about 100 micron diameter. The first phase in the construction of the microthruster has been the construction of the micronozzle on a silicon chip. A

  12. Copernicus observations of Ly-alpha and Mg II emission from HR 1099 /V711 Tauri/ and UX Ari

    Science.gov (United States)

    Weiler, E. J.

    1978-01-01

    Ultraviolet observations of two RS CVn binaries obtained with Copernicus are described. High-resolution (0.05 A) U1 observations indicate that both HR 1099 and UX Ari display broad Ly-alpha emission. The Ly-alpha emission strength from HR 1099 is variable and seems to be correlated with orbital phase, while the UX Ari results indicate no significant variation. Moderate resolution (0.51 A) V2 scans of both systems show variable Mg II h and k emission-line profiles which usually matched the velocity of the more active star in each binary. Additionally, displaced emission components were seen at velocities of up to + or - 250 km/s, indicative of high-velocity gas motions. The radial velocities of these emission features from HR 1099 are marginally correlated with orbital phase. Highly active and variable chromospheric phenomena are found to be the most consistent explanation of these results.

  13. UXOR Hunting among Algol Variables

    Science.gov (United States)

    Poxon, M.

    2015-06-01

    The class of variable typified by UX Orionis (UXORs or UXors) are young stars characterised by aperiodic or semiperiodic fades from maximum. This has led to several of the class being formerly catalogued as Algol-type eclipsing binaries (EAs), which can show superficially similar light variations. With this in view, I propose a campaign to search for more UX Ori type stars.

  14. Task Allocation Between UX Specialists and Developers in Agile Software Development Projects

    OpenAIRE

    Kuusinen, Kati

    2015-01-01

    International audience; Synchronizing efforts between developers and user experience (UX) specialists is one of the major challenges in agile UX work. In this paper, we report results of a study conducted over a release cycle of six agile software development projects in five companies, considering the task allocation and cooperation in the team. Team members (N = 31), including product owners, UX specialists, and developers, reported weekly on the UX-related tasks they had contributed to and...

  15. User experience management essential skills for leading effective UX teams

    CERN Document Server

    Lund, Arnie

    2011-01-01

    The role of UX manager is of vital importance -- it means leading a productive team, influencing businesses to adopt user-centered design, and delivering valuable products customers. Few UX professionals who find themselves in management positions have formal training in management. More often than not they are promoted to a management position after having proven themselves as an effective and successful practitioner.Yet as important as the position of manager is to the advancement of the field there are no books that specifically address the needs of user experience managers. Though informat

  16. The microscopic investigation of structures of moving flux lines by ...

    Indian Academy of Sciences (India)

    We have used a variety of microscopic techniques to reveal the structure and motion of flux line arrangements, when the flux lines in low c type II superconductors are caused to move by a transport current. Using small-angle neutron scattering by the flux line lattice (FLL), we are able to demonstrate directly the alignment ...

  17. Proper Motions of Dwarf Spheroidal Galaxies from Hubble Space Telescope Imaging. 3; Measurement for URSA Minor

    Science.gov (United States)

    Piatek, Slawomir; Pryor, Carlton; Bristow, Paul; Olszewski, Edward W.; Harris, Hugh C.; Mateo, Mario; Minniti, Dante; Tinney, Christopher G.

    2005-01-01

    This article presents a measurement of the proper motion of the Ursa Minor dwarf spheroidal galaxy determined from images taken with the Hubble Space Telescope in two distinct fields. Each field contains a quasi-stellar object that serves as the "reference point". Integrating the motion of Ursa Minor in a realistic potential for the Milky Way produces orbital elements. The perigalacticon and apogalacticon are 40 (10, 76) and 89 (78, 160) kpc, respectively, where the values in the parentheses represent the 95% confidence intervals derived from Monte Carlo experiments. The eccentricity of the orbit is 0.39 (0.09, 0.79), and the orbital period is 1.5 (1.1, 2.7) Gyr. The orbit is retrograde and inclined by 124 degrees (94 deg, 36 deg ) to the Galactic plane. Ursa Minor is not a likely member of a proposed stream of galaxies on similar orbits around the Milky Way, nor is the plane of its orbit coincident with a recently proposed planar alignment of galaxies around the Milky Way. Comparing the orbits of Ursa Minor and Carina shows no reason for the different star formation histories of these two galaxies. Ursa Minor must contain dark matter to have a high probability of having survived disruption by the Galactic tidal force until the present.

  18. The inner circumstellar disk of the UX Orionis star V1026 Scorpii

    Science.gov (United States)

    Vural, J.; Kreplin, A.; Kishimoto, M.; Weigelt, G.; Hofmann, K.-H.; Kraus, S.; Schertl, D.; Dugué, M.; Duvert, G.; Lagarde, S.; Massi, F.

    2014-04-01

    Context. The UX Ori type variables (named after the prototype of their class) are intermediate-mass pre-main sequence objects. One of the most likely causes of their variability is the obscuration of the central star by orbiting dust clouds. Aims: We investigate the structure of the circumstellar environment of the UX Ori star V1026 Sco (HD 142666) and test whether the disk inclination is large enough to explain the UX Ori variability. Methods: We observed the object in the low-resolution mode of the near-infrared interferometric VLTI/AMBER instrument and derived H- and K-band visibilities and closure phases. We modeled our AMBER observations, published Keck Interferometer observations, archival MIDI/VLTI visibilities, and the spectral energy distribution using geometric and temperature-gradient models. Results: Employing a geometric inclined-ring disk model, we find a ring radius of 0.15 ± 0.06 AU in the H band and 0.18 ± 0.06 AU in the K band. The best-fit temperature-gradient model consists of a star and two concentric, ring-shaped disks. The inner disk has a temperature of 1257+133-53 K at the inner rim and extends from 0.19 ± 0.01 AU to 0.23 ± 0.02 AU. The outer disk begins at 1.35+0.19-0.20 AU and has an inner temperature of 334+35-17 K. The derived inclination of 48.6+2.9-3.6° approximately agrees with the inclination derived with the geometric model (49 ± 5° in the K band and 50 ± 11° in the H band). The position angle of the fitted geometric and temperature-gradient models are 163 ± 9° (K band; 179 ± 17° in the H band) and 169.3+4.2-6.7°, respectively. Conclusions: The narrow width of the inner ring-shaped model disk and the disk gap might be an indication for a puffed-up inner rim shadowing outer parts of the disk. The intermediate inclination of ~50° is consistent with models of UX Ori objects where dust clouds in the inclined disk obscure the central star. Based on observations made with ESO telescopes at the La Silla Paranal Observatory

  19. Revealing the inclined circumstellar disk in the UX Orionis system KK Ophiuchi

    Science.gov (United States)

    Kreplin, A.; Weigelt, G.; Kraus, S.; Grinin, V.; Hofmann, K.-H.; Kishimoto, M.; Schertl, D.; Tambovtseva, L.; Clausse, J.-M.; Massi, F.; Perraut, K.; Stee, Ph.

    2013-03-01

    Aims: We study the inner sub-AU region of the circumstellar environment of the UX Ori-type star KK Oph with near-infrared VLTI/AMBER interferometry. We are particularly interested in the inclination of the star-disk system, and we use this information to test the current standard picture for UX Ori stars. Methods: We recorded spectrally dispersed (R ~ 35) interferograms in the near-infrared H and K bands with the VLTI/AMBER instrument. The derived visibilities, closure phases, and the spectral energy distribution of KK Oph were compared with two-dimensional geometric and radiative transfer models (RADMC). Results: We obtained visibilities at four different position angles. Using two-dimensional geometric models, we derive an axis ratio ~3.0 corresponding to an inclination of ~70°. A fitted inclined ring model leads to a ring radius of 2.8 ± 0.2 mas, corresponding to 0.44 ± 0.03 AU at a distance of 160 pc, which is larger than the dust sublimation radius of ~0.1 AU predicted for a dust sublimation temperature of 1500 K. Our derived two-dimensional RADMC model consists of a circumstellar disk with an inclination angle of ~70° and an additional dust envelope. Conclusions: The finding of an ~70° inclined disk around KK Oph is consistent with the prediction that UX Ori objects are seen under large inclination angles, and orbiting clouds in the line of sight cause the observed variability. Furthermore, our results suggest that the orbit of the companion KK Oph B and the disk plane are coplanar. Based on observations made with ESO telescopes at Paranal Observatory under program ID: 083.D-0224(C) and 088.C-0575(A).

  20. Revealing the inclined circumstellar disk in the UX Ori system KK Ophiuchi

    Science.gov (United States)

    Kreplin, A.; Weigelt, G.; Kraus, S.; Grinin, V.; Hofmann, K.-H.; Kishimoto, M.; Schertl, D.; Tambovtseva, L.; Clausse, J.-M.; Massi, F.; Perraut, K.; Stee, Ph.

    2013-07-01

    We study the inner sub-AU region of the circumstellar environment of the UX Ori type star KK Oph with near-infrared VLTI/AMBER interferometry. We are particularly interested in the inclination of the star-disk system, and we will use this information to test the current standard picture for UX Ori stars. We recorded spectrally dispersed (R˜35) interferograms in the near-infrared H and K bands with the VLTI/AMBER instrument. The derived visibilities, closure phases and the SED of KK Oph were compared with two-dimensional geometric and radiative transfer models (RADMC). We obtained visibilities at four different position angles. Using two-dimensional geometric models, we derive an axis ratio ˜3.0 corresponding to an inclination of ˜70 degree. A fitted inclined ring model leads to a ring radius of 2.8 ± 0.2 mas, corresponding to 0.44 ± 0.03 AU at a distance of 160 pc, which is larger than the dust sublimation radius of ˜0.1 AU predicted for a dust sublimation temperature of 1500 K. Our derived two-dimensional RADMC model consists of a circumstellar disk with an inclination angle of ˜70 degree and an additional dust envelope. The finding of an ˜70 degree inclined disk around KK Oph is consistent with the prediction that UX Ori objects are seen under large inclination angles, and orbiting clouds in the line of sight cause the observed variability. Furthermore, our results suggest that the orbit of the companion KK Oph B and the disk plane are coplanar.

  1. IUE ultraviolet spectra and chromospheric models of HR 1099 and UX Arietis

    Science.gov (United States)

    Simon, T.; Linsky, J. L.

    1980-01-01

    IUE spectra in the region 1150-3200 A of the RS CVn-type variables HR 1099 and UX Arietis are presented and analyzed in terms of chromospheric models. Measurements of Mg h and k lines and Ca II H-K and H alpha spectra are indicated which are found not to be correlated with orbital phase or radio flares and which suggest that the strong emission arises in the K star rather than the G star in these systems. Under the assumption that the UV emission lines are associated with the K star, surface gravities of log g = 3.6 and 3.4 and effective temperatures of 4850 and 5000 K are adopted for HR 1099 and UX Ari, respectively, along with solar metal abundances for each. Model calculations of the chromospheric structure necessary to account for observed C(+), Mg(+), Si(+) and Si(+2) line fluxes are presented which indicate that the transition region pressure lies in the range 0.18-1.0 dynes/sq cm, implying transition regions that are more extended than that of the sun and are not conductively heated. It is noted that pressure scaling laws and the use of Mg II and C II lines as pressure diagnostics may be invalid, possibly due to atmospheric inhomogeneities or gas flows.

  2. Optical spectra of UX Ari with BOOTES-2

    Science.gov (United States)

    Caballero-Garcia, M. D.; Castro-Tirado, A.; Jelinek, M.

    2014-07-01

    Following the detection and subsequent monitoring of the new outburst from the RS CVn UX Ari by SWIFT and MAXI (ATEL#5907, #6315 , #6319 ), the 0.6m TELMA robotic telescope at the BOOTES-2 astronomical station Malaga (Spain), obtained optical 4000-9000 A spectra starting at 2014-07-19, 01:32:24.382 UT and ending at 04:25:55.652 UT.

  3. The FK Comae candidate UX Librae

    Science.gov (United States)

    Bopp, B. W.; Goodrich, B. D.; Africano, J. L.; Noah, P. V.; Meredith, R. J.; Palmer, L. H.; Quigley, R. J.

    1984-01-01

    New optical spectroscopic and photometric data are presented for the active chromosphere FK Com candidate UZ Lib. The star is shown to have an extremely large photometric amplitude in V of 0.35 mag, and its rotation period is established as 4.75 + or - 0.01 days. The optical spectrum is that of an early K giant, broadened by a rotation velocity of approximately 65 km/s. H-alpha is visible as a very broad emission feature, with a profile resembling that seen in FK Com. The emission intensity and profile are variable over the rotation period, with the strongest emission present at photometric minimum, in accord with dark starspot models. The photospheric absorption line profiles show variable asymmetries and distortions which are interpreted as due to the effects of the dark starspot rotating across the line of sight. New radial velocity measures are combined with published data to demonstrate the UZ Lib is a member of a binary system in synchronous rotation with a secondary of mass approximately 0.5 solar masses. This information is considered in light of the conflicting models for the origin of the optical and spectral variability of the FK Com stars, as well as their uncertain evolutionary status.

  4. FLOSS UX Design: An Analysis of User Experience Design in Firefox and OpenOffice.org

    Science.gov (United States)

    Bach, Paula M.; Carroll, John M.

    We describe two cases of open user experience (UX) design using the Firefox web browser and OpenOffice.org office suite as case studies. We analyze the social complexity of integrating UX practices into the two open source projects using activity awareness, a framework for understanding team performance in collective endeavors of significant scope, duration, and complexity. The facets of activity awareness are common ground, community of practice, social capital, and human development. We found that differences between the communities include different strategies for community building, UX status in the community, type of open UX design, and different ways to share information.

  5. Rossiter-mclaughlin effect in emission from UX Ori stars

    Science.gov (United States)

    Grinin, V. P.; Potravnov, I. S.

    2013-03-01

    The possibility of detecting changes in the radial velocities of UX Ori stars during eclipses by circumstellar dust clouds is examined. Calculations show that, despite the large sizes of the clouds, this effect may actually be observable and, perhaps, has already been observed during spectral studies of stars of this kind. Monitoring of events of this kind can provide important information about the motion of matter in close proximity to young stars, as well as about the structure of gas-dust clouds shielding a star.

  6. The Prevalence of UX Design in Agile Development Processes in Industry

    DEFF Research Database (Denmark)

    Øvad, Tina; Larsen, Lars Bo

    2015-01-01

    analyses. Almost all the companies carried out development using the Scrum framework. All of the companies were interested in the idea of agile UX, and found the idea of using the developers as a UX resource interesting. This, together with an idea of modifying existing usability methods to be used...

  7. Data of evolutionary structure change: 1AIGM-2UX3L [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AIGM-2UX3L 1AIG 2UX3 M L YQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPIYLGSLGVL...FSLEPPAPEYGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAFLSAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSL...1AIG M 1AIGM IADRG-----TAAER...1AIG M 1AIGM TVVDN-----WYVWG...1AIG M 1AIGM VGPFSTLLGWFG

  8. Data of evolutionary structure change: 1AIGM-2UX5L [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AIGM-2UX5L 1AIG 2UX5 M L YQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPIYLGSLGVL...FSLEPPAPEYGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAFLSAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSL...1AIG M 1AIGM IADRG-----TAAER...1AIG M 1AIGM TVVDN-----WYVWG...1AIG M 1AIGM VGPFSTLLGWFG

  9. Data of evolutionary structure change: 1AIGM-2UX4L [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AIGM-2UX4L 1AIG 2UX4 M L YQNIFSQVQVRGPADLGMTEDVNLANRSGVGPFSTLLGWFGNAQLGPIYLGSLGVL...FSLEPPAPEYGLSFAAPLKEGGLWLIASFFMFVAVWSWWGRTYLRAQALGMGKHTAWAFLSAIWLWMVLGFIRPILMGSWSEAVPYGIFSHLDWTNNFSL...1AIG M 1AIGM IADRG-----TAAER...1AIG M 1AIGM TVVDN-----WYVWG...1AIG M 1AIGM VGPFSTLLGWFG

  10. A Textual Feedback Tool for Empowering Participants in Usability and UX Evaluations

    DEFF Research Database (Denmark)

    Sivaji, Ashok; Clemmensen, Torkil; Nielsen, Søren Feodor

    2017-01-01

    in Malaysia. The results indicate that the Textual Feedback tool may help participants to give their thoughts in UX evaluation in high power distance contexts. In particular, the Textual Feedback tool helps high status females and low status males express more UX problems than they can do with traditional CTA......The usability movement has historically always sought to empower end-users of computers, so that they understand what is happening and can control the outcome. In this paper, we develop and evaluate a ‘Textual feedback’ tool for usability and UX evaluation that can be used to empower well...... alone. We found that classic concurrent think aloud UX evaluation works fine in high power contexts, but only with the addition of Textual feedback to mitigate the effects of socio-economic status in certain user groups. We suggest that future research on UX evaluation look more into how to empower...

  11. The UX Moment: A Weave Digital Panel, Part Two

    Directory of Open Access Journals (Sweden)

    Pete Coco

    2015-01-01

    Full Text Available In mid-January 2015, Weave reached out to a number of librarians who are doing user experience work with the hope of instigating and documenting the conversation they might have with one another. Coming from not only academic and public libraries, but also library and information science degree programs, the assembled group of professionals is doing and thinking about library user experience in a broad set of contexts and by a variety of means. The conversation that resulted reflects that broad range of experience. Some librarians are working inside user experience departments, where others must find a way to do UX amidst other duties (duties which also vary. Some work in job descriptions emphasizing web development, others focus on visual design and architecture and still others work primarily as ethnographers of library users. If this feature is itself a modest documenting of what library user experience can look like—at least in 2015 and in these nine different institutions—then library user experience is itself quite a large number of things. The conversation below unfolded over email between Tuesday, January 20 and Friday, January 23, 2015. Because of the length of the conversation and the range of topics it covers, the editors have decided to run it in two segments. UX,

  12. Ultraviolet and radio flares from UX Arietis and HR 1099

    Science.gov (United States)

    Lang, Kenneth R.; Willson, Robert F.

    1988-01-01

    Simultaneous observations of the RS CVn systems UX Ari and HR 1099 with the IUE satellite and the VLA are presented. Flaring activity is observed at ultraviolet wavelengths with the IUE when none is detected at radio wavelengths with the VLA. Radio flares with no detectable ultraviolet activity have also been observed. Thus, flares in the two spectral regions are either uncorrelated or weakly correlated. The flaring emission probably originates in different regions at the two wavelengths. Radio flares from RS CVn stars may originate in sources that are larger than, or comparable to, a star in size. This is in sharp contrast to compact, coherent radio flares from dwarf M stars. The ultraviolet flares from RS CVn stars probably originate in sources that are smaller than a component star.

  13. Integrating User eXperience practices into software development processes: implications of the UX characteristics

    Directory of Open Access Journals (Sweden)

    Pariya Kashfi

    2017-10-01

    Full Text Available User eXperience (UX is a key factor in the success of software systems. Many software companies face challenges in their work with UX. Existing research does not analyze UX practices and challenges in relation to other software quality characteristics or, in particular, in relation to usability. A better understanding of these challenges can help researchers and practitioners better address them in the future. In this empirical study, we have interviewed 17 practitioners with different backgrounds and occupations from eight software development companies. Their responses are coded, and analyzed with thematic analysis. We report eight themes of challenges that practitioners face in their work with UX. While some of these challenges partly overlap with those reported in existing literature about usability or other software quality characteristics, the participants of our study either view many of the challenges as unique to UX, or more severe in the case of UX. Although at a superficial level challenges of UX and other quality characteristics overlap, we differentiate these challenges at a deeper level through the five main characteristics of UX: subjective, holistic, dynamic, context-dependent and worthwhile. In particular, we identified that these characteristics have at least 20 implications (i.e. additional difficulties for day-to-day work of practitioners. We found that 11 of these implications have been previously reported in literature. However, to the best of our knowledge, the remaining nine implications are unique to our study. These implications can explain why practitioners perceive the challenges to be more severe than for other quality characteristics. Most importantly, they can explain the industry’s lopsided focus on the pragmatic aspect of UX. Our findings can be useful for researchers in identifying new and industry-relevant research areas and for practitioners to learn from empirically investigated challenges in UX work, and

  14. Out of the box selection and application of UX evaluation methods and practical cases

    DEFF Research Database (Denmark)

    Obrist, Marianna; Knoche, Hendrik; Basapur, Santosh

    2013-01-01

    The scope of user experience supersedes the concept of usability and other performance oriented measures by including for example users' emotions, motivations and a strong focus on the context of use. The purpose of this tutorial is to motivate researchers and practitioners to think about...... the challenging questions around how to select and apply UX evaluation methods for different usage contexts, in particular for the "home" and "mobile" context, relevant for TV-based services. Next to a general understanding of UX evaluation and available methods, we will provide concrete UX evaluation case...

  15. Proper Motions of Dwarf Spheroidal Galaxies from Hubble Space Telescope Imaging: III. Measurement for URSA Minor

    Science.gov (United States)

    2005-07-01

    Coordinating Facility, Karl- Schwarzschild -Strasse 2, D-85748 Garching bei Munchen, Germany; bristowp@eso.org Edward W. Olszewski Steward Observatory...structural parameters from IH95: a core radius of 15A8 1A2 and a tidal radius of 50A6 3A6. Kleyna et al. (1998) find similar structural parameters for...system extend be- yond the tidal radius of IH95. They argue that the luminosity of Ursa Minor is 2.7 times larger than the value of IH95. Based on both

  16. Multimodal Interface Based on Novel HMI UI/UX for In‐Vehicle Infotainment System

    National Research Council Canada - National Science Library

    Kim, Jinwoo; Ryu, Jae Hong; Han, Tae Man

    2015-01-01

    We propose a novel HMI UI/UX for an in‐vehicle infotainment system. Our proposed HMI UI comprises multimodal interfaces that allow a driver to safely and intuitively manipulate an infotainment system while driving...

  17. Photometric activity of UX Ori stars and related objects in the near infrared and visual. BF Ori, CQ Tau, WW Vul, and SV Cep

    Science.gov (United States)

    Shenavrin, V. I.; Grinin, V. P.; Rostopchina-Shakhovskaja, A. N.; Demidova, T. V.; Shakhovskoi, D. N.

    2012-05-01

    We have analyzed the activity of four UX Ori stars in the near-IR ( JHKL) and visual ( V) using the results of long-term photometric observations. For comparison, we also obtained IR ( JHKLM) photometric observations of two visually quiet young stars of close spectral types (AB Aur and HD 190073). For the photometrically most active UX Ori stars BF Ori, CQ Tau, and WW Vul, the Algol-like declines of brightness in the visual, which are due to sporadic enhancements of the circumstellar extinction, are also observed (with decreasing amplitude) in the IR bands. A strict correlation between the V and J brightness variations is observed for all the stars except for SV Cep. For some of the UX Ori stars, a strong correlation between the visual and IR activity is observed up to L, where the main contribution to the emission is made by circumstellar dust. In the case of SV Cep, the visual variability is not correlated with the variability of the IR fluxes. On one occasion, a clear anti-correlation was even observed: a shallow, but prolonged decrease of the visual brightness was accompanied by an increase in the IR fluxes. This indicates that circumstellar clouds themselves can become powerful sources of IR emission. Our results provide evidence that the photometric activity of UX Ori stars is a consequence of instability of the deepest layers of their gas-dust accretion disks. In some cases (SV Cep), fluctuations of the density in this region are global, in the sense that they occur along a significant part of the circle marking the inner boundary of the dust disk. It is interesting that AB Aur, which is the quietest in the visual, appeared to be the most active in the IR. In contrast to UX Ori stars, the amplitude of its brightness variations increases from the J to the M band. It follows from analysis of the IR colors of this star that their variability cannot be described by models in which the variable IR emission has a temperature close to the sublimation temperature of

  18. Stellar Kinematics and Metallicities in the Draco and Ursa Minor Dwarf Spheroidal Galaxies from WHT/AF2-WYFFOS

    NARCIS (Netherlands)

    Jin, S.; Irwin, M.; Tolstoy, E.; Lewis, J.; Hartke, J.; Skillen, I.; Barcells, M.; Trager, S.

    2016-01-01

    We present preliminary results from our chemo-dynamical survey of two Milky Way dwarf spheroidal (dSph) galaxies, Draco and Ursa Minor. The two galaxies have similar radial velocities and reside in close proximity in the outskirts of the Milky Way halo, yet exhibit noteworthy differences in their

  19. Novel Technique for the UX15 Cavern Vault Support System

    CERN Document Server

    Rammer, H

    2000-01-01

    The overall LHC project schedule requires the civil engineering work to begin before the final LEP shutdown. The new caverns for the ATLAS experiment will be built in and around the existing underground structures at point 1. In order to make the best possible use of the time available for the LHC civil engineering before the shutdown of LEP, a particular arrangement for the construction of the UX15 cavern vault has been developed. The basic concept of this arrangement consists of the excavation of the cavern top heading and the installation of the concrete vault immediately afterwards, prior to the subsequent bench excavation after LEP shutdown. A temporary support of the dead weight of the concrete roof will be achieved by the suspension of the roof by 38 no. pre-stressed ground anchors of 225 tons capacity each. This support system will work up to the construction of the cavern base slab and walls and the completion of the permanent concrete lining.

  20. Spectroscopy and Doppler tomography of BZ Ursae Majoris in quiescence

    Science.gov (United States)

    Neustroev, V. V.; Medvedev, A.; Turbin, S.; Borisov, N. V.

    2002-01-01

    BZ UMa is a little-studied, very infrequently outbursting dwarf nova with mean intervals longer than 5.2 yr, whose orbital period has been determined as 97.8 minutes (Ringwald, Thorstensen, & Hamway 1994). BZ UMa was observed on January 8, 1995 using the SP-124 spectrograph of the 6-m telescope of the Special Astrophysical Observatory. A total of 39 spectra were taken in the wavelength range 3950--5000Å with a dispersion of 1.1Å channel. Individual exposure times were 200--300 s, the total duration of the observations was about 4.5 hours. The mean spectrum of BZ UMa at first sight is typical for cataclysmic variables (Fig. 1, top panel). However it is possible to detect some peculiarities. First of all we note unusual strong Balmer lines: we found equivalent widths and relative intensities for Hβ of more than 150Å and 7.5 respectively. Secondly, BZ UMa shows the triple-peaked lines profiles, which consist of the usual double-peaked profiles from an accretion disk, and of additional narrow component at the lines center (Fig. 1, bottom panel). The visibility of the latter improves from Hβ to Hɛ. The origin of this component is unclear. Key for understanding of nature of the emission source of the spike is the study of its radial velocities.

  1. Performance Evaluation and Comparison of the Fully Automated Urinalysis Analyzers UX-2000 and Cobas 6500.

    Science.gov (United States)

    Wesarachkitti, Bongkot; Khejonnit, Varanya; Pratumvinit, Busadee; Reesukumal, Kanit; Meepanya, Suriya; Pattanavin, Chanutchaya; Wongkrajang, Preechaya

    2016-05-01

    To evaluate and compare the performances of the automated urinalysis devices UX-2000 and Cobas 6500. A total of 258 urine specimens were collected from the routine specimen workload. We analyzed all specimens on both automated instruments and recorded the turnaround time from each method. Physical, chemical, and sedimentary urine components were compared between the automated and the manual method for each analyzer. The correlation of urine physical/chemical properties between the 2 instruments was excellent. The Cobas 6500 instrument demonstrated a higher level of agreement for red blood cells (Cobas 6500:R= 0.94; UX-2000:R= 0.78) and white blood cells (Cobas 6500:R= 0.95; UX-2000:R= 0.85). The UX-2000 demonstrated higher sensitivity for small round cells, hyaline casts, pathological casts, and bacteria. The median turnaround time was 1.5 minutes and 8.5 minutes for the Cobas 6500 and UX-2000, respectively. The 2 devices showed similar performance in technical evaluation; they each reduce workload and increase time saving. However, manual examination by technicians is recommended for pathological specimens. © American Society for Clinical Pathology, 2016. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  2. A T8.5 BROWN DWARF MEMBER OF THE {xi} URSAE MAJORIS SYSTEM

    Energy Technology Data Exchange (ETDEWEB)

    Wright, Edward L.; Mace, Gregory; McLean, Ian S. [UCLA Astronomy, P.O. Box 951547, Los Angeles, CA 90095-1547 (United States); Skrutskie, M. F.; Nelson, M. J.; Borish, H. J. [Department of Astronomy, University of Virginia, Charlottesville, VA 22904 (United States); Kirkpatrick, J. Davy; Gelino, Christopher R.; Griffith, Roger L.; Jarrett, Tom [Infrared Processing and Analysis Center, California Institute of Technology, Pasadena, CA 91125 (United States); Marsh, Kenneth A. [School of Physics and Astronomy, Cardiff University, Cardiff CF243AA (United Kingdom); Mainzer, Amanda K.; Eisenhardt, Peter R. [Jet Propulsion Laboratory, California Institute of Technology, 4800 Oak Grove Drive, Pasadena, CA 91109-8001 (United States); Tobin, John J. [National Radio Astronomy Observatory, Charlottesville, VA 22903 (United States); Cushing, Michael C., E-mail: wright@astro.ucla.edu [Department of Physics and Astronomy, MS 111, University of Toledo, 2801 W. Bancroft St., Toledo, OH 43606-3328 (United States)

    2013-03-15

    The Wide-field Infrared Survey Explorer has revealed a T8.5 brown dwarf (WISE J111838.70+312537.9) that exhibits common proper motion with a solar-neighborhood (8 pc) quadruple star system-{xi} Ursae Majoris. The angular separation is 8.'5, and the projected physical separation is Almost-Equal-To 4000 AU. The sub-solar metallicity and low chromospheric activity of {xi} UMa A argue that the system has an age of at least 2 Gyr. The infrared luminosity and color of the brown dwarf suggests the mass of this companion ranges between 14 and 38 M{sub J} for system ages of 2 and 8 Gyr, respectively.

  3. Manganese spread in Ursa Minor as a proof of sub-classes of type Ia supernovae

    Science.gov (United States)

    Cescutti, G.; Kobayashi, C.

    2017-10-01

    Context. Recently, new sub-classes of Type Ia supernovae (SNe Ia) were discovered, including SNe Iax. The suggested progenitors of SNe Iax are relatively massive, possibly hybrid C+O+Ne white dwarfs, which can cause white dwarf winds at low metallicities. There is another class that can potentially occur at low or zero metallicities; sub-Chandrasekhar mass explosions in single and/or double degenerate systems of standard C+O white dwarfs. These explosions have different nucleosynthesis yields compared to the normal, Chandrasekhar mass explosions. Aims: We test these SN Ia channels using their characteristic chemical signatures. Methods: The two sub-classes of SNe Ia are expected to be rarer than normal SNe Ia and do not affect the chemical evolution in the solar neighbourhood; however, because of the shorter delay time and/or weaker metallicity dependence, they could influence the evolution of metal-poor systems. Therefore, we have included both in our stochastic chemical evolution model for the dwarf spheroidal galaxy Ursa Minor. Results: The model predicts a butterfly-shape spread in [Mn/Fe] in the interstellar medium at low metallicity and - at the same time - a decrease of [α/Fe] ratios at lower [Fe/H] than in the solar neighbourhood, both of which are consistent with the observed abundances in stars of Ursa Minor. Conclusions: The surprising agreement between our models and available observations provides a strong indication of the origins of these new sub-classes of SNe Ia. This outcome requires confirmation by future abundance measurements of manganese in stars of other satellite galaxies of our Milky Way. It will be vital for this project to measure not the most extreme metal-poor tail, as more commonly happens, but the opposite; the metal-rich end of dwarf spheroidals.

  4. The UX Book Process and Guidelines for Ensuring a Quality User Experience

    CERN Document Server

    Hartson, Rex

    2012-01-01

    This is a comprehensive textbook on designing interaction to ensure a quality user experience. Combining breadth, depth, and practical applications, this book takes a time-tested process-and-guidelines approach that provides readers with actionable methods and techniques while retaining a firm grounding in HCI concepts and theory. The authors will guide you through the UX lifecycle process, including contextual inquiry and analysis, requirements extraction, design ideation and creation, practical design production, prototyping, and UX evaluation. Development activities are linked via handof

  5. Compressible dynamic stall vorticity flux control using a dynamic ...

    Indian Academy of Sciences (India)

    Consequently, the leading edge vorticity flux was redistributed enabling retention of the dynamic lift. Of even greater importance was the fact that the drag and pitching moment coefficients were reduced by nearly 50%. The camber variations introduced when the leading edge was drooped are explained to be the source of ...

  6. UX Design Innovation: Challenges for Working with Machine Learning as a Design Material

    DEFF Research Database (Denmark)

    Dove, Graham; Halskov, Kim; Forlizzi, Jodi

    2017-01-01

    Machine learning (ML) is now a fairly established technology, and user experience (UX) designers appear regularly to integrate ML services in new apps, devices, and systems. Interestingly, this technology has not experienced a wealth of design innovation that other technologies have, and this might...

  7. High-Resolution Near-Infrared Polarimetry of a Circumstellar Disk around UX Tau A

    Science.gov (United States)

    Tanii, Ryoko; Itoh, Yoichi; Kudo, Tomoyuki; Hioki, Tomonori; Oasa, Yumiko; Gupta, Ranjan; Sen, Asoke K.; Wisniewski, John P.; Muto, Takayuki; Grady, Carol A.; Hashimoto, Jun; Fukagawa, Misato; Mayama, Satoshi; Hornbeck, Jeremy; Sitko, Michael L.; Russell, Ray W.; Werren, Chelsea; Curé, Michel; Currie, Thayne; Ohashi, Nagayoshi; Okamoto, Yoshiko; Momose, Munetake; Honda, Mitsuhiko; Inutsuka, Shu-ichi; Takeuchi, Taku; Dong, Ruobing; Abe, Lyu; Brandner, Wolfgang; Brandt, Timothy D.; Carson, Joseph; Egner, Sebastian E.; Feldt, Markus; Fukue, Tsubasa; Goto, Miwa; Guyon, Olivier; Hayano, Yutaka; Hayashi, Masahiko; Hayashi, Saeko S.; Henning, Thomas; Hodapp, Klaus W.; Ishii, Miki; Iye, Masanori; Janson, Markus; Kandori, Ryo; Knapp, Gillian R.; Kusakabe, Nobuhiko; Kuzuhara, Masayuki; Matsuo, Taro; McElwain, Michael W.; Miyama, Shoken; Morino, Jun-ichi; Moro-Martín, Amaya; Nishimura, Tetsuro; Pyo, Tae-Soo; Serabyn, Eugene; Suto, Hiroshi; Suzuki, Ryuji; Takami, Michihiro; Takato, Naruhisa; Terada, Hiroshi; Thalmann, Christian; Tomono, Daigo; Turner, Edwin L.; Watanabe, Makoto; Yamada, Toru; Takami, Hideki; Usuda, Tomonori; Tamura, Motohide

    2012-12-01

    We present H-band polarimetric imagery of UX Tau A taken with HiCIAO/AO188 on the Subaru Telescope. UX Tau A has been classified as a pre-transitional disk object, with a gap structure separating its inner and outer disks. Our imagery taken with the 0.''15 (21 AU) radius coronagraphic mask has revealed a strongly polarized circumstellar disk surrounding UX Tau A, which extends to 120 AU, at a spatial resolution of 0.''1 (14 AU). It is inclined by 46° ± 2°, since the west side is nearest. Although SED modeling and sub-millimeter imagery have suggested the presence of a gap in the disk, with the inner edge of the outer disk estimated to be located at 25-30 AU, we detect no evidence of a gap at the limit of our inner working angle (23 AU) at the near-infrared wavelength. We attribute the observed strong polarization (up to 66%) to light scattering by dust grains in the disk. However, neither polarization models of the circumstellar disk based on Rayleigh-scattering nor Mie-scattering approximations were consistent with the observed azimuthal profile of the polarization degrees of the disk. Instead, a geometric optics model of the disk with nonspherical grains with radii of 30μm is consistent with the observed profile. We suggest that the dust grains have experienced frequent collisional coagulations, and have grown in the circumstellar disk of UX Tau A.

  8. Compensation of the ux modulation distortion using an additional coil in a loudspeaker unit

    DEFF Research Database (Denmark)

    Antonello, Niccoló; Agerkvist, Finn T.

    2014-01-01

    the compensation coil is de- rived. The compensation technique consists on feeding the compensation coil and voice coil with ltered versions of the wanted audio signal. Simulations show that a signicant reduction in ux modulation distor- tion can be achieved with this technique. A simple magnetic circuit has been...

  9. High-Resolution Near-Infrared Polarimetry of a Circumstellar Disk around UX Tau A

    Science.gov (United States)

    Serabyn, G.; Grady, C. A.; Currie, T.

    2012-01-01

    We present H-band polarimetric imagery of UX Tau A taken with HiCIAO/AO188 on the Subaru Telescope. UX Tau A has been classified as a pre-transitional disk object, with a gap structure separating its inner and outer disks. Our imagery taken with the 0.15" (21 AU) radius coronagraphic mask has revealed a strongly polarized circumstellar disk surrounding UX Tau A which extends to 120 AU, at a spatial resolution of 0.1" (14 AU). It is inclined by 46 degrees plus or minus 2 degrees as the west side is nearest. Although SED modeling and sub-millimeter imagery suggested the presence of a gap in the disk, with the inner edge of the outer disk estimated to be located at 25 - 30 AU, we detect no evidence of a gap at the limit of our inner working angle (23AU) at the near-infrared wavelength. We attribute the observed strong polarization (up to 66 %) to light scattering by dust grains in the disk. However, neither polarization models of the circumstellar disk based on Rayleigh scattering nor Mie scattering approximations were consistent with the observed azimuthal profile of the polarization degrees of the disk. Instead, a geometric optics model of the disk with nonspherical grains with the radii of 30 micrometers is consistent with the observed profile. We suggest that the dust grains have experienced frequent collisional coagulations and have grown in the circumstellar disk of UX Tau A.

  10. OAO/MITSuME Photometry of Dwarf Novae. I. SU Ursae Majoris

    Science.gov (United States)

    Imada, Akira; Izumiura, Hideyuki; Kuroda, Daisuke; Yanagisawa, Kenshi; Omodaka, Toshihiro; Miyanoshita, Ryo; Kawai, Nobuyuki; Nogami, Daisaku

    2013-08-01

    We report on simultaneous g', and Rc photometry of SU Ursae Majoris during 2011 December-2012 February using OAO/MITSuME. Our photometry revealed that quiescence is divided into three types based on the magnitude and color. Quiescent light curves showed complicated profiles with various amplitudes and time scales. Although no superoutbursts were observed during our run, five normal outbursts occurred with intervals of 11-21 d. The shapes of the normal outbursts were characteristic of the outside-in type. During the rising phase of a normal outburst, the light curve showed periodic modulations with a period of ˜ 0.048111(354) d, but the origin of this peirod was unclear. We examined daily averaged color-color diagrams, and found that two cycles exist. This implies that the thermal limit cycle in SU UMa is complicated. We newly discovered that g' - Rc becomes red about 3 days prior to an outburst. Although the working mechanism on this reddening is unclear, we propose two possibilities: one is that the inner portion of the accretion disk is filled by matter and obscures the central white dwarf; the other is that the stagnation effect works in the outer region of the accretion disk.

  11. Storytelling and a narrative analysis based method for extracting users´ motives in UX design processes

    OpenAIRE

    Pucillo, Francesco; Michailidou, Ioanna; Cascini, Gaetano; Lindemann, Udo

    2014-01-01

    Users’ emotions are crucial for purchasing decisions. Designing products that evoke positive emotions requires knowledge about users and their psychological needs: the research on User Experience (UX) aims at creating such knowledge. Several UX researchers highlighted that positive emotions emerge in user/product interactions, when user’s psychological motives and needs are met and her/his expectations fulfilled or exceeded. How can users’ motives be acquired? User research in industrial prac...

  12. URSA MAIOR: a One Liter Nanosatellite Bus for Low Cost Access to Space

    Science.gov (United States)

    Santoni, F.

    One of the main limitations in the access to space for developing countries is the economical effort typically required by space missions. Secondly, space activity is a field of very high technology, requiring technical skills, education and practice, at a level which is seldom reached by developing countries. Interventions aimed to facilitate access to space for developing countries should be focussed primarily on the missions allowing access to space at reasonable cost. Moreover, perhaps more importantly, they should emphasize conducting the mission design, construction, ground testing and operation in orbit as an open activity, accessible to developing countries personnel, in order to set up an education process, which is not just selling a product ready satellite. Universities could have a very important role in this activity. Many Universities around the world have designed, built and launched small satellites. Università di Roma "La Sapienza" set up a program for the construction of small satellites in an academic environment, involving directly the students in the design, construction, ground testing and operation in orbit. The first satellite built in the framework of this program, UNISAT, was successfully launched in September 2000. The second, UNISAT-2, initially scheduled for launch in 2001, has been delayed by the launch provider to late 2002. These two satellites, based on a modular design, emphasizing ease of construction and assembly, weight roughly 10 kg. The realization of these satellites was made possible within the regular financing given to university research programs, keeping down cost by the use of commercial off the shelf components instead of space rated ones. The microsatellite experience at Università di Roma "La Sapienza", is going further with the development of a new nanosatellite bus, URSA MAIOR (Università di Roma "la SApienza" Micro Autonomous Imager in ORbit), aiming at cutting down cost and possibly improving performance. The

  13. Early Development of Refl ux Esophagitis after Successful Helicobacter Pylori Eradication in Superfi cial Gastritis

    Directory of Open Access Journals (Sweden)

    H H Jeon

    2011-10-01

    Full Text Available The relationship between gastroesophageal refl ux disease (GERD and Helicobacter pylori (H. pylori eradication is still debated. Recently, we had a patient of GERD who had developed it shortly after H. pylori eradication therapy. A 72-year-old man was diagnosed by endoscopy as suffering from severe superfi cial gastritis in the stomach body. A rapid urease test showed H. pylori infection. He was then started on proton pump inhibitor (PPI based therapy for two weeks eradicating H.pylori. After completion of H. pylori eradication, he complained of a heart-burn sensation. Follow-up endoscopy showed refl ux esophagitis, of grade B according to the Los Angeles classifi cation. Since the patient had developed GERD after completion of the triple therapy, their suggests that H. pylori eradication must have triggered the development of de novo GERD after a short period of time. Keywords: GERD, Helicobacter pylori, PPI.

  14. When nearing the ATLAS cavern UX15 through RB16: the TX1S shielding

    CERN Multimedia

    Maximilien Brice

    2003-01-01

    Photo 01: 52 tons of ATLAS TX1S shielding with bare hands. Photos 02,03,04: Installation of the second TX1S shielding tube at Point Photos 05,06: Positioning of TX1S shielding, the first ATLAS/LHC interface component to be installed underground. Photo 07: Final adjustment of the TX1S shielding tube at the interface between the LHC tunnel and the ATLAS cavern (UX15).

  15. Similarities and differences in the spectral behavior of W Ser and UX Mon in the ultraviolet

    Science.gov (United States)

    Sanad, M. R.; Bobrowsky, M.

    2013-04-01

    We present ultraviolet spectra of two eclipsing interacting binary systems, W Ser and UX Mon, with good coverage over the 14.16-day and 5.9-day orbital periods, respectively, using observations taken by the International Ultraviolet Explorer ( IUE) during the period between 1978-1993 and 1981-1991. Two profiles of W Ser and UX Mon showing variations of line fluxes at two orbital phases are presented. This paper focuses on the N V emission line at 1240 Å, C II emission line at 1336 Å, C IV emission line at 1550 Å, O III emission line at 1666 Å and the Si III emission line at 1892 Å, produced in an extended gaseous envelope around the mass-gaining component by calculating spectral line fluxes. Our results show that there are variations of line fluxes with time, similar to the light curves found for both W Ser and UX Mon. We attribute these spectral variations to eclipse effects and to variations in the mass transfer rate. These results from the IUE observations support the thick disk model around the primary star in which variations of mass transfer affect the observed radiation from the gaseous envelope around the hot star. Future, high-resolution imaging is recommended to confirm the inferred asymmetrical circumstellar envelopes.

  16. Thermophysical and anion diffusion properties of (Ux,Th1−x)O2

    Science.gov (United States)

    Cooper, Michael W. D.; Murphy, Samuel T.; Fossati, Paul C. M.; Rushton, Michael J. D.; Grimes, Robin W.

    2014-01-01

    Using molecular dynamics, the thermophysical properties of the (Ux,Th1−x)O2 system have been investigated between 300 and 3600 K. The thermal dependence of lattice parameter, linear thermal expansion coefficient, enthalpy and specific heat at constant pressure is explained in terms of defect formation and diffusivity on the oxygen sublattice. Vegard's law is approximately observed for solid solution thermal expansion below 2000 K. Different deviations from Vegard's law above this temperature occur owing to the different temperatures at which the solid solutions undergo the superionic transition (2500–3300 K). Similarly, a spike in the specific heat, associated with the superionic transition, occurs at lower temperatures in solid solutions that have a high U content. Correspondingly, oxygen diffusivity is higher in pure UO2 than in pure ThO2. Furthermore, at temperatures below the superionic transition, oxygen mobility is notably higher in solid solutions than in the end members. Enhanced diffusivity is promoted by lower oxygen-defect enthalpies in (Ux,Th1−x)O2 solid solutions. Unlike in UO2 and ThO2, there is considerable variety of oxygen vacancy and oxygen interstitial sites in solid solutions generating a wide range of property values. Trends in the defect enthalpies are discussed in terms of composition and the lattice parameter of (Ux,Th1−x)O2. PMID:25383028

  17. 19a-hydroxy-3-oxo-ursa-1,12-dien-28-oic acid, an antiplasmodial triterpenoid isolated from Canthium multiflorum

    DEFF Research Database (Denmark)

    Traore, Maminata; Ziegler, Hanne Lindvig; Olsen, C Erik

    2009-01-01

    A bioactivity guided fractionation of roots of Canthium multiflorum led to the isolation of the new ursenoic acid derivative 19alpha-hydroxy-3-oxo-ursa-1,12-dien-28-oic acid (1), which showed antiplasmodial effect without inducing change of the shape of membranes of erythrocytes....

  18. Chronic Asthma and Gastro-Esophageal Reflux Disease: The Treatment Plans

    Directory of Open Access Journals (Sweden)

    Leila Ghofraniha

    2015-09-01

    Full Text Available Gastro-esophageal reflux disease (GERD regularly occurs when stomach acid moves up from the stomach into the esophagus. GERD might be associated with chronic asthma symptoms such as coughing and breathlessness. According to several studies on children and adults, GERD is proven to have a close relationship with asthma.  Medication treatment via proton-pump inhibitors (PPIs, such as Omeprazole, H2 receptor blockers (Ranitidine, and other antireflux medications, is appropriate for ameliorating GERD and asthma. Moreover, surgery is another useful approach to GERD and asthma treatment. In this regard, Nissen fundoplication (laparoscopic is a principal surgery method. Medical and surgical antireflux therapies are recognized as effective methods in the treatment of GERD-associated asthma. Our  review included studies that evaluated treatment of GERD-associated asthma. These studies accentuated the critical role of acid reflux suppression in relieving the patients suffering from a difficult to control asthma.

  19. User Experience (Ux sebagai Bagian dari Pemikiran Desain dalam Pendidikan Tinggi Desain Komunikasi Visual

    Directory of Open Access Journals (Sweden)

    Mendiola B. Wiryawan

    2011-10-01

    Full Text Available Digital world, internet and mobile have made communication does not move in one way anymore. Visual Communication as a part of Communication recently is going to be more personal, segmented, interactive, user-generated content, accessible and available in huge quantities. In the positive side, users have more options to receive or to respond communication signals according to his/her needs and wants. In opposite, now everybody gets information clutter caused by unbalanced information between what we can received and what we can digested. For that reason we need method to study the people as an object of our communication. Learning user experience concept make us understand more about our object insight. The aim of this paper is to review principles that used in UX study. In the future we expect this discourse will be assesed and used in a design thinking method and developed in visual communication design institution. Research method used in this paper is based on literatural studies. Understanding of UX will help designers developing design that can be effectively communicate with their segement.  

  20. Accuracy Investigation of Creating Orthophotomaps Based on Images Obtained by Applying Trimble-UX5 UAV

    Science.gov (United States)

    Hlotov, Volodymyr; Hunina, Alla; Siejka, Zbigniew

    2017-06-01

    The main purpose of this work is to confirm the possibility of making largescale orthophotomaps applying unmanned aerial vehicle (UAV) Trimble- UX5. A planned altitude reference of the studying territory was carried out before to the aerial surveying. The studying territory has been marked with distinctive checkpoints in the form of triangles (0.5 × 0.5 × 0.2 m). The checkpoints used to precise the accuracy of orthophotomap have been marked with similar triangles. To determine marked reference point coordinates and check-points method of GNSS in real-time kinematics (RTK) measuring has been applied. Projecting of aerial surveying has been done with the help of installed Trimble Access Aerial Imaging, having been used to run out the UX5. Aerial survey out of the Trimble UX5 UAV has been done with the help of the digital camera SONY NEX-5R from 200m and 300 m altitude. These aerial surveying data have been calculated applying special photogrammetric software Pix 4D. The orthophotomap of the surveying objects has been made with its help. To determine the precise accuracy of the got results of aerial surveying the checkpoint coordinates according to the orthophotomap have been set. The average square error has been calculated according to the set coordinates applying GNSS measurements. A-priori accuracy estimation of spatial coordinates of the studying territory using the aerial surveying data have been calculated: mx=0.11 m, my=0.15 m, mz=0.23 m in the village of Remeniv and mx=0.26 m, my=0.38 m, mz=0.43 m in the town of Vynnyky. The accuracy of determining checkpoint coordinates has been investigated using images obtained out of UAV and the average square error of the reference points. Based on comparative analysis of the got results of the accuracy estimation of the made orthophotomap it can be concluded that the value the average square error does not exceed a-priori accuracy estimation. The possibility of applying Trimble UX5 UAV for making large

  1. Accuracy Investigation of Creating Orthophotomaps Based on Images Obtained by Applying Trimble-UX5 UAV

    Directory of Open Access Journals (Sweden)

    Hlotov Volodymyr

    2017-06-01

    Full Text Available The main purpose of this work is to confirm the possibility of making largescale orthophotomaps applying unmanned aerial vehicle (UAV Trimble- UX5. A planned altitude reference of the studying territory was carried out before to the aerial surveying. The studying territory has been marked with distinctive checkpoints in the form of triangles (0.5 × 0.5 × 0.2 m. The checkpoints used to precise the accuracy of orthophotomap have been marked with similar triangles. To determine marked reference point coordinates and check-points method of GNSS in real-time kinematics (RTK measuring has been applied. Projecting of aerial surveying has been done with the help of installed Trimble Access Aerial Imaging, having been used to run out the UX5. Aerial survey out of the Trimble UX5 UAV has been done with the help of the digital camera SONY NEX-5R from 200m and 300 m altitude. These aerial surveying data have been calculated applying special photogrammetric software Pix 4D. The orthophotomap of the surveying objects has been made with its help. To determine the precise accuracy of the got results of aerial surveying the checkpoint coordinates according to the orthophotomap have been set. The average square error has been calculated according to the set coordinates applying GNSS measurements. A-priori accuracy estimation of spatial coordinates of the studying territory using the aerial surveying data have been calculated: mx=0.11 m, my=0.15 m, mz=0.23 m in the village of Remeniv and mx=0.26 m, my=0.38 m, mz=0.43 m in the town of Vynnyky. The accuracy of determining checkpoint coordinates has been investigated using images obtained out of UAV and the average square error of the reference points. Based on comparative analysis of the got results of the accuracy estimation of the made orthophotomap it can be concluded that the value the average square error does not exceed a-priori accuracy estimation. The possibility of applying Trimble UX5 UAV for making

  2. Antiferromagnetism, crystal fields and hybridisation in UxY1-xPd3 studied by neutron scattering

    DEFF Research Database (Denmark)

    Bull, M.J.; McEwen, K.A.; Eccleston, R.S.

    1999-01-01

    We summarise our UxY1-xPd3 inelastic neutron scattering experiments and present new neutron diffraction results for a single crystal of U0.45Y0.55Pd3. Long-range antiferromagnetic order is unambiguously observed below T-N = 22.5 K. in contrast, no long-range order is found in polycrystalline...

  3. Neutron diffraction and TSDC on Ba1−xUxF2+2x solid electrolytes

    DEFF Research Database (Denmark)

    Ouwerkerk, M.; Andersen, N. H.; Veldkamp, F. F.

    1986-01-01

    The defect structure of fluorite-type Ba1−xUxF2+2x solid solutions, which exhibit fast fluoride ion conductivity, has been investigated by quasi-elastic diffuse neutron scattering (QDNS) experiments, and thermally stimulated depolarisation current (TSDC) measurements. A comparison with model...

  4. UriSed 3 and UX-2000 automated urine sediment analyzers vs manual microscopic method: A comparative performance analysis.

    Science.gov (United States)

    Laiwejpithaya, Sathima; Wongkrajang, Preechaya; Reesukumal, Kanit; Bucha, Chonticha; Meepanya, Suriya; Pattanavin, Chanutchaya; Khejonnit, Varanya; Chuntarut, Achara

    2017-05-02

    Fully automated urine analyzers now play an important role in routine urinalysis in most laboratories. The recently introduced UriSed 3 has a new automated digital imaging urine sediment analyzer with a phase contrast feature. The aim of this study was to compare the performance of the UriSed 3 and UX-2000 automated urine sediment analyzers with each other and with the results of the manual microscopic method. Two hundred seventy-seven (277) samples of leftover fresh urine from our hospital's central laboratory were evaluated by two automated urine sediment analyzers-UriSed 3 and UX-2000. The results of urine sediment analysis were compared between the two automated analyzers and against the results of the manual microscopic method. Both devices demonstrated excellent agreement for quantitative measurement of red blood cells and white blood cells. UX-2000 had a lower coefficient correlation and demonstrated slightly lower agreement for squamous epithelial cells. Regarding semiquantitative analysis, both machines demonstrated very good concordance, with all applicable rates within one grade difference of the other machine. UriSed 3 had higher sensitivity for small round cells, while UX-2000 showed greater sensitivity for detecting bacteria and hyaline casts. UriSed 3 demonstrated slightly better specificity, especially in the detection of hyaline and pathological casts. Both instruments had nearly similar performance for red blood cells and white blood cells measurement. UriSed 3 was more reliable for measuring squamous epithelial cells and small round cells, while the UX-2000 was more accurate for detecting bacteria and hyaline casts. © 2017 Wiley Periodicals, Inc.

  5. Photometric and spectroscopic monitoring of AA Tau, DN Tau, UX Tau A, T Tau, RY Tau, Lk Ca 4, and Lk Ca 7

    Science.gov (United States)

    Vrba, F. J.; Chugainov, P. F.; Weaver, W. B.; Stauffer, J. S.

    1993-01-01

    We report the results of a UBVRI photometric monitoring campaign for three classical T Tauri stars (AA Tau, DN Tau, and UX Tau A) and two weak emission line T Tauri stars (Lk Ca 4 and Lk Ca 7). Observations were obtained at three sites during a core observing period spanning UT 1985 October 14 through UT 1985 December 25, with additional observations continuing until UT 1986 April 6. Concurrent spectrophotometric observations were obtained for all main program stars except Lk Ca 7 and additionally for T Tau, RW Aur, and RY Tau. Periodic photometric variability, assumed to be the stars' rotation periods, were found for AA Tau, DN Tau, Lk Ca 4, and Lk Ca 7, respectively, as 8.2, 6.3, 3.4, and 5.7 days. Several U-filter flares were observed for Lk Ca 4 and Lk Ca 7, which are strongly concentrated toward phases of minimum light. Correlations are found between H-alpha line strengths and V magnitudes for AA Tau and RY Tau. An analysis of absolute color variations of classical T Tauri stars confirms that hot spots are the predominant cause of these stars' variability. Our overall results are consistent with earlier findings that long-lived cool spots are responsible for most of the variability found for weak-emission T Tauri stars, while temporal hot spots are primarily responsible for the observed variability found in classical T Tauri stars.

  6. White dwarfs in cataclysmic variables - Low state IUE observations of V794 Aquilae, MR Serpentis, and AN Ursae Majoris

    Science.gov (United States)

    Szkody, Paula; Mateo, Mario; Downes, Ronald

    1988-01-01

    IUE low-dispersion observations of one novalike system (V794 Aql) and two AM Her systems (MR Ser and AN UMa) during low or intermediate-low accretion-rate states are reported. The decreased UV emission during these times was used to place limits on the white dwarf temperatures. When these results are added to the existing data on white dwarf temperatures, it appears that the white dwarfs in systems with normal high accretion rates and only occasional low-accretion-rate states remain hotter than the white dwarfs in systems with low average accretion rates.

  7. Design and construction of the tensioned ties for UX15 cavern vault

    CERN Document Server

    Parkin, R J H

    2002-01-01

    Due to the programme constraints for the UX15 cavern set by CERN, it has been necessary to complete the concrete lining of the vault prior to the excavation of the bench. The vault lining is therefore being temporarily suspended from a number of pre-tensioned high capacity multi-strand tensioned ties. During excavation of the bench, additional loads will be imposed onto the vault lining due to ground displacements. In order to minimise the number of ties, the previously completed linings of the PX14 and PX16 access shafts will be used to support some of the load. Three-dimensional modelling has been undertaken to design the structures and determine the expected behaviour of this complex support system. Geotechnical instrumentation has been installed in the concrete linings and the ground to monitor loads and displacements during construction. After the cavern walls have been completed, the ties will be released.

  8. Three-Component Model of Spottedness in the Classical RS CVn System UX Ari

    Science.gov (United States)

    Alekseev, I. Yu.

    2014-09-01

    It is shown that the hypothesis of a complex (cold spots and hot flares) structure for the active regions on UX Ari reproduces well the photometric behavior of the star. According to the model the spots are colder than the quiescent atmosphere at 1300 K, while the flares are hotter than the photosphere at 750 K. These estimates are in good agreement with Doppler mapping of the star, with calculations of its photometric behavior, and with observations of OH molecular bands. The effective area of the spotted regions approaches half the total surface of the star. Our estimates show that the flares form about a third of the spotted area. The time variation in the star's brightness and in the effective area of the spots is probably cyclical with a characteristic time of 8-9 years. The switching of the active latitudes shows no obvious cyclicity.

  9. Clinical and functional features of gastroesophageal refl ux disease in children and adolescents

    Directory of Open Access Journals (Sweden)

    L. M. Boyarska

    2012-04-01

    Full Text Available The aim of our work was to study clinical and endoscopic peculiarities, infl uence of H.Pylori infection and gastric acidity on changes of mucosa of the esophagus in children and adolescents with gastroesophageal refl ux disease (GERD. 140 children (93 with GERD: 48.4% – children with oesophagitis, 51.6% – children with endoscopically negative form of GERD were examinated. Main complaints of heartburn were in 79,6% patients. Frequency and intensity of heartburn did not depend on oesophagitis presence. The correlation between frequency and severity of heartburn and endoscopic changes wasn’t detected. Esophageal endoscopic changes were combined with moderate infl ammation signs of stomach and duodenum. The correlation between H.Pylori and GERD wasn’t detected. According to acidometry data hyperacid state in stomach prevailed.

  10. Quantitative comparison of Zeiss-Humphrey model 840 and Rion UX-02 systems of ultrasound biomicroscopy.

    Science.gov (United States)

    Kobayashi, H; Kobayashi, K

    1999-05-01

    Our objective was to estimate the agreement between two different ultrasound biomicroscopes (UBMs) and to evaluate the clinical implications of the measurements obtained. We measured the anterior chamber depth, trabecular-iris angle, angle opening distance at 250 and 500 microm from the scleral spur, iris thickness and scleral-iris angle using the Humphrey UBM model 840 and Rion UBM UX-02 in 25 eyes of 25 normal volunteers. No significant difference was found in the mean values of any parameters measured by the Humphrey and Rion systems. Correlation coefficients of greater than 90% were observed for the parameters studied. Each system showed high reproducibility for all measured parameters. There were significant differences between the two systems in coefficients of variation for all parameters measured except the anterior chamber depth. The parameters measured with the Humphrey and Rion systems showed correlation coefficients of greater than 90%. The Humphrey system showed better reproducibility than the Rion system.

  11. IUE spectra of a flare in the RS Canum Venaticorum-type system UX Arietis

    Science.gov (United States)

    Simon, T.; Linsky, J. L.; Schiffer, F. H., III

    1980-01-01

    IUE spectra of UX Ari obtained during the large flare of 1979 January 1 exhibit chromospheric and transition-region emission-line fluxes about 2.5 and 5.5 times brighter than quiescent fluxes, respectively, and up to 1400 times brighter than the quiet sun. A high-dispersion spectrum of the 2000-3000 A region exhibits enhanced Fe II emission, which is probably associated mainly with the K0 IV star, and enhanced Mg II emission with asymmetric wings extending to +475 km/s. These line wings are interpreted as evidence for mass flow from the K0 IV star to the G5 V star. A speculative scenario of major long-lived RS CVn flares is proposed in which the component stars have very large corotating flux tubes, which occasionally interact. Magnetic reconnection results in flux tubes that temporarily connect the two stars.

  12. Redesign uživatelského rozhraní webové aplikace vycházející z principů UX designu

    OpenAIRE

    Fröhlichová, Karin

    2017-01-01

    This bachelor thesis deals with the redesign of the web application user interface based on the principles of UX design. The theoretical part is focused on defining the concept of user experience (UX), as well as the sub-disciplines involved in the creation of user interface (UI), which together creates the resulting user experience. The aim of the theoretical part is to describe the individual steps of the selected procedure of the UX design process based on the principles of user-centered d...

  13. Variables for probing neutrino oscillation at super-Kamiokande and ...

    Indian Academy of Sciences (India)

    2015-11-27

    Nov 27, 2015 ... We propose several new variables, insensitive to the absolute flux of the incident solar or supernova neutrino beam, which probe the shape of the observed spectrum at super-Kamiokande and Sudbury Neutrino Observatory experiments and can sensitively signal neutrino oscillations. One class of such ...

  14. VLBI observations of the RS Canum Venaticorum binary systems UX Arietis and HR 1099 at 1.65 GHz

    Science.gov (United States)

    Mutel, R. L.; Doiron, D. J.; Phillips, R. B.; Lestrade, J. F.

    1984-01-01

    VLBI observations of the RS CVn binaries UX Arietis and HR 1099 have been made at 1.65 GHz using a three-element array with a minimum fringe spacing of 11.5 milli-arcsec. Both sources were found to be unresolved within measurement uncertainties. In both cases, the derived upper limit to the source size was comparable to the overall size of each binary system. The lower limits to the brightness temperature were 1.4 x 10 to the 10th K for UX Arietis and 2.9 x 10 to the 10th K for HR 1099. Simultaneous polarization measurements at the VLA showed 4-8 percent circular polarization and less than 2 percent linear polarization. It is found that the data are consistent with gyrosynchrotron emission from a power-law energy distribution of electrons in a magnetic field B less than or approximately equal to 6 gauss.

  15. UV-B and B-band Optical Flare Search in AR Lacertae, II Pegasi, and UX Arietis Star Systems

    Science.gov (United States)

    Vander Haagen, G. A.

    2013-11-01

    A high-cadence search was conducted on the known RS CVn-type flare stars AR Lac, II Peg, and UX Ari. Two optical flares were observed in the B-band on AR Lac at 5 milliseconds (ms) resolution for a rate of 0.04 fl/hr. Flare energy of the two B-band fast-flares ranged from 0.55 to 16.7 × 1033 ergs. The UV-B and B-band search of II Peg for 44.5 hours at 5 and 10 ms resolution and UV-B band search of UX Ari for 25.6 hours at 10 ms resolution detected no flare activity.

  16. Using physiological measures in conjunction with other UX approaches for better understanding of the player's gameplay experiences

    OpenAIRE

    Mirza-Babaei, Pejman

    2011-01-01

    The goal of video games is to challenge and entertain the players. Successful video games deliver experience that impact players on a level of arousal. Therefore undertaking a user experience (UX) study is crucial to ensure that a game achieves both critical and financial success. However, traditional usability methods (observation, subjective reporting, questionnaire, and interview) have a number of limitations on game user research. In this study we capture player's physiological measures d...

  17. Initial Evaluation of the Intelligent Multi-UxV Planner with Adaptive Collaborative/Control Technologies (IMPACT)

    Science.gov (United States)

    2017-02-17

    free to respond to commander and sensor operator requests with the play (called with the modality of their choice) they felt best achieved the...UAV to Point Charlie and to instruct other UxVs to go highly mobile in response to a patrol reporting smoke at Point Charlie. 5. Operator receives a...Control Research and Technology Symposium (ICCTRS) Conference, Quebec City , Canada. 37 DISTRIBUTION STATEMENT A. Approved for public release

  18. Exploring organisational competences in Human Factors and UX project work: managing careers, project tactics and organisational strategy.

    Science.gov (United States)

    Furniss, Dominic; Curzon, Paul; Blandford, Ann

    2017-12-01

    Organisational competence in Human Factors and UX (user experience) has not been looked at before despite its relevance to project success. We define organisational competence as the collective competence of the individuals, bringing together their complementary abilities to deliver an outcome that is typically more than the sum of its parts. Twenty-two UX and Human Factors practitioners were interviewed about their project work in two contrasting domains: web design and safety-critical systems to explore organisational competences. Through doing a FRAM analysis, 29 functions and 6 main areas of competences were identified: the central project process; the process of learning about the problem; maintaining and developing client relations; staff development; evolving practices; and the management of documentation for audit and quality control. These dynamic and situated competences form a web of interactions. Managing competences is essential for project success. Implications for managing careers, project tactics and organisational strategy are discussed. Practitioner Summary: Organisational competences impact how routine and non-routine project work is performed, but these have received little attention in the literature. Six key areas of competences in Human Factors and UX project work were identified from practitioner interviews. Managing combinations of adaptive competences is important for developing careers, project tactics and organisational strategies.

  19. Measurements of Anisotropy in the Cosmic Microwave Background Radiation at 0.5 Degree Angular Scales Near the Star Gamma Ursae Minoris

    OpenAIRE

    Devlin, M.J; Clapp, A. C.; Gundersen, J. O.; Hagmann, C. A.; Hristov, V. V.; Lange, A. E.; Lim, M. A.; Lubin, P. M.; Mauskopf, P. D.; Meinhold, P. R.; Richards, P. L.; Smoot, G. F.; Tanaka, S. T.; Timbie, P.T.; Wuensche, C. A.

    1994-01-01

    We present results from a four frequency observation of a 6 x 0.6 degree strip of the sky centered near the star Gamma Ursae Minoris during the fourth flight of the Millimeter-wave Anisotropy eXperiment (MAX). The observation was made with a 1.4 degree peak-to-peak sinusoidal chop in all bands. The FWHM beam sizes were 0.55 +/- 0.05 degrees at 3.5 cm-1 and 0.75 +/-0.05 degrees at 6, 9, and 14 cm-1. During this observation significant correlated structure was observed at 3.5, 6 and 9 cm-1 with...

  20. Coherent energy scale revealed by ultrafast dynamics of UX3 (X = Al, Sn, Ga) single crystals

    Science.gov (United States)

    Nair, Saritha K.; Zhu, J.-X.; Sarrao, J. L.; Taylor, A. J.; Chia, Elbert E. M.

    2012-09-01

    The temperature dependence of relaxation dynamics of UX3 (X = Al, Ga, Sn) compounds is studied using the time-resolved pump-probe technique in reflectance geometry. For UGa3, our data are consistent with the formation of a spin density wave gap as evidenced from the quasidivergence of the relaxation time τ near the Néel temperature TN. For UAl3 and USn3, the relaxation dynamics shows a change from single-exponential to two-exponential behavior below a particular temperature, suggestive of coherence formation of the 5f electrons with the conduction band electrons. This particular temperature can be attributed to the spin fluctuation temperature Tsf, a measure of the strength of Kondo coherence. Our Tsf is consistent with other data such as resistivity and susceptibility measurements. The temperature dependence of the relaxation amplitude and time of UAl3 and USn3 were also fitted by the Rothwarf-Taylor model. Our results show that ultrafast optical spectroscopy is sensitive to c-f Kondo hybridization in the f-electron systems.

  1. W Ursae Majoris--Type Systems Discovered in the Central Baade's Window in the OGLE Experiment

    Science.gov (United States)

    Rucinski, Slavek M.

    1995-06-01

    Seventy-seven W UMa-type systems to I = 18 mag in one of the 21 fields of the Optical Gravitational Lensing Experiment (OGLE) have been assessed in terms of utility for extraction of astrophysical information from time-independent data such as colors, periods, maximum magnitudes, and variability amplitudes, with special attention to limitations which might affect analysis of data in the final OGLE catalog, expected to contain more than 1000 contact binaries.

  2. Orbital Elements and Stellar Parameters of the Active Binary UX Arietis

    Science.gov (United States)

    Hummel, C. A.; Monnier, J. D.; Roettenbacher, R. M.; Torres, G.; Henry, G. W.; Korhonen, H.; Beasley, A.; Schaefer, G. H.; Turner, N. H.; Ten Brummelaar, T.; Farrington, C. D.; Sturmann, J.; Sturmann, L.; Baron, F.; Kraus, S.

    2017-08-01

    Stellar activity observed as large surface spots, radio flares, or emission lines is often found in binary systems. UX Arietis exhibits these signs of activity, originating on the K0 subgiant primary component. Our aim is to resolve the binary, measure the orbital motion, and provide accurate stellar parameters such as masses and luminosities to aid in the interpretation of the observed phenomena. Using the CHARA six-telescope optical long-baseline array on Mount Wilson, California, we obtained amplitudes and phases of the interferometric visibility on baselines up to 330 m in length, resolving the two components of the binary. We reanalyzed archival Center for Astrophysics spectra to disentangle the binary component spectra and the spectrum of the third component, which was resolved by speckle interferometry. We also obtained new spectra with the Nordic Optical Telescope, and we present new photometric data that we use to model stellar surface spot locations. Both interferometric visibilities and spectroscopic radial velocities are modeled with a spotted primary stellar surface using the Wilson-Devinney code. We fit the orbital elements to the apparent orbit and radial velocity data to derive the distance (52.1 ± 0.8 pc) and stellar masses ({M}{{P}}=1.30+/- 0.06 {M}⊙ , {M}{{S}}=1.14+/- 0.06 {M}⊙ ). The radius of the primary can be determined to be {R}{{P}}=5.6+/- 0.1 {R}⊙ and that of the secondary to be {R}{{S}}=1.6+/- 0.2 {R}⊙ . The equivalent spot coverage of the primary component was found to be 62% with an effective temperature 20% below that of the unspotted surface.

  3. A Suprime-Cam study of the stellar population of the Ursa Major I dwarf spheroidal galaxy

    Science.gov (United States)

    Okamoto, S.; Arimoto, N.; Yamada, Y.; Onodera, M.

    2008-08-01

    We present deep and wide V, I CCD photometry of the Ursa Major I (UMa I) dwarf spheroidal galaxy (dSph) in the Local Group. The images of the galaxy were taken with the Subaru/Suprime-Cam wide field camera, covering a field of 34´ × 27´ located at the centre of the galaxy. The colour-magnitude diagram (CMD) of the UMa I dSph shows a steep and narrow red giant branch (RGB), blue and red horizontal branch (HB), and main sequence (MS) stars. A well-defined main sequence turn-off (MSTO) is found to be located at V0,MSTO ~ 23.5 mag. The distance modulus is derived as (m-M)0 = 19.93±0.1 (corresponding to a distance D = 96.8±4 kpc) from the V-band magnitude of the horizontal branch (V0,HB = 20.45±0.02). The mean metallicity of the RGB stars is estimated by the V-I colour as [Fe/H] ~ -2.0. The turn-off age estimated by overlaying the theoretical isochrones reveals that most of stars in the UMa I dSph are formed at a very early epoch (~12 Gyr ago). The isopleth map of stellar number density of the UMa I dSph, based upon the resolved star counts of MS, RGB, HB stars as well as blue stragglers (BS), shows that the morphology of the UMa I dSph is quite irregular and distorted, suggesting that the galaxy is in a process of disruption. The very old and metal-poor nature of the stellar population implies that the star formation history of this newly discoverd faint dSph may have been different from other well-known “classical” dSphs, which show significant stellar populations of intermediate age. The stellar population of the UMa I dSph closely resembles that of Galactic old metal-poor globular clusters, but its size is typical of Galactic dSphs (re = 188 [pc], r1/2 = 300 [pc]), and the shape of its spatial density contours suggests that it is undergoing tidal disruption. These characteristics of stellar population and spatial distribution of the faint galaxies help us to understand how they formed and evolved, and give a hint to the nature of the building blocks of

  4. Constraints on the parameters of radiatively decaying dark matter from the dark matter halo of the Milky Way and Ursa Minor

    CERN Document Server

    Boyarsky, A; Ruchayskiy, O; Boyarsky, Alexey; Nevalainen, Jukka; Ruchayskiy, Oleg

    2007-01-01

    Using the recent XMM-Newton PN blank sky data, we improve the earlier restrictions on parameters of the warm dark matter (DM) in the form of sterile neutrino (by as much as the order of magnitude at masses ~ 3.5 kev). The results are obtained from non-observing DM decay line in the X-ray spectrum of the Milky Way. We also present similar constraint coming from the recent XMM-Newton observation of Ursa Minor -- dark, X-ray quiet dwarf spheroidal. Although this observation has relatively poor statistics, the constraints are comparable to those, recently obtained using observations of Large Magellanic Cloud or M31. This confirms recent proposal that dwarf satellites of the MW are very interesting candidates for the DM search and should be studied dedicatedly on this purpose.

  5. Study of the ventilation at ATLAS cavern UX15 air velocity and temperature around the muon chambers

    CERN Document Server

    Vigo-Castellví, E

    2000-01-01

    The Muon Chambers of ATLAS detector cannot work under temperature differences between two opposed faces above 3 K. In addition, a low velocity of the air around the Muon Chambers is essential to avoid vibration problems. The CV group at the ST division is involved in an airflow simulation inside UX15 cavern to check air temperature and velocity profiles around the ATLAS Muon Chambers. In this paper, the status and the content of the performed theoretical studies will be explained. Three simulation models, which helped to understand the Muon Spectrometer thermal environment and the efficiency of the ventilation system at ATLAS cavern, will be presented. Besides, it will be shown how these studies support the proposal of a deeper individual Muon Chamber study.

  6. Delivery at CERN and installation of the LHC underground refrigerator 1.8K in UX85 (point 8).

    CERN Multimedia

    Caterina BERTONE (TS-IC-HS)

    2004-01-01

    Series of photographs showing the delivery, handling and installation of the LHC cryogenic refrigerator in point 8 (UX85). The LHC cryogenic fluid (liquid helium at 1.9 K) is produced by cryogenic refrigerators (QURC) that are situated in the shafts and in the underground tunnel areas: 8 new units are being installed to reinforce the existing LEP cryogenic units. Each of them has an overall weight of about 25 t, the shape of a huge reversed L, 2-m wide, 7-m long and around 7-m high. Each QURC is installed in a different cavern/pit and is surrounded by a multitude of other services; consequentially it demands a detailed handling study, the procurement/design of dedicated handling tools and several days for installation of any single part.

  7. Living with an autonomous spatiotemporal home heating system: Exploration of the user experiences (UX) through a longitudinal technology intervention-based mixed-methods approach.

    Science.gov (United States)

    Kruusimagi, Martin; Sharples, Sarah; Robinson, Darren

    2017-11-01

    Rising energy demands place pressure on domestic energy consumption, but savings can be delivered through home automation and engaging users with their heating and energy behaviours. The aim of this paper is to explore user experiences (UX) of living with an automated heating system regarding experiences of control, understanding of the system, emerging thermal behaviours, and interactions with the system as this area is not sufficiently researched in the existing homes setting through extended deployment. We present a longitudinal deployment of a quasi-autonomous spatiotemporal home heating system in three homes. Users were provided with a smartphone control application linked to a self-learning heating algorithm. Rich qualitative and quantitative data presented here enabled a holistic exploration of UX. The paper's contribution focuses on highlighting key aspects of UX living with an automated heating systems including (i) adoption of the control interface into the social context, (ii) how users' vigilance in maintaining preferred conditions prevailed as a better indicator of system over-ride than gross deviation from thermal comfort, (iii) limited but motivated proactivity in system-initiated communications as best strategy for soliciting user feedback when inference fails, and (iv) two main motivations for interacting with the interface - managing irregularities when absent from the house and maintaining immediate comfort, latter compromising of a checking behaviour that can transit to a system state alteration behaviour depending on mismatches. We conclude by highlighting the complex socio-technical context in which thermal decisions are made in a situated action manner, and by calling for a more holistic, UX-focused approach in the design of automated home systems involving user experiences. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.

  8. Effects of density functionals and dispersion interactions on geometries, bond energies and harmonic frequencies of Etbnd UX3 (E = N, P, CH; X = H, F, Cl)

    Science.gov (United States)

    Pandey, Krishna Kumar; Patidar, Pankaj; Patidar, Sunil Kumar; Vishwakarma, Ravi

    2014-12-01

    Quantum-chemical calculations have been performed to evaluate the geometries, bonding nature and harmonic frequencies of the compounds [Etbnd UX3] at DFT, DFT-D3, DFT-D3(BJ) and DFT-dDSc levels using different density functionals BP86, BLYP, PBE, revPBE, PW91, TPSS and M06-L. The stretching frequency of Utbnd N bond in [Ntbnd UF3] calculated with DFT/BLYP closely resembles with the experimental value. The performance of different density functionals for accurate Utbnd N vibrational frequencies follows the order BLYP > revPBE > BP86 > PW91 > TPSS > PBE > M06-L. The BLYP functional gives accurate value of the Utbnd E bond distances. The uranium atom in the studied compounds [Etbnd UX3] is positively charged. Upon going from [Etbnd UF3] to [Etbnd UCl3], the partial Hirshfeld charge on uranium atom decreases because of the lower electronegativity of chlorine compared to flourine. The Gopinathan-Jug bond order for Utbnd E bonds ranges from 2.90 to 3.29. The Utbnd E bond dissociation energies vary with different density functionals as M06-L UX3] are larger than the electrostatic interaction ΔEelstat, which means the Utbnd N bonds in these compound have greater degree of covalent character (in the range 63.8-77.2%). The Usbnd E σ-bonding interaction is the dominant bonding interaction in the nitride and methylidyne complexes while it is weaker in [Ptbnd UX3]. The dispersion energy contributions to the total bond dissociation energies are rather small. Compared to the Grimme's D3(BJ) corrections, the Corminboeuf's dispersion corrections are larger with metaGGA functionals (TPSS, M06-L) while smaller with GGA functionals.

  9. The VESPA Survey: 100 New Variable Stars Discovered in Two Years

    Science.gov (United States)

    Quadri, U.; Strabla, L.; Girelli, R.

    2017-06-01

    We describe the VESPA project made at IAU station 565, Astronomical Observatory in Bassano Bresciano (BS), Italy. It is one photometric survey of the northern hemisphere which has the aim of discovering and investigating new variable stars. In the first two years of activity we have discovered 100 new variable stars in the course of observations carried out from August 2014 to September 2016. The newly discovered stars comprise 80 eclipsing binary stars (66 of them classified as W Ursae Majoris, 11 as beta Lyrae, and 3 beta Persei), one rotating (ROT), one ellipsoidal variable (ELL), and 18 pulsating variables (5 of them classified as RRAB, 7 RRC, 3 HADS, 2 delta Scuti and one Cepheid). Variability classification is based on the properties of the optical light curves that we obtained using our 255 mm F/4.7 Newton robotic telescope.

  10. Little Bear's pulsating stars: Variable star census of UMi dSph Galaxy

    Science.gov (United States)

    Kinemuchi, K.; Jeffery, E.; Kuehn, C.; Grabowski, K.; Nemec, J.

    2017-09-01

    Recent observations and a photometric search for variable stars in the Ursa Minor dwarf spheroidal galaxy (UMi dSph) are presented. Our observations were taken at Apache Point Observatory in 2014 and 2016 using the 0.5m ARCSAT telescope and the West Mountain Observatory (WMO) 0.9m telescope of Brigham Young University in 2016. Previously known RR Lyrae stars in our field of view of the UMi dSph are identified, and we also catalog new variable star candidates. Tentative classifications are given for some of the new variable stars. We have conducted period searches with the data collected with the WMO telescope. Our ultimate goal is to create an updated catalog of variable stars in the UMi dSph and to compare the RR Lyrae stellar characteristics to other RR Lyrae stars found in the Local Group dSph galaxies.

  11. Little Bear’s pulsating stars: Variable star census of UMi dSph Galaxy

    Directory of Open Access Journals (Sweden)

    Kinemuchi K.

    2017-01-01

    Full Text Available Recent observations and a photometric search for variable stars in the Ursa Minor dwarf spheroidal galaxy (UMi dSph are presented. Our observations were taken at Apache Point Observatory in 2014 and 2016 using the 0.5m ARCSAT telescope and the West Mountain Observatory (WMO 0.9m telescope of Brigham Young University in 2016. Previously known RR Lyrae stars in our field of view of the UMi dSph are identified, and we also catalog new variable star candidates. Tentative classifications are given for some of the new variable stars. We have conducted period searches with the data collected with the WMO telescope. Our ultimate goal is to create an updated catalog of variable stars in the UMi dSph and to compare the RR Lyrae stellar characteristics to other RR Lyrae stars found in the Local Group dSph galaxies.

  12. Vesicoureteral Reflux

    African Journals Online (AJOL)

    2007-11-07

    Nov 7, 2007 ... If there ever was a structural abnormality This was the real launchingpoint for pediatric that defined a specialty, ... PEDIATRIC URlNARY TRACT INFECTIONS AND VESICOURETERAL REFLUX. However, our initial thoughts about ..... tive study to examine renal function associat- ed with VUR in 52 patients ...

  13. UX, XD & UXD

    DEFF Research Database (Denmark)

    Jensen, Jens F.

    . produkter og tjenester, der har et andet primært formål end oplevelsen, men hvor oplevelsesaspekter er et tillæg til og en merværdi i forhold til den primære funktion (Rambøll Management, 2005; Lund et al., 2005). User experience og user experience design kan på denne måde anskues som den særlige udmøntning...... experience, experience design og user experience design. Disse begreber er beslægtede og i nogle sammenhænge tæt sammenvævede, men har dog også separate betydninger. I denne publikations sammenhæng vil vi både tale om user experience, experience design og user experience design som et samlet felt og om de...... enkelte termer separat. User experience vil her blive betragtet som den centrale term, dvs. som den term, der i denne konkrete sammenhæng er i fokus, mens experience design og user experience design vil blive betragtet som relaterede begreber. Af sammen grund vil oplevelser i forbindelse med IT udgøre...

  14. Heavily doped M1−xUxF2+2x fluorites studied by quasielastic neutron scattering(M=Ba) and specific heat measurements (M=Pb)

    DEFF Research Database (Denmark)

    Andersen, Niels Hessel; Clausen, Kurt Nørgaard; Kjems, Jørgen

    1983-01-01

    The thermal generation of defects in pure and doped Pb1−xUxF2+2x (x=0, 0.05and0.10) has been studied by specific heat measurements between 475 k and 875 k. A simple phenomenological mean field thermodynamic model has been developed and used to interpret the data. At low temperatures the result...

  15. Photometric, Spectroscopic, and Orbital Period Study of Three Early-type Semi-detached Systems: XZ Aql, UX Her, and AT Peg

    Science.gov (United States)

    Zola, S.; Baştürk, Ö.; Liakos, A.; Gazeas, K.; Şenavcı, H. V.; Nelson, R. H.; Özavcı, İ.; Zakrzewski, B.; Yılmaz, M.

    2016-08-01

    In this paper, we present a combined photometric, spectroscopic, and orbital period study of three early-type eclipsing binary systems: XZ Aql, UX Her, and AT Peg. As a result, we have derived the absolute parameters of their components and, on that basis, we discuss their evolutionary states. Furthermore, we compare their parameters with those of other binary systems and with theoretical models. An analysis of all available up-to-date times of minima indicated that all three systems studied here show cyclic orbital changes; their origin is discussed in detail. Finally, we performed a frequency analysis for possible pulsational behavior, and as a result we suggest that XZ Aql hosts a δ Scuti component.

  16. Competing Jahn-Teller distortions and ferrimagnetic ordering in the geometrically frustrated system N i1 -xC uxC r2O4

    Science.gov (United States)

    Reehuis, M.; Tovar, M.; Többens, D. M.; Pattison, P.; Hoser, A.; Lake, B.

    2015-01-01

    Competing Jahn-Teller distortions combined with geometrical frustration give rise to a rich phase diagram as a function of x (Cu ) and temperature in the spinel system N i1 -xC uxC r2O4 . The Jahn-Teller distortion of the end members acts in opposite ways, with an elongation of the Ni O4 tetrahedra resulting in a structural transition at TS 1=317 K in NiC r2O4 , but a flattening in the Cu O4 tetrahedra at TS 1=846 K in CuC r2O4 . In both cases the symmetry is lowered from cubic (F d 3 ¯m ) to tetragonal (I 41/a m d ) on cooling. In order to follow the influence of Jahn-Teller active N i2 + and C u2 + ions on the structural and magnetic properties of chromium spinels, we have investigated a series of samples of N i1 -xC uxC r2O4 by x-ray and neutron powder diffraction. In the critical range 0.10 copper content up to x (Cu )˜0.5 . For the Ni-rich chromites, geometrical frustration causes a strong reduction of the chromium moments, where magnetic long-range order coexists with a disordered spin-liquid-like or a reentrant-spin-glass-like state. This paper provides insight into the interplay between the Jahn-Teller effect, geometrical frustration, and long-range magnetic order in these complex systems.

  17. Synthesis of coffinite, USiO4, and structural investigations of UxTh(1-x)SiO4 solid solutions.

    Science.gov (United States)

    Labs, Sabrina; Hennig, Christoph; Weiss, Stephan; Curtius, Hilde; Zänker, Harald; Bosbach, Dirk

    2014-01-01

    The miscibility behavior of the USiO4-ThSiO4 system was investigated. The end members and 10 solid solutions UxTh(1-x)SiO4 with x = 0.12-0.92 were successfully synthesized, without formation of other secondary uranium or thorium phases. Lattice parameters of the solid solutions evidently follow Vegard's Law. Investigation of the local structure with EXAFS reveals small differences between the U and Th environment attributed to different atomic radii of the metal atoms but no implications for a miscibility gap. The data provided confirm complete miscibility for the system USiO4-ThSiO4. The structure of the end members was studied in detail with XRD and discussed with special regard to the oxygen positions and the often neglected Si-O bond length. USiO4 could be obtained without UO2 impurities and the lattice parameters derived from Rietveld refinement as c = 6.2606(3) Å and a = 6.9841(3) Å. The Si-O distance in USiO4 appears to be 1.64 Å, which is more reasonable than earlier reported values.

  18. DET/MPS - THE GSFC ENERGY BALANCE PROGRAM, DIRECT ENERGY TRANSFER/MULTIMISSION SPACECRAFT MODULAR POWER SYSTEM (MACINTOSH A/UX VERSION)

    Science.gov (United States)

    Jagielski, J. M.

    1994-01-01

    The DET/MPS programs model and simulate the Direct Energy Transfer and Multimission Spacecraft Modular Power System in order to aid both in design and in analysis of orbital energy balance. Typically, the DET power system has the solar array directly to the spacecraft bus, and the central building block of MPS is the Standard Power Regulator Unit. DET/MPS allows a minute-by-minute simulation of the power system's performance as it responds to various orbital parameters, focusing its output on solar array output and battery characteristics. While this package is limited in terms of orbital mechanics, it is sufficient to calculate eclipse and solar array data for circular or non-circular orbits. DET/MPS can be adjusted to run one or sequential orbits up to about one week, simulated time. These programs have been used on a variety of Goddard Space Flight Center spacecraft projects. DET/MPS is written in FORTRAN 77 with some VAX-type extensions. Any FORTRAN 77 compiler that includes VAX extensions should be able to compile and run the program with little or no modifications. The compiler must at least support free-form (or tab-delineated) source format and 'do do-while end-do' control structures. DET/MPS is available for three platforms: GSC-13374, for DEC VAX series computers running VMS, is available in DEC VAX Backup format on a 9-track 1600 BPI tape (standard distribution) or TK50 tape cartridge; GSC-13443, for UNIX-based computers, is available on a .25 inch streaming magnetic tape cartridge in UNIX tar format; and GSC-13444, for Macintosh computers running AU/X with either the NKR FORTRAN or AbSoft MacFORTRAN II compilers, is available on a 3.5 inch 800K Macintosh format diskette. Source code and test data are supplied. The UNIX version of DET requires 90K of main memory for execution. DET/MPS was developed in 1990. A/UX and Macintosh are registered trademarks of Apple Computer, Inc. VMS, DEC VAX and TK50 are trademarks of Digital Equipment Corporation. UNIX is a

  19. Supreme Court of the United States Syllabus: Runyon et ux., dba Bobbe's School v. McCrary et al. Certiorari to the United States Court of Appeals for the Fourth Circuit. No. 75-62. Argued April 26, 1976--Decided June 25, 1976.

    Science.gov (United States)

    Supreme Court of the U. S., Washington, DC.

    This publication presents the full text of the U.S. Supreme Court's decision in Runyon et ux., dba Bobbe's School v. McCrary et al., as written by Justice Stewart. Also included are separate concurring opinions written by Justice Powell and Justice Stevens and a dissenting opinion written by Justice White, as well as a syllabus that summarizes the…

  20. Unit Replacement System Analysis I (URSA I).

    Science.gov (United States)

    1982-01-01

    1981, the US Army Concepts Analysis Agency (CAA) was formally tasked to conduct an analy- sis of the steady state condition of a unit rotation...ental Force CostMng Metod ogsr tue IStatisticalPe n l IAnais i al y i Mo e IF R O T Cossc Dataos onnel) Moe MOE/MOC/DOt Expnde-.d eln ehd g 2-6 CAA-SR...Board review required of every formal CAA study. 2-9 .L :, W~l°° --°?.- - - -. - - - .- . -. .2 . .... - -/ -. --i ; - -, - - - --- CAA-SR-82-1 CHAPTER 3

  1. Ashtekar variables

    Science.gov (United States)

    Ashtekar, Abhay

    2015-05-01

    In the spirit of Scholarpedia, this invited article is addressed to students and younger researchers. It provides the motivation and background material, a summary of the main physical ideas, mathematical structures and results, and an outline of applications of the connection variables for general relativity. These variables underlie both the canonical/Hamiltonian and the spinfoam/path integral approaches in loop quantum gravity.

  2. Variability Bugs:

    DEFF Research Database (Denmark)

    Melo, Jean

    2017-01-01

    be exploited. Variability bugs are not confined to any particular type of bug, error-prone feature, or location. In addition to introducing an exponential number of program variants, variability increases the complexity of bugs due to unintended feature interactions, hidden features, combinations of layers...... and bug finding, but not terribly so. This is positive and consistent with the existence of highly-configurable software systems with hundreds, even thousands, of features, testifying that developers in the trenches are able to deal with variability.......Many modern software systems are highly configurable. They embrace variability to increase adaptability and to lower cost. To implement configurable software, developers often use the C preprocessor (CPP), which is a well-known technique, mainly in industry, to deal with variability in code...

  3. Complex variables

    CERN Document Server

    Fisher, Stephen D

    1999-01-01

    The most important topics in the theory and application of complex variables receive a thorough, coherent treatment in this introductory text. Intended for undergraduates or graduate students in science, mathematics, and engineering, this volume features hundreds of solved examples, exercises, and applications designed to foster a complete understanding of complex variables as well as an appreciation of their mathematical beauty and elegance. Prerequisites are minimal; a three-semester course in calculus will suffice to prepare students for discussions of these topics: the complex plane, basic

  4. Exploring the Variable Sky with the Sloan Digital Sky Survey

    Energy Technology Data Exchange (ETDEWEB)

    Sesar, Branimir; Ivezic, Zeljko; Lupton, Robert H.; Juric, Mario; Gunn, James E.; Knapp, Gillian R.; Lee, Nathan De; Smith, J.Allyn; Miknaitis, Gajus; Lin, Huan; Tucker,

    2007-04-01

    We quantify the variability of faint unresolved optical sources using a catalog based on multiple SDSS imaging observations. The catalog covers SDSS Stripe 82, which lies along the celestial equator in the Southern Galactic Hemisphere (22h 24m < {alpha}{sub J2000} < 04h 08m, -1.27 < {delta}{sub J2000} < +1.27, {approx}290 deg{sup 2} ), and contains 58 million photometric observations in the SDSS ugriz system for 1.4 million unresolved sources that were observed at least 4 times in each of the gri bands (with a median of 10 observations obtained over {approx}5 years). In each photometric bandpass we compute various low-order lightcurve statistics such as root-mean-square scatter (rms), {chi}{sup 2} 2 per degree of freedom, skewness, minimum and maximum magnitude, and use them to select and study variable sources. We find that 2% of unresolved optical sources brighter than g = 20.5 appear variable at the 0.05 mag level (rms) simultaneously in the g and r bands. The majority (2/3) of these variable sources are low-redshift (< 2) quasars, although they represent only 2% of all sources in the adopted ux-limited sample. We find that at least 90% of quasars are variable at the 0.03 mag level (rms) and confirm that variability is as good a method for finding low-redshift quasars as is the UV excess color selection (at high Galactic latitudes). We analyze the distribution of lightcurve skewness for quasars and find that is centered on zero. We find that about 1/4 of the variable stars are RR Lyrae stars, and that only 0.5% of stars from the main stellar locus are variable at the 0.05 mag level. The distribution of lightcurve skewness in the g-r vs. u-g color-color diagram on the main stellar locus is found to be bimodal (with one mode consistent with Algol-like behavior). Using over six hundred RR Lyrae stars, we demonstrate rich halo substructure out to distances of 100 kpc. We extrapolate these results to expected performance by the Large Synoptic Survey Telescope and

  5. Complex variables

    CERN Document Server

    Flanigan, Francis J

    2010-01-01

    A caution to mathematics professors: Complex Variables does not follow conventional outlines of course material. One reviewer noting its originality wrote: ""A standard text is often preferred [to a superior text like this] because the professor knows the order of topics and the problems, and doesn't really have to pay attention to the text. He can go to class without preparation."" Not so here-Dr. Flanigan treats this most important field of contemporary mathematics in a most unusual way. While all the material for an advanced undergraduate or first-year graduate course is covered, discussion

  6. Complex variables

    CERN Document Server

    Taylor, Joseph L

    2011-01-01

    The text covers a broad spectrum between basic and advanced complex variables on the one hand and between theoretical and applied or computational material on the other hand. With careful selection of the emphasis put on the various sections, examples, and exercises, the book can be used in a one- or two-semester course for undergraduate mathematics majors, a one-semester course for engineering or physics majors, or a one-semester course for first-year mathematics graduate students. It has been tested in all three settings at the University of Utah. The exposition is clear, concise, and lively

  7. Gastro Oesophageal Reflux Disease

    African Journals Online (AJOL)

    ablative therapy. The latter is not being routinely performed in South Africa. Oesophageal adenocarcinoma is one of the most rapidly increasing forms of malignancy in the western world, and generally has a poor prognosis. Whilst detecting Barrett's oesophagus and dysplasia may have some impact on these numbers, it is ...

  8. Variable importance in latent variable regression models

    NARCIS (Netherlands)

    Kvalheim, O.M.; Arneberg, R.; Bleie, O.; Rajalahti, T.; Smilde, A.K.; Westerhuis, J.A.

    2014-01-01

    The quality and practical usefulness of a regression model are a function of both interpretability and prediction performance. This work presents some new graphical tools for improved interpretation of latent variable regression models that can also assist in improved algorithms for variable

  9. Classifying variability modeling techniques

    NARCIS (Netherlands)

    Sinnema, Marco; Deelstra, Sybren

    Variability modeling is important for managing variability in software product families, especially during product derivation. In the past few years, several variability modeling techniques have been developed, each using its own concepts to model the variability provided by a product family. The

  10. Types of biological variables.

    Science.gov (United States)

    Mayya, Shreemathi S; Monteiro, Ashma D; Ganapathy, Sachit

    2017-06-01

    Identification and description of variables used in any study is a necessary component in biomedical research. Statistical analyses rely on the type of variables that are involved in the study. In this short article, we introduce the different types of biological variables. A researcher has to be familiar with the type of variable he/she is dealing with in his/her research to decide about appropriate graphs/diagrams, summary measures and statistical analysis.

  11. Variable mechanical ventilation

    OpenAIRE

    Fontela, Paula Caitano; Prestes, Renata Bernardy; Forgiarini Jr.,Luiz Alberto; Friedman, Gilberto

    2017-01-01

    Objective To review the literature on the use of variable mechanical ventilation and the main outcomes of this technique. Methods Search, selection, and analysis of all original articles on variable ventilation, without restriction on the period of publication and language, available in the electronic databases LILACS, MEDLINE?, and PubMed, by searching the terms "variable ventilation" OR "noisy ventilation" OR "biologically variable ventilation". Results A total of 36 studies were selected. ...

  12. Latent variable theory

    NARCIS (Netherlands)

    Borsboom, D.

    2008-01-01

    This paper formulates a metatheoretical framework for latent variable modeling. It does so by spelling out the difference between observed and latent variables. This difference is argued to be purely epistemic in nature: We treat a variable as observed when the inference from data structure to

  13. Amplification variable factor amplifier

    NARCIS (Netherlands)

    Akitsugu, Oshita; Nauta, Bram

    2007-01-01

    PROBLEM TO BE SOLVED: To provide an amplification factor variable amplifier capable of achieving temperature compensation of an amplification factor over a wide variable amplification factor range. ; SOLUTION: A Gilbert type amplification factor variable amplifier 11 amplifies an input signal and

  14. Amplification variable factor amplifier

    NARCIS (Netherlands)

    Akitsugu, O.; Nauta, Bram

    2006-01-01

    PROBLEM TO BE SOLVED: To provide an amplification factor variable amplifier capable of achieving temperature compensation of an amplification factor over a wide variable amplification factor range. ; SOLUTION: A Gilbert type amplification factor variable amplifier 11 amplifies an input signal and

  15. Variable mechanical ventilation

    Science.gov (United States)

    Fontela, Paula Caitano; Prestes, Renata Bernardy; Forgiarini Jr., Luiz Alberto; Friedman, Gilberto

    2017-01-01

    Objective To review the literature on the use of variable mechanical ventilation and the main outcomes of this technique. Methods Search, selection, and analysis of all original articles on variable ventilation, without restriction on the period of publication and language, available in the electronic databases LILACS, MEDLINE®, and PubMed, by searching the terms "variable ventilation" OR "noisy ventilation" OR "biologically variable ventilation". Results A total of 36 studies were selected. Of these, 24 were original studies, including 21 experimental studies and three clinical studies. Conclusion Several experimental studies reported the beneficial effects of distinct variable ventilation strategies on lung function using different models of lung injury and healthy lungs. Variable ventilation seems to be a viable strategy for improving gas exchange and respiratory mechanics and preventing lung injury associated with mechanical ventilation. However, further clinical studies are necessary to assess the potential of variable ventilation strategies for the clinical improvement of patients undergoing mechanical ventilation. PMID:28444076

  16. Variable mechanical ventilation.

    Science.gov (United States)

    Fontela, Paula Caitano; Prestes, Renata Bernardy; Forgiarini, Luiz Alberto; Friedman, Gilberto

    2017-01-01

    To review the literature on the use of variable mechanical ventilation and the main outcomes of this technique. Search, selection, and analysis of all original articles on variable ventilation, without restriction on the period of publication and language, available in the electronic databases LILACS, MEDLINE®, and PubMed, by searching the terms "variable ventilation" OR "noisy ventilation" OR "biologically variable ventilation". A total of 36 studies were selected. Of these, 24 were original studies, including 21 experimental studies and three clinical studies. Several experimental studies reported the beneficial effects of distinct variable ventilation strategies on lung function using different models of lung injury and healthy lungs. Variable ventilation seems to be a viable strategy for improving gas exchange and respiratory mechanics and preventing lung injury associated with mechanical ventilation. However, further clinical studies are necessary to assess the potential of variable ventilation strategies for the clinical improvement of patients undergoing mechanical ventilation.

  17. The nebular variables

    CERN Document Server

    Glasby, John S

    1974-01-01

    The Nebular Variables focuses on the nebular variables and their characteristics. Discussions are organized by type of nebular variable, namely, RW Aurigae stars, T Orionis stars, T Tauri stars, and peculiar nebular objects. Topics range from light variations of the stars to their spectroscopic and physical characteristics, spatial distribution, interaction with nebulosity, and evolutionary features. This volume is divided into four sections and consists of 25 chapters, the first of which provides general information on nebular variables, including their stellar associations and their classifi

  18. INTER-EXAMINER VARIABILITY

    African Journals Online (AJOL)

    Background: The traditional clinical examination has fallen into disfavour on account of considerable inter-examiner variability. The OSCE is gaining popularity as it is perceived to be less prone to this. Objective: To establish whether inter-examiner variability is still a significant factor for the undergraduate orthopaedic ...

  19. Software variability management

    NARCIS (Netherlands)

    Bosch, J; Nord, RL

    2004-01-01

    During recent years, the amount of variability that has to be supported by a software artefact is growing considerably and its management is evolving into a major challenge during development, usage, and evolution of software artefacts. Successful management of variability in software leads to

  20. Microinertia and internal variables

    CERN Document Server

    Berezovski, A

    2015-01-01

    The origin of microinertia of micromorphic theories is investigated from the point of view of non-equilibrium thermodynamics. In the framework of dual internal variables microinertia stems from a thermodynamic equation of state related to the internal variable with the properties of mechanical momentum.

  1. Variable volume combustor

    Science.gov (United States)

    Ostebee, Heath Michael; Ziminsky, Willy Steve; Johnson, Thomas Edward; Keener, Christopher Paul

    2017-01-17

    The present application provides a variable volume combustor for use with a gas turbine engine. The variable volume combustor may include a liner, a number of micro-mixer fuel nozzles positioned within the liner, and a linear actuator so as to maneuver the micro-mixer fuel nozzles axially along the liner.

  2. Rapidly variable relatvistic absorption

    Science.gov (United States)

    Parker, M.; Pinto, C.; Fabian, A.; Lohfink, A.; Buisson, D.; Alston, W.; Jiang, J.

    2017-10-01

    I will present results from the 1.5Ms XMM-Newton observing campaign on the most X-ray variable AGN, IRAS 13224-3809. We find a series of nine absorption lines with a velocity of 0.24c from an ultra-fast outflow. For the first time, we are able to see extremely rapid variability of the UFO features, and can link this to the X-ray variability from the inner accretion disk. We find a clear flux dependence of the outflow features, suggesting that the wind is ionized by increasing X-ray emission.

  3. Eternity Variables to Simulate Specifications

    NARCIS (Netherlands)

    Hesselink, WH; Boiten, EA; Moller, B

    2002-01-01

    Simulation of specifications is introduced as a unification and generalization of refinement mappings, history variables, forward simulations, prophecy variables, and backward simulations. Eternity variables are introduced as a more powerful alternative for prophecy variables and backward

  4. Variable-Rate Premiums

    Data.gov (United States)

    Pension Benefit Guaranty Corporation — These interest rates are used to value vested benefits for variable rate premium purposes as described in PBGC's regulation on Premium Rates (29 CFR Part 4006) and...

  5. Software Testing Requires Variability

    DEFF Research Database (Denmark)

    Christensen, Henrik Bærbak

    2003-01-01

    Software variability is the ability of a software system or artefact to be changed, customized or configured for use in a particular context. Variability in software systems is important from a number of perspectives. Some perspectives rightly receive much attention due to their direct economic i...... impact in software production. As is also apparent from the call for papers these perspectives focus on qualities such as reuse, adaptability, and maintainability.......Software variability is the ability of a software system or artefact to be changed, customized or configured for use in a particular context. Variability in software systems is important from a number of perspectives. Some perspectives rightly receive much attention due to their direct economic...

  6. Variable Attitude Test Stand

    Data.gov (United States)

    Federal Laboratory Consortium — The Variable Attitude Test Stand designed and built for testing of the V-22 tilt rotor aircraft propulsion system, is used to evaluate the effect of aircraft flight...

  7. Calculus of one variable

    CERN Document Server

    Grossman, Stanley I

    1986-01-01

    Calculus of One Variable, Second Edition presents the essential topics in the study of the techniques and theorems of calculus.The book provides a comprehensive introduction to calculus. It contains examples, exercises, the history and development of calculus, and various applications. Some of the topics discussed in the text include the concept of limits, one-variable theory, the derivatives of all six trigonometric functions, exponential and logarithmic functions, and infinite series.This textbook is intended for use by college students.

  8. Neuroanatomical variability of religiosity.

    Science.gov (United States)

    Kapogiannis, Dimitrios; Barbey, Aron K; Su, Michael; Krueger, Frank; Grafman, Jordan

    2009-09-28

    We hypothesized that religiosity, a set of traits variably expressed in the population, is modulated by neuroanatomical variability. We tested this idea by determining whether aspects of religiosity were predicted by variability in regional cortical volume. We performed structural magnetic resonance imaging of the brain in 40 healthy adult participants who reported different degrees and patterns of religiosity on a survey. We identified four Principal Components of religiosity by Factor Analysis of the survey items and associated them with regional cortical volumes measured by voxel-based morphometry. Experiencing an intimate relationship with God and engaging in religious behavior was associated with increased volume of R middle temporal cortex, BA 21. Experiencing fear of God was associated with decreased volume of L precuneus and L orbitofrontal cortex BA 11. A cluster of traits related with pragmatism and doubting God's existence was associated with increased volume of the R precuneus. Variability in religiosity of upbringing was not associated with variability in cortical volume of any region. Therefore, key aspects of religiosity are associated with cortical volume differences. This conclusion complements our prior functional neuroimaging findings in elucidating the proximate causes of religion in the brain.

  9. Classifying TDSS Stellar Variables

    Science.gov (United States)

    Amaro, Rachael Christina; Green, Paul J.; TDSS Collaboration

    2017-01-01

    The Time Domain Spectroscopic Survey (TDSS), a subprogram of SDSS-IV eBOSS, obtains classification/discovery spectra of point-source photometric variables selected from PanSTARRS and SDSS multi-color light curves regardless of object color or lightcurve shape. Tens of thousands of TDSS spectra are already available and have been spectroscopically classified both via pipeline and by visual inspection. About half of these spectra are quasars, half are stars. Our goal is to classify the stars with their correct variability types. We do this by acquiring public multi-epoch light curves for brighter stars (rclassifications and parameters in the Catalina Surveys Periodic Variable Star Catalog. Variable star classifications include RR Lyr, close eclipsing binaries, CVs, pulsating white dwarfs, and other exotic systems. The key difference between our catalog and others is that along with the light curves, we will be using TDSS spectra to help in the classification of variable type, as spectra are rich with information allowing estimation of physical parameters like temperature, metallicity, gravity, etc. This work was supported by the SDSS Research Experience for Undergraduates program, which is funded by a grant from Sloan Foundation to the Astrophysical Research Consortium.

  10. Resiliencia y variables sociodemograficas

    OpenAIRE

    Calero Martinez, Edgar David

    2015-01-01

    En el presente trabajo se aborda la definición de una de las variables dentro de lo que se denomina Capital psicológico positivo, la Resiliencia, sus principales características y algunas de las variables socio demográficas que en el estudio pretenden ver el nivel de relación existente entre cada una de ellas (indirecta o directamente) en el proceso resiliente de una persona para posteriores discusiones y su implicación dentro de la gestión empresarial y sus direcciones futuras.

  11. Validation and Variability

    DEFF Research Database (Denmark)

    Carusi, Annamaria

    2014-01-01

    as inter-subject variability. This need is simultaneously social and epistemic: social as systems biologists attempt to engage with the interests and concerns of clinicians and others in applied medical research; epistemic as they attempt to develop new strategies to cope with variability in the validation...... of the computational models typical of systems biology. This paper describes one attempt to develop such a strategy: a trial with a population of models approach in the context of cardiac electrophysiology. I discuss the development of this approach against the background of ongoing tensions between mathematically...

  12. Applied complex variables

    CERN Document Server

    Dettman, John W

    1965-01-01

    Analytic function theory is a traditional subject going back to Cauchy and Riemann in the 19th century. Once the exclusive province of advanced mathematics students, its applications have proven vital to today's physicists and engineers. In this highly regarded work, Professor John W. Dettman offers a clear, well-organized overview of the subject and various applications - making the often-perplexing study of analytic functions of complex variables more accessible to a wider audience. The first half of Applied Complex Variables, designed for sequential study, is a step-by-step treatment of fun

  13. Internal variables in thermoelasticity

    CERN Document Server

    Berezovski, Arkadi

    2017-01-01

    This book describes an effective method for modeling advanced materials like polymers, composite materials and biomaterials, which are, as a rule, inhomogeneous. The thermoelastic theory with internal variables presented here provides a general framework for predicting a material’s reaction to external loading. The basic physical principles provide the primary theoretical information, including the evolution equations of the internal variables. The cornerstones of this framework are the material representation of continuum mechanics, a weak nonlocality, a non-zero extra entropy flux, and a consecutive employment of the dissipation inequality. Examples of thermoelastic phenomena are provided, accompanied by detailed procedures demonstrating how to simulate them.

  14. Terrestrial Carbon Cycle Variability.

    Science.gov (United States)

    Baldocchi, Dennis; Ryu, Youngryel; Keenan, Trevor

    2016-01-01

    A growing literature is reporting on how the terrestrial carbon cycle is experiencing year-to-year variability because of climate anomalies and trends caused by global change. As CO 2 concentration records in the atmosphere exceed 50 years and as satellite records reach over 30 years in length, we are becoming better able to address carbon cycle variability and trends. Here we review how variable the carbon cycle is, how large the trends in its gross and net fluxes are, and how well the signal can be separated from noise. We explore mechanisms that explain year-to-year variability and trends by deconstructing the global carbon budget. The CO 2 concentration record is detecting a significant increase in the seasonal amplitude between 1958 and now. Inferential methods provide a variety of explanations for this result, but a conclusive attribution remains elusive. Scientists have reported that this trend is a consequence of the greening of the biosphere, stronger northern latitude photosynthesis, more photosynthesis by semi-arid ecosystems, agriculture and the green revolution, tropical temperature anomalies, or increased winter respiration. At the global scale, variability in the terrestrial carbon cycle can be due to changes in constituent fluxes, gross primary productivity, plant respiration and heterotrophic (microbial) respiration, and losses due to fire, land use change, soil erosion, or harvesting. It remains controversial whether or not there is a significant trend in global primary productivity (due to rising CO 2 , temperature, nitrogen deposition, changing land use, and preponderance of wet and dry regions). The degree to which year-to-year variability in temperature and precipitation anomalies affect global primary productivity also remains uncertain. For perspective, interannual variability in global gross primary productivity is relatively small (on the order of 2 Pg-C y -1 ) with respect to a large and uncertain background (123 +/- 4 Pg-C y -1 ), and

  15. Complex variables I essentials

    CERN Document Server

    Solomon, Alan D

    2013-01-01

    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Complex Variables I includes functions of a complex variable, elementary complex functions, integrals of complex functions in the complex plane, sequences and series, and poles and r

  16. Biological Sampling Variability Study

    Energy Technology Data Exchange (ETDEWEB)

    Amidan, Brett G. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Hutchison, Janine R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2016-11-08

    There are many sources of variability that exist in the sample collection and analysis process. This paper addresses many, but not all, sources of variability. The main focus of this paper was to better understand and estimate variability due to differences between samplers. Variability between days was also studied, as well as random variability within each sampler. Experiments were performed using multiple surface materials (ceramic and stainless steel), multiple contaminant concentrations (10 spores and 100 spores), and with and without the presence of interfering material. All testing was done with sponge sticks using 10-inch by 10-inch coupons. Bacillus atrophaeus was used as the BA surrogate. Spores were deposited using wet deposition. Grime was coated on the coupons which were planned to include the interfering material (Section 3.3). Samples were prepared and analyzed at PNNL using CDC protocol (Section 3.4) and then cultured and counted. Five samplers were trained so that samples were taken using the same protocol. Each sampler randomly sampled eight coupons each day, four coupons with 10 spores deposited and four coupons with 100 spores deposited. Each day consisted of one material being tested. The clean samples (no interfering materials) were run first, followed by the dirty samples (coated with interfering material). There was a significant difference in recovery efficiency between the coupons with 10 spores deposited (mean of 48.9%) and those with 100 spores deposited (mean of 59.8%). There was no general significant difference between the clean and dirty (containing interfering material) coupons or between the two surface materials; however, there was a significant interaction between concentration amount and presence of interfering material. The recovery efficiency was close to the same for coupons with 10 spores deposited, but for the coupons with 100 spores deposited, the recovery efficiency for the dirty samples was significantly larger (65

  17. Proper elimination of latent variables

    NARCIS (Netherlands)

    Polderman, Jan W.

    1997-01-01

    We consider behaviors in which we distinguish two types of variables, manifest variables, the variables that are of interest to the user and latent variables, the variables that are introduced to obtain a first representation. The problem is to find a representation of the manifest behavior, that

  18. Spatial Variability of Rainfall

    DEFF Research Database (Denmark)

    Jensen, N.E.; Pedersen, Lisbeth

    2005-01-01

    As a part of a Local Area Weather Radar (LAWR) calibration exercise 15 km south of Århus, Denmark, the variability in accumulated rainfall within a single radar pixel (500 by 500 m) was measured using nine high-resolution rain gauges. The measured values indicate up to a 100% variation between ne...

  19. Variability in GPS sources

    NARCIS (Netherlands)

    Jauncey, DL; King, EA; Bignall, HE; Lovell, JEJ; Kedziora-Chudczer, L; Tzioumis, AK; Tingay, SJ; Macquart, JP; McCulloch, PM

    2003-01-01

    Flux density monitoring data at 2.3 and 8.4 GHz is presented for a sample of 33 southern hemisphere GPS sources, drawn from the 2.7 GHz Parkes survey. This monitoring data, together with VLBI monitoring data, shows that a small fraction of these sources, similar to10%, vary. Their variability falls

  20. Classes of Instructional Variables.

    Science.gov (United States)

    Reigeluth, Charles M.; Merrill, M. David

    1979-01-01

    Describes three classes of variables which should be considered when one is designing instructional materials, doing research on instruction, or developing better methods of instruction, and proposes a classification scheme which is summarized in the last of the 13 figures that illustrate the article. A blbliography is included. (Author/RAO)

  1. Variable rate irrigation

    Science.gov (United States)

    Systems are available to producers to make variable-rate applications of defoliants, fertilizer, lime, pesticides, plant growth regulators, and seed. These systems could potentially offer cost savings to a producer; however, the full potential of the benefits and savings cannot be realized if water ...

  2. Variable gravity research facility

    Science.gov (United States)

    Allan, Sean; Ancheta, Stan; Beine, Donna; Cink, Brian; Eagon, Mark; Eckstein, Brett; Luhman, Dan; Mccowan, Daniel; Nations, James; Nordtvedt, Todd

    1988-01-01

    Spin and despin requirements; sequence of activities required to assemble the Variable Gravity Research Facility (VGRF); power systems technology; life support; thermal control systems; emergencies; communication systems; space station applications; experimental activities; computer modeling and simulation of tether vibration; cost analysis; configuration of the crew compartments; and tether lengths and rotation speeds are discussed.

  3. Typhoon Structural Variability,

    Science.gov (United States)

    1985-10-01

    1980: An analytical model of the wind and pressure profiles in hurricanes. Mort . KUa. Rev., 108, 8, 1212-1218. Holland, G. J., and R. T. Merrill, 1984...Recipient’s Acce..sion No. SHEET ATS-391 4. Title and Subit le 5. Report Date Typhoon Structural Variability October, 1985 6. 7. Author(s) S. Performing

  4. Variable thrust cartridge

    Science.gov (United States)

    Taleyarkhan, Rusi P.

    2000-11-07

    The present invention is a variable thrust cartridge comprising a water-molten aluminum reaction chamber from which a slug is propelled. The cartridge comprises a firing system that initiates a controlled explosion from the reaction chamber. The explosive force provides a thrust to a slug, preferably contained within the cartridge.

  5. Variability and component composition

    NARCIS (Netherlands)

    T. van der Storm (Tijs)

    2004-01-01

    textabstractIn component-based product populations, feature models have to be described at the component level to be able to benefit from a product family approach. As a consequence, composition of components becomes very complex. We describe how component-level variability can be managed in the

  6. Variable speed generators

    CERN Document Server

    Boldea, Ion

    2005-01-01

    With the deregulation of electrical energy production and distribution, says Boldea (Polytechnical Institute, Timisoara, Romania) producers are looking for ways to tailor their electricity for different markets. Variable-speed electric generators are serving that purpose, up to the 400 megavolt ampere unit size, in Japan since 1996 and Germany sinc

  7. All Those Independent Variables.

    Science.gov (United States)

    Meacham, Merle L.

    This paper presents a case study of a sixth grade remedial math class which illustrates the thesis that only the "experimental attitude," not the "experimental method," is appropriate in the classroom. The thesis is based on the fact that too many independent variables exist in a classroom situation to allow precise measurement. The case study…

  8. Assessing seniors' user experience (UX) of exergames for balance training

    DEFF Research Database (Denmark)

    Nawaz, Ather; Skjæret, Nina; Ystmark, Kristine

    2014-01-01

    of the exergames and their preference to use exergames was assessed using a semi-structured interview, the system usability scale (SUS), and card ranking. The results of the study showed that in order for seniors to use exergames to train their balance, the exergames should particularly focus on challenging tasks......Exergames technologies are increasingly used to help people achieve their exercise requirements including balance training. However, little is known about seniors' user experience of exergame technology for balance training and what factors they consider most important for using the exergames....... This study aims to evaluate user experience and preferences of exergame technologies to train balance and to identify different factors that affect seniors' intention to use exergames. Fourteen healthy senior citizens played three different stepping exergames in a laboratory setting. Seniors' experience...

  9. Unusual recurrent eclipses of the UX Ori star WW Vul

    Science.gov (United States)

    Rostopchina-Shakhovskaja, A. N.; Grinin, V. P.; Shakhovskoi, D. N.

    2012-06-01

    In a prolonged study (about 30 years) of the photometric activity of WW Vul we have discovered unusual eclipses in the light curve of this star. They last 2-3 years and repeat with a period of 13.9 years. One nontrivial feature of these eclipses is that in their deepest part the star's brightness increases. Changes in the color indices during these events indicate that the brightening of the star is caused by reduced extinction in the center of an extended gas-dust structure that periodically intersects the line of sight. Possible mechanisms for these eclipses are discussed briefly.

  10. A Service Based Adaptive U-Learning System Using UX

    Directory of Open Access Journals (Sweden)

    Hwa-Young Jeong

    2014-01-01

    Full Text Available In recent years, traditional development techniques for e-learning systems have been changing to become more convenient and efficient. One new technology in the development of application systems includes both cloud and ubiquitous computing. Cloud computing can support learning system processes by using services while ubiquitous computing can provide system operation and management via a high performance technical process and network. In the cloud computing environment, a learning service application can provide a business module or process to the user via the internet. This research focuses on providing the learning material and processes of courses by learning units using the services in a ubiquitous computing environment. And we also investigate functions that support users’ tailored materials according to their learning style. That is, we analyzed the user’s data and their characteristics in accordance with their user experience. We subsequently applied the learning process to fit on their learning performance and preferences. Finally, we demonstrate how the proposed system outperforms learning effects to learners better than existing techniques.

  11. The UX Moment: A Weave Digital Panel, Part One

    Directory of Open Access Journals (Sweden)

    Pete Coco

    2015-01-01

    Full Text Available In mid-January 2015, Weave reached out to a number of librarians who are doing user experience work with the hope of instigating and documenting the conversation they might have with one another. Coming from not only academic and public libraries, but also library and information science degree programs, the assembled group of professionals is doing and thinking about library user experience in a broad set of contexts and by a variety of means.

  12. UX of Social Network Edmodo in Undergraduate Engineering Students

    Directory of Open Access Journals (Sweden)

    Angélica Gómez

    2015-08-01

    Full Text Available The main objective of this research is to describe the use that students make of an academic SNS (social network service and detail the relationship between socio-demographic and academic factors associated with the use of EDMODO and the perception of the contribution to the acquisition of skills for the future career. In the analysis of user experience, participants positively evaluated EDMODO and found that the level of satisfaction is positively associated with the academic results obtained, and negatively with perceived usefulness in terms of the impact on their grades.

  13. UX in the Wild: on Experience Blend & Embedded Media Design

    NARCIS (Netherlands)

    Koen van Turnhout; Lambert Zaad; René Bakker; Emiel Ruis; Sander van Leer

    2012-01-01

    The internet is becoming a tightly interwoven part of our everyday lives. There is a growing market for web services which augment the daily life of users trough products with an internet connection. We call these real world extensions of the web embedded media. In the last couple of years we

  14. The UX of amila pregnancy on mobile device

    Science.gov (United States)

    Hussain, Azham; Mkpojiogu, Emmanuel O. C.; Fadzil, Najdawati Mohd; Hassan, Norhasizasuriati Mohd

    2017-10-01

    The increased use of mobile devices has led to an upsurge in the number of mobile applications. This makes the usability of these applications a very crucial and critical issue. The Amila Pregnancy mobile app is revolutionizing the delivery of healthcare services to pregnancy woman across the globe and is increasingly becoming beneficial in their daily life. Only a few digital interventions have been developed for pregnant woman, and little is known about the acceptability and usability of such mobile apps that provide assistance to pregnant women. Usability comprises everything that is connected with the intuitive and efficient handling of user interaction with human-made devices. This paper reports the result of a usability evaluation for Amila Pregnancy mobile application. In the study five attributes of perceived usability was measured following Jakob Nielsen principles, namely: effectiveness, efficiency, learnability, memorability and satisfaction. In addition, performance metrics were also captured. The results reveal the difficulty users had in interpreting displayed icon, locating the information provided, re-finding it and in navigating through the mobile app. The study suggests that the main menu of the app need to be further improved upon to enhance its usability.

  15. Improving UXS Network Availability with Asymmetric Polarized MIMO

    Science.gov (United States)

    2013-06-01

    Raven . Weighing four pounds, a Raven can fly on battery power for about one hour. Allowing its controller to “look over the hill,” it relays real...Haykin. Cognitive radio: Brain -empowered wireless communications. IEEE J. Sel. Areas Commun. vol. 23 no. 2, pp. 201–220. 2005. [78] M. McHenry, D

  16. Optical magnetic flux generation in superconductor

    Indian Academy of Sciences (India)

    Author Affiliations. Masayoshi Tonouchi1. Research Center for Superconductor Photonics, Osaka University, and PRESTO/CREST, Japan Science and Technology Corporation (JST), 2-1 Yamadaoka, Suita, Osaka 565-0871, Japan ...

  17. UX concepts, how they affected our development flow.

    CERN Multimedia

    CERN. Geneva

    2017-01-01

    The talk aims at showing the development of Locations before and after this moment, and how the way of thinking at the application changed for taking in account the improvements in the user experience of the application.

  18. A service based adaptive U-learning system using UX.

    Science.gov (United States)

    Jeong, Hwa-Young; Yi, Gangman

    2014-01-01

    In recent years, traditional development techniques for e-learning systems have been changing to become more convenient and efficient. One new technology in the development of application systems includes both cloud and ubiquitous computing. Cloud computing can support learning system processes by using services while ubiquitous computing can provide system operation and management via a high performance technical process and network. In the cloud computing environment, a learning service application can provide a business module or process to the user via the internet. This research focuses on providing the learning material and processes of courses by learning units using the services in a ubiquitous computing environment. And we also investigate functions that support users' tailored materials according to their learning style. That is, we analyzed the user's data and their characteristics in accordance with their user experience. We subsequently applied the learning process to fit on their learning performance and preferences. Finally, we demonstrate how the proposed system outperforms learning effects to learners better than existing techniques.

  19. UX of Social Network Edmodo in Undergraduate Engineering Students

    National Research Council Canada - National Science Library

    Angélica Gómez; Angel Alberto Magreñán; Lara Orcos

    2015-01-01

    ... (social network service) and detail the relationship between socio-demographic and academic factors associated with the use of EDMODO and the perception of the contribution to the acquisition of skills for the future career...

  20. Designing Search UX Strategies for eCommerce Success

    CERN Document Server

    Nudelman, Greg

    2011-01-01

    Best practices, practical advice, and design ideas for successful ecommerce search A glaring gap has existed in the market for a resource that offers a comprehensive, actionable design patterns and design strategies for ecommerce search-but no longer. With this invaluable book, user experience designer and user researcher Greg Nudelman shares his years of experience working on popular ecommerce sites as he tackles even the most difficult ecommerce search design problems. Nudelman helps you create highly effective and intuitive ecommerce search design solutions and he takes a unique forward-thi

  1. Technological Capability's Predictor Variables

    Directory of Open Access Journals (Sweden)

    Fernanda Maciel Reichert

    2011-03-01

    Full Text Available The aim of this study was to identify the factors that influence in configuration of the technological capability of companies in sectors with medium-low technological intensity. To achieve the goal proposed in this article a survey was carried out. Based on the framework developed by Lall (1992 which classifies firms in basic, intermediate and advanced level of technological capability; it was found that the predominant technological capability is intermediate, with 83.7% of respondent companies (plastics companies in Brazil. It is believed that the main contribution of this study is the finding that the dependent variable named “Technological Capability” can be explained at a rate of 65% by six variables: development of new processes; selection of the best equipment supplier; sales of internally developed new technology to third parties; design and manufacture of equipment; study of the work methods and perform inventory control; and improvement of product quality.

  2. Theoretical spectroscopy study of the low-lying electronic states of UX and UX(+), X = F and Cl.

    Science.gov (United States)

    Bross, David H; Peterson, Kirk A

    2015-11-14

    Spectroscopic constants (Te, re, B0, ωe, and ωexe) have been calculated for the low-lying electronic states of UF, UF(+), UCl, and UCl(+) using complete active space 2nd-order perturbation theory (CASPT2), with a series of correlation consistent basis sets. The latter included those based on both pseudopotential (PP) and all-electron Douglas-Kroll-Hess Hamiltonians for the U atom. Spin orbit (SO) effects were included a posteriori using the state interacting method using both PP and Breit Pauli (BP) operators, as well as from exact two-component methods for U(+) and UF(+). Complete basis set (CBS) limits were obtained by extrapolation where possible and the PP and BP calculations were compared at their respective CBS limits. The PP-based method was shown to be reliable in calculating spectroscopic constants, in particular when using the state interacting method with CASPT2 energies (SO-CASPT2). The two component calculations were limited by computational resources and could not include electron correlation from the nominally closed shell 6s and 6p orbitals of U. UF and UCl were both calculated to have Ω = 9/2 ground states. The first excited state of UCl was calculated to be an Ω = 7/2 state at 78 cm(-1) as opposed to the same state at 435 cm(-1) in UF, and the other low-lying states of UCl showed a similar compression relative to UF. Likewise, UF(+) and UCl(+) both have Ω = 4 ground states and the manifold of low-lying excited Ω = 3, 2, 1, 0 states was energetically closer together in UCl(+) than in UF(+), ranging up to 776 cm(-1) in UF(+) and only 438 cm(-1) in UCl(+). As in previous studies, the final PP-based SO-CASPT2 results for UF(+) and UF agree well with experiment and are expected to be predictive for UCl and UCl(+), which are reported here for the first time.

  3. Theoretical spectroscopy study of the low-lying electronic states of UX and UX+, X = F and Cl

    Science.gov (United States)

    Bross, David H.; Peterson, Kirk A.

    2015-11-01

    Spectroscopic constants (Te, re, B0, ωe, and ωexe) have been calculated for the low-lying electronic states of UF, UF+, UCl, and UCl+ using complete active space 2nd-order perturbation theory (CASPT2), with a series of correlation consistent basis sets. The latter included those based on both pseudopotential (PP) and all-electron Douglas-Kroll-Hess Hamiltonians for the U atom. Spin orbit (SO) effects were included a posteriori using the state interacting method using both PP and Breit Pauli (BP) operators, as well as from exact two-component methods for U+ and UF+. Complete basis set (CBS) limits were obtained by extrapolation where possible and the PP and BP calculations were compared at their respective CBS limits. The PP-based method was shown to be reliable in calculating spectroscopic constants, in particular when using the state interacting method with CASPT2 energies (SO-CASPT2). The two component calculations were limited by computational resources and could not include electron correlation from the nominally closed shell 6s and 6p orbitals of U. UF and UCl were both calculated to have Ω = 9/2 ground states. The first excited state of UCl was calculated to be an Ω = 7/2 state at 78 cm-1 as opposed to the same state at 435 cm-1 in UF, and the other low-lying states of UCl showed a similar compression relative to UF. Likewise, UF+ and UCl+ both have Ω = 4 ground states and the manifold of low-lying excited Ω = 3, 2, 1, 0 states was energetically closer together in UCl+ than in UF+, ranging up to 776 cm-1 in UF+ and only 438 cm-1 in UCl+. As in previous studies, the final PP-based SO-CASPT2 results for UF+ and UF agree well with experiment and are expected to be predictive for UCl and UCl+, which are reported here for the first time.

  4. Complex variable HVPT

    Energy Technology Data Exchange (ETDEWEB)

    Killingbeck, John P [Mathematics Department, University of Hull, Hull HU6 7RX (United Kingdom); Grosjean, Alain [Laboratoire d' Astrophysique de l' Observatoire de Besancon (CNRS, UPRES-A 6091), 41 bis Avenue de l' Observatoire, BP 1615, 25010 Besancon Cedex (France); Jolicard, Georges [Laboratoire d' Astrophysique de l' Observatoire de Besancon (CNRS, UPRES-A 6091), 41 bis Avenue de l' Observatoire, BP 1615, 25010 Besancon Cedex (France)

    2004-08-13

    Complex variable hypervirial perturbation theory is applied to the case of oscillator and Coulomb potentials perturbed by a single term potential of the form Vx{sup n} or Vr{sup n}, respectively. The trial calculations reported show that this approach can produce accurate complex energies for resonant states via a simple and speedy calculation and can also be useful in studies of PT symmetry and tunnelling resonance effects. (addendum)

  5. Spreading with variable viscosity

    OpenAIRE

    Foit, J.J.

    1997-01-01

    Ausbreitung mit variabler Viskosität Die isotherme Ausbreitung eines Volumenstromes, , in Form von dünnen Schichten kann mit Hilfe selbstähnlicher Lösungen beschrieben werden (Huppert). Für die axialsymmetrische Ausbreitung eines konstanten Volumens mit einer variablen Viskosität von der Form existieren ebenfalls selbstähnliche Lösungen (Sakimoto, Zuber). Dieses Ergebnis wird auf den Fall einer eindimensionalen und einer axialsymmetrischen Ausbreitung für alle , erweitert.

  6. Historical Variable Star Catalogs

    OpenAIRE

    Pagnotta, Ashley; Graur, Or; Murray, Zachary; Kruk, Julia; Christie-Dervaux, Lucien; Chen, Dong Yi

    2015-01-01

    Slides from my talk during one of the Historical Astronomy Division sessions at AAS 225 in Seattle, WA (January 2015). A brief history of the variable star catalogs Henrietta Swan Leavitt and Cecilia Payne-Gaposchkin assembled at Harvard, and the update to them that some of our students at AMNH have done.(Figshare only previews the first few slides. Download the PDF to see all of them!)

  7. Score test variable screening

    OpenAIRE

    Zhao, Sihai Dave; Li, Yi

    2014-01-01

    Variable screening has emerged as a crucial first step in the analysis of high-throughput data, but existing procedures can be computationally cumbersome, difficult to justify theoretically, or inapplicable to certain types of analyses. Motivated by a high-dimensional censored quantile regression problem in multiple myeloma genomics, this paper makes three contributions. First, we establish a score test-based screening framework, which is widely applicable, extremely computationally efficient...

  8. Short Timescale Variability In The Faint Sky Variability Survey

    NARCIS (Netherlands)

    Morales-Rueda, L.; Groot, P.J.; Augusteijn, T.; Nelemans, G.A.; Vreeswijk, P.M.; Besselaar, E.J.M. van den

    2006-01-01

    We present the V band variability analysis of the point sources in the Faint Sky Variability Survey on time scales from 24 minutes to tens of days. We find that about one percent of the point sources down to V = 24 are variables. We discuss the variability detection probabilities for each field

  9. Short timescale variability in the faint sky variability survey

    NARCIS (Netherlands)

    Morales-Rueda, L.; Groot, P.J.; Augusteijn, T.; Nelemans, G.A.; Vreeswijk, P.M.; Besselaar, E.J.M. van den

    2006-01-01

    We present the V-band variability analysis of the Faint Sky Variability Survey (FSVS). The FSVS combines colour and time variability information, from timescales of 24 minutes to tens of days, down to V = 24. We find that �1% of all point sources are variable along the main sequence reaching �3.5%

  10. Population effects and variability.

    Science.gov (United States)

    Dorne, Jean Lou; Amzal, Billy; Bois, Frédéric; Crépet, Amélie; Tressou, Jessica; Verger, Philippe

    2012-01-01

    Chemical risk assessment for human health requires a multidisciplinary approach through four steps: hazard identification and characterization, exposure assessment, and risk characterization. Hazard identification and characterization aim to identify the metabolism and elimination of the chemical (toxicokinetics) and the toxicological dose-response (toxicodynamics) and to derive a health-based guidance value for safe levels of exposure. Exposure assessment estimates human exposure as the product of the amount of the chemical in the matrix consumed and the consumption itself. Finally, risk characterization evaluates the risk of the exposure to human health by comparing the latter to with the health-based guidance value. Recently, many research efforts in computational toxicology have been put together to characterize population variability and uncertainty in each of the steps of risk assessment to move towards more quantitative and transparent risk assessment. This chapter focuses specifically on modeling population variability and effects for each step of risk assessment in order to provide an overview of the statistical and computational tools available to toxicologists and risk assessors. Three examples are given to illustrate the applicability of those tools: derivation of pathway-related uncertainty factors based on population variability, exposure to dioxins, dose-response modeling of cadmium.

  11. Regularization by External Variables

    DEFF Research Database (Denmark)

    Bossolini, Elena; Edwards, R.; Glendinning, P. A.

    2016-01-01

    Regularization was a big topic at the 2016 CRM Intensive Research Program on Advances in Nonsmooth Dynamics. There are many open questions concerning well known kinds of regularization (e.g., by smoothing or hysteresis). Here, we propose a framework for an alternative and important kind of regula...... of regularization, by external variables that shadow either the state or the switch of the original system. The shadow systems are derived from and inspired by various applications in electronic control, predator-prey preference, time delay, and genetic regulation....

  12. Atmospheric Infrared Radiance Variability.

    Science.gov (United States)

    1981-05-27

    ATMOSPHERIC VARIABILITY ON INFRARED RADIANCE PREDICTIONS - T. C. Degges 53 5. ATMOSPHERIC STRUCTURE - C.H. HLmphrey, C.R. Philbrick, S.M. Silverman , T.F. Tuan...variations similar to those shown in Figure 2. In arctic and subarctic regions, sudden warmings and coolings of the winter stratosphere and mesosphere... Silverman \\Jr I",rre. (;.L~~sIalmratorN Hanscom Air Force Base, Manss. T.F. Tuan Universitv of Cincinnati Cincinnati, (tio M. Anapol S.S.G.. Inc. Waltham

  13. Variable camshaft timing system

    Energy Technology Data Exchange (ETDEWEB)

    Butterfield, R.P.; Smith, F.R.

    1989-09-05

    This patent describes an improvement in a variable camshaft timing system for an internal combustion engine having intake and exhaust valves and a camshaft for each of the intake and exhaust valves, an intake sprocket and an exhaust sprocket keyed to their respective camshaft, only one of the camshafts being directly driven by an engine crankshaft, and a timing chain engaging both sprockets. The improvement comprising a single bracket carrying at least one idler sprocket engaging the timing chain, the bracket being mounted for movement to alter the timing relationship between the intake and exhaust sprockets.

  14. Complex variables II essentials

    CERN Document Server

    Solomon, Alan D

    2013-01-01

    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Complex Variables II includes elementary mappings and Mobius transformation, mappings by general functions, conformal mappings and harmonic functions, applying complex functions to a

  15. Glycemic variability: Clinical implications

    Directory of Open Access Journals (Sweden)

    Surabhi Venkata Satya Krishna

    2013-01-01

    Full Text Available Glycemic control and its benefits in preventing microvascular diabetic complications are convincingly proved by various prospective trials. Diabetes control and complications trial (DCCT had reported variable glycated hemoglobin (HbA1C as a cause of increased microvascular complications in conventional glycemic control group versus intensive one. However, in spite of several indirect evidences, its link with cardiovascular events or macrovascular complications is still not proved. Glycemic variability (GV is one more tool to explain relation between hyperglycemia and increased cardiovascular risk in diabetic patients. In fact GV along with fasting blood sugar, postprandial blood sugar, HbA1C, and quality of life has been proposed to form glycemic pentad, which needs to be considered in diabetes management. Postprandial spikes in blood glucose as well as hypoglycemic events, both are blamed for increased cardiovascular events in Type 2 diabetics. GV includes both these events and hence minimizing GV can prevent future cardiovascular events. Modern diabetes management modalities including improved sulfonylureas, glucagon like peptide-1 (GLP-1-based therapy, newer basal insulins, and modern insulin pumps address the issue of GV effectively. This article highlights mechanism, clinical implications, and measures to control GV in clinical practice.

  16. Score test variable screening.

    Science.gov (United States)

    Zhao, Sihai Dave; Li, Yi

    2014-12-01

    Variable screening has emerged as a crucial first step in the analysis of high-throughput data, but existing procedures can be computationally cumbersome, difficult to justify theoretically, or inapplicable to certain types of analyses. Motivated by a high-dimensional censored quantile regression problem in multiple myeloma genomics, this article makes three contributions. First, we establish a score test-based screening framework, which is widely applicable, extremely computationally efficient, and relatively simple to justify. Secondly, we propose a resampling-based procedure for selecting the number of variables to retain after screening according to the principle of reproducibility. Finally, we propose a new iterative score test screening method which is closely related to sparse regression. In simulations we apply our methods to four different regression models and show that they can outperform existing procedures. We also apply score test screening to an analysis of gene expression data from multiple myeloma patients using a censored quantile regression model to identify high-risk genes. © 2014, The International Biometric Society.

  17. Variable Valve Actuation

    Energy Technology Data Exchange (ETDEWEB)

    Jeffrey Gutterman; A. J. Lasley

    2008-08-31

    Many approaches exist to enable advanced mode, low temperature combustion systems for diesel engines - such as premixed charge compression ignition (PCCI), Homogeneous Charge Compression Ignition (HCCI) or other HCCI-like combustion modes. The fuel properties and the quantity, distribution and temperature profile of air, fuel and residual fraction in the cylinder can have a marked effect on the heat release rate and combustion phasing. Figure 1 shows that a systems approach is required for HCCI-like combustion. While the exact requirements remain unclear (and will vary depending on fuel, engine size and application), some form of substantially variable valve actuation is a likely element in such a system. Variable valve actuation, for both intake and exhaust valve events, is a potent tool for controlling the parameters that are critical to HCCI-like combustion and expanding its operational range. Additionally, VVA can be used to optimize the combustion process as well as exhaust temperatures and impact the after treatment system requirements and its associated cost. Delphi Corporation has major manufacturing and product development and applied R&D expertise in the valve train area. Historical R&D experience includes the development of fully variable electro-hydraulic valve train on research engines as well as several generations of mechanical VVA for gasoline systems. This experience has enabled us to evaluate various implementations and determine the strengths and weaknesses of each. While a fully variable electro-hydraulic valve train system might be the 'ideal' solution technically for maximum flexibility in the timing and control of the valve events, its complexity, associated costs, and high power consumption make its implementation on low cost high volume applications unlikely. Conversely, a simple mechanical system might be a low cost solution but not deliver the flexibility required for HCCI operation. After modeling more than 200 variations of

  18. Chatter Prediction for Variable Pitch and Variable Helix Milling

    Directory of Open Access Journals (Sweden)

    Yong Wang

    2015-01-01

    Full Text Available Regenerative chatter is a self-excited vibration that can occur during milling, which shortens the lifetime of the tool and results in unacceptable surface quality. In this paper, an improved semidiscretization method for modeling and simulation with variable pitch and variable helix milling is proposed. Because the delay between each flute varies along the axial depth of the tool in milling, the cutting tool is discrete into some axial layers to simplify calculation. A comparison of the predicted and observed performance of variable pitch and variable helix against uniform pitch and uniform helix milling is presented. It is shown that variable pitch and variable helix milling can obtain larger stable cutting area than uniform pitch and uniform helix milling. Thus, it is concluded that variable pitch and variable helix milling are an effective way for suppressing chatter.

  19. Variable cycle engine

    Energy Technology Data Exchange (ETDEWEB)

    Adamson, A.P.; Sprunger, E.V.

    1980-09-16

    A variable cycle turboshaft engine includes a remote fan system and respective high and low pressure systems for selectively driving the fan system in such a manner as to provide VTOL takeoff capability and minimum specific fuel consumption (SFC) at cruise and loiter conditions. For takeoff the fan system is primarily driven by the relatively large low pressure system whose combustor receives the motive fluid from a core bypass duct and, for cruise and loiter conditions, the fan system is driven by both a relatively small high pressure core and the low pressure system with its combustor inoperative. A mixer is disposed downstream of the high pressure system for mixing the relatively cold air from the bypass duct and the relatively hot air from the core prior to its flow to the low pressure turbine.

  20. Variable Amplitude Fatigue

    Science.gov (United States)

    Ranganathan, Narayanaswami; Joly, Damien; Leroy, René

    Fatigue crack growth behavior of selected aluminum alloys under variable amplitude loading is discussed in this study, based principally on experimental observations. The tests include single overloads tests in different environments, block load tests and tests using an aircraft wing loading spectrum. It is shown that conditions favoring a planar slip behavior lead to very high delays as opposed to conditions leading to multiple slip behavior. The Aluminium Liithium alloy studied here, has the best fatigue crack growth resistance in almost all test conditions studied here as compared to other conventional alloys. Under the spectrum loading studied here, the same alloy exhibits a change in micromechanism leading to a four fould acceleration of growth rates. Acceptable life predictions can be made, by taking into account this crack acceleration effect.

  1. Gait Variability and Multiple Sclerosis

    Directory of Open Access Journals (Sweden)

    Michael J. Socie

    2013-01-01

    Full Text Available Gait variability, that is, fluctuations in movement during walking, is an indicator of walking function and has been associated with various adverse outcomes such as falls. In this paper, current research concerning gait variability in persons with multiple sclerosis (MS is discussed. It is well established that persons with MS have greater gait variability compared to age and gender matched controls without MS. The reasons for the increase in gait variability are not completely understood. Evidence indicates that disability level, assistive device use, attentional requirement, and fatigue are related to gait variability in persons with MS. Future research should address the time-evolving structure (i.e., temporal characteristics of gait variability, the clinical importance of gait variability, and underlying mechanisms that drive gait variability in individuals with MS.

  2. Modeling Shared Variables in VHDL

    DEFF Research Database (Denmark)

    Madsen, Jan; Brage, Jens P.

    1994-01-01

    A set of concurrent processes communicating through shared variables is an often used model for hardware systems. This paper presents three modeling techniques for representing such shared variables in VHDL, depending on the acceptable constraints on accesses to the variables. Also a set...... of guidelines for handling atomic updates of multiple shared variables is given. 1 Introduction It is often desirable to partition a computational system into discrete functional units which cooperates to....

  3. Strong Decomposition of Random Variables

    DEFF Research Database (Denmark)

    Hoffmann-Jørgensen, Jørgen; Kagan, Abram M.; Pitt, Loren D.

    2007-01-01

    A random variable X is stongly decomposable if X=Y+Z where Y=Φ(X) and Z=X-Φ(X) are independent non-degenerated random variables (called the components). It is shown that at least one of the components is singular, and we derive a necessary and sufficient condition for strong decomposability...... of a discrete random variable....

  4. THE VARIABILITY OF INTERLANGUAGE USE

    African Journals Online (AJOL)

    www

    This pattern of linguistic behaviour is called "non-systematic variability". In this article, the phenomenon of this variability in L2 knowledge is investigated. The existing body of knowledge about L2 acquisition provides ample proof that L2 learners are characteristically variable in their interlanguage use. The question arises ...

  5. Preservice Teachers' Understanding of Variable

    Science.gov (United States)

    Brown, Sue; Bergman, Judy

    2013-01-01

    This study examines the research on middle school students' understanding of variables and explores preservice elementary and middle school teachers' knowledge of variables. According to research studies, middle school students have limited understanding of variables. Many studies have examined the performance of middle school students and offered…

  6. Integration i flere variable

    DEFF Research Database (Denmark)

    Markvorsen, Steen

    2010-01-01

    Denne note handler om parameterfremstillinger for kurver, flader og rumlige områder og om integration af funktioner på sådanne geometriske objekter. Formålet er primært at opstille og motivere de generelle definitioner og beregninger af henholdsvis kurve- \\, flade- \\, og rum-integraler. Udgangspu......Denne note handler om parameterfremstillinger for kurver, flader og rumlige områder og om integration af funktioner på sådanne geometriske objekter. Formålet er primært at opstille og motivere de generelle definitioner og beregninger af henholdsvis kurve- \\, flade- \\, og rum......-integralerne. Undervejs introduceres \\texttt{Integrator8}. Det er en pakke med Maple procedurer, som er udviklet specielt med henblik på eksempelbaseret visuel læring af de indledende integrationsbegreber og deres mangfoldige anvendelser. Vi giver eksempler på, hvordan integration i flere variable anvendes til beregning...... og forståelse af rumfang, vægt, massemidtpunkter, inertimomenter, kraftmomenter, etc. Flowkurverne for et givet vektorfelt i rummet kan findes og visualiseres med \\texttt{Integrator8}. De vigtige begreber divergens og rotation for et vektorfelt fremtræder derved som naturlige størrelser til...

  7. Variables moderadoras del estres

    Directory of Open Access Journals (Sweden)

    María Cristina Richaud de Minzi

    1999-01-01

    Full Text Available El objetivo del presente trabajo es analizar la influenciadel estilo atribucional, la confianza interpersonal y el soporte social sobre la percepción de la amenaza. Se administraron la Escala de Estilo Atribucional; la Manheim Interview 01 Social Support, la Escala de Confianza Interpersonal; y el Inventario de Situaciones y Respuestas de Ansiedad, a 260 sujetos de ambos sexos, de 30 años de edad promedio, de nivel socioeconómico medio, residentes en la ciudad de Buenos Aires. El soporte social no demostró influencia significativa sobre la percepción de la amenaza. Con respecto a la influencia del estilo atribucional se puede decir que las personas indefensas perciben más amenaza, especialmente expresada como ansiedad cognitiva y, en menor grado, como ansiedad motora o conductual. La confianza interpersonal demostró ser una variable importante en la percepción de la amenaza. Los sujetos que presentaron alta desconfianza hacia las personas de su entorno perciben un mundo amenazante, que se manifiesta como ansiedad cognitiva, fisiológica y motora o conductual.

  8. Hydrostatic continuously variable transmission

    Energy Technology Data Exchange (ETDEWEB)

    Hayashi, T.; Saito, M.; Matsuto, T.; Nakajima, Y.; Sakakibara, K.; Yakigaya, N.; Nakamura, K.

    1989-05-09

    A hydrostatic continuously variable transmission is described, comprising: a swashplate type hydraulic pump having a pump swashplate and annularly arranged pump plungers whose suction and discharge strokes are provided by the pump swashplate; a swashplate type hydraulic motor having a motor swashplate and annularly arranged motor plungers whose expansion and shrinkage strokes are provided by the motor swashplate; and a hydraulic closed circuit formed between the hydraulic pump and the hydraulic motor. The transmission has at least one of a relationship that a middle point of a discharge region of the hydraulic pump is angularly delayed at a given angle in a direction of rotation of the hydraulic pump relative to a tilting axis of the pump swashplate and a relationship that a middle point of an expansion region of the hydraulic motor is angularly advanced at a given angle in a direction of rotation of the hydraulic motor relative to a tilting axis of the motor swashplate, wherein the transmission has at least one of a relationship that a suction region of the hydraulic pump is set at an angle larger than that of the discharge region thereof and a relationship that a shrinkage region of the hydraulic motor is set at an angle larger than that of the expansion region of the motor.

  9. Variable subsistence indemnity

    CERN Document Server

    1999-01-01

    At its meeting on 9 December 1998, the Finance Committee approved, with effect from 1st January 1999, adjustments to the Variable Subsistence Indemnity according to the rates published by the United Nations Organization given in document CERN/FC/4113. This decision maintained the reference method in force since 1983. The Management now proposes to adjust the CERN rates of indemnities, with effect from 1st January 2000, on the basis of the United Nations 1999 rates, as shown for typical destinations in the table contained in this document. Although a precise estimate of the cost effect for duty travel is difficult to achieve due to currency exchange values, it is probable that this will remain unchanged if calculated in Swiss francs. The Management also proposes to formalise the practice of paying a lower subsistence indemnity than the approved basic amount, wherever feasible for events such as group duty travel to conferences or similar events, as discussed at the Finance Committee in December 1998. An amendm...

  10. Variable angle correlation spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Young Kyo [Univ. of California, Berkeley, CA (United States)

    1994-05-01

    In this dissertation, a novel nuclear magnetic resonance (NMR) technique, variable angle correlation spectroscopy (VACSY) is described and demonstrated with 13C nuclei in rapidly rotating samples. These experiments focus on one of the basic problems in solid state NMR: how to extract the wealth of information contained in the anisotropic component of the NMR signal while still maintaining spectral resolution. Analysis of the anisotropic spectral patterns from poly-crystalline systems reveal information concerning molecular structure and dynamics, yet in all but the simplest of systems, the overlap of spectral patterns from chemically distinct sites renders the spectral analysis difficult if not impossible. One solution to this problem is to perform multi-dimensional experiments where the high-resolution, isotropic spectrum in one dimension is correlated with the anisotropic spectral patterns in the other dimensions. The VACSY technique incorporates the angle between the spinner axis and the static magnetic field as an experimental parameter that may be incremented during the course of the experiment to help correlate the isotropic and anisotropic components of the spectrum. The two-dimensional version of the VACSY experiments is used to extract the chemical shift anisotropy tensor values from multi-site organic molecules, study molecular dynamics in the intermediate time regime, and to examine the ordering properties of partially oriented samples. The VACSY technique is then extended to three-dimensional experiments to study slow molecular reorientations in a multi-site polymer system.

  11. Intraspecific chromosome variability

    Directory of Open Access Journals (Sweden)

    N Dubinin

    2010-12-01

    Full Text Available (Editorial preface. The publication is presented in order to remind us of one of dramatic pages of the history of genetics. It re-opens for the contemporary reader a comprehensive work marking the priority change from plant cytogenetics to animal cytogenetics led by wide population studies which were conducted on Drosophila polytene chromosomes. The year of the publication (1937 became the point of irretrievable branching between the directions of Old World and New World genetics connected with the problems of chromosome variability and its significance for the evolution of the species. The famous book of T. Dobzhansky (1937 was published by Columbia University in the US under the title “Genetics and the origin of species”, and in the shadow of this American ‘skybuilding’ all other works grew dim. It is remarkable that both Dobzhansky and Dubinin come to similar conclusions about the role of chromosomes in speciation. This is not surprising given that they both might be considered as representatives of the Russian genetic school, by their birth and education. Interestingly, Dobzhansky had never referred to the full paper of Dubinin et al. (1937, though a previous short communication in Nature (1936 was included together with all former papers on the related subject. In full, the volume of the original publication printed in the Biological Journal in Moscow comprised 47 pages, in that number 41 pages of the Russian text accompanied by 16 Figs, a table and reference list, and, above all, 6 pages of the English summary. This final part in English is now reproduced in the authors’ version with the only addition being the reference list in the originally printed form.

  12. Spatial variability of groundwater recharge - I. Is it really variable?

    OpenAIRE

    De Silva, RP

    2004-01-01

    The spatial variability of recharge is an important consideration in estimating recharge especially as all methods of estimating it are 'point' estimates and in most places recharge varies in space. This paper along with the accompanying paper attempts to find a suitable answer to the question of taking this variability into account in estimating groundwater recharge. This paper attempts to determine if recharge is actually varying in space and that this is 'true' variability and that it is n...

  13. Variable Sampling Mapping

    Science.gov (United States)

    Smith, Jeffrey, S.; Aronstein, David L.; Dean, Bruce H.; Lyon, Richard G.

    2012-01-01

    The performance of an optical system (for example, a telescope) is limited by the misalignments and manufacturing imperfections of the optical elements in the system. The impact of these misalignments and imperfections can be quantified by the phase variations imparted on light traveling through the system. Phase retrieval is a methodology for determining these variations. Phase retrieval uses images taken with the optical system and using a light source of known shape and characteristics. Unlike interferometric methods, which require an optical reference for comparison, and unlike Shack-Hartmann wavefront sensors that require special optical hardware at the optical system's exit pupil, phase retrieval is an in situ, image-based method for determining the phase variations of light at the system s exit pupil. Phase retrieval can be used both as an optical metrology tool (during fabrication of optical surfaces and assembly of optical systems) and as a sensor used in active, closed-loop control of an optical system, to optimize performance. One class of phase-retrieval algorithms is the iterative transform algorithm (ITA). ITAs estimate the phase variations by iteratively enforcing known constraints in the exit pupil and at the detector, determined from modeled or measured data. The Variable Sampling Mapping (VSM) technique is a new method for enforcing these constraints in ITAs. VSM is an open framework for addressing a wide range of issues that have previously been considered detrimental to high-accuracy phase retrieval, including undersampled images, broadband illumination, images taken at or near best focus, chromatic aberrations, jitter or vibration of the optical system or detector, and dead or noisy detector pixels. The VSM is a model-to-data mapping procedure. In VSM, fully sampled electric fields at multiple wavelengths are modeled inside the phase-retrieval algorithm, and then these fields are mapped to intensities on the light detector, using the properties

  14. HOW NORMAL IS VARIABLE, OR HOW VARIABLE IS NORMAL

    NARCIS (Netherlands)

    TOUWEN, BCL

    Variability is an important property of the central nervous system, and it shows characteristic changes during infancy and childhood. The large amount of variations in the performance of sensomotor functions in infancy is called indiscriminate or primary variability. During toddling age the child

  15. Variable Speed Rotor System Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Variable speed rotors will give helicopters several advantages: higher top speed, greater fuel efficiency, momentary emergency over-power, resonance detuning...

  16. The Hubble Catalog of Variables

    Directory of Open Access Journals (Sweden)

    Sokolovsky K.

    2017-01-01

    Full Text Available We aim to construct an exceptionally deep (V ≲ 27 catalog of variable objects in selected Galactic and extragalactic fields visited multiple times by the Hubble Space Telescope (HST. While HST observations of some of these fields were searched for specific types of variables before (most notably, the extragalactic Cepheids, we attempt a systematic study of the population of variable objects of all types at the magnitude range not easily accessible with ground-based telescopes. The variability timescales that can be probed range from hours to years depending on how often a particular field has been visited. For source extraction and cross-matching of sources between visits we rely on the Hubble Source Catalog which includes 107 objects detected with WFPC2, ACS, and WFC3 HST instruments. The lightcurves extracted from the HSC are corrected for systematic effects by applying local zero-point corrections and are screened for bad measurements. For each lightcurve we compute variability indices sensitive to a broad range of variability types. The indices characterize the overall lightcurve scatter and smoothness. Candidate variables are selected as having variability index values significantly higher than expected for objects of similar brightness in the given set of observations. The Hubble Catalog of Variables will be released in 2018.

  17. Modifying the Standard Disk Model for the Ultraviolet Spectral Analysis of Disk-dominated Cataclysmic Variables. I. The Novalikes MV Lyrae, BZ Camelopardalis, and V592 Cassiopeiae

    Science.gov (United States)

    Godon, Patrick; Sion, Edward M.; Balman, Şölen; Blair, William P.

    2017-09-01

    The standard disk is often inadequate to model disk-dominated cataclysmic variables (CVs) and generates a spectrum that is bluer than the observed UV spectra. X-ray observations of these systems reveal an optically thin boundary layer (BL) expected to appear as an inner hole in the disk. Consequently, we truncate the inner disk. However, instead of removing the inner disk, we impose the no-shear boundary condition at the truncation radius, thereby lowering the disk temperature and generating a spectrum that better fits the UV data. With our modified disk, we analyze the archival UV spectra of three novalikes that cannot be fitted with standard disks. For the VY Scl systems MV Lyr and BZ Cam, we fit a hot inflated white dwarf (WD) with a cold modified disk (\\dot{M} ˜ a few 10-9 M ⊙ yr-1). For V592 Cas, the slightly modified disk (\\dot{M}˜ 6× {10}-9 {M}⊙ {{yr}}-1) completely dominates the UV. These results are consistent with Swift X-ray observations of these systems, revealing BLs merged with ADAF-like flows and/or hot coronae, where the advection of energy is likely launching an outflow and heating the WD, thereby explaining the high WD temperature in VY Scl systems. This is further supported by the fact that the X-ray hardness ratio increases with the shallowness of the UV slope in a small CV sample we examine. Furthermore, for 105 disk-dominated systems, the International Ultraviolet Explorer spectra UV slope decreases in the same order as the ratio of the X-ray flux to optical/UV flux: from SU UMa’s, to U Gem’s, Z Cam’s, UX UMa’s, and VY Scl’s.

  18. Variability in human body size

    Science.gov (United States)

    Annis, J. F.

    1978-01-01

    The range of variability found among homogeneous groups is described and illustrated. Those trends that show significantly marked differences between sexes and among a number of racial/ethnic groups are also presented. Causes of human-body size variability discussed include genetic endowment, aging, nutrition, protective garments, and occupation. The information is presented to aid design engineers of space flight hardware and equipment.

  19. Students' Misconceptions about Random Variables

    Science.gov (United States)

    Kachapova, Farida; Kachapov, Ilias

    2012-01-01

    This article describes some misconceptions about random variables and related counter-examples, and makes suggestions about teaching initial topics on random variables in general form instead of doing it separately for discrete and continuous cases. The focus is on post-calculus probability courses. (Contains 2 figures.)

  20. Phonological Variability in Canadian English.

    Science.gov (United States)

    de Wolf, Gaelan Dodds

    A study compared salient variables of Canadian English from two concurrent sociodialectal surveys, one for Ottawa, Ontario and one for Vancouver, British Columbia. Using the Labovian model of phonological variation in association with sociological parameters and other linguistic variables within each specific area, the analysis investigated four…

  1. A process variability control chart

    NARCIS (Netherlands)

    Riaz, M.; Does, R.J.M.M.

    2009-01-01

    In this study a Shewhart type control chart namely the Vt chart, is proposed for improvedmonitoring of the process variability of a quality characteristic of interest Y . The proposed control chart is based on the ratio type estimator of the variance using a single auxiliary variable X. It is

  2. Speed control variable rate irrigation

    Science.gov (United States)

    Speed control variable rate irrigation (VRI) is used to address within field variability by controlling a moving sprinkler’s travel speed to vary the application depth. Changes in speed are commonly practiced over areas that slope, pond or where soil texture is predominantly different. Dynamic presc...

  3. New Scaling Model for Variables and Increments with Heavy-Tailed Distributions

    Science.gov (United States)

    Riva, Monica; Guadagnini, Alberto; Neuman, Shlomo P.

    2015-04-01

    Many earth, environmental, ecological, biological, physical, social, financial and other variables, Y , exhibit (i) asymmetry in sample frequency distributions, as well as (ii) symmetry in distributions of their spatial and/or temporal increments, ΔY , at diverse separation distances (or lags), with sharp peaks and heavy tails which appear to decay asymptotically (often toward exponential tails of the Gaussian distribution) as lag increases. No model known to us captures all of these behaviors in a unique and consistent manner. We propose a new model that does so upon treating Y (x) as a random function of a coordinate x in the Euclidean (spatial) domain or time, forming a stationary random field (or process) with constant ensemble mean (expectation) . We express the zero-mean random fluctuation Y '(x) = Y (x) - in sub-Gaussian form. In the classical sub-Gaussian form, Y '(x) = UG(x), where G(x) is a zero-mean stationary Gaussian random field (or process) and the subordinator U is an independent non-negative random variable (Samorodnitsky and Taqqu, 2014). We generalize this by writing Y '(x) = U(x)G(x) in which U(x) is iid. This enables us to analyze, and synthetically generate, heavy-tailed non-Gaussian distributions of both Y and ΔY in both probability space (across an infinite ensemble of random realizations) and real space (in a single realization). We derive analytical expressions for probability distribution functions (pdf s) of Y and ΔY as well as their lead statistical moments. We show that when U is lognormal Y follows the well-known normal-lognormal distribution (NLN, of which the Gaussian distribution is a particular case) with constant parameters. The NLN pdf has been successfully used to interpret financial (Clark, 1973) and environmental (Guadagnini et al., 2014) data. However, ΔY is not NLN and forcing the latter on the former gives a false and widely accepted impression that (a) parameters of the ΔY pdf vary with lag and (b) the pdfs of Y and

  4. Association between oral variables and heart rate variability.

    Science.gov (United States)

    Santana, Milana Drumond Ramos; de Souza, Ana Cecilia Amorim; de Abreu, Luiz Carlos; Valenti, Vitor E

    2013-12-27

    The heart rate variability is a useful method to assess cardiac autonomic modulation in patients undergoing dental procedures, because knowledge of physiological conditions provides greater security to the professional as well as the possibility of a better plan treatment to patient benefit. The aim of our study was to describe the association between cardiac autonomic control and dental variables. We consulted the databases Medline, SciELO, Lilacs and Cochrane, using the terms "autonomic", "dentistry", "heart rate variability", "cardiovascular physiology." The selected studies indicated a strong relationship between dental variables and HRV. There was an association between malocclusion, TMD, dental procedures cirugia and low HRV. Thus, they become more studies that relate to HRV in dental science, especially in clinical practice.

  5. Variable pixel size ionospheric tomography

    Science.gov (United States)

    Zheng, Dunyong; Zheng, Hongwei; Wang, Yanjun; Nie, Wenfeng; Li, Chaokui; Ao, Minsi; Hu, Wusheng; Zhou, Wei

    2017-06-01

    A novel ionospheric tomography technique based on variable pixel size was developed for the tomographic reconstruction of the ionospheric electron density (IED) distribution. In variable pixel size computerized ionospheric tomography (VPSCIT) model, the IED distribution is parameterized by a decomposition of the lower and upper ionosphere with different pixel sizes. Thus, the lower and upper IED distribution may be very differently determined by the available data. The variable pixel size ionospheric tomography and constant pixel size tomography are similar in most other aspects. There are some differences between two kinds of models with constant and variable pixel size respectively, one is that the segments of GPS signal pay should be assigned to the different kinds of pixel in inversion; the other is smoothness constraint factor need to make the appropriate modified where the pixel change in size. For a real dataset, the variable pixel size method distinguishes different electron density distribution zones better than the constant pixel size method. Furthermore, it can be non-chided that when the effort is spent to identify the regions in a model with best data coverage. The variable pixel size method can not only greatly improve the efficiency of inversion, but also produce IED images with high fidelity which are the same as a used uniform pixel size method. In addition, variable pixel size tomography can reduce the underdetermined problem in an ill-posed inverse problem when the data coverage is irregular or less by adjusting quantitative proportion of pixels with different sizes. In comparison with constant pixel size tomography models, the variable pixel size ionospheric tomography technique achieved relatively good results in a numerical simulation. A careful validation of the reliability and superiority of variable pixel size ionospheric tomography was performed. Finally, according to the results of the statistical analysis and quantitative comparison, the

  6. Symmetrization of binary random variables

    OpenAIRE

    Kagan, Abram; Mallows, Colin L.; Shepp, Larry A.; Vanderbei, Robert J.; Vardi, Yehuda

    1999-01-01

    A random variable [math] is called an independent symmetrizer of a given random variable [math] if (a) it is independent of [math] and (b) the distribution of [math] is symmetric about [math] . In cases where the distribution of [math] is symmetric about its mean, it is easy to see that the constant random variable [math] is a minimum-variance independent symmetrizer. Taking [math] to have the same distribution as [math] clearly produces a symmetric sum, but it may not be of minimum variance....

  7. Solar Variability and Planetary Climates

    CERN Document Server

    Calisesi, Y; Gray, L; Langen, J; Lockwood, M

    2007-01-01

    Variations in solar activity, as revealed by variations in the number of sunspots, have been observed since ancient times. To what extent changes in the solar output may affect planetary climates, though, remains today more than ever a subject of controversy. In 2000, the SSSI volume on Solar Variability and Climate reviewed the to-date understanding of the physics of solar variability and of the associated climate response. The present volume on Solar Variability and Planetary Climates provides an overview of recent advances in this field, with particular focus at the Earth's middle and lower atmosphere. The book structure mirrors that of the ISSI workshop held in Bern in June 2005, the collection of invited workshop contributions and of complementary introductory papers synthesizing the current understanding in key research areas such as middle atmospheric processes, stratosphere-troposphere dynamical coupling, tropospheric aerosols chemistry, solar storm influences, solar variability physics, and terrestri...

  8. Mirador - Climate Variability and Change

    Data.gov (United States)

    National Aeronautics and Space Administration — Earth Science data access made simple. NASA's role in climate variability study is centered around providing the global scale observational data sets on oceans and...

  9. External bulb variable volume maser

    Science.gov (United States)

    Reinhardt, V. S.; Cervenka, P. O. (Inventor)

    1978-01-01

    A maser functioning as a frequency standard stable to one part in 10 to the 14th power includes a variable volume, constant surface area storage bulb having a fixed volume portion located in a resonant cavity from which the frequency standard is derived. A variable volume portion of the bulb, exterior to the resonant cavity, has a maximum volume on the same order of magnitude as the fixed volume bulb portion. The cavity has a length to radius ratio of at least 3:1 so that the operation is attained without the need for a feedback loop. A baffle plate, between the fixed and variable volume bulb portions, includes apertures for enabling hydrogen atoms to pass between the two bulb portions and is an electromagnetic shield that prevents coupling of the electromagnetic field of the cavity into the variable volume bulb portion.

  10. The winds of cataclysmic variables

    Energy Technology Data Exchange (ETDEWEB)

    Mauche, C.W. [Lawrence Livermore National Lab., CA (United States). Lab. for Experimental Astrophysics; Raymond, J.C. [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA (United States)

    1994-02-16

    The authors present an observational and theoretical review of the winds of cataclysmic variables (CVs). Specifically, they consider the related problems of the geometry and mass-loss rate of the winds of CVs, their ionization state and variability, and the results from studies of eclipsing CVs. Finally, they consider the properties of accretion disk wind models. Some of these models predict substantial angular momentum loss, which could affect both disk structure and binary evolution.

  11. Ordering variable for parton showers

    Energy Technology Data Exchange (ETDEWEB)

    Nagy, Zoltán [DESY,Notkestrasse 85, 22607 Hamburg (Germany); Soper, Davison E. [Institute of Theoretical Science, University of Oregon,Eugene, OR 97403-5203 (United States)

    2014-06-30

    The parton splittings in a parton shower are ordered according to an ordering variable, for example the transverse momentum of the daughter partons relative to the direction of the mother, the virtuality of the splitting, or the angle between the daughter partons. We analyze the choice of the ordering variable and conclude that one particular choice has the advantage of factoring softer splittings from harder splittings graph by graph in a physical gauge.

  12. Ordering variable for parton showers

    Energy Technology Data Exchange (ETDEWEB)

    Nagy, Zoltan [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); Soper, Davison E. [Oregon Univ., Eugene, OR (United States). Inst. of Theoretical Science

    2014-01-15

    The parton splittings in a parton shower are ordered according to an ordering variable, for example the transverse momentum of the daughter partons relative to the direction of the mother, the virtuality of the splitting, or the angle between the daughter partons. We analyze the choice of the ordering variable and conclude that one particular choice has the advantage of factoring softer splittings from harder splittings graph by graph in a physical gauge.

  13. Decomposing global crop yield variability

    Science.gov (United States)

    Ben-Ari, Tamara; Makowski, David

    2014-11-01

    Recent food crises have highlighted the need to better understand the between-year variability of agricultural production. Although increasing future production seems necessary, the globalization of commodity markets suggests that the food system would also benefit from enhanced supplies stability through a reduction in the year-to-year variability. Here, we develop an analytical expression decomposing global crop yield interannual variability into three informative components that quantify how evenly are croplands distributed in the world, the proportion of cultivated areas allocated to regions of above or below average variability and the covariation between yields in distinct world regions. This decomposition is used to identify drivers of interannual yield variations for four major crops (i.e., maize, rice, soybean and wheat) over the period 1961-2012. We show that maize production is fairly spread but marked by one prominent region with high levels of crop yield interannual variability (which encompasses the North American corn belt in the USA, and Canada). In contrast, global rice yields have a small variability because, although spatially concentrated, much of the production is located in regions of below-average variability (i.e., South, Eastern and South Eastern Asia). Because of these contrasted land use allocations, an even cultivated land distribution across regions would reduce global maize yield variance, but increase the variance of global yield rice. Intermediate results are obtained for soybean and wheat for which croplands are mainly located in regions with close-to-average variability. At the scale of large world regions, we find that covariances of regional yields have a negligible contribution to global yield variance. The proposed decomposition could be applied at any spatial and time scales, including the yearly time step. By addressing global crop production stability (or lack thereof) our results contribute to the understanding of a key

  14. Investigation of load reduction for a variable speed, variable pitch, and variable coning wind turbine

    Energy Technology Data Exchange (ETDEWEB)

    Pierce, K. [Univ. of Utah, Salt Lake City, UT (United States)

    1997-12-31

    A two bladed, variable speed and variable pitch wind turbine was modeled using ADAMS{reg_sign} to evaluate load reduction abilities of a variable coning configuration as compared to a teetered rotor, and also to evaluate control methods. The basic dynamic behavior of the variable coning turbine was investigated and compared to the teetered rotor under constant wind conditions as well as turbulent wind conditions. Results indicate the variable coning rotor has larger flap oscillation amplitudes and much lower root flap bending moments than the teetered rotor. Three methods of control were evaluated for turbulent wind simulations. These were a standard IPD control method, a generalized predictive control method, and a bias estimate control method. Each control method was evaluated for both the variable coning configuration and the teetered configuration. The ability of the different control methods to maintain the rotor speed near the desired set point is evaluated from the RMS error of rotor speed. The activity of the control system is evaluated from cycles per second of the blade pitch angle. All three of the methods were found to produce similar results for the variable coning rotor and the teetered rotor, as well as similar results to each other.

  15. Variable Selection via Partial Correlation.

    Science.gov (United States)

    Li, Runze; Liu, Jingyuan; Lou, Lejia

    2017-07-01

    Partial correlation based variable selection method was proposed for normal linear regression models by Bühlmann, Kalisch and Maathuis (2010) as a comparable alternative method to regularization methods for variable selection. This paper addresses two important issues related to partial correlation based variable selection method: (a) whether this method is sensitive to normality assumption, and (b) whether this method is valid when the dimension of predictor increases in an exponential rate of the sample size. To address issue (a), we systematically study this method for elliptical linear regression models. Our finding indicates that the original proposal may lead to inferior performance when the marginal kurtosis of predictor is not close to that of normal distribution. Our simulation results further confirm this finding. To ensure the superior performance of partial correlation based variable selection procedure, we propose a thresholded partial correlation (TPC) approach to select significant variables in linear regression models. We establish the selection consistency of the TPC in the presence of ultrahigh dimensional predictors. Since the TPC procedure includes the original proposal as a special case, our theoretical results address the issue (b) directly. As a by-product, the sure screening property of the first step of TPC was obtained. The numerical examples also illustrate that the TPC is competitively comparable to the commonly-used regularization methods for variable selection.

  16. Variable Dynamics in the Inner Disk of HD 135344B Revealed with Multi-epoch Scattered Light Imaging

    Science.gov (United States)

    Stolker, Tomas; Sitko, Mike; Lazareff, Bernard; Benisty, Myriam; Dominik, Carsten; Waters, Rens; Min, Michiel; Perez, Sebastian; Milli, Julien; Garufi, Antonio; de Boer, Jozua; Ginski, Christian; Kraus, Stefan; Berger, Jean-Philippe; Avenhaus, Henning

    2017-11-01

    We present multi-epoch Very Large Telescope/Spectro-Polarimetric High-contrast Exoplanet REsearch (VLT/SPHERE) observations of the protoplanetary disk around HD 135344B (SAO 206462). The J-band scattered light imagery reveal, with high spatial resolution (˜41 mas, 6.4 au), the disk surface beyond ˜20 au. Temporal variations are identified in the azimuthal brightness distributions of all epochs, presumably related to the asymmetrically shading dust distribution in the inner disk. These shadows manifest themselves as narrow lanes, cast by localized density enhancements, and broader features which possibly trace the larger scale dynamics of the inner disk. We acquired visible and near-infrared photometry which shows variations up to 10% in the JHK bands, possibly correlated with the presence of the shadows. Analysis of archival Very Large Telescope Interferometer/Precision Integrated-Optics Near-infrared Imaging ExpeRiment (VLTI/PIONIER) H-band visibilities constrain the orientation of the inner disk to I=18\\buildrel{\\circ}\\over{.} {2}-4.1+3.4 and {PA}=57\\buildrel{\\circ}\\over{.} 3+/- 5\\buildrel{\\circ}\\over{.} 7, consistent with an alignment with the outer disk or a minor disk warp of several degrees. The latter scenario could explain the broad, quasi-stationary shadowing in north-northwest direction in case the inclination of the outer disk is slightly larger. The correlation between the shadowing and the near-infrared excess is quantified with a grid of radiative transfer models. The variability of the scattered light contrast requires extended variations in the inner disk atmosphere (H/r≲ 0.2). Possible mechanisms that may cause asymmetric variations in the optical depth ({{Δ }}τ ≲ 1) through the atmosphere of the inner disk include turbulent fluctuations, planetesimal collisions, or a dusty disk wind, possibly enhanced by a minor disk warp. A fine temporal sampling is required to follow day-to-day changes of the shadow patterns which may be a face

  17. Atmospheric variables as driving variables of agricultural and forest ecosystems

    Directory of Open Access Journals (Sweden)

    Luigi Mariani

    Full Text Available Atmospheric variables, which represent meteorology if seen in their instantaneous behavior or climatology if seen in their long time behavior, can be considered among the main driving variables of agricultural and forest ecosystems. In other words meteo-climatic variables determine productivity and quality and territorial specificity of agroforestry productions. On the base of this premise some significant examples are shown in order to describe how different modeling approaches (empirical and mechanistic can improve our degree of description of phenomena and the rationality of our approach to management of agro-ecosystem. The need of strict linkage among agrometeorology and other physical and biological sciences referred to agro-forestry ecosystems is also discussed.

  18. Crank drive for variable compression ratio; Kurbeltrieb fuer variable Verdichtung

    Energy Technology Data Exchange (ETDEWEB)

    Bollig, C. [FEV Motorentechnik GmbH und Co. KG, Aachen (Germany); Habermann, K.; Marckwardt, H.; Yapici, K.I. [Technische Hochschule Aachen (Germany). Lehrstuhl fuer Angewandte Thermodynamik (LAT)

    1997-11-01

    In a research project at the Institute of Applied Thermodynamics (LAT) of the University of Aachen (RWTH) between April 1995 and October 1996, a variable compression ratio was realised on a specially prepared FEV Single Cylinder Research Engine and investigated in terms of combustion and tribological behaviour. On the basis of an invention by the FEV Motorentechnik, the variable compression ratio was realised with a variable crankdrive. This technology allows a variable compression ratio across a wide range. In combination with High Pressure Supercharging, F.E. concept for S.I. engines results in a fuel saving potential of up to 30%. Equipped with well-known Three-Way-Catalyst (TWC) technology, it is capable of meeting future low emission standards. To achieve a weight-optimised design of the conrod, FEM analyses have been conducted. The primary goal of the test bench investigation was to obtain information about the influence of the unconventional piston movement during combustion as well as about the tribological behaviour of the variable crankdrive. (orig.) [Deutsch] Innerhalb eines Forschungsprojektes am Lehrstuhl fuer Angewandte Thermodynamik der RWTH-Aachen (LAT) wurde im Zeitraum April 1995 bis Oktober 1996 ein variables Verdichtungsverhaeltnis an einem speziell praeparierten FEV-Einzylinder-Ottomotor umgesetzt und brennverfahrenstechnisch wie auch tribologisch im Pruefstandsbetrieb untersucht. Basierend auf einer Erfindung der FEV Motorentechnik wurde das veraenderliche Verdichtungsverhaeltnis mit einem variablen Kurbeltrieb realisiert. Diese Technik ermoeglicht eine Variabilitaet der Verdichtung in einem grossen Bereich. In Verbindung mit Hochaufladung kann so ein ottomotorisches Verbrauchskonzept mit einem Einsparpotential von bis zu 30% dargestellt werden, das unter Beibehaltung der {lambda}=1-Technik zukuenftige Abgasnormen erfuellen kann. Die Eignung des variablen Kurbeltriebs zur Realisierung einer veraenderlichen Verdichtung konnte in der

  19. The cataclysmic variable AE Aquarii: orbital variability in V band

    Science.gov (United States)

    Zamanov, R.; Latev, G.

    2017-07-01

    We present 62.7 hours observations of the cataclysmic variable AE Aqr in Johnson V band. These are non-published archive electro-photometric data obtained during the time period 1993 to 1999. We construct the orbital variability in V band and obtain a Fourier fit to the double-wave quiescent light curve. The strongest flares in our data set are in phase interval 0.6 - 0.8. The data can be downloaded from http://www.astro.bas.bg/~rz/DATA/AEAqr.elphot.dat.

  20. Variable order variable stepsize algorithm for solving nonlinear Duffing oscillator

    Science.gov (United States)

    Fadly Nurullah Rasedee, Ahmad; Ishak, Norizarina; Raihana Hamzah, Siti; Ijam, Hazizah Mohd; Suleiman, Mohamed; Bibi Ibrahim, Zarina; Sathar, Mohammad Hasan Abdul; Ainna Ramli, Nur; Shuhada Kamaruddin, Nur

    2017-09-01

    Nonlinear phenomena in science and engineering such as a periodically forced oscillator with nonlinear elasticity are often modeled by the Duffing oscillator (Duffing equation). The Duffling oscillator is a type of nonlinear higher order differential equation. In this research, a numerical approximation for solving the Duffing oscillator directly is introduced using a variable order stepsize (VOS) algorithm coupled with a backward difference formulation. By selecting the appropriate restrictions, the VOS algorithm provides a cost efficient computational code without affecting its accuracy. Numerical results have demonstrated the advantages of a variable order stepsize algorithm over conventional methods in terms of total steps and accuracy.

  1. All varieties of encoding variability are not created equal: Separating variable processing from variable tasks

    Science.gov (United States)

    Huff, Mark J.; Bodner, Glen E.

    2014-01-01

    Whether encoding variability facilitates memory is shown to depend on whether item-specific and relational processing are both performed across study blocks, and whether study items are weakly versus strongly related. Variable-processing groups studied a word list once using an item-specific task and once using a relational task. Variable-task groups’ two different study tasks recruited the same type of processing each block. Repeated-task groups performed the same study task each block. Recall and recognition were greatest in the variable-processing group, but only with weakly related lists. A variable-processing benefit was also found when task-based processing and list-type processing were complementary (e.g., item-specific processing of a related list) rather than redundant (e.g., relational processing of a related list). That performing both item-specific and relational processing across trials, or within a trial, yields encoding-variability benefits may help reconcile decades of contradictory findings in this area. PMID:25018583

  2. Sparse estimation for structural variability

    Directory of Open Access Journals (Sweden)

    Singh Rohit

    2011-04-01

    Full Text Available Abstract Background Proteins are dynamic molecules that exhibit a wide range of motions; often these conformational changes are important for protein function. Determining biologically relevant conformational changes, or true variability, efficiently is challenging due to the noise present in structure data. Results In this paper we present a novel approach to elucidate conformational variability in structures solved using X-ray crystallography. We first infer an ensemble to represent the experimental data and then formulate the identification of truly variable members of the ensemble (as opposed to those that vary only due to noise as a sparse estimation problem. Our results indicate that the algorithm is able to accurately distinguish genuine conformational changes from variability due to noise. We validate our predictions for structures in the Protein Data Bank by comparing with NMR experiments, as well as on synthetic data. In addition to improved performance over existing methods, the algorithm is robust to the levels of noise present in real data. In the case of Human Ubiquitin-conjugating enzyme Ubc9, variability identified by the algorithm corresponds to functionally important residues implicated by mutagenesis experiments. Our algorithm is also general enough to be integrated into state-of-the-art software tools for structure-inference.

  3. Continuous-variable supraquantum nonlocality

    Science.gov (United States)

    Ketterer, Andreas; Laversanne-Finot, Adrien; Aolita, Leandro

    2018-01-01

    Supraquantum nonlocality refers to correlations that are more nonlocal than allowed by quantum theory but still physically conceivable in postquantum theories, in the sense of respecting the basic no-faster-than-light communication principle. While supraquantum correlations are relatively well understood for finite-dimensional systems, little is known in the infinite-dimensional case. Here, we study supraquantum nonlocality for bipartite systems with two measurement settings and infinitely many outcomes per subsystem. We develop a formalism for generic no-signaling black-box measurement devices with continuous outputs in terms of probability measures, instead of probability distributions, which involves a few technical subtleties. We show the existence of a class of supraquantum Gaussian correlations, which violate the Tsirelson bound of an adequate continuous-variable Bell inequality. We then introduce the continuous-variable version of the celebrated Popescu-Rohrlich (PR) boxes, as a limiting case of the above-mentioned Gaussian ones. Finally, we characterize the geometry of the set of continuous-variable no-signaling correlations. Namely, we show that that the convex hull of the continuous-variable PR boxes is dense in the no-signaling set. We also show that these boxes are extreme in the set of no-signaling behaviors and provide evidence suggesting that they are indeed the only extreme points of the no-signaling set. Our results lay the grounds for studying generalized-probability theories in continuous-variable systems.

  4. Entropy as a collective variable

    Science.gov (United States)

    Parrinello, Michele

    Sampling complex free energy surfaces that exhibit long lived metastable states separated by kinetic bottlenecks is one of the most pressing issues in the atomistic simulations of matter. Not surprisingly many solutions to this problem have been suggested. Many of them are based on the identification of appropriate collective variables that span the manifold of the slow varying modes of the system. While much effort has been put in devising and even constructing on the fly appropriate collective variables there is still a cogent need of introducing simple, generic, physically transparent, and yet effective collective variables. Motivated by the physical observation that in many case transitions between one metastable state and another result from a trade off between enthalpy and entropy we introduce appropriate collective variables that are able to represent in a simple way these two physical properties. We use these variables in the context of the recently introduced variationally enhanced sampling and apply it them with success to the simulation of crystallization from the liquid and to conformational transitions in protein. Department of Chemistry and Applied Biosciences, ETH Zurich, and Facolta' di Informatica, Istituto di Scienze Computazionali, Universita' della Svizzera Italiana, Via G. Buffi 13, 6900 Lugano, Switzerland.

  5. Modulated mass-transfer model for superhumps in SU Ursae Majoris stars

    Science.gov (United States)

    Mineshige, Shin

    1988-01-01

    The response of a circular accretion disk to rapid modulation of the mass-transfer rate into the disk is explored in order to model superhumps in SU UMa stars. It is proposed that periodically enhanced flow may disrupt or heat up the outer disk and produce the dips noted just before the superhump peaks. The elliptical accretion-disk model with extended vertical disk structure can account for the observed characteristics of superhumps in these stars.

  6. Photometric Study on the Spot-Double Star XY Ursae Majoris (II

    Directory of Open Access Journals (Sweden)

    Woo-Baik Lee

    1988-12-01

    Full Text Available The photometric behaviour of XY UMa, an eclipsing binary showing photospheric and chromospheric activity, has been described by spot hypothesis. They are based on the all the available UBV light curves, which were carried out by Geyer since 1955. A "spherical rectangular" spot model shows very pronounced spot activities during the last 30 years. On the average, the spot covered about 16% of the visible hemisphere. Observational evidence for photospheric and chromospheric activities on the XY UMa and related systems are also discussed.

  7. A Transparently-Scalable Metadata Service for the Ursa Minor Storage System

    Science.gov (United States)

    2010-06-25

    Software Engineering Institute,Pittsburgh,PA,15213 8. PERFORMING ORGANIZATION REPORT NUMBER 9. SPONSORING/MONITORING AGENCY NAME(S) AND ADDRESS(ES) 10...metadata server for metadata activity and to discover the locations of data. They then access data directly at the appropriate data servers. Metadata...necessary for Section 4.4. Second, we doubled the warmup time for each run to 10 minutes to ensure the measured portion of the run did not benefit from

  8. Statistical variability of hydro-meteorological variables as indicators ...

    African Journals Online (AJOL)

    The aim of this study is to examine the variability patterns of rainfall and actual evapotranspiration during two climatic scenarios as an insight in climatic response to global warming. The comparison between evapotranspiration during the periods (1943-1977) and (1978-2012) at the five studied weather stations revealed a ...

  9. Cardinality-dependent Variability in Orthogonal Variability Models

    DEFF Research Database (Denmark)

    Mærsk-Møller, Hans Martin; Jørgensen, Bo Nørregaard

    2012-01-01

    During our work on developing and running a software product line for eco-sustainable greenhouse-production software tools, which currently have three products members we have identified a need for extending the notation of the Orthogonal Variability Model (OVM) to support what we refer...

  10. Time as a dynamical variable

    Science.gov (United States)

    Thron, Christopher

    2017-01-01

    Since the time of Galileo, the equations of physics have expressed dynamical variables such as particle position or electromagnetic field strength as functions of time. In this paper, we argue that this assumption reflects observational bias, and that there are many good reasons for viewing time also as a dynamical variable. We hypothesize that the spacetime universe is an outcome of a process, rather than a process unfolding in time. This new viewpoint gives rise to a physical interpretation of the wavefunction as a complex vibrational amplitude in a non-spacetime independent variable. It resolves quantum mechanical paradoxes involving wavefunction entanglement, and gives a much simpler solution to the problem of wavefunction collapse than the many-worlds interpretation. The Born rule is also shown to be a natural consequence. We also show that small deviations from conventional quantum probabilities are predicted.

  11. Variable geometry Darrieus wind machine

    Science.gov (United States)

    Pytlinski, J. T.; Serrano, D.

    1983-08-01

    A variable geometry Darrieus wind machine is proposed. The lower attachment of the blades to the rotor can move freely up and down the axle allowing the blades of change shape during rotation. Experimental data for a 17 m. diameter Darrieus rotor and a theoretical model for multiple streamtube performance prediction were used to develop a computer simulation program for studying parameters that affect the machine's performance. This new variable geometry concept is described and interrelated with multiple streamtube theory through aerodynamic parameters. The computer simulation study shows that governor behavior of a Darrieus turbine can not be attained by a standard turbine operating within normally occurring rotational velocity limits. A second generation variable geometry Darrieus wind turbine which uses a telescopic blade is proposed as a potential improvement on the studied concept.

  12. Complex variable methods in elasticity

    CERN Document Server

    England, A H

    2003-01-01

    The plane strain and generalized plane stress boundary value problems of linear elasticity are the focus of this graduate-level text, which formulates and solves these problems by employing complex variable theory. The text presents detailed descriptions of the three basic methods that rely on series representation, Cauchy integral representation, and the solution via continuation. Its five-part treatment covers functions of a complex variable, the basic equations of two-dimensional elasticity, plane and half-plane problems, regions with circular boundaries, and regions with curvilinear bounda

  13. A process variability control chart

    OpenAIRE

    Riaz, M.; Does, R.J.M.M.

    2009-01-01

    In this study a Shewhart type control chart namely the Vt chart, is proposed for improvedmonitoring of the process variability of a quality characteristic of interest Y . The proposed control chart is based on the ratio type estimator of the variance using a single auxiliary variable X. It is assumed that (Y, X) follows a bivariate normal distribution. The design structure of the Vt chart is developed for Phase-I quality control and its comparison is made with those of the S2 chart (a well-kn...

  14. Complex Variables throughout the Curriculum

    Science.gov (United States)

    D'Angelo, John P.

    2017-01-01

    We offer many specific detailed examples, several of which are new, that instructors can use (in lecture or as student projects) to revitalize the role of complex variables throughout the curriculum. We conclude with three primary recommendations: revise the syllabus of Calculus II to allow early introductions of complex numbers and linear…

  15. On colorings of variable words

    OpenAIRE

    Tyros, Konstantinos

    2014-01-01

    In this note, we prove that the base case of the Graham--Rothschild Theorem, i.e., the one that considers colorings of the ($1$-dimensional) variable words, admits bounds in the class $\\mathcal{E}^5$ of Grzegorczyk's hierarchy.

  16. Cataclysmic Variables in the Backyard

    Science.gov (United States)

    Patterson, J.

    2012-06-01

    (Abstract only) The last decade has seen plummeting prices and significant advances in CCD-camera and smart-telescope technology, reaching all the way to the humblest of telescopes. There are now thousands of well-equipped amateur astronomers interested in using their telescopes for research, and many hundreds already doing so in coordinated campaigns. Variable star science has benefited tremendously. Since it's always dark and always clear somewhere, coordinated photometry can accumulate nearly 24-hour coverage - and since the observers own their telescopes, very long campaigns are feasible, with little worry about weather. I'll describe one network of observers, the Center for Backyard Astrophysics (CBA). The telescope apertures are 20-50 cm, enabling good signal-to-noise and time resolution down to V=18. We organize campaigns of time-series photometry of cataclysmic variables (novae, dwarf novae, magnetic variables, some X-ray binaries) - and routinely achieve thousand-hour campaigns with no significant aliasing, since the telescopes are distributed around the world. This enables sensitive searches for periodic signals, extending even to long time scales (months). We now produce most of the world's supply of accretion-disk precession periods, and keep close watch on all the other clocks in cataclysmic variables (orbit, white-dwarf rotation and pulsation, and quasiperiodic oscillations).

  17. Operating Reserves and Variable Generation

    Energy Technology Data Exchange (ETDEWEB)

    Ela, E.; Milligan, M.; Kirby, B.

    2011-08-01

    This report tries to first generalize the requirements of the power system as it relates to the needs of operating reserves. It also includes a survey of operating reserves and how they are managed internationally in system operations today and then how new studies and research are proposing they may be managed in the future with higher penetrations of variable generation.

  18. Marginality and Variability in Esperanto.

    Science.gov (United States)

    Brent, Edmund

    This paper discusses Esperanto as a planned language and refutes three myths connected to it, namely, that Esperanto is achronical, atopical, and apragmatic. The focus here is on a synchronic analysis. Synchronic variability is studied with reference to the structuralist determination of "marginality" and the dynamic linguistic…

  19. Several topics in complex variables

    NARCIS (Netherlands)

    Smit, I.M.

    2015-01-01

    This thesis is based on three articles in the field of Several Complex Variables. The first article, which is joint work with M. El Kadiri, defines and studies the concept of maximality for plurifinely plurisubharmonic functions. Its main result is that a finite plurifinely plurisubharmonic function

  20. Variable rules meet Impoverishment theory

    DEFF Research Database (Denmark)

    Parrott, Jeffrey K.; Nevins, Andrew

    2010-01-01

    This paper revives the sociolinguistic notion of ‘variable rules’ (Labov 1969, Cedergren and Sankoff 1974, Guy 1991) as a specific and restricted mechanism within the theoretical framework of Distributed Morphology (Halle and Marantz 1993, Embick and Noyer 2007). We propose that intra-individual ...

  1. Compact plasmonic variable optical attenuator

    DEFF Research Database (Denmark)

    Leosson, Kristjan; Rosenzveig, Tiberiu; Hermannsson, Pétur Gordon

    2008-01-01

    We demonstrate plasmonic nanowire-based thermo-optic variable optical attenuators operating in the 1525-1625 nm wavelength range. The devices have a footprint as low as 1 mm, extinction ratio exceeding 40 dB, driving voltage below 3 V, and full modulation bandwidth of 1 kHz. The polarization...

  2. Extraction Methods, Variability Encountered in

    NARCIS (Netherlands)

    Bodelier, P.L.E.; Nelson, K.E.

    2014-01-01

    Synonyms Bias in DNA extractions methods; Variation in DNA extraction methods Definition The variability in extraction methods is defined as differences in quality and quantity of DNA observed using various extraction protocols, leading to differences in outcome of microbial community composition

  3. Lectures on several complex variables

    CERN Document Server

    Gauthier, Paul M

    2014-01-01

    This monograph provides a concise, accessible snapshot of key topics in several complex variables, including the Cauchy Integral Formula, sequences of holomorphic functions, plurisubharmonic functions, the Dirichlet problem, and meromorphic functions.  Based on a course given at Université de Montréal, this brief introduction covers areas of contemporary importance that are not mentioned in most treatments of the subject, such as modular forms, which are essential for Wiles' theorem and the unification of quantum theory and general relativity.   Also covered is the Riemann manifold of a function, which generalizes the Riemann surface of a function of a single complex variable and is a topic that is well-known in one complex variable, but rarely treated in several variables.  Many details, which are intentionally left out, as well as many theorems are stated as problems, providing students with carefully structured instructive exercises.   Prerequisites for use of this book are functions of one complex ...

  4. Soil variability in engineering applications

    Science.gov (United States)

    Vessia, Giovanna

    2014-05-01

    Natural geomaterials, as soils and rocks, show spatial variability and heterogeneity of physical and mechanical properties. They can be measured by in field and laboratory testing. The heterogeneity concerns different values of litho-technical parameters pertaining similar lithological units placed close to each other. On the contrary, the variability is inherent to the formation and evolution processes experienced by each geological units (homogeneous geomaterials on average) and captured as a spatial structure of fluctuation of physical property values about their mean trend, e.g. the unit weight, the hydraulic permeability, the friction angle, the cohesion, among others. The preceding spatial variations shall be managed by engineering models to accomplish reliable designing of structures and infrastructures. Materon (1962) introduced the Geostatistics as the most comprehensive tool to manage spatial correlation of parameter measures used in a wide range of earth science applications. In the field of the engineering geology, Vanmarcke (1977) developed the first pioneering attempts to describe and manage the inherent variability in geomaterials although Terzaghi (1943) already highlighted that spatial fluctuations of physical and mechanical parameters used in geotechnical designing cannot be neglected. A few years later, Mandelbrot (1983) and Turcotte (1986) interpreted the internal arrangement of geomaterial according to Fractal Theory. In the same years, Vanmarcke (1983) proposed the Random Field Theory providing mathematical tools to deal with inherent variability of each geological units or stratigraphic succession that can be resembled as one material. In this approach, measurement fluctuations of physical parameters are interpreted through the spatial variability structure consisting in the correlation function and the scale of fluctuation. Fenton and Griffiths (1992) combined random field simulation with the finite element method to produce the Random

  5. NASA's atmospheric variability experiments /AVE/

    Science.gov (United States)

    Hill, K.; Turner, R. E.

    1977-01-01

    A series of seven mesoscale experiments were conducted under the NASA program, Atmospheric Variability Experiments (AVE). Rawinsonde, satellite, aircraft, and ground observations were recorded during specially selected meteorological periods lasting from 1 to 3 days. Details are presented for each AVE relative to observation times, experiment size and location, and significant weather. Some research results based on the use of these AVE data are referenced. These include contributions to regional numerical prediction; relations between wind shears, instability, and thunderstorm motion and development; relations between moisture and temperature and the probability of convection; retrieval of tropospheric temperature profiles from cloud-contaminated satellite data; variation of convection intensity as a result of atmospheric variability; and effects of cloud rotation on their trajectories.

  6. Continuous-Variable Entanglement Swapping

    Directory of Open Access Journals (Sweden)

    Kevin Marshall

    2015-05-01

    Full Text Available We present a very brief overview of entanglement swapping as it relates to continuous-variable quantum information. The technical background required is discussed and the natural link to quantum teleportation is established before discussing the nature of Gaussian entanglement swapping. The limitations of Gaussian swapping are introduced, along with the general applications of swapping in the context of to quantum communication and entanglement distribution. In light of this, we briefly summarize a collection of entanglement swapping schemes which incorporate a non-Gaussian ingredient and the benefits of such schemes are noted. Finally, we motivate the need to further study and develop such schemes by highlighting requirements of a continuous-variable repeater.

  7. Variable immune molecules in invertebrates.

    Science.gov (United States)

    Cerenius, Lage; Söderhäll, Kenneth

    2013-12-01

    Recently it has become evident that invertebrates may mount a highly variable immune response that is dependent on which pathogen is involved. The molecular mechanisms behind this diversity are beginning to be unravelled and in several invertebrate taxa immune proteins exhibiting a broad range of diversity have been found. In some cases, evidence has been gathered suggesting that this molecular diversity translates into the ability of an affected invertebrate to mount a defence that is specifically aimed at a particular pathogen.

  8. Reproducing Kernels and Variable Bandwidth

    Directory of Open Access Journals (Sweden)

    R. Aceska

    2012-01-01

    Full Text Available We show that a modulation space of type ( is a reproducing kernel Hilbert space (RKHS. In particular, we explore the special cases of variable bandwidth spaces Aceska and Feichtinger (2011 with a suitably chosen weight to provide strong enough decay in the frequency direction. The reproducing kernel property is valid even if ( does not coincide with any of the classical Sobolev spaces because unbounded bandwidth (globally is allowed. The reproducing kernel will be described explicitly.

  9. AEROSOL VARIABILITY OBSERVED WITH RPAS

    Directory of Open Access Journals (Sweden)

    B. Altstädter

    2013-08-01

    Full Text Available To observe the origin, vertical and horizontal distribution and variability of aerosol particles, and especially ultrafine particles recently formed, we plan to employ the remotely piloted aircraft system (RPAS Carolo-P360 "ALADINA" of TU Braunschweig. The goal of the presented project is to investigate the vertical and horizontal distribution, transport and small-scale variability of aerosol particles in the atmospheric boundary layer using RPAS. Two additional RPAS of type MASC of Tübingen University equipped with turbulence instrumentation add the opportunity to study the interaction of the aerosol concentration with turbulent transport and exchange processes of the surface and the atmosphere. The combination of different flight patterns of the three RPAS allows new insights in atmospheric boundary layer processes. Currently, the different aerosol sensors are miniaturized at the Leibniz Institute for Tropospheric Research, Leipzig and together with the TU Braunschweig adapted to fit into the RPAS. Moreover, an additional meteorological payload for measuring temperature, humidity and turbulence properties is constructed by Tübingen University. Two condensation particle counters determine the total aerosol number with a different lower detection threshold in order to investigate the horizontal and vertical aerosol variability and new particle formation (aerosol particles of some nm diameter. Further the aerosol size distribution in the range from about 0.300 to ~5 μm is given by an optical particle counter.

  10. Simulating solar power plant variability :

    Energy Technology Data Exchange (ETDEWEB)

    Lave, Matthew Samuel; Ellis, Abraham; Stein, Joshua.

    2013-06-01

    It is important to be able to accurately simulate the variability of solar PV power plants for grid integration studies. We aim to inform integration studies of the ease of implementation and application-specific accuracy of current PV power plant output simulation methods. This report reviews methods for producing simulated high-resolution (sub-hour or even sub-minute) PV power plant output profiles for variability studies and describes their implementation. Two steps are involved in the simulations: estimation of average irradiance over the footprint of a PV plant and conversion of average irradiance to plant power output. Six models are described for simulating plant-average irradiance based on inputs of ground-measured irradiance, satellite-derived irradiance, or proxy plant measurements. The steps for converting plant-average irradiance to plant power output are detailed to understand the contributions to plant variability. A forthcoming report will quantify the accuracy of each method using application-specific validation metrics.

  11. Aerosol Variability Observed with Rpas

    Science.gov (United States)

    Altstädter, B.; Lampert, A.; Scholtz, A.; Bange, J.; Platis, A.; Hermann, M.; Wehner, B.

    2013-08-01

    To observe the origin, vertical and horizontal distribution and variability of aerosol particles, and especially ultrafine particles recently formed, we plan to employ the remotely piloted aircraft system (RPAS) Carolo-P360 "ALADINA" of TU Braunschweig. The goal of the presented project is to investigate the vertical and horizontal distribution, transport and small-scale variability of aerosol particles in the atmospheric boundary layer using RPAS. Two additional RPAS of type MASC of Tübingen University equipped with turbulence instrumentation add the opportunity to study the interaction of the aerosol concentration with turbulent transport and exchange processes of the surface and the atmosphere. The combination of different flight patterns of the three RPAS allows new insights in atmospheric boundary layer processes. Currently, the different aerosol sensors are miniaturized at the Leibniz Institute for Tropospheric Research, Leipzig and together with the TU Braunschweig adapted to fit into the RPAS. Moreover, an additional meteorological payload for measuring temperature, humidity and turbulence properties is constructed by Tübingen University. Two condensation particle counters determine the total aerosol number with a different lower detection threshold in order to investigate the horizontal and vertical aerosol variability and new particle formation (aerosol particles of some nm diameter). Further the aerosol size distribution in the range from about 0.300 to ~5 μm is given by an optical particle counter.

  12. Andoyer construction for Hill and Delaunay variables

    Science.gov (United States)

    Laskar, Jacques

    2017-08-01

    Andoyer variables are well known for the study of rotational dynamics. These variables were derived by Andoyer through a procedure that can be also used to obtain the Hill variables of the Kepler problem. Andoyer construction can also forecast the Delaunay variables which canonicity is then obtained without the use of a generating function.

  13. Andoyer construction for Hill and Delaunay variables

    OpenAIRE

    Laskar, Jacques

    2014-01-01

    Andoyer variables are well known for the study of rotational dynamics. These variables were derived by Andoyer through a procedure that can be also used to obtain the Hill variables of the Kepler problem. Andoyer construction can also forecast the Delaunay variables which canonicity is then obtained without the use of a generating function.

  14. An evaluation of FIA's stand age variable

    Science.gov (United States)

    John D. Shaw

    2015-01-01

    The Forest Inventory and Analysis Database (FIADB) includes a large number of measured and computed variables. The definitions of measured variables are usually well-documented in FIA field and database manuals. Some computed variables, such as live basal area of the condition, are equally straightforward. Other computed variables, such as individual tree volume,...

  15. Motor Integrated Variable Speed Drives

    OpenAIRE

    Singh, Yash Veer

    2015-01-01

    A new trend in the variable speed drives (VSDs) is to develop fully integrated systems, which lead to low-cost products with shorter design cycles. Motor Integrated design of VSDs will reduce cable length to connect drive with machine windings and installation time for end user. The electric drives are expected to have minimum effect on grid and motor connected to it, i.e. currents drawn from grid should be within specified limits and currents injecting in to machine should not overheat the m...

  16. Gibbs Variable Selection using BUGS

    Directory of Open Access Journals (Sweden)

    Ioannis Ntzoufras

    2002-09-01

    Full Text Available In this paper we discuss and present in detail the implementation of Gibbs variable selection as defined by Dellaportas et al. (2000, 2002 using the BUGS software (Spiegelhalter et al. , 1996a,b,c. The specification of the likelihood, prior and pseudo-prior distributions of the parameters as well as the prior term and model probabilities are described in detail. Guidance is also provided for the calculation of the posterior probabilities within BUGS environment when the number of models is limited. We illustrate the application of this methodology in a variety of problems including linear regression, log-linear and binomial response models.

  17. SYSTEMATICALLY MISCLASSIFIED BINARY DEPENDENT VARIABLES.

    Science.gov (United States)

    Tennekoon, Vidhura; Rosenman, Robert

    When a binary dependent variable is misclassified, that is, recorded in the category other than where it really belongs, probit and logit estimates are biased and inconsistent. In some cases the probability of misclassification may vary systematically with covariates, and thus be endogenous. In this paper we develop an estimation approach that corrects for endogenous misclassification, validate our approach using a simulation study, and apply it to the analysis of a treatment program designed to improve family dynamics. Our results show that endogenous misclassification could lead to potentially incorrect conclusions unless corrected using an appropriate technique.

  18. Variable Density Turbulence Tunnel Facility

    OpenAIRE

    Bodenschatz, Eberhard; Bewley, Gregory P.; Nobach, Holger; Sinhuber, Michael; Xu, Haitao

    2014-01-01

    The Variable Density Turbulence Tunnel (VDTT) at the Max Planck Institute for Dynamics and Self-Organization in G\\"ottingen, Germany produces very high turbulence levels at moderate flow velocities, low power consumption and adjustable kinematic viscosity between $10^{-4} m^2/s$ and $10^{-7} m^2/s$. The Reynolds number can be varied by changing the pressure or flow rate of the gas or by using different non-flammable gases including air. The highest kinematic viscosities, and hence lowest Reyn...

  19. Lateralidad y variables de personalidad

    OpenAIRE

    Claudia Brusasca; Mabel Labiano; José Portellano-Pérez

    2011-01-01

    El objetivo del presente trabajo fue realizar una medición de lateralidad en una muestra de individuos de la región de Cuyo, Argentina, analizando las asociaciones entre lateralidad (diestros-zurdos) y variables de personalidad (control-neuroticismo; introversión-extroversión). Se conformó una muestra no aleatoria de 197 individuos (100 sujetos de sexo femenino y 97 de sexo masculino), con un rango de edad entre 18 y 55 años (M= 28,14; DE= 9,77). Se aplicaron los siguientes instrumentos: ...

  20. Continuously-Variable Vernier Scale

    Science.gov (United States)

    Miller, Irvin M.

    1989-01-01

    Easily fabricated device increases precision in reading graphical data. Continuously-variable vernier scale (CV VS) designed to provide greater accuracy to scientists and technologists in reading numerical values from graphical data. Placed on graph and used to interpolate coordinate value of point on curve or plotted point on figure within division on each coordinate axis. Requires neither measurement of line segments where projection of point intersects division nor calculation to quantify projected value. Very flexible device constructed with any kind of scale. Very easy to use, requiring no special equipment of any kind, and saves considerable amount of time if numerous points to be evaluated.

  1. Classification and prediction of port variables

    Energy Technology Data Exchange (ETDEWEB)

    Molina Serrano, B.

    2016-07-01

    Many variables are included in planning and management of port terminals. They can beeconomic, social, environmental and institutional. Agent needs to know relationshipbetween these variables to modify planning conditions. Use of Bayesian Networks allowsfor classifying, predicting and diagnosing these variables. Bayesian Networks allow forestimating subsequent probability of unknown variables, basing on know variables.In planning level, it means that it is not necessary to know all variables because theirrelationships are known. Agent can know interesting information about how port variablesare connected. It can be interpreted as cause-effect relationship. Bayesian Networks can beused to make optimal decisions by introduction of possible actions and utility of theirresults.In proposed methodology, a data base has been generated with more than 40 port variables.They have been classified in economic, social, environmental and institutional variables, inthe same way that smart port studies in Spanish Port System make. From this data base, anetwork has been generated using a non-cyclic conducted grafo which allows for knowingport variable relationships - parents-children relationships-. Obtained network exhibits thateconomic variables are – in cause-effect terms- cause of rest of variable typologies.Economic variables represent parent role in the most of cases. Moreover, whenenvironmental variables are known, obtained network allows for estimating subsequentprobability of social variables.It has been concluded that Bayesian Networks allow for modeling uncertainty in aprobabilistic way, even when number of variables is high as occurs in planning andmanagement of port terminals. (Author)

  2. Microelectrofluidic iris for variable aperture

    Science.gov (United States)

    Chang, Jong-hyeon; Jung, Kyu-Dong; Lee, Eunsung; Choi, Minseog; Lee, Seungwan

    2012-03-01

    This paper presents a variable aperture design based on the microelectrofluidic technology which integrates electrowetting and microfluidics. The proposed microelectrofluidic iris (MEFI) consists of two immiscible fluids and two connected surface channels formed by three transparent plates and two spacers between them. In the initial state, the confined aqueous ring makes two fluidic interfaces, on which the Laplace pressure is same, in the hydrophobic surface channels. When a certain voltage is applied between the dielectric-coated control electrode beneath the three-phase contact line (TCL) and the reference electrode for grounding the aqueous, the contact angle changes on the activated control electrode. At high voltage over the threshold, the induced positive pressure difference makes the TCLs on the 1st channel advance to the center and the aperture narrow. If there is no potential difference between the control and reference electrodes, the pressure difference becomes negative. It makes the TCLs on the 1st channel recede and the aperture widen to the initial state. It is expected that the proposed MEFI is able to be widely used because of its fast response, circular aperture, digital operation, high aperture ratio, and possibility to be miniaturized for variable aperture.

  3. CONSTRUCTING ACCOUNTING UNCERTAINITY ESTIMATES VARIABLE

    Directory of Open Access Journals (Sweden)

    Nino Serdarevic

    2012-10-01

    Full Text Available This paper presents research results on the BIH firms’ financial reporting quality, utilizing empirical relation between accounting conservatism, generated in created critical accounting policy choices, and management abilities in estimates and prediction power of domicile private sector accounting. Primary research is conducted based on firms’ financial statements, constructing CAPCBIH (Critical Accounting Policy Choices relevant in B&H variable that presents particular internal control system and risk assessment; and that influences financial reporting positions in accordance with specific business environment. I argue that firms’ management possesses no relevant capacity to determine risks and true consumption of economic benefits, leading to creation of hidden reserves in inventories and accounts payable; and latent losses for bad debt and assets revaluations. I draw special attention to recent IFRS convergences to US GAAP, especially in harmonizing with FAS 130 Reporting comprehensive income (in revised IAS 1 and FAS 157 Fair value measurement. CAPCBIH variable, resulted in very poor performance, presents considerable lack of recognizing environment specifics. Furthermore, I underline the importance of revised ISAE and re-enforced role of auditors in assessing relevance of management estimates.

  4. Phenotypic variability in Patau syndrome.

    Science.gov (United States)

    Caba, Lavinia; Rusu, Cristina; Butnariu, Lacramioara; Panzaru, Monica; Braha, Elena; Volosciuc, M; Popescu, Roxana; Gramescu, Mihaela; Bujoran, C; Martiniuc, Violeta; Covic, M; Gorduza, E V

    2013-01-01

    Patau syndrome has an incidence of 1/10.000-20.000, the clinical diagnosis being suggested by the triad cleft lip and palate, microphthalmia/anophthalmia and postaxial polydactyly. Most frequent cytogenetic abnormality is free and homogeneous trisomy 13 (80.0%), rarely being detected trisomy mosaics or Robertsonian translocations. The objective of the study was to identify phenotypic features of trisomy 13. The retrospective study was conducted on a trial group of 14 cases diagnosed cytogenetically with trisomy 13 between January 2000 and December 2012 at lasi Medical Genetics Centre. Of the 14 cases, 3 were evaluated pathologically (two aborted foetuses and one stillborn), 8 cases were detected in the neonatal period, and 3 in infancy. Clinical diagnosis was supported by the identification of a model of abnormal development, mainly characterized by: maxillary cleft (lip and palate--5 cases; lip--1 case), ocular abnormalities (microphthalmia/anophthalmia--7 cases; cyclopia--1 case), postaxial polydactyly (7 cases), scalp defects (6 cases), congenital heart anomalies (10 cases, 6 patients with atrial septal defect), complete holoprosencephaly (4 cases), ear abnormalities (11 cases), broad nasal root (10 cases). An important issue in confirming the phenotypic variability of Patau syndrome is that the classic clinical triad was identified only in one case. Patau syndrome is a disease with variable expression and is characterized by a pattern of abnormal prenatal development characterized by facial dysmorphia, polydactyly and severe birth defects (heart, brain) that generate an increased in utero and perinatal mortality.

  5. Microvillous inclusion disease: ultrastructural variability.

    Science.gov (United States)

    Iancu, Theodore C; Mahajnah, Muhammad; Manov, Irena; Shaoul, Ron

    2007-01-01

    Microvillous inclusion disease (MVID) is a congenital, usually neonatal, autosomal recessive condition manifested by severe, prolonged secretory diarrhea. Intestinal biopsies reveal extensive microvilli abnormalities, typical inclusions and vesicles mainly of the apical-luminal enterocytes and colonocytes. Although diagnosis can be suspected by special stains of the mucosa (PAS, CD10), the definitive diagnosis, recommended in view of potential intestinal transplantation, requires electron microscopy. In view of the marked variability of ultrastructural changes, extensive illustration is considered valuable for diagnosis. While the pathogenesis is still unknown, a number of images illustrate the suspected "arrested-trafficking" hypothesis of microvillous abnormalities. Others micrographs support the "engulfing" mechanism of inclusion formation. The electron micrographs should help ultrastructural diagnosis in this heterogeneous disease and can confirm diagnosis even in the absence of the typical inclusions.

  6. AMXP Pulse variability wih NICER

    Science.gov (United States)

    Bult, Peter

    2017-08-01

    Accreting millisecond X-ray pulsars show a diverse scope variability, including coherent pulsations from the stellar surface and quasi-periodic oscillations attributed to the accretion flow. Because the pulsations are ultimately powered by accreting material, it may be expected that these periodic and quasi-periodic signals show coupled behavior. Observing and characterizing such coupling then gives a unique view of the flow of matter in the closest vicinity of the neutron star surface. In this contribution I will present recently developed specialized methods that can detect such coupling, and discuss how high quality X-ray observations by NICER may enable pulse amplitude modulation studies, and their potential to constrain the physics of accretion.

  7. Quantum computation and hidden variables

    CERN Document Server

    Aristov, V V

    2010-01-01

    Many physicists limit oneself to an instrumentalist description of quantum phenomena and ignore the problems of foundation and interpretation of quantum mechanics. This instrumentalist approach results to "specialization barbarism" and mass delusion concerning the problem, how a quantum computer can be made. The idea of quantum computation can be described within the limits of quantum formalism. But in order to understand how this idea can be put into practice one should realize the question: "What could the quantum formalism describe?", in spite of the absence of an universally recognized answer. Only a realization of this question and the undecided problem of quantum foundations allows to see in which quantum systems the superposition and EPR correlation could be expected. Because of the "specialization barbarism" many authors are sure that Bell proved full impossibility of any hidden-variables interpretation. Therefore it is important to emphasize that in reality Bell has restricted to validity limits of t...

  8. Earth\\'s Mass Variability

    CERN Document Server

    Mawad, Ramy

    2014-01-01

    The perturbation of the Earth caused by variability of mass of Earth as additional reason with gravity of celestial bodies and shape of the Earth. The Earth eating and collecting matters from space and loss or eject matters to space through its flying in the space around the Sun. The source of the rising in the global sea level is not closed in global warming and icebergs, but the outer space is the additional important source for this rising. The Earth eats waters from space in unknown mechanism. The mass of the Earth become greater in November i.e. before transit apoapsis two months, and become latter in February i.e. after transit apoapsis to two months.

  9. Motor Integrated Variable Speed Drives

    DEFF Research Database (Denmark)

    Singh, Yash Veer

    A new trend in the variable speed drives (VSDs) is to develop fully integrated systems, which lead to low-cost products with shorter design cycles. Motor Integrated design of VSDs will reduce cable length to connect drive with machine windings and installation time for end user. The electric drives...... are expected to have minimum effect on grid and motor connected to it, i.e. currents drawn from grid should be within specified limits and currents injecting in to machine should not overheat the machine windings to avoid insulation failure due to harmonics. It is also necessary that electric drives should...... when it comes to the development of any kind of power converter topology for power electronic applications. Concerning the use of a power converter in motor integrated VSDs, the first two mentioned aspects receive an even greater im-portance. Power converter design for integrated drives poses a host...

  10. Variable-bias coin tossing

    Science.gov (United States)

    Colbeck, Roger; Kent, Adrian

    2006-03-01

    Alice is a charismatic quantum cryptographer who believes her parties are unmissable; Bob is a (relatively) glamorous string theorist who believes he is an indispensable guest. To prevent possibly traumatic collisions of self-perception and reality, their social code requires that decisions about invitation or acceptance be made via a cryptographically secure variable-bias coin toss (VBCT). This generates a shared random bit by the toss of a coin whose bias is secretly chosen, within a stipulated range, by one of the parties; the other party learns only the random bit. Thus one party can secretly influence the outcome, while both can save face by blaming any negative decisions on bad luck. We describe here some cryptographic VBCT protocols whose security is guaranteed by quantum theory and the impossibility of superluminal signaling, setting our results in the context of a general discussion of secure two-party computation. We also briefly discuss other cryptographic applications of VBCT.

  11. Benchmarking heart rate variability toolboxes.

    Science.gov (United States)

    Vest, Adriana N; Li, Qiao; Liu, Chengyu; Nemati, Shamim; Shah, Amit; Clifford, Gari D

    Heart rate variability (HRV) metrics hold promise as potential indicators for autonomic function, prediction of adverse cardiovascular outcomes, psychophysiological status, and general wellness. Although the investigation of HRV has been prevalent for several decades, the methods used for preprocessing, windowing, and choosing appropriate parameters lack consensus among academic and clinical investigators. A comprehensive and open-source modular program is presented for calculating HRV implemented in Matlab with evidence-based algorithms and output formats. We compare our software with another widely used HRV toolbox written in C and available through PhysioNet.org. Our findings show substantially similar results when using high quality electrocardiograms (ECG) free from arrhythmias. Our software shows equivalent performance alongside an established predecessor and includes validated tools for performing preprocessing, signal quality, and arrhythmia detection to help provide standardization and repeatability in the field, leading to fewer errors in the presence of noise or arrhythmias. Copyright © 2017 Elsevier Inc. All rights reserved.

  12. Continuously variable focal length lens

    Science.gov (United States)

    Adams, Bernhard W; Chollet, Matthieu C

    2013-12-17

    A material preferably in crystal form having a low atomic number such as beryllium (Z=4) provides for the focusing of x-rays in a continuously variable manner. The material is provided with plural spaced curvilinear, optically matched slots and/or recesses through which an x-ray beam is directed. The focal length of the material may be decreased or increased by increasing or decreasing, respectively, the number of slots (or recesses) through which the x-ray beam is directed, while fine tuning of the focal length is accomplished by rotation of the material so as to change the path length of the x-ray beam through the aligned cylindrical slows. X-ray analysis of a fixed point in a solid material may be performed by scanning the energy of the x-ray beam while rotating the material to maintain the beam's focal point at a fixed point in the specimen undergoing analysis.

  13. Intraindividual Variability in Serum Micronutrients

    Science.gov (United States)

    Shvetsov, Yurii B.; Hernandez, Brenda Y.; Wong, Sze H.; Wilkens, Lynne R.; Franke, Adrian A.; Goodman, Marc T.

    2009-01-01

    Background: Although serum measures of micronutrients are more specific than questionnaires in quantifying nutritional status, the reliability of serum measures depends on between- and within-person variability of circulating micronutrient levels. The extent to which multiple samples per person might improve reliability is useful information for planning studies and interpreting results. Methods: We analyzed levels of 25 micronutrients in serum samples taken from 381 Hawaii women at 4-month intervals. For all subjects and for subjects at the low and high end of the micronutrient distributions, we calculated inter- and intraindividual variability, reliability coefficients, and the number of measurements required to limit attenuation in estimated parameters (ie, to keep estimates close to their true values). Results: For 18 of the 25 micronutrients, a single measurement provided an estimate within 20% of the true value. For regression coefficients, 2 measurements were needed to limit attenuation to no more than 20% for nearly half of the micronutrients. To achieve no more than 10% attenuation, the number of measurements required ranged from 2 to 10 for correlation and from 3 to 20 for regression coefficients. To achieve no more than 5% attenuation, the corresponding ranges were 3 to 21 for correlation and 6 to 42 regression coefficients. In general, more measurements were required for adequate characterization of subjects with relatively high levels of micronutrients than for subjects with lower levels. Conclusions: Our analysis suggests that 2 or 3 blood measurements are enough to limit attenuation of regression coefficients within 20% of the true value for most carotenoids and tocopherols. For 10% attenuation or less, 4 or more micronutrient measurements may be needed. PMID:18813024

  14. Eternity Variables to Prove Simulation of Specifications

    NARCIS (Netherlands)

    Hesselink, Wim H.

    2005-01-01

    Simulations of specifications are introduced as a unification and generalization of refinement mappings, history variables, forward simulations, prophecy variables, and backward simulations. A specification implements another specification if and only if there is a simulation from the first one to

  15. Concomitant variables in finite mixture models

    NARCIS (Netherlands)

    Wedel, M

    The standard mixture model, the concomitant variable mixture model, the mixture regression model and the concomitant variable mixture regression model all enable simultaneous identification and description of groups of observations. This study reviews the different ways in which dependencies among

  16. Grid of streamflow variability index for Ohio

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — A generalized streamflow-variability index coverage was created by interpolating a grid (with 6,066-ft^2 cells) from at-site values of the streamflow-variability...

  17. VARIABLE SELECTION FOR CENSORED QUANTILE REGRESION

    National Research Council Canada - National Science Library

    Huixia Judy Wang; Jianhui Zhou; Yi Li

    2013-01-01

    ... the identification of important prognostic factors. In view of the limited work on variable selection in this context, we develop a new adaptive-lasso-based variable selection procedure for quantile regression with censored outcomes...

  18. The Protestant Ethic as a Personality Variable

    Science.gov (United States)

    Mirels, Herbert L.; Garrett, James B.

    1971-01-01

    The work described in this paper views the Protestant Ethic as a dispositional variable and attempts to characterize its psychological meaning in terms of its relationship with other personality variables and with occupational interests. (Author)

  19. Intrasubject variability in power reflectance.

    Science.gov (United States)

    Abur, Defne; Horton, Nicholas J; Voss, Susan E

    2014-05-01

    Power reflectance measurements are an active area of research related to the development of noninvasive middle-ear assessment methods. There are limited data related to test-retest measures of power reflectance. This study investigates test-retest features of power reflectance, including comparisons of intrasubject versus intersubject variability and how ear-canal measurement location affects measurements. Repeated measurements of power reflectance were made at about weekly intervals. The subjects returned for four to eight sessions. Measurements were made at three ear-canal locations: a deep insertion depth (with a foam plug flush at the entrance to the ear canal) and both 3 and 6 mm more lateral to this deep insertion. Repeated measurements on seven subjects are reported. All subjects were female, between 19 and 22 yr old, and enrolled at an undergraduate women's college. Measurements on both the right and left ears were made at three ear-canal locations during each of four to eight measurement sessions. Random-effects regression models were used for the analysis to account for repeated measures within subjects. The mean power reflectance for each position over all sessions was calculated for each subject. The comparison of power reflectance from the left and right ears of an individual subject varied greatly over the seven subjects; the difference between the power reflectance measured on the left and that measured on the right was compared at 248 frequencies, and depending on the subject, the percentage of tested frequencies for which the left and right ears differed significantly ranged from 10% to 93% (some with left values greater than right values and others with the opposite pattern). Although the individual subjects showed left-right differences, the overall population generally did not show significant differences between the left and right ears. The mean power reflectance for each measurement position over all sessions depended on the location of the

  20. Determining the explanatory potential of variables

    NARCIS (Netherlands)

    Abraham, E.A.; Bronkhorst, E.M.; Truin, G.J.; Severens, J.L.; Felling, A.J.A.

    2002-01-01

    A meta-analysis may not be the most appropriate method for the extraction of information on independent variables from the scientific literature. A formal quantitative review method is proposed for reducing a literature review variable list to a manageable list of explanatory variables. The proposed

  1. Transformation of independent variables in polynomial regression ...

    African Journals Online (AJOL)

    In representing a relationship between a response and a number of independent variables, it is preferable when possible to work with a simple functional form in transformed variables rather than with a more complicated form in the original variables. In this paper, it is shown that linear transformations applied to ...

  2. Climate variability drives population cycling and synchrony

    Science.gov (United States)

    Lars Y. Pomara; Benjamin Zuckerberg

    2017-01-01

    Aim There is mounting concern that climate change will lead to the collapse of cyclic population dynamics, yet the influence of climate variability on population cycling remains poorly understood. We hypothesized that variability in survival and fecundity, driven by climate variability at different points in the life cycle, scales up from...

  3. Synchronization Model for Pulsating Variables

    Science.gov (United States)

    Takahashi, S.; Morikawa, M.

    2013-12-01

    A simple model is proposed, which describes the variety of stellar pulsations. In this model, a star is described as an integration of independent elements which interact with each other. This interaction, which may be gravitational or hydrodynamic, promotes the synchronization of elements to yield a coherent mean field pulsation provided some conditions are satisfied. In the case of opacity driven pulsations, the whole star is described as a coupling of many heat engines. In the case of stochastic oscillation, the whole star is described as a coupling of convection cells, interacting through their flow patterns. Convection cells are described by the Lorentz model. In both models, interactions of elements lead to various pulsations, from irregular to regular. The coupled Lorenz model also describes a light curve which shows a semi-regular variability and also shows a low-frequency enhancement proportional to 1/f in its power spectrum. This is in agreement with observations (Kiss et al. 2006). This new modeling method of ‘coupled elements’ may provide a powerful description for a variety of stellar pulsations.

  4. Emission-Line Region Variability

    Science.gov (United States)

    Peterson, Bradley M.

    We propose to obtain simultaneous optical and ultraviolet observations of the rapidly varying active galaxies Akn 120 and 3C 120. Both these sources are distinguished by short-time scale variations in their continuum and broadline fluxes, and we intend to exploit this property to determine fundamental characteristics of the emission-line gas. Akn 120 has been studied extensively by the Ohio State group, and is one of the few active galaxies for which a reliable upper limit for the separation between the continuum source and the emission-line clouds has been established from reverberation measurements. The important goals of the proposed project are (1) to provide a suitable database of optical and ultraviolet broad-line flux measurements obtained during different continuum states and (2) to compare the temporal behavior of optical and ultraviolet emission lines. In particular, we wish to determine whether or not C III] A1909 varies on the same time scale as the Balmer lines and how much of the flux in this feature can actually be ascribed to broad-line emission from C^+2. These data will enable us to make a differential comparison with predictions of photoionization models, since the emission-line spectrum will change in response to the variable ionizing continuum flux. Such a differential comparison between observation and theory should be more reliable than attempts to match absolute intensities because errors in the atomic data base should tend to cancel out.

  5. Hidden Variables and Placebo Effects

    Science.gov (United States)

    Goradia, Shantilal

    2006-03-01

    God's response to prayers and placebo leads to a question. How does He respond deterministically? He may be controlling at least one of the two variables of the uncertainty principle by extending His invisible soul to each body particle locally. Amazingly, many Vedic verses support this answer. One describes the size of the soul as arithmetically matching the size of the nucleons as if a particle is a soul. One gives a name meaning particle soul (anu-atma), consistent with particle's indeterministic behavior like that of (soulful) bird’s flying in any directions irrespective of the direction of throw. One describes souls as eternal consistent with the conservation of baryon number. One links the souls to the omnipresent (param- atma) like Einstein Rosen bridges link particles to normal spacetime. One claims eternal coexistence of matter and soul as is inflationary universe in physics/0210040 V2. The implicit scientific consistency of such verses makes the relationship of particle source of consciousness to the omnipresent Supreme analogous to the relationship of quantum source of gravitons in my gr-qc/0507130 to normal spacetime This frees us from the postulation of quantum wormholes and quantum foam. Dr. Hooft's view in ``Does God play dice,'' Physicsword, Dec 2005 seems consistent with my progressive conference presentations in Russia, Europe, India, and USA (Hindu University) in 2004/05. I see implications for nanoscience.

  6. Variable Pitch Darrieus Water Turbines

    Science.gov (United States)

    Kirke, Brian; Lazauskas, Leo

    In recent years the Darrieus wind turbine concept has been adapted for use in water, either as a hydrokinetic turbine converting the kinetic energy of a moving fluid in open flow like an underwater wind turbine, or in a low head or ducted arrangement where flow is confined, streamtube expansion is controlled and efficiency is not subject to the Betz limit. Conventional fixed pitch Darrieus turbines suffer from two drawbacks, (i) low starting torque and (ii) shaking due to cyclical variations in blade angle of attack. Ventilation and cavitation can also cause problems in water turbines when blade velocities are high. Shaking can be largely overcome by the use of helical blades, but these do not produce large starting torque. Variable pitch can produce high starting torque and high efficiency, and by suitable choice of pitch regime, shaking can be minimized but not entirely eliminated. Ventilation can be prevented by avoiding operation close to a free surface, and cavitation can be prevented by limiting blade velocities. This paper summarizes recent developments in Darrieus water turbines, some problems and some possible solutions.

  7. PROGNOSIS OF RESULTS IN CRITERIA VARIABLE BASIC SWINGING BASIS ON VARIABLES OF MOTOR ABILITIES

    Directory of Open Access Journals (Sweden)

    Edin Mujanović

    2008-08-01

    Full Text Available Main goal of this research is identification prognosis of results in criteria variable basic swinging basis on variables of motor abilities. Research has been conducted on sample of 81 students the 3rd year of Faculty of physical education and sport at University of Tuzla. Measuring was accomplished with 24 variables of motor abilities and criteria variable, basic swinging. Results of regressive analyze have shown that success in performing of criteria variable is conditioned with all applied variables of motor abilities, and prognosis of results is exceeds, basis on the entire system of prediction variables in regard to help of individual influence prognosis variables on criteria system.

  8. ASYMPIOTIC SOLUTIONS OF THE NON-LINEAR WAVE EQUAION

    African Journals Online (AJOL)

    MIS

    1983-09-01

    Sep 1, 1983 ... we scale both x and t by introducing the fast variables. = t, X = x. (2.2a) and the slow variables. T. = εt, X = εX. (2.2b). The derivatives now become ut = u + εuT and ux = ux + εuX and the solution of the nonlinear wave equation (1.1) is sought in the form of a uniformly valid asymptotic expansion in powers of ε.

  9. Variable control system for diesel engine

    Energy Technology Data Exchange (ETDEWEB)

    Nakahira, Toshio; Yokota, Katsuhiko

    1987-08-01

    Various variable mechanisms, aiming at smaller, lighter and low-fuel consumption diesel engine, are introduced. With the variable mechanism in the ingalation system, there are the variable nozzle vane type variable capacity turbocharger and the variable inertia supercharger using an inertia supercharging pipe. In the variable mechanism of the fuel system, there is a variable swirl for matching air flow, fuel injection system and the shape of the combustion chamber. The fuel injection system is provided with an injection rate variable pump in which prestroke of the pump is made variable by the electronic control, a DDA electronic unit injection which controls injection timing using a high-speed solenoid valve and a pressure cumulative fuel injection device with which fuel injection characteristics are completely isolated from the influence of engine revolution, etc. Other variable mechanisms, thus far developed, include the retarder of a new mechanism and an electonic governor, etc. The variable control system of diesel engine for medium and large vehicles will be modified to a comprehensive optimum control mechanisms for the engine. (10 figs, 1 tab, 15 refs)

  10. Variable density turbulence tunnel facility

    Science.gov (United States)

    Bodenschatz, E.; Bewley, G. P.; Nobach, H.; Sinhuber, M.; Xu, H.

    2014-09-01

    The Variable Density Turbulence Tunnel at the Max Planck Institute for Dynamics and Self-Organization in Göttingen, Germany, produces very high turbulence levels at moderate flow velocities, low power consumption, and adjustable kinematic viscosity between 10-4 m2/s and 10-7 m2/s. The Reynolds number can be varied by changing the pressure or flow rate of the gas or by using different non-flammable gases including air. The highest kinematic viscosities, and hence lowest Reynolds numbers, are reached with air or nitrogen at 0.1 bar. To reach the highest Reynolds numbers the tunnel is pressurized to 15 bars with the dense gas sulfur hexafluoride (SF6). Turbulence is generated at the upstream ends of two measurement sections with grids, and the evolution of this turbulence is observed as it moves down the length of the sections. We describe the instrumentation presently in operation, which consists of the tunnel itself, classical grid turbulence generators, and state-of-the-art nano-fabricated hot-wire anemometers provided by Princeton University [M. Vallikivi, M. Hultmark, S. C. C. Bailey, and A. J. Smits, Exp. Fluids 51, 1521 (2011)]. We report measurements of the characteristic scales of the flow and of turbulent spectra up to Taylor Reynolds number Rλ ≈ 1600, higher than any other grid-turbulence experiment. We also describe instrumentation under development, which includes an active grid and a Lagrangian particle tracking system that moves down the length of the tunnel with the mean flow. In this configuration, the properties of the turbulence are adjustable and its structure is resolvable up to Rλ ≈ 8000.

  11. Variable density turbulence tunnel facility.

    Science.gov (United States)

    Bodenschatz, E; Bewley, G P; Nobach, H; Sinhuber, M; Xu, H

    2014-09-01

    The Variable Density Turbulence Tunnel at the Max Planck Institute for Dynamics and Self-Organization in Göttingen, Germany, produces very high turbulence levels at moderate flow velocities, low power consumption, and adjustable kinematic viscosity between 10(-4) m(2)/s and 10(-7) m(2)/s. The Reynolds number can be varied by changing the pressure or flow rate of the gas or by using different non-flammable gases including air. The highest kinematic viscosities, and hence lowest Reynolds numbers, are reached with air or nitrogen at 0.1 bar. To reach the highest Reynolds numbers the tunnel is pressurized to 15 bars with the dense gas sulfur hexafluoride (SF6). Turbulence is generated at the upstream ends of two measurement sections with grids, and the evolution of this turbulence is observed as it moves down the length of the sections. We describe the instrumentation presently in operation, which consists of the tunnel itself, classical grid turbulence generators, and state-of-the-art nano-fabricated hot-wire anemometers provided by Princeton University [M. Vallikivi, M. Hultmark, S. C. C. Bailey, and A. J. Smits, Exp. Fluids 51, 1521 (2011)]. We report measurements of the characteristic scales of the flow and of turbulent spectra up to Taylor Reynolds number R(λ) ≈ 1600, higher than any other grid-turbulence experiment. We also describe instrumentation under development, which includes an active grid and a Lagrangian particle tracking system that moves down the length of the tunnel with the mean flow. In this configuration, the properties of the turbulence are adjustable and its structure is resolvable up to R(λ) ≈ 8000.

  12. Short time-scale variability in the Faint Sky Variability Survey

    NARCIS (Netherlands)

    Morales-Rueda, L.; Groot, P.J.; Augusteijn, T.; Nelemans, G.A.; Vreeswijk, P.M.; Besselaar, E.J.M. van den

    2006-01-01

    We present the V-band variability analysis of the point sources in the Faint Sky Variability Survey on time-scales from 24 min to tens of days. We find that about one per cent of the point sources down to V = 24 are variables. We discuss the variability-detection probabilities for each field

  13. QT Variability and Other Electrocardiographic Predictors of Sudden Cardiac Death

    NARCIS (Netherlands)

    M.E. van den Berg (Marten)

    2017-01-01

    markdownabstractThis thesis investigates sudden cardiac death, focusing of QT variability, heart-rate variability and other electrocardiographic markers. Topics include: - Normal values for heart-rate variability - Normal values for QT variability - The association of QT variability with

  14. Exploring phase dependent functional gait variability.

    Science.gov (United States)

    Hamacher, Daniel; Hamacher, Dennis; Müller, Roy; Schega, Lutz; Zech, Astrid

    2017-04-01

    Gait variability is frequently used to evaluate the sensorimotor system and elderly fallers compared to non-fallers exhibit an altered variability in gait parameters during unchanged conditions. While gait variability is often interpreted as movement error, it is also necessary to change the gait pattern in order to react to internal and external perturbations. This phenomenon has been described as functional variability and ensures the stability of gait motor control. The aim of the current study is to explore the functional variability in relation to the different phases of the gait cycle (phase-dependent gait variability). Kinematics of the foot, shank and thigh were registered with inertial sensors (MTw2, Xsens Technologies B.V) in 25 older participants (70±6years) during normal overground walking. Phase-dependent variability was defined as the standard deviation of the Euclidean norm of the angular velocity data. To assess differences with respect to the variability of different body segments (foot, shank, and thigh), the statistical parametric mapping method was applied. In normal walking, the variability of the time-continuous foot kinematics during parts of the swing phase was higher compared to the shank (9-14% of swing phase, pgait. In fact, we found reduced variability in the time-continuous foot kinematics in mid swing during normal walking where also the minimum toe clearance event occurs. Copyright © 2017 Elsevier B.V. All rights reserved.

  15. Concurrent variable-interval variable-ratio schedules in a dynamic choice environment.

    Science.gov (United States)

    Bell, Matthew C; Baum, William M

    2017-11-07

    Most studies of operant choice have focused on presenting subjects with a fixed pair of schedules across many experimental sessions. Using these methods, studies of concurrent variable- interval variable-ratio schedules helped to evaluate theories of choice. More recently, a growing literature has focused on dynamic choice behavior. Those dynamic choice studies have analyzed behavior on a number of different time scales using concurrent variable-interval schedules. Following the dynamic choice approach, the present experiment examined performance on concurrent variable-interval variable-ratio schedules in a rapidly changing environment. Our objectives were to compare performance on concurrent variable-interval variable-ratio schedules with extant data on concurrent variable-interval variable-interval schedules using a dynamic choice procedure and to extend earlier work on concurrent variable-interval variable-ratio schedules. We analyzed performances at different time scales, finding strong similarities between concurrent variable-interval variable-interval and concurrent variable-interval variable- ratio performance within dynamic choice procedures. Time-based measures revealed almost identical performance in the two procedures compared with response-based measures, supporting the view that choice is best understood as time allocation. Performance at the smaller time scale of visits accorded with the tendency seen in earlier research toward developing a pattern of strong preference for and long visits to the richer alternative paired with brief "samples" at the leaner alternative ("fix and sample"). © 2017 Society for the Experimental Analysis of Behavior.

  16. Business Cycle Variability and Growth Linkage

    OpenAIRE

    Inekwe John Nkwoma

    2014-01-01

    This study contributes in bridging the dichotomy between economic growth and business cycle paradigms by providing dynamic characterisation of the link between economic growth, risk aversion, uncertainty and variability in industrial production, consumption and investment. In a system of equations, the study reveals that risk aversion, uncertainty and variability of business cycle components aid to contract growth. In contrast, ambiguous relationship exists between variability of hours worked...

  17. Eccentric crank variable compression ratio mechanism

    Science.gov (United States)

    Lawrence, Keith Edward [Kobe, JP; Moser, William Elliott [Peoria, IL; Roozenboom, Stephan Donald [Washington, IL; Knox, Kevin Jay [Peoria, IL

    2008-05-13

    A variable compression ratio mechanism for an internal combustion engine that has an engine block and a crankshaft is disclosed. The variable compression ratio mechanism has a plurality of eccentric disks configured to support the crankshaft. Each of the plurality of eccentric disks has at least one cylindrical portion annularly surrounded by the engine block. The variable compression ratio mechanism also has at least one actuator configured to rotate the plurality of eccentric disks.

  18. Desigualdades rango lineales en 5 variables

    OpenAIRE

    Campos Maldonado, Luis Andrés

    2013-01-01

    En este trabajo se hace un estudio de las desigualdades rango lineales, encontradas por R. Dougherty, C. Freiling y K. Zeger, las cuales involucran 5 variables, ´estas, junto a las desigualdades polimatroides y de Ingleton verifican que, las funciones rango lineales en 5 variables determinan un cono convexo poli´edrico. Adem´as, se estudia la caracterizaci´on de estas funciones involucrando hasta 4 variables, donde solo las desigualdades polimatroides y de Ingleton, logran cara...

  19. Integrated Variable Fidelity Conceptual Design Project

    Data.gov (United States)

    National Aeronautics and Space Administration — CADNexus proposes to develop an Integrated Variable Fidelity Conceptual Design tool. The application will enable design and analysis of unconventional and advanced...

  20. INTERACTION OF MACROECONOMIC VARIABLES WITH STOCK PRICES

    Directory of Open Access Journals (Sweden)

    ALİ ÖZER

    2013-06-01

    Full Text Available The aim of this study is to determine whether there is a relationship between ISE 100 Index and some macroeconomic variables by using monthly data of January 1996 – December 2009. ISE 100 Index was used as dependent variable and interest rates, money supply, foreign trade equilibrium, industrial production index, gold prices, exchange rates, consumer price index were used as independent variables. Least squares estimation method, Johansen-Jeselius cointegration test, Granger causality test and variance decomposition results produced by VEC model were used in the study. These analysis show that there is a long run relationship between some macroeconomic variables and stock prices.

  1. Variable Fidelity Aeroelastic Toolkit - Structural Model Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The proposed innovation is a methodology to incorporate variable fidelity structural models into steady and unsteady aeroelastic and aeroservoelastic analyses in...

  2. Correlation between some environmental variables and abundance ...

    African Journals Online (AJOL)

    Correlation between some environmental variables and abundance of Almophrya mediovacuolata (Ciliophora: Anoplophryidae) endocommensal ciliate of an anecic earthworms (Oligochaeta: Annelida) in Bambui (North-West Cameroon)

  3. Variable-Period Undulators For Synchrotron Radiation

    Energy Technology Data Exchange (ETDEWEB)

    Shenoy, Gopal (Naperville, IL); Lewellen, John (Plainfield, IL); Shu, Deming (Darien, IL); Vinokurov, Nikolai (Novosibirsk, RU)

    2005-02-22

    A new and improved undulator design is provided that enables a variable period length for the production of synchrotron radiation from both medium-energy and high-energy storage rings. The variable period length is achieved using a staggered array of pole pieces made up of high permeability material, permanent magnet material, or an electromagnetic structure. The pole pieces are separated by a variable width space. The sum of the variable width space and the pole width would therefore define the period of the undulator. Features and advantages of the invention include broad photon energy tunability, constant power operation and constant brilliance operation.

  4. Variable-Period Undulators for Synchrotron Radiation

    Energy Technology Data Exchange (ETDEWEB)

    Shenoy, Gopal; Lewellen, John; Shu, Deming; Vinokurov, Nikolai

    2005-02-22

    A new and improved undulator design is provided that enables a variable period length for the production of synchrotron radiation from both medium-energy and high energy storage rings. The variable period length is achieved using a staggered array of pole pieces made up of high permeability material, permanent magnet material, or an electromagnetic structure. The pole pieces are separated by a variable width space. The sum of the variable width space and the pole width would therefore define the period of the undulator. Features and advantages of the invention include broad photon energy tunability, constant power operation and constant brilliance operation.

  5. A Core Language for Separate Variability Modeling

    DEFF Research Database (Denmark)

    Iosif-Lazăr, Alexandru Florin; Wasowski, Andrzej; Schaefer, Ina

    2014-01-01

    models. Our language, Featherweight VML, has several distinctive features. Its architecture and operations are inspired by the recently proposed Common Variability Language (CVL). Its semantics is considerably simpler than that of CVL, while remaining confluent (unlike CVL). We simplify complex......Separate variability modeling adds variability to a modeling language without requiring modifications of the language or the supporting tools. We define a core language for separate variability modeling using a single kind of variation point to define transformations of software artifacts in object......, this is the first attempt to comprehensively formalize variant derivation, encompassing feature models, variation points, implementation artifacts and transformations....

  6. Variability of OI 090.4

    Indian Academy of Sciences (India)

    OI 090.4 was monitored on 21 nights from 2006 to 2012 for studying the variability. Strong variations occurred during the past 6 years. The long-term variability amplitude is consistent with previous results. Microvariability was analysed for 43 intra-night light curves. 30 out of 43 light curves showed microvariability by C and F ...

  7. Assessing Early Intervention Outcomes: Beyond Program Variables.

    Science.gov (United States)

    Marfo, Kofi; Dinero, Thomas E.

    1991-01-01

    This paper argues that efficacy of early intervention must be assessed in relation to both program and extra-program variables. A framework outlining five classes of independent variables and two classes of outcomes to be considered in efficacy research is presented, and regression and path analytic techniques are suggested as tools for addressing…

  8. Learning dynamic Bayesian networks with mixed variables

    DEFF Research Database (Denmark)

    Bøttcher, Susanne Gammelgaard

    This paper considers dynamic Bayesian networks for discrete and continuous variables. We only treat the case, where the distribution of the variables is conditional Gaussian. We show how to learn the parameters and structure of a dynamic Bayesian network and also how the Markov order can be learned...

  9. Convex trace functions of several variables

    DEFF Research Database (Denmark)

    Hansen, Frank

    2002-01-01

    We prove that the function (x1,...,xk)¿Tr(f(x1,...,xk)), defined on k-tuples of symmetric matrices of order (n1,...,nk) in the domain of f, is convex for any convex function f of k variables. The matrix f(x1,...,xk) is defined by the functional calculus for functions of several variables...

  10. Photospheric Variability and the Solar Atmosphere

    Science.gov (United States)

    Rosner, R.

    Variations in the bolometric luminosity of the Sun (due to photospheric variability) have for some time been related to solar magnetic activity. Such variations are observed on both the solar rotational period and on much longer time scales; I will review the current work in this area, and discuss related work in observations of stellar photospheric variability tied to stellar magnetic activity.

  11. Hidden Variable Theories and Quantum Nonlocality

    Science.gov (United States)

    Boozer, A. D.

    2009-01-01

    We clarify the meaning of Bell's theorem and its implications for the construction of hidden variable theories by considering an example system consisting of two entangled spin-1/2 particles. Using this example, we present a simplified version of Bell's theorem and describe several hidden variable theories that agree with the predictions of…

  12. Structural Modeling of Institutional Variables and Undergraduates ...

    African Journals Online (AJOL)

    Peer influence and facilities for research were the major exogenous variables while students' perception of their supervisors' commitment to research supervision was a critical variable that influences their attitude towards research projects. We suggest that research supervisors be firm and discreet in the supervision and ...

  13. About Variable Speed Heating and Cooling Pumps

    Directory of Open Access Journals (Sweden)

    Cătălin Popovici

    2009-01-01

    Full Text Available The present work has the purpose of underlying the advantages of variable speed heating and cooling pumps use for the perspective of general and particular pumping costs and efficiency. The study approaches comparisons between constant flow pumps and variable flow pumps in different given situations and comparatively analyses the pumping costs.

  14. About Variable Speed Heating and Cooling Pumps

    OpenAIRE

    Popovici, Cătălin; Ignat, Jan

    2009-01-01

    The present work has the purpose of underlying the advantages of variable speed heating and cooling pumps use for the perspective of general and particular pumping costs and efficiency. The study approaches comparisons between constant flow pumps and variable flow pumps in different given situations and comparatively analyses the pumping costs.

  15. Ecosystem variability in west Greenland waters

    DEFF Research Database (Denmark)

    Buch, E.; Pedersen, Søren Anker; Ribergaard, M. H.

    2004-01-01

    A review of the climate conditions off West Greenland during the past 50 years shows large variability in the atmospheric, oceanographic and sea-ice variables, as well as in fish stocks. A positive relationship is found between water temperature and the recruitment of cod and redfish, whereas the...

  16. Machine learning techniques to select variable stars

    Science.gov (United States)

    García-Varela, Alejandro; Pérez, Muriel; Sabogal, Beatriz; Quiroz, Adolfo

    2017-09-01

    In order to perform a supervised classification of variable stars, we propose and evaluate a set of six features extracted from the magnitude density of the light curves. They are used to train automatic classification systems using state-of-the-art classifiers implemented in the R statistical computing environment. We find that random forests is the most successful method to select variables.

  17. Continuous Variable Quantum Communication and Computation

    DEFF Research Database (Denmark)

    Andersen, Ulrik Lund; Dong, Ruifang; Jezek, Miroslav

    2011-01-01

    We use squeezed states of light to implement a robust continuous variable quantum key distribution scheme and an optical Hadamard gate based on coherent state qubits.......We use squeezed states of light to implement a robust continuous variable quantum key distribution scheme and an optical Hadamard gate based on coherent state qubits....

  18. Monitoring process variability using auxiliary information

    NARCIS (Netherlands)

    Riaz, M.

    2008-01-01

    In this study a Shewhart type control chart namely V (r) chart is proposed for improved monitoring of process variability (targeting large shifts) of a quality characteristic of interest Y. The proposed control chart is based on regression type estimator of variance using a single auxiliary variable

  19. Psychosocial Variables As Correlates Of University Maladjustment ...

    African Journals Online (AJOL)

    Psychosocial Variables As Correlates Of University Maladjustment Behaviour. ... Abstract. The goal of the study was to examine the influence of some psychosocial variables like personality factors (extraversion, agreeableness, neuroticism, conscientiousness and openness), gender (male and female) and age in predicting ...

  20. Precipitation variability assessment of northeast China: Songhua ...

    Indian Academy of Sciences (India)

    Variability in precipitation is critical for the management of water resources. In this study, the research entropy base concept was applied to investigate spatial and temporal variability of the precipitation during 1964–2013 in the Songhua River basin of Heilongjiang Province in China. Sample entropy was applied on ...

  1. Precipitation variability assessment of northeast China: Songhua ...

    Indian Academy of Sciences (India)

    Variability in precipitation is critical for the management of water resources. In this study, the researchentropy base concept was applied to investigate spatial and temporal variability of the precipitationduring 1964–2013 in the Songhua River basin of Heilongjiang Province in China. Sample entropy wasapplied on ...

  2. Estimation of biochemical variables using quantumbehaved particle ...

    African Journals Online (AJOL)

    Due to the difficulties in the measurement of biochemical variables in fermentation process, softsensing model based on radius basis function neural network had been established for estimating the variables. To generate a more efficient neural network estimator, we employed the previously proposed quantum-behaved ...

  3. Arctic decadal variability in a warming world

    NARCIS (Netherlands)

    Linden, van der Eveline C.; Bintanja, Richard; Hazeleger, Wilco

    2017-01-01

    Natural decadal variability of surface air temperature might obscure Arctic temperature trends induced by anthropogenic forcing. It is therefore imperative to know how Arctic decadal variability (ADV) will change as the climate warms. In this study, we evaluate ADV characteristics in three

  4. Variable Thermal Conductivity on Compressible Boundary Layer ...

    African Journals Online (AJOL)

    In this paper, variable thermal conductivity on heat transfer over a circular cylinder is presented. The concept of assuming constant thermal conductivity on materials is however not efficient. Hence, the governing partial differential equation is reduced using non-dimensionless variables into a system of coupled non-linear ...

  5. AGN Variability in the GOODS Fields

    Science.gov (United States)

    Sarajedini, Vicki

    2007-07-01

    Variability is a proven method to identify intrinsically faint active nuclei in galaxies found in deep HST surveys. We propose to extend our short-term variability study of the GOODS fields to include the more recent epochs obtained via supernovae searchers, increasing the overall time baseline from 6 months to 2.5 years. Based on typical AGN lightcurves, we expect to detect 70% more AGN by including these more recent epochs. Variable-detected AGN samples complement current X-ray and mid-IR surveys for AGN by providing unambigous evidence of nuclear activity. Additionallty, a significant number of variable nuclei are not associated with X-ray or mid-IR sources and would thus go undetected. With the increased time baseline, we will be able to construct the structure function {variability amplitude vs. time} for low-luminosity AGN to z 1. The inclusion of the longer time interval will allow for better descrimination among the various models describing the nature of AGN variability. The variability survey will be compared against spectroscopically selected AGN from the Team Keck Redshift Survey of the GOODS-N and the upcoming Flamingos-II NIR survey of the GOODS-S. The high-resolution ACS images will be used to separate the AGN from the host galaxy light and study the morphology, size and environment of the host galaxy. These studies will address questions concerning the nature of low-luminosity AGN evolution and variability at z 1.

  6. Energy-Efficient Variable Stiffness Actuators

    NARCIS (Netherlands)

    Visser, L.C.; Carloni, Raffaella; Stramigioli, Stefano

    2011-01-01

    Variable stiffness actuators are a particular class of actuators that is characterized by the property that the apparent output stiffness can be changed independent of the output position. To achieve this, variable stiffness actuators consist of a number of elastic elements and a number of actuated

  7. String matching with variable length gaps

    DEFF Research Database (Denmark)

    Bille, Philip; Gørtz, Inge Li; Vildhøj, Hjalte Wedel

    2012-01-01

    We consider string matching with variable length gaps. Given a string T and a pattern P consisting of strings separated by variable length gaps (arbitrary strings of length in a specified range), the problem is to find all ending positions of substrings in T that match P. This problem is a basic...

  8. A Semi-Automatic Variability Search

    Science.gov (United States)

    Maciejewski, G.; Niedzielski, A.

    Technical features of the Semi-Automatic Variability Search (SAVS) operating at the Astronomical Observatory of the Nicolaus Copernicus University and the results of the first year of observations are presented. The user-friendly software developed for reduction of acquired CCD images and detection of new variable stars is also described.

  9. Environmental variability and indicators: a few observations

    Science.gov (United States)

    William F. Laudenslayer

    1991-01-01

    Abstract The environment of the earth is exceedingly complex and variable. Indicator species are used to reduce thaf complexity and variability to a level that can be more emily understood. In recent years, use of indicators has increased dramatically. For the Forest Service, as an example, regulations that interpret the National Forest Management Act require the use...

  10. Confounding of three binary-variables counterfactual model

    OpenAIRE

    Liu, Jingwei; Hu, Shuang

    2011-01-01

    Confounding of three binary-variables counterfactual model is discussed in this paper. According to the effect between the control variable and the covariate variable, we investigate three counterfactual models: the control variable is independent of the covariate variable, the control variable has the effect on the covariate variable and the covariate variable affects the control variable. Using the ancillary information based on conditional independence hypotheses, the sufficient conditions...

  11. The variable stars of NGC 1866

    Science.gov (United States)

    Welch, Douglas L.; Cote, Patrick; Fischer, Philippe; Mateo, Mario; Madore, Barry F.

    1991-01-01

    A search has been conducted for new variables in the LMC cluster NGC 1866 using new multiepoch CCD photometry. Eight previously unknown Cepheid variables, most near the cluster core, are found. Of the new variables reported by Storm et al. (188), only six of 10 appear to be Cepheids and one of these is not a member. Periods and mean magnitudes and colors for sufficiently uncrowded variables are reported, as is one red giant variable of long period and one Cepheid which is a single-lined spectroscopic binary with a velocity semiamplitude greater than or equal to 10.5 km/s. The variation of light-curve amplitude with position in the instability strip is reported along with an apparently nonvariable star, which is a radial velocity member, in the strip. A true distance modulus of 18.57 + or - 0.01 mag is obtained for the cluster.

  12. Cognitive Variables Implicated In Chronic Pain

    Directory of Open Access Journals (Sweden)

    Moretti, Luciana Sofía

    2010-12-01

    Full Text Available Since the creation of gate control theory, the importance of psychological variables in chronic pain has emerged. Thus, the cognitive variables are emphasized in between behaviors, emotions and social factors for the explanation of chronic pain. Considering the gate control theory, cognitive variables modulate the other two dimensions of the chronic pain experience: the motivational-afective dimension and the sensory-discriminative dimension (Camacho Martel & Anarte Ortiz, 2001; Gatchel, Peng, Peters, Fuchs & Turk, 2007. The aim of this work is to review the main cognitive variables implicated in the chronic pain experience. Moreover, empirical evidence that support the importance of these variables is presented. Furthermore, it is discussed the clinical implications and the importance of this area in the local context.

  13. Quantum engineering of continuous variable quantum states

    Energy Technology Data Exchange (ETDEWEB)

    Sabuncu, Metin

    2009-10-29

    Quantum information with continuous variables is a field attracting increasing attention recently. In continuous variable quantum information one makes use of the continuous information encoded into the quadrature of a quantized light field instead of binary quantities such as the polarization state of a single photon. This brand new research area is witnessing exciting theoretical and experimental achievements such as teleportation, quantum computation and quantum error correction. The rapid development of the field is mainly due higher optical data rates and the availability of simple and efficient manipulation tools in continuous-variable quantum information processing. We in this thesis extend the work in continuous variable quantum information processing and report on novel experiments on amplification, cloning, minimal disturbance and noise erasure protocols. The promising results we obtain in these pioneering experiments indicate that the future of continuous variable quantum information is bright and many advances can be foreseen. (orig.)

  14. Variable Red Giants--The MACHO View

    Energy Technology Data Exchange (ETDEWEB)

    Keller, S C; Cook, K H

    2003-01-03

    The authors present a study of the MACHO red variable population in the Large Magellanic Cloud. This study reveals six period-luminosity relations among the red variable population. Only two of these were known prior to MACHO. The results are consistent with Mira pulsation in the fundamental mode. A sequence comprising 26% of the red variable population can not be explained by pulsation. They propose a dust {kappa}-mechanism in the circumstellar environment is responsible for the long period variation of these objects. The luminosity function of the variables shows a sharp edge at the tip of the red giant branch (TRGB). This is the first clear indication of a population of variable stars within the immediate vicinity of the TRGB. The results indicate this population amounts to 8% of the RGB population near the TRGB.

  15. Continuous-variable quantum homomorphic signature

    Science.gov (United States)

    Li, Ke; Shang, Tao; Liu, Jian-wei

    2017-10-01

    Quantum cryptography is believed to be unconditionally secure because its security is ensured by physical laws rather than computational complexity. According to spectrum characteristic, quantum information can be classified into two categories, namely discrete variables and continuous variables. Continuous-variable quantum protocols have gained much attention for their ability to transmit more information with lower cost. To verify the identities of different data sources in a quantum network, we propose a continuous-variable quantum homomorphic signature scheme. It is based on continuous-variable entanglement swapping and provides additive and subtractive homomorphism. Security analysis shows the proposed scheme is secure against replay, forgery and repudiation. Even under nonideal conditions, it supports effective verification within a certain verification threshold.

  16. Adaptive Variability in Skilled Human Movements

    Science.gov (United States)

    Kudo, Kazutoshi; Ohtsuki, Tatsuyuki

    Human movements are produced in variable external/internal environments. Because of this variability, the same motor command can result in quite different movement patterns. Therefore, to produce skilled movements humans must coordinate the variability, not try to exclude it. In addition, because human movements are produced in redundant and complex systems, a combination of variability should be observed in different anatomical/physiological levels. In this paper, we introduce our research about human movement variability that shows remarkable coordination among components, and between organism and environment. We also introduce nonlinear dynamical models that can describe a variety of movements as a self-organization of a dynamical system, because the dynamical systems approach is a major candidate to understand the principle underlying organization of varying systems with huge degrees-of-freedom.

  17. Soil CO 2 Flux in Hövsgöl National Park, Northern Mongolia

    Directory of Open Access Journals (Sweden)

    Avirmed Otgonsuren

    2008-06-01

    Full Text Available We investigated soil CO 2 fl ux and bare soil respiration in grasslands that are located at the southern edge of the Siberian boreal forest in Northern Mongolia. The study area has warmed by almost 1.8 o C over the last 40 years, and the soil and vegetation covers have been changed due to intense nomadic grazing pressure. Bare soil respiration is decreased with increasing grazing pressure, but there was no consistent pattern of total soil CO 2 fl ux under three distinct grazing levels. Bare soil respiration and soil CO 2 fl ux were higher on north-facing slopes than on south-facing slopes, due to high organic matter accumulation and the presence of permafrost. Both bare soil respiration and soil CO 2 fl ux were signi fi cantly higher in riparian areas compared with the lower and upper portions of the south-facing slope. Topography has a stronger effect on variability of soil CO 2 fl ux and bare soil respiration than variability induced by grazing. Inter-annual variability in soil CO 2 fl ux and bare soil respiration was very high, because of high variability in climate conditions.

  18. Neural Variability Quenching Predicts Individual Perceptual Abilities.

    Science.gov (United States)

    Arazi, Ayelet; Censor, Nitzan; Dinstein, Ilan

    2017-01-04

    Neural activity during repeated presentations of a sensory stimulus exhibits considerable trial-by-trial variability. Previous studies have reported that trial-by-trial neural variability is reduced (quenched) by the presentation of a stimulus. However, the functional significance and behavioral relevance of variability quenching and the potential physiological mechanisms that may drive it have been studied only rarely. Here, we recorded neural activity with EEG as subjects performed a two-interval forced-choice contrast discrimination task. Trial-by-trial neural variability was quenched by ∼40% after the presentation of the stimulus relative to the variability apparent before stimulus presentation, yet there were large differences in the magnitude of variability quenching across subjects. Individual magnitudes of quenching predicted individual discrimination capabilities such that subjects who exhibited larger quenching had smaller contrast discrimination thresholds and steeper psychometric function slopes. Furthermore, the magnitude of variability quenching was strongly correlated with a reduction in broadband EEG power after stimulus presentation. Our results suggest that neural variability quenching is achieved by reducing the amplitude of broadband neural oscillations after sensory input, which yields relatively more reproducible cortical activity across trials and enables superior perceptual abilities in individuals who quench more. Variability quenching is a phenomenon in which neural variability across trials is reduced by the presentation of a stimulus. Although this phenomenon has been reported across a variety of animal and human studies, its functional significance and behavioral relevance have been examined only rarely. Here, we report novel empirical evidence from humans revealing that variability quenching differs dramatically across individual subjects and explains to a certain degree why some individuals exhibit better perceptual abilities than

  19. Instrumental variable methods for causal inference.

    Science.gov (United States)

    Baiocchi, Michael; Cheng, Jing; Small, Dylan S

    2014-06-15

    A goal of many health studies is to determine the causal effect of a treatment or intervention on health outcomes. Often, it is not ethically or practically possible to conduct a perfectly randomized experiment, and instead, an observational study must be used. A major challenge to the validity of observational studies is the possibility of unmeasured confounding (i.e., unmeasured ways in which the treatment and control groups differ before treatment administration, which also affect the outcome). Instrumental variables analysis is a method for controlling for unmeasured confounding. This type of analysis requires the measurement of a valid instrumental variable, which is a variable that (i) is independent of the unmeasured confounding; (ii) affects the treatment; and (iii) affects the outcome only indirectly through its effect on the treatment. This tutorial discusses the types of causal effects that can be estimated by instrumental variables analysis; the assumptions needed for instrumental variables analysis to provide valid estimates of causal effects and sensitivity analysis for those assumptions; methods of estimation of causal effects using instrumental variables; and sources of instrumental variables in health studies. Copyright © 2014 John Wiley & Sons, Ltd.

  20. Determining out-of-control variable(s) in a multivariate quality control ...

    African Journals Online (AJOL)

    In this work, we extend the technique to four process variables which can be used for identifying out-of-control variables when signal occurs in a control chart. Twenty four (24) decompositions are presented of which one of the decompositions is used to identify out-of-control variables. Shift in the mean as well as in the ...

  1. Validity of a Residualized Dependent Variable after Pretest Covariance Adjustments: Still the Same Variable?

    Science.gov (United States)

    Nimon, Kim; Henson, Robin K.

    2015-01-01

    The authors empirically examined whether the validity of a residualized dependent variable after covariance adjustment is comparable to that of the original variable of interest. When variance of a dependent variable is removed as a result of one or more covariates, the residual variance may not reflect the same meaning. Using the pretest-posttest…

  2. Gait variability: methods, modeling and meaning

    Directory of Open Access Journals (Sweden)

    Hausdorff Jeffrey M

    2005-07-01

    Full Text Available Abstract The study of gait variability, the stride-to-stride fluctuations in walking, offers a complementary way of quantifying locomotion and its changes with aging and disease as well as a means of monitoring the effects of therapeutic interventions and rehabilitation. Previous work has suggested that measures of gait variability may be more closely related to falls, a serious consequence of many gait disorders, than are measures based on the mean values of other walking parameters. The Current JNER series presents nine reports on the results of recent investigations into gait variability. One novel method for collecting unconstrained, ambulatory data is reviewed, and a primer on analysis methods is presented along with a heuristic approach to summarizing variability measures. In addition, the first studies of gait variability in animal models of neurodegenerative disease are described, as is a mathematical model of human walking that characterizes certain complex (multifractal features of the motor control's pattern generator. Another investigation demonstrates that, whereas both healthy older controls and patients with a higher-level gait disorder walk more slowly in reduced lighting, only the latter's stride variability increases. Studies of the effects of dual tasks suggest that the regulation of the stride-to-stride fluctuations in stride width and stride time may be influenced by attention loading and may require cognitive input. Finally, a report of gait variability in over 500 subjects, probably the largest study of this kind, suggests how step width variability may relate to fall risk. Together, these studies provide new insights into the factors that regulate the stride-to-stride fluctuations in walking and pave the way for expanded research into the control of gait and the practical application of measures of gait variability in the clinical setting.

  3. Variable selection by lasso-type methods

    Directory of Open Access Journals (Sweden)

    Sohail Chand

    2011-09-01

    Full Text Available Variable selection is an important property of shrinkage methods. The adaptive lasso is an oracle procedure and can do consistent variable selection. In this paper, we provide an explanation that how use of adaptive weights make it possible for the adaptive lasso to satisfy the necessary and almost sufcient condition for consistent variable selection. We suggest a novel algorithm and give an important result that for the adaptive lasso if predictors are normalised after the introduction of adaptive weights, it makes the adaptive lasso performance identical to the lasso.

  4. A survey of hidden-variables theories

    CERN Document Server

    Belinfante, F J

    1973-01-01

    A Survey of Hidden-Variables Theories is a three-part book on the hidden-variable theories, referred in this book as """"theories of the first kind"""". Part I reviews the motives in developing different types of hidden-variables theories. The quest for determinism led to theories of the first kind; the quest for theories that look like causal theories when applied to spatially separated systems that interacted in the past led to theories of the second kind. Parts II and III further describe the theories of the first kind and second kind, respectively. This book is written to make the literat

  5. Analytic functions of several complex variables

    CERN Document Server

    Gunning, Robert C

    2009-01-01

    The theory of analytic functions of several complex variables enjoyed a period of remarkable development in the middle part of the twentieth century. After initial successes by Poincaré and others in the late 19th and early 20th centuries, the theory encountered obstacles that prevented it from growing quickly into an analogue of the theory for functions of one complex variable. Beginning in the 1930s, initially through the work of Oka, then H. Cartan, and continuing with the work of Grauert, Remmert, and others, new tools were introduced into the theory of several complex variables that resol

  6. Variable displacement alpha-type Stirling engine

    Science.gov (United States)

    Homutescu, V. M.; Bălănescu, D. T.; Panaite, C. E.; Atanasiu, M. V.

    2016-08-01

    The basic design and construction of an alpha-type Stirling engine with on load variable displacement is presented. The variable displacement is obtained through a planar quadrilateral linkage with one on load movable ground link. The physico-mathematical model used for analyzing the variable displacement alpha-type Stirling engine behavior is an isothermal model that takes into account the real movement of the pistons. Performances and power adjustment capabilities of such alpha-type Stirling engine are calculated and analyzed. An exemplification through the use of the numerical simulation was performed in this regard.

  7. 40 Variability Bugs in the Linux Kernel

    DEFF Research Database (Denmark)

    Abal Rivas, Iago; Brabrand, Claus; Wasowski, Andrzej

    2014-01-01

    Feature-sensitive verification is a recent field that pursues the effective analysis of the exponential number of variants of a program family. Today researchers lack examples of concrete bugs induced by variability, and occurring in real large-scale software. Such a collection of bugs...... variability affects and increases the complexity of software bugs....... is a requirement for goal-oriented research, serving to evaluate tool implementations of feature-sensitive analyses by testing them on real bugs. We present a qualitative study of 40 variability bugs collected from bug-fixing commits to the Linux kernel repository. We investigate each of the 40 bugs, recording...

  8. Variable speed wind turbine control system

    Science.gov (United States)

    Conley, E.

    Variable speed wind turbine operation offers potential increased energy production if the turbine rotor is controlled to operate at constant blade tip speed to wind speed ratio. Two variable speed control systems are compared to a constant speed control system during field tests of a 5m Darrieus type wind turbine generator. Data indicates that a simple variable speed control scheme using wind rotor RPM as the single input signal can control the Darrieus test machine to operate at roughly constant blade tip to wind speed ratio and thus maximize energy production.

  9. Using variable combination population analysis for variable selection in multivariate calibration.

    Science.gov (United States)

    Yun, Yong-Huan; Wang, Wei-Ting; Deng, Bai-Chuan; Lai, Guang-Bi; Liu, Xin-bo; Ren, Da-Bing; Liang, Yi-Zeng; Fan, Wei; Xu, Qing-Song

    2015-03-03

    Variable (wavelength or feature) selection techniques have become a critical step for the analysis of datasets with high number of variables and relatively few samples. In this study, a novel variable selection strategy, variable combination population analysis (VCPA), was proposed. This strategy consists of two crucial procedures. First, the exponentially decreasing function (EDF), which is the simple and effective principle of 'survival of the fittest' from Darwin's natural evolution theory, is employed to determine the number of variables to keep and continuously shrink the variable space. Second, in each EDF run, binary matrix sampling (BMS) strategy that gives each variable the same chance to be selected and generates different variable combinations, is used to produce a population of subsets to construct a population of sub-models. Then, model population analysis (MPA) is employed to find the variable subsets with the lower root mean squares error of cross validation (RMSECV). The frequency of each variable appearing in the best 10% sub-models is computed. The higher the frequency is, the more important the variable is. The performance of the proposed procedure was investigated using three real NIR datasets. The results indicate that VCPA is a good variable selection strategy when compared with four high performing variable selection methods: genetic algorithm-partial least squares (GA-PLS), Monte Carlo uninformative variable elimination by PLS (MC-UVE-PLS), competitive adaptive reweighted sampling (CARS) and iteratively retains informative variables (IRIV). The MATLAB source code of VCPA is available for academic research on the website: http://www.mathworks.com/matlabcentral/fileexchange/authors/498750. Copyright © 2015 Elsevier B.V. All rights reserved.

  10. Crystal Growth and Characterization of THO2 and UxTh1-xO2

    Science.gov (United States)

    2013-03-01

    thus the thorium fuel cycle produces a much smaller quantity of plutonium and long-lived minor actinides. Chemically, thorium dioxide is more...because the different chemistry of each species must be taken into account. 4 Most importantly, thorium dioxide fuels offer better resistance to...grade plutonium can be disposed of using thorium- plutonium fuels since plutonium is not bred in the reaction and the end product is the same uranium

  11. CDS, UX, and System Redesign - Promising Techniques and Tools to Bridge the Evidence Gap.

    Science.gov (United States)

    McGinn, Thomas

    2015-01-01

    In this special issue of eGEMs, we explore the struggles related to bringing evidence into day-to-day practice, what I define as the "evidence gap." We are all aware of high quality evidence in the form of guidelines, randomized clinical trials for treatments and diagnostic tests, and clinical prediction rules, which are all readily available online. We also know that electronic health records (EHRs) are now ubiquitous in health care and in most practices across the country. How we marry this high quality evidence and the practice of medicine through effective decision support is a major challenge. All of the articles in this issue explore, in some fashion, CDS systems and how we can best bring providers and their work environment to the evidence. We are at the very early stages of the science of usability. Much more research and funding is needed in this area if we hope to improve the dissemination and implementation of evidence in practice. While the featured examples, techniques, and tools in the special issue are a promising start to improving usability and CDS, many of the papers highlight current gaps in knowledge and a great need for generalizable approaches. The great promise is for "learning" approaches to generate new evidence and to integrate this evidence in reliable, patient-centered ways at scale using new technology. Closing the evidence gap is a real possibility, but only if the community works together to innovate and invest in research on the best ways to disseminate, communicate, and implement evidence in practice.

  12. UX Trianguli - Pulsation Period Change Since 2005 and Re-analysis of the Blazhko Effect

    Science.gov (United States)

    Achterberg, Herbert; Husar, Dieter

    2012-10-01

    CCD observations after JD = 2453662 show again a small change of the main pulsation period. The period is now P = 0.4669286 ± 0.0000006 [d]. The change is deltaP = + 2.44 × 10-5 [d] if compared with the period in the previous time range. The strong Blazhko effect is confirmed by this paper with unchanged Blazhko period PB = 43.70 ± 0.06 [d]. A light curve particularity ("double maximum") around Blazhko phase phiB = 0.97 is presented.

  13. Spontaneous vesicoureteral refl ux resolution in children: A ten-year ...

    African Journals Online (AJOL)

    Background/Aim: To evaluate the spontaneous resolution rate in infants and young children with vesicoureteral reflux (VUR). Patients and Methods: Paediatric patients with VUR treated in our hospital from January 2000 to December 2010 were retrospectively analyzed. Only patients with pretreatment and followup voiding ...

  14. An implicit test of UX: individuals differ in what they associate with computers

    NARCIS (Netherlands)

    Schmettow, Martin; Noordzij, Matthijs Leendert; Mundt, M.

    2013-01-01

    User experience research has made considerable progress in understanding subjective experience with interactive technology. Nevertheless, we argue, some blind spots have remained: individual differences are frequently ignored, the prevalent measures of self-report rarely undergo verification, and

  15. Anticipatory Design: Improving Search UX using Query Analysis and Machine Cues

    National Research Council Canada - National Science Library

    Clark, Jason A

    2016-01-01

    .... This is anticipatory design in practice. In the article, I define the components of anticipatory design, consider the privacy implications of anticipatory systems, examine how our search interfaces as a primary interaction model lend...

  16. Anticipatory Design: Improving Search UX using Query Analysis and Machine Cues

    Directory of Open Access Journals (Sweden)

    Jason A. Clark

    2016-01-01

    Full Text Available This article looks at how inferred and contextual aspects of a search query can offer new ways of thinking about the search results page. Data mining for user context requires using techniques to understand the intentions behind search queries and the physical/network locations of our users. By applying the residual machine cues inherent to the search act and using semantic query analysis, we can improve user experience to anticipate user needs and introduce personal context. This is anticipatory design in practice. In the article, I define the components of anticipatory design, consider the privacy implications of anticipatory systems, examine how our search interfaces as a primary interaction model lend themselves to anticipatory design, and look at how inferred and contextual cues can be brought into a search prototype to improve the search user experience.

  17. Models for the UX-X Emission in AGN: Influence of Different Parameters

    Science.gov (United States)

    Coupé, S.; Artru, M.-C.; Collin, S.; Czerny, B.; Dumont, A.-M.

    We present the results of computations performed with a new photoionisation-transfer code designed for hot Compton thick media. Presently the code solves the transfer of the continuum with the Presently the code solves the transfer of the continuum with the Accelerated Lambda Iteration method (ALI) and that of the lines in a two stream Eddington approximation, without using the local escape probability formalism to approximate the line transfer. We show the influence that the approximations made in the treatment of the transfer and of the atomic data can have on the broad band UV-X spectrum and on the detailed spectral features (X-ray lines and ionization edges) emitted/absorbed by an X-ray irradiated medium. This transfer code is coupled with a Monte Carlo code which allows to take into account direct and inverse Compton diffusions, and to compute the spectrum emitted up to hundreds of keV energies. The influence of a few physical parameters is shown, and the importance of the density and pressure distribution (constant density, pressure equilibrium) is discussed.

  18. Interview techniques for UX practitioners a user-centered design method

    CERN Document Server

    Wilson, Chauncey

    2014-01-01

    Much of the work of user-centered design practitioners involves some type of interviewing. While interviewing is an important skill, many colleagues have little or no formal training in interviewing methods and often learn on the job with limited feedback on the quality of their interviews. This book teaches readers about the three basic interview methods: structured interviews, semi-structured interviews, and unstructured interviews. The author discusses the various strengths, weaknesses, issues with each type of interview, and includes best practices and procedures for conducing effective

  19. Variables in Color Perception of Young Children

    Science.gov (United States)

    Gaines, Rosslyn

    1972-01-01

    Study investigated the effect of the stimulus variables of value, chroma, and hue in relation to sex, intelligence, and dimensional attention of kindergarten children using two reward conditions. (Author)

  20. Potential volcanic impacts on future climate variability

    Science.gov (United States)

    Bethke, Ingo; Outten, Stephen; Otterå, Odd Helge; Hawkins, Ed; Wagner, Sebastian; Sigl, Michael; Thorne, Peter

    2017-11-01

    Volcanic activity plays a strong role in modulating climate variability. Most model projections of the twenty-first century, however, under-sample future volcanic effects by not representing the range of plausible eruption scenarios. Here, we explore how sixty possible volcanic futures, consistent with ice-core records, impact climate variability projections of the Norwegian Earth System Model (NorESM) under RCP4.5 (ref. ). The inclusion of volcanic forcing enhances climate variability on annual-to-decadal timescales. Although decades with negative global temperature trends become ~50% more commonplace with volcanic activity, these are unlikely to be able to mitigate long-term anthropogenic warming. Volcanic activity also impacts probabilistic projections of global radiation, sea level, ocean circulation, and sea-ice variability, the local-scale effects of which are detectable when quantifying the time of emergence. These results highlight the importance and feasibility of representing volcanic uncertainty in future climate assessments.

  1. Instrumental Variables in the Long Run

    DEFF Research Database (Denmark)

    Casey, Gregory; Klemp, Marc Patrick Brag

    2017-01-01

    In the study of long-run economic growth, it is common to use historical or geographical variables as instruments for contemporary endogenous regressors. We study the interpretation of these conventional instrumental variable (IV) regressions in a general, yet simple, framework. Our aim...... is to estimate the long-run causal effect of changes in the endogenous explanatory variable. We find that conventional IV regressions generally cannot recover this parameter of interest. To estimate this parameter, therefore, we develop an augmented IV estimator that combines the conventional regression...... with a separate regression estimating the degree of persistence in the endogenous regressor. Importantly, our estimator can overcome a particular violation of the exclusion restriction that can arise when there is a time gap between the instrument and the endogenous explanatory variable. We apply our results...

  2. Statistical identification of effective input variables. [SCREEN

    Energy Technology Data Exchange (ETDEWEB)

    Vaurio, J.K.

    1982-09-01

    A statistical sensitivity analysis procedure has been developed for ranking the input data of large computer codes in the order of sensitivity-importance. The method is economical for large codes with many input variables, since it uses a relatively small number of computer runs. No prior judgemental elimination of input variables is needed. The sceening method is based on stagewise correlation and extensive regression analysis of output values calculated with selected input value combinations. The regression process deals with multivariate nonlinear functions, and statistical tests are also available for identifying input variables that contribute to threshold effects, i.e., discontinuities in the output variables. A computer code SCREEN has been developed for implementing the screening techniques. The efficiency has been demonstrated by several examples and applied to a fast reactor safety analysis code (Venus-II). However, the methods and the coding are general and not limited to such applications.

  3. Stock returns, macroeconomic variables and expectations

    National Research Council Canada - National Science Library

    Lúcio Linck; Roberto Frota Decourt

    2016-01-01

    ... returns in Brazil from 2000 to 2010. The study investigates the causality relationships among real stock returns, basic interest rates, GDP, ination and the market expectation of future behavior of these macroeconomic variables...

  4. Signal enhancement with variable span linear filters

    CERN Document Server

    Benesty, Jacob; Jensen, Jesper R

    2016-01-01

    This book introduces readers to the novel concept of variable span speech enhancement filters, and demonstrates how it can be used for effective noise reduction in various ways. Further, the book provides the accompanying Matlab code, allowing readers to easily implement the main ideas discussed. Variable span filters combine the ideas of optimal linear filters with those of subspace methods, as they involve the joint diagonalization of the correlation matrices of the desired signal and the noise. The book shows how some well-known filter designs, e.g. the minimum distortion, maximum signal-to-noise ratio, Wiener, and tradeoff filters (including their new generalizations) can be obtained using the variable span filter framework. It then illustrates how the variable span filters can be applied in various contexts, namely in single-channel STFT-based enhancement, in multichannel enhancement in both the time and STFT domains, and, lastly, in time-domain binaural enhancement. In these contexts, the properties of ...

  5. A canonical neural mechanism for behavioral variability

    Science.gov (United States)

    Darshan, Ran; Wood, William E.; Peters, Susan; Leblois, Arthur; Hansel, David

    2017-05-01

    The ability to generate variable movements is essential for learning and adjusting complex behaviours. This variability has been linked to the temporal irregularity of neuronal activity in the central nervous system. However, how neuronal irregularity actually translates into behavioural variability is unclear. Here we combine modelling, electrophysiological and behavioural studies to address this issue. We demonstrate that a model circuit comprising topographically organized and strongly recurrent neural networks can autonomously generate irregular motor behaviours. Simultaneous recordings of neurons in singing finches reveal that neural correlations increase across the circuit driving song variability, in agreement with the model predictions. Analysing behavioural data, we find remarkable similarities in the babbling statistics of 5-6-month-old human infants and juveniles from three songbird species and show that our model naturally accounts for these `universal' statistics.

  6. Zooplankton variability in the Zuari estuary, Goa

    Digital Repository Service at National Institute of Oceanography (India)

    Nair, V.R.; Achuthankutty, C.T.; Nair, S.R.S.

    Short term variability in the secondary production and composition of zooplankton were studied during February to March 1979 by collecting zooplankton every alternate day from a station located near the mouth of Zuari. Irregularity in the production...

  7. Programmable variable stiffness 2D surface design

    Science.gov (United States)

    Trabia, Sarah; Hwang, Taeseon; Yim, Woosoon

    2014-03-01

    Variable stiffness features can contribute to many engineering applications ranging from robotic joints to shock and vibration mitigation. In addition, variable stiffness can be used in the tactile feedback to provide the sense of touch to the user. A key component in the proposed device is the Biased Magnetorheological Elastomer (B-MRE) where iron particles within the elastomer compound develop a dipole interaction energy. A novel feature of this device is to introduce a field induced shear modulus bias via a permanent magnet which provides an offset with a current input to the electromagnetic control coil to change the compliance or modulus of a base elastomer in both directions (softer or harder). The B-MRE units can lead to the design of a variable stiffness surface. In this preliminary work, both computational and experimental results of the B-MRE are presented along with a preliminary design of the programmable variable stiffness surface design.

  8. DATA COLLECTION METHOD FOR PEDESTRIAN MOVEMENT VARIABLES

    Directory of Open Access Journals (Sweden)

    Hajime Inamura

    2000-01-01

    Full Text Available The need of tools for design and evaluation of pedestrian areas, subways stations, entrance hall, shopping mall, escape routes, stadium etc lead to the necessity of a pedestrian model. One approach pedestrian model is Microscopic Pedestrian Simulation Model. To be able to develop and calibrate a microscopic pedestrian simulation model, a number of variables need to be considered. As the first step of model development, some data was collected using video and the coordinate of the head path through image processing were also taken. Several numbers of variables can be gathered to describe the behavior of pedestrian from a different point of view. This paper describes how to obtain variables from video taking and simple image processing that can represent the movement of pedestrians and its variables

  9. Thermoelectrically-cooled variable-temperature probe

    Science.gov (United States)

    Kelso, R. M.; Richmond, R. G.

    1979-01-01

    Variable-temperature probe for electron spectroscopy requires no cryogenic liquids or resistance heating elements. Device consists of heat sink, probe tip, and nickel-plated copper body which resists oxidation and transfers heat efficiently between tip and heat sink.

  10. Signal Enhancement with Variable Span Linear Filters

    DEFF Research Database (Denmark)

    Benesty, Jacob; Christensen, Mads Græsbøll; Jensen, Jesper Rindom

    This book introduces readers to the novel concept of variable span speech enhancement filters, and demonstrates how it can be used for effective noise reduction in various ways. Further, the book provides the accompanying Matlab code, allowing readers to easily implement the main ideas discussed....... Variable span filters combine the ideas of optimal linear filters with those of subspace methods, as they involve the joint diagonalization of the correlation matrices of the desired signal and the noise. The book shows how some well-known filter designs, e.g. the minimum distortion, maximum signal......-to-noise ratio, Wiener, and tradeoff filters (including their new generalizations) can be obtained using the variable span filter framework. It then illustrates how the variable span filters can be applied in various contexts, namely in single-channel STFT-based enhancement, in multichannel enhancement in both...

  11. Pilot Preferences on Displayed Aircraft Control Variables

    Science.gov (United States)

    Trujillo, Anna C.; Gregory, Irene M.

    2013-01-01

    The experiments described here explored how pilots want available maneuver authority information transmitted and how this information affects pilots before and after an aircraft failure. The aircraft dynamic variables relative to flight performance were narrowed to energy management variables. A survey was conducted to determine what these variables should be. Survey results indicated that bank angle, vertical velocity, and airspeed were the preferred variables. Based on this, two displays were designed to inform the pilot of available maneuver envelope expressed as bank angle, vertical velocity, and airspeed. These displays were used in an experiment involving control surface failures. Results indicate the displayed limitations in bank angle, vertical velocity, and airspeed were helpful to the pilots during aircraft surface failures. However, the additional information did lead to a slight increase in workload, a small decrease in perceived aircraft flying qualities, and no effect on aircraft situation awareness.

  12. Climate variability: Picking apart climate models

    Science.gov (United States)

    Huntingford, Chris

    2017-10-01

    Data and model-based evidence suggests that future weather patterns will be more complex than simply those of the past plus background warming. Now research offers physical explanations of how short-term climate variability might adjust.

  13. X-Ray variability in LINERs

    Science.gov (United States)

    Hernández-García, L.; González-Martín, O.; Masegosa, J.; Márquez, I.

    2013-05-01

    Active galactic nuclei (AGN) are powered by energetic phenomena which cannot be attributed to stars. Among AGN, several objects can be described by the unified model (Antonucci 1993; Urry & Padovani 1995). However, several subclasses of objects that cannot be accommodated into this scheme, as is the case of LINERs (low ionisation narrow emission line regions). Variability across the whole electromagnetic spectrum is one of the properties that characterized AGNs. Therefore, searching for variability in LINERs could unequivocally demonstrate the presence of a non-thermal source. Also, X-rays is one of the best ways to search for AGN signature. In this work (which is part of a larger study) we add more evidence about the X-ray variability in LINERs and investigate its origin. We study two LINER nuclei; NGC 1052 (type 2) and NGC 4278 (type 1). The data consist on different observations in different epochs (timescale of years), taken from XMM-Newton and Chandra archives, respectively. To search for variability we try to fit all the spectra with the same model using XSPEC; if we can fit all the spectra with the same parameters, it is supposed that the object is non-variable, whereas if we cannot fit them properly, it will be variable. In the last case we need to let one or more parameters to vary in the model, so it may provide clues to understand the nature of this variability. For NGC 1052 we fit a model containing a thermal component plus two power laws. This results in a variability due to changes in the column density and the slope of the power law, both at hard energies. This scenario is consistent with the variability understood as variations in the clouds intersecting the line of sight of the observer (see Rissalitti et al. (2007, 2010)), and is also compatible with the framework of the clumpy torus model (Elitzur 2006). For NGC 4278 the model contains a thermal component plus a single power law. The spectral fitting results in variations of the slope and

  14. On the variability of dissolution data.

    Science.gov (United States)

    Elkoshi, Z

    1997-10-01

    To investigate dissolution data variability and its origins. The Weibull function with four parameters t0 (dissolution lag-time), K (the rate parameter), beta (the shape parameter) and D (the fraction dissolved as t-->infinity), is used to describe the dissolution curve. The variance of the dissolution data is expressed in terms of these parameters and their individual variances sigma t02, sigma K2, sigma beta 2, and sigma D2. These four variances originate from variable physical properties of the dosage units and from a variable dissolution environment. Therefore, dissolution data variability depends on both, the functional form of the curve and on the variance of the physical conditions. The use of this method enables the elucidation of the sources of dissolution data variability. In the case of a sigmoidal dissolution curve (beta > 1), data variance is zero as dissolution begins (following dissolution lag-time). This initial variance diverges when the dissolution curve is non-sigmoidal (with beta point (corresponding to the curve inflection point, when the main source of variability is dissolution lag-time t0, or around t = 1/K + t0, when the main sources of variability are the rate parameter K or the shape parameter beta). When the curve is sigmoidal (beta > 1) and the main source of variability relates to the dissolution extent, the overall variance grows with time all the way to the plateau of the dissolution curve. With a non-sigmoidal dissolution curve (beta point. The dissolution relative variance, on the other hand, diverges as dissolution begins and decreases with time at least until 63% of the drug is released, irrespective to the Weibull parameter values. Later, it may decrease or increase, attaining a fixed value (sigma D2/D2) at the plateau of the dissolution curve. The particular time dependence of dissolution data variance is well defined in terms of the Weibull shape parameters and their individual variances. Dissolution data variability may

  15. Partitioning the impacts of spatial rainfall variability and climate variability in urban drainage flow modelling

    Science.gov (United States)

    Peleg, Nadav; Blumensaat, Frank; Molnar, Peter; Fatichi, Simone; Burlando, Paolo

    2017-04-01

    The performance of urban drainage systems is typically examined using hydrological and hydrodynamic models where rainfall is uniformly distributed and derived from a single rain gauge, or spatially distributed and obtained from a weather radar system. When models are fed with a single realization, the response of the urban drainage system to the spatiotemporal variability of rainfall remains unexplored. High resolution stochastic rainfall generators allow studying the response and sensitivity of urban drainage networks to these spatial and climatological rainfall variabilities. The goal in this study was to understand how climate variability and spatial rainfall variability affect the response of a calibrated hydrodynamic urban drainage model. A stochastic high resolution rainfall generator (STREAP) was used to simulate many realizations of rainfall, accounting for both climate variability and spatial rainfall variability. The generated rainfall was then used as input into a calibrated hydrodynamic model (EPA SWMM) to simulate surface runoff and channel flow for a small urban catchment. The variability of peak flows at three different locations in the urban drainage network in response to rainfall of different return periods was evaluated and partitioned among it sources. We found that the main contribution to the total flow variability originates from the natural climate variability. In addition, the contribution of spatial rainfall variability to the total flow variability was found to increase with longer return periods.

  16. Real variables with basic metric space topology

    CERN Document Server

    Ash, Robert B

    2009-01-01

    Designed for a first course in real variables, this text presents the fundamentals for more advanced mathematical work, particularly in the areas of complex variables, measure theory, differential equations, functional analysis, and probability. Geared toward advanced undergraduate and graduate students of mathematics, it is also appropriate for students of engineering, physics, and economics who seek an understanding of real analysis.The author encourages an intuitive approach to problem solving and offers concrete examples, diagrams, and geometric or physical interpretations of results. Deta

  17. Latent variables and route choice behavior

    DEFF Research Database (Denmark)

    Prato, Carlo Giacomo; Bekhor, Shlomo; Pronello, Cristina

    2012-01-01

    In the last decade, a broad array of disciplines has shown a general interest in enhancing discrete choice models by considering the incorporation of psychological factors affecting decision making. This paper provides insight into the comprehension of the determinants of route choice behavior...... results illustrate that considering latent variables (i.e., memory, habit, familiarity, spatial ability, time saving skills) alongside traditional variables (e.g., travel time, distance, congestion level) enriches the comprehension of route choice behavior....

  18. Machine learning techniques to select variable stars

    Directory of Open Access Journals (Sweden)

    García-Varela Alejandro

    2017-01-01

    Full Text Available In order to perform a supervised classification of variable stars, we propose and evaluate a set of six features extracted from the magnitude density of the light curves. They are used to train automatic classification systems using state-of-the-art classifiers implemented in the R statistical computing environment. We find that random forests is the most successful method to select variables.

  19. EUVE Observations of Nonmagnetic Cataclysmic Variables

    Energy Technology Data Exchange (ETDEWEB)

    Mauche, C W

    2001-09-05

    The authors summarize EUVE's contribution to the study of the boundary layer emission of high accretion-rate nonmagnetic cataclysmic variables, especially the dwarf novae SS Cyg, U Gem, VW Hyi, and OY Car in outburst. They discuss the optical and EUV light curves of dwarf nova outbursts, the quasi-coherent oscillations of the EUV flux of SS Cyg, the EUV spectra of dwarf novae, and the future of EUV observations of cataclysmic variables.

  20. Roles of Variables and Program Analysis

    OpenAIRE

    Bishop, Craig; Johnson, Colin G.

    2005-01-01

    The idea of roles of variables is to provide a vocabulary for describing the way in which variables are used by experienced programmers. This paper presents work on a system that is designed to automatically check students' role assignments in simple procedural programming. This is achieved by applying program analysis techniques, in particular program slicing and data flow analysis, to programs that students have written and annotated with role assignments.

  1. Robust controllers for variable reluctance motors

    OpenAIRE

    Mohamed Zribi; Muthana T. Alrifai

    2005-01-01

    This paper investigates the control problem of variable reluctance motors (VRMs). VRMs are highly nonlinear motors; a model that takes magnetic saturation into account is adopted in this work. Two robust control schemes are developed for the speed control of a variable reluctance motor. The first control scheme guarantees the uniform ultimate boundedness of the closed loop system. The second control scheme guarantees the exponential stability of the closed loop system. Simulation results of t...

  2. VARIABLE SELECTION FOR CENSORED QUANTILE REGRESION

    OpenAIRE

    Wang, Huixia Judy; Zhou, Jianhui; Li, Yi

    2013-01-01

    Quantile regression has emerged as a powerful tool in survival analysis as it directly links the quantiles of patients’ survival times to their demographic and genomic profiles, facilitating the identification of important prognostic factors. In view of limited work on variable selection in the context, we develop a new adaptive-lasso-based variable selection procedure for quantile regression with censored outcomes. To account for random censoring for data with multivariate covariates, we emp...

  3. Variable and subset selection in PLS regression

    DEFF Research Database (Denmark)

    Høskuldsson, Agnar

    2001-01-01

    The purpose of this paper is to present some useful methods for introductory analysis of variables and subsets in relation to PLS regression. We present here methods that are efficient in finding the appropriate variables or subset to use in the PLS regression. The general conclusion is that vari...... obtained by different methods. We also present an approach to orthogonal scatter correction. The procedures and comparisons are applied to industrial data. (C) 2001 Elsevier Science B.V. All rights reserved....

  4. Handbook of latent variable and related models

    CERN Document Server

    Lee, Sik-Yum

    2011-01-01

    This Handbook covers latent variable models, which are a flexible class of models for modeling multivariate data to explore relationships among observed and latent variables.- Covers a wide class of important models- Models and statistical methods described provide tools for analyzing a wide spectrum of complicated data- Includes illustrative examples with real data sets from business, education, medicine, public health and sociology.- Demonstrates the use of a wide variety of statistical, computational, and mathematical techniques.

  5. Rainfall variability and seasonality in northern Bangladesh

    Science.gov (United States)

    Bari, Sheikh Hefzul; Hussain, Md. Manjurul; Husna, Noor-E.-Ashmaul

    2017-08-01

    This paper aimed at the analysis of rainfall seasonality and variability for the northern part of South-Asian country, Bangladesh. The coefficient of variability was used to determine the variability of rainfall. While rainfall seasonality index ( SI ) and mean individual seasonality index ( \\overline{SI_i} ) were used to identify seasonal contrast. We also applied Mann-Kendall trend test and sequential Mann-Kendall test to determine the trend in seasonality. The lowest variability was found for monsoon among the four seasons whereas winter has the highest variability. Observed variability has a decreasing tendency from the northwest region towards the northeast region. The mean individual seasonality index (0.815378 to 0.977228) indicates that rainfall in Bangladesh is "markedly seasonal with a long dry season." It was found that the length of the dry period is lower at the northeastern part of northern Bangladesh. Trend analysis results show no significant change in the seasonality of rainfall in this region. Regression analysis of \\overline{SI_i} and SI, and longitude and mean individual seasonality index show a significant linear correlation for this area.

  6. Contextuality in canonical systems of random variables.

    Science.gov (United States)

    Dzhafarov, Ehtibar N; Cervantes, Víctor H; Kujala, Janne V

    2017-11-13

    Random variables representing measurements, broadly understood to include any responses to any inputs, form a system in which each of them is uniquely identified by its content (that which it measures) and its context (the conditions under which it is recorded). Two random variables are jointly distributed if and only if they share a context. In a canonical representation of a system, all random variables are binary, and every content-sharing pair of random variables has a unique maximal coupling (the joint distribution imposed on them so that they coincide with maximal possible probability). The system is contextual if these maximal couplings are incompatible with the joint distributions of the context-sharing random variables. We propose to represent any system of measurements in a canonical form and to consider the system contextual if and only if its canonical representation is contextual. As an illustration, we establish a criterion for contextuality of the canonical system consisting of all dichotomizations of a single pair of content-sharing categorical random variables.This article is part of the themed issue 'Second quantum revolution: foundational questions'. © 2017 The Author(s).

  7. VaST: A variability search toolkit

    Science.gov (United States)

    Sokolovsky, K. V.; Lebedev, A. A.

    2018-01-01

    Variability Search Toolkit (VaST) is a software package designed to find variable objects in a series of sky images. It can be run from a script or interactively using its graphical interface. VaST relies on source list matching as opposed to image subtraction. SExtractor is used to generate source lists and perform aperture or PSF-fitting photometry (with PSFEx). Variability indices that characterize scatter and smoothness of a lightcurve are computed for all objects. Candidate variables are identified as objects having high variability index values compared to other objects of similar brightness. The two distinguishing features of VaST are its ability to perform accurate aperture photometry of images obtained with non-linear detectors and handle complex image distortions. The software has been successfully applied to images obtained with telescopes ranging from 0.08 to 2.5 m in diameter equipped with a variety of detectors including CCD, CMOS, MIC and photographic plates. About 1800 variable stars have been discovered with VaST. It is used as a transient detection engine in the New Milky Way (NMW) nova patrol. The code is written in C and can be easily compiled on the majority of UNIX-like systems. VaST is free software available at http://scan.sai.msu.ru/vast/.

  8. Risk variables in evaluation of transport projects

    Science.gov (United States)

    Vařbuchta, Petr; Kovářová, Hana; Hromádka, Vít; Vítková, Eva

    2017-09-01

    Depending on the constantly increasing demands on assessment of investment projects, especially assessment of large-scale projects in transport and important European projects with wide impacts, there is constantly increasing focus on risk management, whether to find mitigations, creating corrective measures or their implementation in assessment, especially in the context of Cost-Benefit analysis. To project assessment is often used implementation of certain risk variables, which can generate negative impacts of project outputs in framework of assess. Especially in case of transportation infrastructure projects is taken much emphasis on the influence of risk variables. However, currently in case of assessment of transportation projects is in Czech Republic used a few risk variables, which occur in the most projects. This leads to certain limitation in framework of impact assessment of risk variables. This papers aims to specify a new risk variables and process of applying them to already executed project assessment. Based on changes generated by new risk variables will be evaluated differences between original and adapted assessment.

  9. Variable Star Search Using ROTSE3 Data

    Science.gov (United States)

    Ferrante, Farley; Kehoe, Robert

    2012-10-01

    I present results of a variable star search using data from the Robotic Optical Transient Search Experiment 3 (ROTSE3) telescopes. Variable stars fluctuate in magnitude as seen from Earth due either to changes in the star's luminosity or to changes in the amount of the star's light that reaches Earth. My research is focused on analysis of the time variation of optical light output as recorded in ROTSE 3 images. Specifically, I am attempting to identify short-period variable candidates such as delta Scuti stars, eclipsing binary stars, and contact binary stars. Amplitude variations for these classes of variables are on the order of one magnitude with periods on the order of two to five hours. The ROTSE3 telescope sensitivity holds the promise of significantly extending our reach to dimmer objects than previous searches and I will report on the confirmed discovery of a previously unidentified contact binary star in the constellation Sagittarius. This contact binary is now listed in the International Variable Star Index (VSX) maintained by the American Association of Variable Star Observers (AAVSO).

  10. Contextuality in canonical systems of random variables

    Science.gov (United States)

    Dzhafarov, Ehtibar N.; Cervantes, Víctor H.; Kujala, Janne V.

    2017-10-01

    Random variables representing measurements, broadly understood to include any responses to any inputs, form a system in which each of them is uniquely identified by its content (that which it measures) and its context (the conditions under which it is recorded). Two random variables are jointly distributed if and only if they share a context. In a canonical representation of a system, all random variables are binary, and every content-sharing pair of random variables has a unique maximal coupling (the joint distribution imposed on them so that they coincide with maximal possible probability). The system is contextual if these maximal couplings are incompatible with the joint distributions of the context-sharing random variables. We propose to represent any system of measurements in a canonical form and to consider the system contextual if and only if its canonical representation is contextual. As an illustration, we establish a criterion for contextuality of the canonical system consisting of all dichotomizations of a single pair of content-sharing categorical random variables. This article is part of the themed issue `Second quantum revolution: foundational questions'.

  11. Ubiquitous time variability of integrated stellar populations

    Science.gov (United States)

    Conroy, Charlie; van Dokkum, Pieter G.; Choi, Jieun

    2015-11-01

    Long-period variable stars arise in the final stages of the asymptotic giant branch phase of stellar evolution. They have periods of up to about 1,000 days and amplitudes that can exceed a factor of three in the I-band flux. These stars pulsate predominantly in their fundamental mode, which is a function of mass and radius, and so the pulsation periods are sensitive to the age of the underlying stellar population. The overall number of long-period variables in a population is directly related to their lifetimes, which is difficult to predict from first principles because of uncertainties associated with stellar mass-loss and convective mixing. The time variability of these stars has not previously been taken into account when modelling the spectral energy distributions of galaxies. Here we construct time-dependent stellar population models that include the effects of long-period variable stars, and report the ubiquitous detection of this expected ‘pixel shimmer’ in the massive metal-rich galaxy M87. The pixel light curves display a variety of behaviours. The observed variation of 0.1 to 1 per cent is very well matched to the predictions of our models. The data provide a strong constraint on the properties of variable stars in an old and metal-rich stellar population, and we infer that the lifetime of long-period variables in M87 is shorter by approximately 30 per cent compared to predictions from the latest stellar evolution models.

  12. Variability of seasonal-mean fields arising from intraseasonal variability: Part 1. Methodology

    Energy Technology Data Exchange (ETDEWEB)

    Zheng, X. [National Institute of Water and Atmospheric Research, Wellington (New Zealand); Frederiksen, C.S. [Bureau of Meteorology Research Centre, GPO Box 1289K, Melbourne, 3001 Victoria (Australia)

    2004-08-01

    We propose a method for studying the influence of intraseasonal variability on the interannual variability of seasonal mean fields. The method, using monthly mean data, provides estimates of the interannual variance and covariance, in the seasonal mean field, associated with intraseasonal variability. These estimates can be used to derive patterns of interannual variability associated with meteorological phenomena that vary significantly within a season, such as atmospheric blocking, or intraseasonal oscillations. By removing this intraseasonal component from the total interannual variance/covariance, one can define a ''slow'' component of interannual variability that is closely related to very slowly varying (interannual/supra-annual) external forcings and internal dynamics. Together these patterns may help in our understanding of the source of climate predictive skill, and also the influence of intraseasonal variability on interannual variability. To show the efficacy of our methodology, we have tested it on synthetic data, using Monte Carlo simulations of the 500-hPa geopotential heights for boreal winter over the North Pacific/North American region. The synthetic data has been constructed in such a way that the intraseasonal and slow components of interannual variability are known a priori. It is demonstrated that our methodology can effectively separate the spatial patterns of both components of variability. The methodology is also applied to diagnose meteorological phenomena that play major roles in the variability and predictability of DJF New Zealand temperatures. (orig.)

  13. A strategy that iteratively retains informative variables for selecting optimal variable subset in multivariate calibration.

    Science.gov (United States)

    Yun, Yong-Huan; Wang, Wei-Ting; Tan, Min-Li; Liang, Yi-Zeng; Li, Hong-Dong; Cao, Dong-Sheng; Lu, Hong-Mei; Xu, Qing-Song

    2014-01-07

    Nowadays, with a high dimensionality of dataset, it faces a great challenge in the creation of effective methods which can select an optimal variables subset. In this study, a strategy that considers the possible interaction effect among variables through random combinations was proposed, called iteratively retaining informative variables (IRIV). Moreover, the variables are classified into four categories as strongly informative, weakly informative, uninformative and interfering variables. On this basis, IRIV retains both the strongly and weakly informative variables in every iterative round until no uninformative and interfering variables exist. Three datasets were employed to investigate the performance of IRIV coupled with partial least squares (PLS). The results show that IRIV is a good alternative for variable selection strategy when compared with three outstanding and frequently used variable selection methods such as genetic algorithm-PLS, Monte Carlo uninformative variable elimination by PLS (MC-UVE-PLS) and competitive adaptive reweighted sampling (CARS). The MATLAB source code of IRIV can be freely downloaded for academy research at the website: http://code.google.com/p/multivariate-calibration/downloads/list. Copyright © 2013 Elsevier B.V. All rights reserved.

  14. A novel variable selection approach that iteratively optimizes variable space using weighted binary matrix sampling.

    Science.gov (United States)

    Deng, Bai-chuan; Yun, Yong-huan; Liang, Yi-zeng; Yi, Lun-zhao

    2014-10-07

    In this study, a new optimization algorithm called the Variable Iterative Space Shrinkage Approach (VISSA) that is based on the idea of model population analysis (MPA) is proposed for variable selection. Unlike most of the existing optimization methods for variable selection, VISSA statistically evaluates the performance of variable space in each step of optimization. Weighted binary matrix sampling (WBMS) is proposed to generate sub-models that span the variable subspace. Two rules are highlighted during the optimization procedure. First, the variable space shrinks in each step. Second, the new variable space outperforms the previous one. The second rule, which is rarely satisfied in most of the existing methods, is the core of the VISSA strategy. Compared with some promising variable selection methods such as competitive adaptive reweighted sampling (CARS), Monte Carlo uninformative variable elimination (MCUVE) and iteratively retaining informative variables (IRIV), VISSA showed better prediction ability for the calibration of NIR data. In addition, VISSA is user-friendly; only a few insensitive parameters are needed, and the program terminates automatically without any additional conditions. The Matlab codes for implementing VISSA are freely available on the website: https://sourceforge.net/projects/multivariateanalysis/files/VISSA/.

  15. Variability in large-scale wind power generation: Variability in large-scale wind power generation

    Energy Technology Data Exchange (ETDEWEB)

    Kiviluoma, Juha [VTT Technical Research Centre of Finland, Espoo Finland; Holttinen, Hannele [VTT Technical Research Centre of Finland, Espoo Finland; Weir, David [Energy Department, Norwegian Water Resources and Energy Directorate, Oslo Norway; Scharff, Richard [KTH Royal Institute of Technology, Electric Power Systems, Stockholm Sweden; Söder, Lennart [Royal Institute of Technology, Electric Power Systems, Stockholm Sweden; Menemenlis, Nickie [Institut de recherche Hydro-Québec, Montreal Canada; Cutululis, Nicolaos A. [DTU, Wind Energy, Roskilde Denmark; Danti Lopez, Irene [Electricity Research Centre, University College Dublin, Dublin Ireland; Lannoye, Eamonn [Electric Power Research Institute, Palo Alto California USA; Estanqueiro, Ana [LNEG, Laboratorio Nacional de Energia e Geologia, UESEO, Lisbon Spain; Gomez-Lazaro, Emilio [Renewable Energy Research Institute and DIEEAC/EDII-AB, Castilla-La Mancha University, Albacete Spain; Zhang, Qin [State Grid Corporation of China, Beijing China; Bai, Jianhua [State Grid Energy Research Institute Beijing, Beijing China; Wan, Yih-Huei [National Renewable Energy Laboratory, Transmission and Grid Integration Group, Golden Colorado USA; Milligan, Michael [National Renewable Energy Laboratory, Transmission and Grid Integration Group, Golden Colorado USA

    2015-10-25

    The paper demonstrates the characteristics of wind power variability and net load variability in multiple power systems based on real data from multiple years. Demonstrated characteristics include probability distribution for different ramp durations, seasonal and diurnal variability and low net load events. The comparison shows regions with low variability (Sweden, Spain and Germany), medium variability (Portugal, Ireland, Finland and Denmark) and regions with higher variability (Quebec, Bonneville Power Administration and Electric Reliability Council of Texas in North America; Gansu, Jilin and Liaoning in China; and Norway and offshore wind power in Denmark). For regions with low variability, the maximum 1 h wind ramps are below 10% of nominal capacity, and for regions with high variability, they may be close to 30%. Wind power variability is mainly explained by the extent of geographical spread, but also higher capacity factor causes higher variability. It was also shown how wind power ramps are autocorrelated and dependent on the operating output level. When wind power was concentrated in smaller area, there were outliers with high changes in wind output, which were not present in large areas with well-dispersed wind power.

  16. The dynamics of variable-density turbulence

    Energy Technology Data Exchange (ETDEWEB)

    Sandoval, D.L.

    1995-11-01

    The dynamics of variable-density turbulent fluids are studied by direct numerical simulation. The flow is incompressible so that acoustic waves are decoupled from the problem, and implying that density is not a thermodynamic variable. Changes in density occur due to molecular mixing. The velocity field, is in general, divergent. A pseudo-spectral numerical technique is used to solve the equations of motion. Three-dimensional simulations are performed using a grid size of 128{sup 3} grid points. Two types of problems are studied: (1) the decay of isotropic, variable-density turbulence, and (2) buoyancy-generated turbulence in a fluid with large density fluctuations. In the case of isotropic, variable-density turbulence, the overall statistical decay behavior, for the cases studied, is relatively unaffected by the presence of density variations when the initial density and velocity fields are statistically independent. The results for this case are in quantitative agreement with previous numerical and laboratory results. In this case, the initial density field has a bimodal probability density function (pdf) which evolves in time towards a Gaussian distribution. The pdf of the density field is symmetric about its mean value throughout its evolution. If the initial velocity and density fields are statistically dependent, however, the decay process is significantly affected by the density fluctuations. For the case of buoyancy-generated turbulence, variable-density departures from the Boussinesq approximation are studied. The results of the buoyancy-generated turbulence are compared with variable-density model predictions. Both a one-point (engineering) model and a two-point (spectral) model are tested against the numerical data. Some deficiencies in these variable-density models are discussed and modifications are suggested.

  17. Central Neurochemical Ultradian Variability in Depression

    Directory of Open Access Journals (Sweden)

    Ronald M. Salomon

    2006-01-01

    Full Text Available Depression is characterized by blunted behavior and neuroendocrine function that generally improve with antidepressant treatment. This study examined intrinsic variability in brain neurotransmitter function, since it may be a source of blunted behavior and neuroendocrine function in depression and a marker for the illness, and has not previously been analyzed using wavelet decomposition. To measure variability in monoamine metabolites, lumbar cerebrospinal fluid (CSF was collected in serial samples in depressed patients before and after treatment. We hypothesized that changes in variability would be observed after treatment. Mechanisms that control such variability may be critical to the pathophysiology of depression. Method: Time series data was obtained from serial ten-min sampling over a 24-hr period (N = 144 from thirteen depressed patients, with a repeat collection after 5 weeks of antidepressant (sertraline or bupropion treatment. Concentrations of tryptophan (TRP, the monoamine metabolites 5-HIAA (metabolite of serotonin and HVA (metabolite of dopamine, and the HVA:5HIAA ratio were transformed to examine power in slowly (160 min/cycle to rapidly (20 min/cycle occurring events. Power, the sum of the squares of the coefficients in each d (detail wavelet, reflects variability within a limited frequency bandwidth for that wavelet. Pre-treatment to post-treatment comparisons were conducted with repeated measures ANOVA. Results: Antidepressant treatment was associated with increased power in the d2 wavelet from the HVA (p = 0.03 and the HVA:5-HIAA ratio (p = 0.03 series. The d1 and d3 wavelets showed increased power following antidepressant treatment for the ratio series (d1, p = 0.01; d3, p = 0.05. Significant changes in power were not observed for the 5-HIAA data series. Power differences among analytes suggest that the findings are specific to each system. Conclusion: The wavelet transform analysis shows changes in neurochemical signal

  18. Interindividual epigenetic variability: Sound or noise?

    Science.gov (United States)

    Tejedor, J Ramón; Fraga, Mario F

    2017-07-01

    Interindividual variability is an inherent characteristic of biological systems. Whereas the underlying molecular sources of interindividual variability remain poorly understood, recent work by Ecker et al. (Ecker S, Chen L, Pancaldi V, Bagger FO, et al. 2017. Genome Biol 18: 18.) sheds light on the characterization of this phenomenon in a complex biological scenario. By combining data from the BLUEPRINT Epigenome Project with a novel analytical approach, these authors were able to measure the degree of transcriptional and epigenetic variability across a wide panel of samples and types of immune cell. Interestingly, neutrophils displayed increased variability compared to monocytes and T cells, which may be related to the crucial role of the former as an initial mediator of immune responses. Here we review recent literature in this area, and discuss some important issues raised by these innovative analyses. Furthermore, we summarize other potential sources of epigenetic variability, such as epigenetic drift and the epigenetic clock, as well as the current ongoing direction of the field. © 2017 WILEY Periodicals, Inc.

  19. Metabolic variability in micro-populations.

    Directory of Open Access Journals (Sweden)

    Yuval Elhanati

    Full Text Available Biological cells in a population are variable in practically every property. Much is known about how variability of single cells is reflected in the statistical properties of infinitely large populations; however, many biologically relevant situations entail finite times and intermediate-sized populations. The statistical properties of an ensemble of finite populations then come into focus, raising questions concerning inter-population variability and dependence on initial conditions. Recent technologies of microfluidic and microdroplet-based population growth realize these situations and make them immediately relevant for experiments and biotechnological application. We here study the statistical properties, arising from metabolic variability of single cells, in an ensemble of micro-populations grown to saturation in a finite environment such as a micro-droplet. We develop a discrete stochastic model for this growth process, describing the possible histories as a random walk in a phenotypic space with an absorbing boundary. Using a mapping to Polya's Urn, a classic problem of probability theory, we find that distributions approach a limiting inoculum-dependent form after a large number of divisions. Thus, population size and structure are random variables whose mean, variance and in general their distribution can reflect initial conditions after many generations of growth. Implications of our results to experiments and to biotechnology are discussed.

  20. Metabolic variability in micro-populations.

    Science.gov (United States)

    Elhanati, Yuval; Brenner, Naama

    2012-01-01

    Biological cells in a population are variable in practically every property. Much is known about how variability of single cells is reflected in the statistical properties of infinitely large populations; however, many biologically relevant situations entail finite times and intermediate-sized populations. The statistical properties of an ensemble of finite populations then come into focus, raising questions concerning inter-population variability and dependence on initial conditions. Recent technologies of microfluidic and microdroplet-based population growth realize these situations and make them immediately relevant for experiments and biotechnological application. We here study the statistical properties, arising from metabolic variability of single cells, in an ensemble of micro-populations grown to saturation in a finite environment such as a micro-droplet. We develop a discrete stochastic model for this growth process, describing the possible histories as a random walk in a phenotypic space with an absorbing boundary. Using a mapping to Polya's Urn, a classic problem of probability theory, we find that distributions approach a limiting inoculum-dependent form after a large number of divisions. Thus, population size and structure are random variables whose mean, variance and in general their distribution can reflect initial conditions after many generations of growth. Implications of our results to experiments and to biotechnology are discussed.

  1. Variability extraction and modeling for product variants.

    Science.gov (United States)

    Linsbauer, Lukas; Lopez-Herrejon, Roberto Erick; Egyed, Alexander

    2017-01-01

    Fast-changing hardware and software technologies in addition to larger and more specialized customer bases demand software tailored to meet very diverse requirements. Software development approaches that aim at capturing this diversity on a single consolidated platform often require large upfront investments, e.g., time or budget. Alternatively, companies resort to developing one variant of a software product at a time by reusing as much as possible from already-existing product variants. However, identifying and extracting the parts to reuse is an error-prone and inefficient task compounded by the typically large number of product variants. Hence, more disciplined and systematic approaches are needed to cope with the complexity of developing and maintaining sets of product variants. Such approaches require detailed information about the product variants, the features they provide and their relations. In this paper, we present an approach to extract such variability information from product variants. It identifies traces from features and feature interactions to their implementation artifacts, and computes their dependencies. This work can be useful in many scenarios ranging from ad hoc development approaches such as clone-and-own to systematic reuse approaches such as software product lines. We applied our variability extraction approach to six case studies and provide a detailed evaluation. The results show that the extracted variability information is consistent with the variability in our six case study systems given by their variability models and available product variants.

  2. Investigating phenotypic variability in Colletotrichum lindemuthianum populations.

    Science.gov (United States)

    Pinto, J M A; Pereira, R; Mota, S F; Ishikawa, F H; Souza, E A

    2012-05-01

    Colletotrichum lindemuthianum, causal agent of anthracnose in the common bean, has wide genetic variability. Differential bean cultivars and morphological and physiological characteristics were used to analyze 74 isolates of C. lindemuthianum collected in two counties in the state of Minas Gerais, Brazil. Six different races were found, with a predominance of race 65 at both locations. Isolates were classified according to their sensitivities to the fungicide thiophanate-methyl, normally used in the control of common bean anthracnose. In all, ≈10% of isolates were resistant to the fungicide in vitro. Characteristics such as indexes of mycelia growth rate, colony diameter, sporulation capacity, and percentage of germination demonstrated the high genetic variability of C. lindemuthianum. We also observed variation in conidial cytology. The conidia of most isolates showed septa formation after germination, in contrast to septa absence, previously reported in the literature. Sexual and asexual reproduction were evaluated for mechanisms that may contribute in the generation of variability in C. lindemuthianum. Conidial anastomosis tubes were commonly found, indicating that asexual reproduction can help increase variability in this species. Information from this study confirmed high variability in C. lindemuthianum and will guide future studies in basic knowledge and applied technologies.

  3. Color Variable Light Source Using Electrodeless Discharge

    Science.gov (United States)

    Miki, Ryoji; Motomura, Hideki; Jinno, Masahumi; Aono, Masaharu

    Color variable pulsed Hg-Ne discharge lamp was invented and reported by Itatani's group in 1973. The color of Hg-Ne discharge was controlled by changing electron temperature by changing pulse frequency. Maya's group reported about color variable mercury fluorescent lamps using burst pulse and different type of phosphors. Kroesen's group proposed Hg-Ne color variable lamp using depletion effect. All these lamps use electrodes inside a tube. The authors propose a new type of color variable discharge lamp using inductively coupled plasma (ICP), electrodeless discharge. Color variable lamp using ICP is demonstrated. Just after starting discharge of Hg-Ne, the luminescent color of the lamp is red because of Ne emission. After that, the color changes gradually toward blue resulting from increase in mercury vapor pressure. When the color change stoppes and it is in the steady state with blue color, the color can be changed toward red by increasing input power. This is due to Ne emission resulting from increase in current density.

  4. Temporal variability in the deglutition literature.

    Science.gov (United States)

    Molfenter, Sonja M; Steele, Catriona M

    2012-06-01

    A literature review was conducted on temporal measures of swallowing in healthy individuals with the purpose of determining the degree of variability present in such measures within the literature. A total of 46 studies that met inclusion criteria were reviewed. The definitions and descriptive statistics for all reported temporal parameters were compiled for meta-analysis. In total, 119 different temporal parameters were found in the literature. The three most-frequently occurring durational measures were upper esophageal sphincter opening, laryngeal closure, and hyoid movement. The three most-frequently occurring interval measures were stage transition duration, pharyngeal transit time, and duration from laryngeal closure-to-UES opening. Subtle variations in operational definitions across studies were noted, making the comparison of data challenging. Analysis of forest plots compiling descriptive statistical data (means and 95% confidence intervals) across studies revealed differing degrees of variability across durations and intervals. Two parameters (UES opening duration and the laryngeal closure-to-UES opening interval) demonstrated the least variability, reflected by small ranges for mean values and tight confidence intervals. Trends emerged for factors of bolus size and participant age for some variables. Other potential sources of variability are discussed.

  5. Gaia DR1 documentation Chapter 6: Variability

    Science.gov (United States)

    Eyer, L.; Rimoldini, L.; Guy, L.; Holl, B.; Clementini, G.; Cuypers, J.; Mowlavi, N.; Lecoeur-Taïbi, I.; De Ridder, J.; Charnas, J.; Nienartowicz, K.

    2017-12-01

    This chapter describes the photometric variability processing of the Gaia DR1 data. Coordination Unit 7 is responsible for the variability analysis of over a billion celestial sources. In particular the definition, design, development, validation and provision of a software package for the data processing of photometrically variable objects. Data Processing Centre Geneva (DPCG) responsibilities cover all issues related to the computational part of the CU7 analysis. These span: hardware provisioning, including selection, deployment and optimisation of suitable hardware, choosing and developing software architecture, defining data and scientific workflows as well as operational activities such as configuration management, data import, time series reconstruction, storage and processing handling, visualisation and data export. CU7/DPCG is also responsible for interaction with other DPCs and CUs, software and programming training for the CU7 members, scientific software quality control and management of software and data lifecycle. Details about the specific data treatment steps of the Gaia DR1 data products are found in Eyer et al. (2017) and are not repeated here. The variability content of the Gaia DR1 focusses on a subsample of Cepheids and RR Lyrae stars around the South ecliptic pole, showcasing the performance of the Gaia photometry with respect to variable objects.

  6. VariableR Reclustering in Multiple Top Quark and W Boson Events

    Energy Technology Data Exchange (ETDEWEB)

    Hyde, Jeremy [SLAC National Accelerator Lab., Menlo Park, CA (United States)

    2015-08-14

    VariableR jet reclustering is an innovative technique that allows for the reconstruction of boosted object over a wide range of kinematic regimes. Such capability enables the efficient identification of events with multiple boosted top quarks which is a typical signature for new physics processes such as the production of the supersymmetric partner of the gluon. In order to evaluate the performance of the algorithm, the VariableR reclustered jets are compared with fixed radius reclustered jets. The flexibility of the algorithm is tested by reconstructing both boosted top quarks and boosted W bosons. The VariableR reclustering method is found to be more efficient than the fixed radius algorithm at identifying top quarks and W bosons in events with four top quarks, therefore enhancing the sensitivity for gluino searches.

  7. VariableR reclustering in multiple top quark events - Oral Presentation

    Energy Technology Data Exchange (ETDEWEB)

    Hyde, Jeremy; /SLAC

    2015-08-22

    VariableR jet reclustering is an innovative technique that allows for the reconstruction of boosted object over a wide range of kinematic regimes. Such capability enables the efficient identification of events with multiple boosted top quarks which is a typical signature for new physics processes such as the production of the supersymmetric partner of the gluon. In order to evaluate the performance of the algorithm, the VariableR reclustered jets are compared with fixed radius reclustered jets. The flexibility of the algorithm is tested by reconstructing both boosted top quarks and boosted W bosons. The VariableR reclustering method is found to be more efficient than the fixed radius algorithm at identifying top quarks and W bosons in events with four top quarks, therefore enhancing the sensitivity for gluino searches.

  8. Light curve analysis of three W Ursae Majoris-type binaries: V0449 Peg, EP And, and EK Com

    Science.gov (United States)

    Tavakkoli, F.; Haghi, A.; Hosseini, S. M.; Abdollahi, M.; Hasanzadeh, A.

    2017-10-01

    Photometry from online databases were used for the light curve analysis of three eclipsing binary systems, V0449 Peg, EP And, and EK Com. These W UMa-type stars have orbital periods ranging from 0.2 to 0.4 days. Hundreds of new times of minimum for these binaries were collected; from this, estimations were determined of periodic variations and decrease or increase in orbital period. The first analysis of the light curves using the Binary Maker 3.0 and a significant third light contribution were determined for V0449 Peg. The light curve was analyzed using both the Binary Maker 3.0 and PHOEBE 0.31 programs to determine some geometrical and physical parameters of the system and the mass transfer rate is determined for EK Com. Also mass transfer from the less massive component to the more massive one and cyclic variations of the orbital period through the presence of a third body was derived for EP And.

  9. An Adaptive Mesh Algorithm: Mapping the Mesh Variables

    Energy Technology Data Exchange (ETDEWEB)

    Scannapieco, Anthony J. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-07-25

    Both thermodynamic and kinematic variables must be mapped. The kinematic variables are defined on a separate kinematic mesh; it is the duel mesh to the thermodynamic mesh. The map of the kinematic variables is done by calculating the contributions of kinematic variables on the old thermodynamic mesh, mapping the kinematic variable contributions onto the new thermodynamic mesh and then synthesizing the mapped kinematic variables on the new kinematic mesh. In this document the map of the thermodynamic variables will be described.

  10. Dynamics of mechanical systems with variable mass

    CERN Document Server

    Belyaev, Alexander

    2014-01-01

    The book presents up-to-date and unifying formulations for treating dynamics of different types of mechanical systems with variable mass. The starting point is overview of the continuum mechanics relations of balance and jump for open systems from which extended Lagrange and Hamiltonian formulations are derived. Corresponding approaches are stated at the level of analytical mechanics with emphasis on systems with a position-dependent mass and at the level of structural mechanics. Special emphasis is laid upon axially moving structures like belts and chains, and on pipes with an axial flow of fluid. Constitutive relations in the dynamics of systems with variable mass are studied with particular reference to modeling of multi-component mixtures. The dynamics of machines with a variable mass are treated in detail and conservation laws and the stability of motion will be analyzed. Novel finite element formulations for open systems in coupled fluid and structural dynamics are presented.

  11. Structure and Evolution of Magnetic Cataclysmic Variables

    Science.gov (United States)

    Andronov, I. L.

    2007-06-01

    Theoretical models and observational results are reviewed. The general picture of the structure and evolution of cataclysmic variables (CV) is presented, together with a brief discussion of additional mechanisms of intrinsic variability of the components and magnetic activity of secondaries. Special attention is paid to the accretion structures - flow, disk, column - which are affected by the magnetic field of the white dwarf. The mass and angular momentum transfer in asynchronous MCVs leads to a "propeller" stage of rapid synchronization, after which the "idlings" of the white dwarf are altered to "swingings" with a characteristic time of century(ies). The disk- magnetic field interaction leads to precession of the white dwarf, which causes quasi-periodic changes of the equilibrium rotational period. "Shot noise" in cataclysmic variables is discussed based on one-bandpass and multi-color observations.

  12. Freshwater reservoir effect variability in Northern Germany

    DEFF Research Database (Denmark)

    Philippsen, Bente; Heinemeier, Jan

    2012-01-01

    The freshwater reservoir effect is a potential problem when radiocarbon dating fishbones, shells, human bones or food crusts on pottery from sites next to rivers or lakes. The reservoir age in rivers containing considerable amounts of dissolved 14C-free carbonates can be up to several thousand...... years and may be highly variable. For accurate radiocarbon dating of freshwater-based samples, the order of magnitude of the reservoir effect as well as the degree of variability has to be known. The initial problem in this case was the accurate dating of food crusts on pottery from the Mesolithic sites...... and variability that can also be expected for the past. Water DIC from different seasons, and from the same season in different years, has been dated because it is the carbon source in photosynthesis and thus at the basis of the rivers’ food webs. The radiocarbon ages of underwater plants and different parts...

  13. Imaging Brain Development: Benefiting from Individual Variability

    Directory of Open Access Journals (Sweden)

    Megha Sharda

    2015-01-01

    Full Text Available Human brain development is a complex process that evolves from early childhood to young adulthood. Major advances in brain imaging are increasingly being used to characterize the developing brain. These advances have further helped to elucidate the dynamic maturational processes that lead to the emergence of complex cognitive abilities in both typical and atypical development. However, conventional approaches involve categorical group comparison models and tend to disregard the role of widespread interindividual variability in brain development. This review highlights how this variability can inform our understanding of developmental processes. The latest studies in the field of brain development are reviewed, with a particular focus on the role of individual variability and the consequent heterogeneity in brain structural and functional development. This review also highlights how such heterogeneity might be utilized to inform our understanding of complex neuropsychiatric disorders and recommends the use of more dimensional approaches to study brain development.

  14. Observing variable stars. A guide for beginners

    Science.gov (United States)

    Levy, David H.

    David Levy's entertaining, well-researched book is aimed at the amateur enthusiast who likes to learn enjoyably. Beginning with advice on binoculars and telescopes, and how to observe the night sky effectively, the author goes on to describe thoroughly the field of variable star observation, a field in which amateurs have made important contributions. He shows how to interpret variations in light output in terms of the life of a star, from birth through to sometimes violent death. All of the major variable stars are described and classified, as well as other variable objects such as active galaxies, asteroids, comets and the sun. The book also contains a guide to the seasonal night sky. Throughout, practical observations serve to complement the text, producing an exciting, very readable introduction to this fascinating subject.

  15. Harmonic and complex analysis in several variables

    CERN Document Server

    Krantz, Steven G

    2017-01-01

    Authored by a ranking authority in harmonic analysis of several complex variables, this book embodies a state-of-the-art entrée at the intersection of two important fields of research: complex analysis and harmonic analysis. Written with the graduate student in mind, it is assumed that the reader has familiarity with the basics of complex analysis of one and several complex variables as well as with real and functional analysis. The monograph is largely self-contained and develops the harmonic analysis of several complex variables from the first principles. The text includes copious examples, explanations, an exhaustive bibliography for further reading, and figures that illustrate the geometric nature of the subject. Each chapter ends with an exercise set. Additionally, each chapter begins with a prologue, introducing the reader to the subject matter that follows; capsules presented in each section give perspective and a spirited launch to the segment; preludes help put ideas into context. Mathematicians and...

  16. Variability in shell models of GRBs

    Science.gov (United States)

    Sumner, M. C.; Fenimore, E. E.

    1997-01-01

    Many cosmological models of gamma-ray bursts (GRBs) assume that a single relativistic shell carries kinetic energy away from the source and later converts it into gamma rays, perhaps by interactions with the interstellar medium or by internal shocks within the shell. Although such models are able to reproduce general trends in GRB time histories, it is difficult to reproduce the high degree of variability often seen in GRBs. The authors investigate methods of achieving this variability using a simplified external shock model. Since the model emphasizes geometric and statistical considerations, rather than the detailed physics of the shell, it is applicable to any theory that relies on relativistic shells. They find that the variability in GRBs gives strong clues to the efficiency with which the shell converts its kinetic energy into gamma rays.

  17. Effects of role variables on job satisfaction.

    Science.gov (United States)

    Sherman, E C

    1998-01-01

    This study examines the effects of role variables on job satisfaction among physician and non-physician executives in hospital settings. Positive relationships were found for both groups between role variables and job satisfaction. The results indicate that role variables have a significant effect on stress, job satisfaction, and organizational commitment in the physician executive and the non-physician health care executive. On a theoretical level, this research allowed for an extended test of role theory, specifically as it applies to the management of health care. The implications of these findings for role theory and the physician executive are discussed. Since this study is of an exploratory nature, it offers new insights into the field of health care management, and the physician's role as the executive.

  18. Clinical and acoustical variability in hypokinetic dysarthria

    Energy Technology Data Exchange (ETDEWEB)

    Metter, E.J.; Hanson, W.R.

    1986-10-01

    Ten male patients with parkinsonism secondary to Parkinson's disease or progressive supranuclear palsy had clinical neurological, speech, and acoustical speech evaluations. In addition, seven of the patients were evaluated by x-ray computed tomography (CT) and (F-18)-fluorodeoxyglucose (FDG) positron emission tomography (PET). Extensive variability of speech features, both clinical and acoustical, were found and seemed to be independent of the severity of any parkinsonian sign, CT, or FDG PET. In addition, little relationship existed between the variability across each measured speech feature. What appeared to be important for the appearance of abnormal acoustic measures was the degree of overall severity of the dysarthria. These observations suggest that a better understanding of hypokinetic dysarthria may result from more extensive examination of the variability between patients. Emphasizing a specific feature such as rapid speaking rate in characterizing hypokinetic dysarthria focuses on a single and inconstant finding in a complex speech pattern.

  19. Penalized variable selection in competing risks regression.

    Science.gov (United States)

    Fu, Zhixuan; Parikh, Chirag R; Zhou, Bingqing

    2017-07-01

    Penalized variable selection methods have been extensively studied for standard time-to-event data. Such methods cannot be directly applied when subjects are at risk of multiple mutually exclusive events, known as competing risks. The proportional subdistribution hazard (PSH) model proposed by Fine and Gray (J Am Stat Assoc 94:496-509, 1999) has become a popular semi-parametric model for time-to-event data with competing risks. It allows for direct assessment of covariate effects on the cumulative incidence function. In this paper, we propose a general penalized variable selection strategy that simultaneously handles variable selection and parameter estimation in the PSH model. We rigorously establish the asymptotic properties of the proposed penalized estimators and modify the coordinate descent algorithm for implementation. Simulation studies are conducted to demonstrate the good performance of the proposed method. Data from deceased donor kidney transplants from the United Network of Organ Sharing illustrate the utility of the proposed method.

  20. Pc3 pulsations during variable IMF conditions

    Directory of Open Access Journals (Sweden)

    U. Villante

    1999-04-01

    Full Text Available Pc3 geomagnetic field fluctuations detected at low latitude (L'Aquila, Italy during the passage of a high velocity solar wind stream, characterized by variable interplanetary magnetic field conditions, are analyzed. Higher frequency resonant fluctuations and lower frequency phenomena are simultaneously observed; the intermittent appearance and the variable frequency of the longer period modes can be well interpreted in terms of the variable IMF elements; moreover their polarization characteristics are consistent with an origin related to external waves propagating in antisunward direction. A comparison with simultaneous observations performed at Terra Nova Bay (Antarctica provides additional evidence for a clear relationship between the IMF and Pc3 pulsations also at very high latitudes.Key words. Magnetospheric physics (MHD waves and instabilities; solar wind · magnetosphere interactions

  1. VARIABLES IN GLOBULAR CLUSTER NGC 5024

    Energy Technology Data Exchange (ETDEWEB)

    Safonova, M.; Stalin, C. S., E-mail: rita@iiap.res.in, E-mail: stalin@iiap.res.in [Indian Institute of Astrophysics, Koramangala, Bangalore 560 034 (India)

    2011-12-15

    We present the results of a commissioning campaign to observe Galactic globular clusters for the search of microlensing events. The central 10' Multiplication-Sign 10' region of the globular cluster NGC 5024 was monitored using the 2 m Himalayan Chandra Telescope in R-band for a period of about 8 hr on 2010 March 24. Light curves were obtained for nearly 10,000 stars using a modified Differential Image Analysis technique. We identified all known variables within our field of view and revised the periods and status of some previously reported short-period variables. We report about 70 new variable sources and present their equatorial coordinates, periods, light curves, and possible types. Out of these, 15 are SX Phe stars, 10 are W UMa-type stars, and 14 are probable RR Lyrae stars. Nine of the newly discovered SX Phe stars and one eclipsing binary belong to the blue straggler star population.

  2. VARIABLE SELECTION FOR CENSORED QUANTILE REGRESION.

    Science.gov (United States)

    Wang, Huixia Judy; Zhou, Jianhui; Li, Yi

    2013-01-01

    Quantile regression has emerged as a powerful tool in survival analysis as it directly links the quantiles of patients' survival times to their demographic and genomic profiles, facilitating the identification of important prognostic factors. In view of limited work on variable selection in the context, we develop a new adaptive-lasso-based variable selection procedure for quantile regression with censored outcomes. To account for random censoring for data with multivariate covariates, we employ the ideas of redistribution-of-mass and e ective dimension reduction. Asymptotically our procedure enjoys the model selection consistency, that is, identifying the true model with probability tending to one. Moreover, as opposed to the existing methods, our new proposal requires fewer assumptions, leading to more accurate variable selection. The analysis of a real cancer clinical trial demonstrates that our procedure can identify and distinguish important factors associated with patient sub-populations characterized by short or long survivals, which is of particular interest to oncologists.

  3. Pc3 pulsations during variable IMF conditions

    Directory of Open Access Journals (Sweden)

    U. Villante

    Full Text Available Pc3 geomagnetic field fluctuations detected at low latitude (L'Aquila, Italy during the passage of a high velocity solar wind stream, characterized by variable interplanetary magnetic field conditions, are analyzed. Higher frequency resonant fluctuations and lower frequency phenomena are simultaneously observed; the intermittent appearance and the variable frequency of the longer period modes can be well interpreted in terms of the variable IMF elements; moreover their polarization characteristics are consistent with an origin related to external waves propagating in antisunward direction. A comparison with simultaneous observations performed at Terra Nova Bay (Antarctica provides additional evidence for a clear relationship between the IMF and Pc3 pulsations also at very high latitudes.

    Key words. Magnetospheric physics (MHD waves and instabilities; solar wind · magnetosphere interactions

  4. AGN Variability: Probing Black Hole Accretion

    Science.gov (United States)

    Moreno, Jackeline; O'Brien, Jack; Vogeley, Michael S.; Richards, Gordon T.; Kasliwal, Vishal P.

    2017-01-01

    We combine the long temporal baseline of Sloan Digital Sky Survey (SDSS) for quasars in Stripe 82 with the high precision photometry of the Kepler/K2 Satellite to study the physics of optical variability in the accretion disk and supermassive black hole engine. We model the lightcurves directly as Continuous-time Auto Regressive Moving Average processes (C-ARMA) with the Kali analysis package (Kasliwal et al. 2016). These models are extremely robust to irregular sampling and can capture aperiodic variability structure on various timescales. We also estimate the power spectral density and structure function of both the model family and the data. A Green's function kernel may also be estimated for the resulting C-ARMA parameter fit, which may be interpreted as the response to driving impulses such as hotspots in the accretion disk. We also examine available spectra for our AGN sample to relate observed and modelled behavior to spectral properties. The objective of this work is twofold: to explore the proper physical interpretation of different families of C-ARMA models applied to AGN optical flux variability and to relate empirical characteristic timescales of our AGN sample to physical theory or to properties estimated from spectra or simulations like the disk viscosity and temperature. We find that AGN with strong variability features on timescales resolved by K2 are well modelled by a low order C-ARMA family while K2 lightcurves with weak amplitude variability are dominated by outliers and measurement errors which force higher order model fits. This work explores a novel approach to combining SDSS and K2 data sets and presents recovered characteristic timescales of AGN variability.

  5. Variability of the Wind Turbine Power Curve

    Directory of Open Access Journals (Sweden)

    Mahesh M. Bandi

    2016-09-01

    Full Text Available Wind turbine power curves are calibrated by turbine manufacturers under requirements stipulated by the International Electrotechnical Commission to provide a functional mapping between the mean wind speed v ¯ and the mean turbine power output P ¯ . Wind plant operators employ these power curves to estimate or forecast wind power generation under given wind conditions. However, it is general knowledge that wide variability exists in these mean calibration values. We first analyse how the standard deviation in wind speed σ v affects the mean P ¯ and the standard deviation σ P of wind power. We find that the magnitude of wind power fluctuations scales as the square of the mean wind speed. Using data from three planetary locations, we find that the wind speed standard deviation σ v systematically varies with mean wind speed v ¯ , and in some instances, follows a scaling of the form σ v = C × v ¯ α ; C being a constant and α a fractional power. We show that, when applicable, this scaling form provides a minimal parameter description of the power curve in terms of v ¯ alone. Wind data from different locations establishes that (in instances when this scaling exists the exponent α varies with location, owing to the influence of local environmental conditions on wind speed variability. Since manufacturer-calibrated power curves cannot account for variability influenced by local conditions, this variability translates to forecast uncertainty in power generation. We close with a proposal for operators to perform post-installation recalibration of their turbine power curves to account for the influence of local environmental factors on wind speed variability in order to reduce the uncertainty of wind power forecasts. Understanding the relationship between wind’s speed and its variability is likely to lead to lower costs for the integration of wind power into the electric grid.

  6. THE SUN AS A VARIABLE STAR III.

    Science.gov (United States)

    observations has taught us more about the variations of solar type stars than about the sun itself. The observations of 15 stars of spectral types F and...stars 40 Leo, beta CVn and eta Boo this deviation is less than 0.004 mag. No evidence of variability in the stars which are similar to the sun has been...detected during this program. If we assume the sun acts in similar fashion to each of these stars, its variability over a fifteen-year period probably

  7. Freshwater reservoir effect variability in Northern Germany

    OpenAIRE

    Philippsen, Bente; Heinemeier, Jan

    2012-01-01

    The freshwater reservoir effect is a potential problem when radiocarbon dating fishbones, shells, human bones or food crusts on pottery from sites next to rivers or lakes. The reservoir age in rivers containing considerable amounts of dissolved 14C-free carbonates can be up to several thousand years and may be highly variable. For accurate radiocarbon dating of freshwater-based samples, the order of magnitude of the reservoir effect as well as the degree of variability has to be known.The ini...

  8. A Model for Positively Correlated Count Variables

    DEFF Research Database (Denmark)

    Møller, Jesper; Rubak, Ege Holger

    2010-01-01

    An α-permanental random field is briefly speaking a model for a collection of non-negative integer valued random variables with positive associations. Though such models possess many appealing probabilistic properties, many statisticians seem unaware of α-permanental random fields and their poten......An α-permanental random field is briefly speaking a model for a collection of non-negative integer valued random variables with positive associations. Though such models possess many appealing probabilistic properties, many statisticians seem unaware of α-permanental random fields...

  9. Tensor Decompositions for Learning Latent Variable Models

    Science.gov (United States)

    2012-12-08

    for several popular latent variable models Tensor Decompositions for Learning Latent Variable Models Anima Anandkumar1, Rong Ge2, Daniel Hsu3, Sham M...the ARO Award W911NF-12-1-0404. References [AFH+12] A. Anandkumar, D. P. Foster, D. Hsu, S. M. Kakade, and Y.-K. Liu . A spectral algorithm for latent...volume 13. Cambridge University Press, 2005. [PSX11] A. Parikh, L. Song , and E. P. Xing. A spectral algorithm for latent tree graphical models. In

  10. Selected variables in bonding to dentin.

    Science.gov (United States)

    Uno, S; Asmussen, E

    1992-04-01

    The aim of this study was to investigate the effect of three variables on the shear bond strength between a composite resin and dentin treated with a simplified Gluma system. Thickness of material (2 or 3 mm), distance between light guide and the surface of composite resin (0, 1, 3, or 5 mm) and irradiation time (10, 20, 40, or 60 s) were selected as variables. Thickness of material and distance between light guide and composite resin affected bond strength, but there was little influence of irradiation time under the conditions of the study. It is suggested that bond strength depends on the amount of light transmitted through the composite.

  11. GLORIA and Study of Cataclysmic Variables

    Directory of Open Access Journals (Sweden)

    R. Hudec

    2015-02-01

    Full Text Available We report here on the ongoing EU FP7 Project GLORIA (GLObal Robotic-telescopes Intelligent Array with emphasis on possibility of investigation of cataclysmic variables by users. GLORIA will enable the first free and open-access network of robotic telescopes in the world. We show several examples of the not often used topics (but suitable for GLORIA for the studies of activity of cataclysmic variables, e.g. search for outbursts in intermediate polars and the fluctuations of brightness in their quiescence, and investigation of the optical counterparts of supersoft X-ray sources.

  12. Function theory of several complex variables

    CERN Document Server

    Krantz, Steven G

    2001-01-01

    The theory of several complex variables can be studied from several different perspectives. In this book, Steven Krantz approaches the subject from the point of view of a classical analyst, emphasizing its function-theoretic aspects. He has taken particular care to write the book with the student in mind, with uniformly extensive and helpful explanations, numerous examples, and plentiful exercises of varying difficulty. In the spirit of a student-oriented text, Krantz begins with an introduction to the subject, including an insightful comparison of analysis of several complex variables with th

  13. Gaussian mixture model of heart rate variability.

    Directory of Open Access Journals (Sweden)

    Tommaso Costa

    Full Text Available Heart rate variability (HRV is an important measure of sympathetic and parasympathetic functions of the autonomic nervous system and a key indicator of cardiovascular condition. This paper proposes a novel method to investigate HRV, namely by modelling it as a linear combination of Gaussians. Results show that three Gaussians are enough to describe the stationary statistics of heart variability and to provide a straightforward interpretation of the HRV power spectrum. Comparisons have been made also with synthetic data generated from different physiologically based models showing the plausibility of the Gaussian mixture parameters.

  14. Variable ordering structures in vector optimization

    CERN Document Server

    Eichfelder, Gabriele

    2014-01-01

    This book provides an introduction to vector optimization with variable ordering structures, i.e., to optimization problems with a vector-valued objective function where the elements in the objective space are compared based on a variable ordering structure: instead of a partial ordering defined by a convex cone, we see a whole family of convex cones, one attached to each element of the objective space. The book starts by presenting several applications that have recently sparked new interest in these optimization problems, and goes on to discuss fundamentals and important results on a wide ra

  15. Robust cluster analysis and variable selection

    CERN Document Server

    Ritter, Gunter

    2014-01-01

    Clustering remains a vibrant area of research in statistics. Although there are many books on this topic, there are relatively few that are well founded in the theoretical aspects. In Robust Cluster Analysis and Variable Selection, Gunter Ritter presents an overview of the theory and applications of probabilistic clustering and variable selection, synthesizing the key research results of the last 50 years. The author focuses on the robust clustering methods he found to be the most useful on simulated data and real-time applications. The book provides clear guidance for the varying needs of bot

  16. Storage of Quantum Variables in Atomic Media

    DEFF Research Database (Denmark)

    Cviklinski, J.; Ortalo, J.; Josse, V.

    2007-01-01

    Storage and read-out of non classical states of light is a critical element for quantum information networks. Simultaneous storage of two non-commuting variables carried by light and subsequent read-out is shown to be possible in atomic ensembles. Interaction of light fields with three-level syst......Storage and read-out of non classical states of light is a critical element for quantum information networks. Simultaneous storage of two non-commuting variables carried by light and subsequent read-out is shown to be possible in atomic ensembles. Interaction of light fields with three...

  17. Introduction to rotational motion by Andoyer variables

    Science.gov (United States)

    Kinoshita, Hiroshi

    Eulerian angles are frequently used to describe the rotational motion of a rigid body. The equations of motion with use of the Eulerian angles have a complicated form and the treatment and the discussion of the equations of motion is difficult and troublesome. Here we introduce Andoyer variables and express the Hamiltonian with use of them, of which form is very simple and the analytical treatment of the rigid motion becomes much simpler than that with use of the Eulerian angles. Then we show the precession of a symmetric top and the rigid Earth, and the long-periodic motion of a planet as examples of the application of the Andoyer variables.

  18. Web Service Matchmaking Based on Linguistic Variables

    Science.gov (United States)

    Zhao, Dexin; Li, Wenjie; Zhang, Degan

    Matchmaking is considered as one of the crucial factors to ensure pervasive discovery of web services. Current matchmaking methods are inadequate to semantic information with machine understandable, therefore intelligent service discovery can not be carried on. In this paper, we use fuzzy linguistic variables to represent the vague or imprecise data at abstract level. The match method performs two levels, first level is capability match by inputs and outputs interfaces based on description logic reasoning, and the second level is the fuzzy match with linguistic variables, thus the more reasonable results will be presented to the users for selection.

  19. Additive measures of travel time variability

    DEFF Research Database (Denmark)

    Engelson, Leonid; Fosgerau, Mogens

    2011-01-01

    This paper derives a measure of travel time variability for travellers equipped with scheduling preferences defined in terms of time-varying utility rates, and who choose departure time optimally. The corresponding value of travel time variability is a constant that depends only on preference...... parameters. The measure is unique in being additive with respect to independent parts of a trip. It has the variance of travel time as a special case. Extension is provided to the case of travellers who use a scheduled service with fixed headway....

  20. Response-rate differences in variable-interval and variable-ratio schedules: An old problem revisited

    OpenAIRE

    Cole, Mark R.

    1994-01-01

    In Experiment 1, a variable-ratio 10 schedule became, successively, a variable-interval schedule with only the minimum interreinforcement intervals yoked to the variable ratio, or a variable-interval schedule with both interreinforcement intervals and reinforced interresponse times yoked to the variable ratio. Response rates in the variable-interval schedule with both interreinforcement interval and reinforced interresponse time yoking fell between the higher rates maintained by the variable-...

  1. Complex Variables-Intro-duction and Applications

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 11. Complex Variables – Introduction and Applications. S Kesavan. Book Review Volume 4 Issue 11 November 1999 pp 86-87. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/004/11/0086-0087 ...

  2. A pocket of variability in Pinus rigida

    Science.gov (United States)

    F. Thomas Ledig; John H. Fryer

    1971-01-01

    Steady state gene frequencies around a pocket of differential fitness have been formulated by Hanson (1966) in a generalization of the work of Haldane (1948). A pocket of differential fitness would result in a pocket-of-variability, assuming that the radius of the area of contrasting fitness was large in relation to the vagility of the organism. Conversely, the absence...

  3. The variability problem of normal human walking

    DEFF Research Database (Denmark)

    Simonsen, Erik B; Alkjær, Tine

    2012-01-01

    Previous investigations have suggested considerable inter-individual variability in the time course pattern of net joint moments during normal human walking, although the limited sample sizes precluded statistical analyses. The purpose of the present study was to obtain joint moment patterns from...

  4. Familial Variables Related to Domestic Violence.

    Science.gov (United States)

    Matlock, Tracy; And Others

    Domestic violence is the most frequent type of violent crime, thus children are likely to experience or witness violence at home. In this study, familial variables predictive of domestic violence were investigated. Data were collected from 64 intake forms at a battered women's shelter in the Mississippi Delta. Most clients were white and had…

  5. Age dependant somatometric and cephalometric variables among ...

    African Journals Online (AJOL)

    Background: The process of growth passes through stages of developmental processes. This stage is the age. Age is known to affect many parameters in the body and this includes somatometric and cephalometric variables. Methods: The study was conducted with a total number of 409 students of university of Jos, ...

  6. Temporal relationship between climate variability, Prosopis juliflora ...

    African Journals Online (AJOL)

    Kyuma

    1Department of Land Resource Management and Agricultural Technology, University of Nairobi, Nairobi, Kenya. 2Department of Animal ... A study was conducted to determine the association of climate variability, Prosopis juliflora spread, and other ...... Pastoralists as Shrewd Managers of Risk and Resilience in the Horn of ...

  7. Interpolation of climate variables and temperature modeling

    Science.gov (United States)

    Samanta, Sailesh; Pal, Dilip Kumar; Lohar, Debasish; Pal, Babita

    2012-01-01

    Geographic Information Systems (GIS) and modeling are becoming powerful tools in agricultural research and natural resource management. This study proposes an empirical methodology for modeling and mapping of the monthly and annual air temperature using remote sensing and GIS techniques. The study area is Gangetic West Bengal and its neighborhood in the eastern India, where a number of weather systems occur throughout the year. Gangetic West Bengal is a region of strong heterogeneous surface with several weather disturbances. This paper also examines statistical approaches for interpolating climatic data over large regions, providing different interpolation techniques for climate variables' use in agricultural research. Three interpolation approaches, like inverse distance weighted averaging, thin-plate smoothing splines, and co-kriging are evaluated for 4° × 4° area, covering the eastern part of India. The land use/land cover, soil texture, and digital elevation model are used as the independent variables for temperature modeling. Multiple regression analysis with standard method is used to add dependent variables into regression equation. Prediction of mean temperature for monsoon season is better than winter season. Finally standard deviation errors are evaluated after comparing the predicted temperature and observed temperature of the area. For better improvement, distance from the coastline and seasonal wind pattern are stressed to be included as independent variables.

  8. Do psychological variables affect early surgical recovery?

    Directory of Open Access Journals (Sweden)

    Michael N Mavros

    Full Text Available BACKGROUND: Numerous studies have examined the effect of psychological variables on surgical recovery, but no definite conclusion has been reached yet. We sought to examine whether psychological factors influence early surgical recovery. METHODS: We performed a systematic search in PubMed, Scopus and PsycINFO databases to identify studies examining the association of preoperative psychological variables or interventions with objectively measured, early surgical outcomes. RESULTS: We identified 16 eligible studies, 15 of which reported a significant association between at least one psychological variable or intervention and an early postoperative outcome. However, most studies also reported psychological factors not influencing surgical recovery and there was significant heterogeneity across the studies. Overall, trait and state anxiety, state anger, active coping, subclinical depression, and intramarital hostility appeared to complicate recovery, while dispositional optimism, religiousness, anger control, low pain expectations, and external locus of control seemed to promote healing. Psychological interventions (guided relaxation, couple support visit, and psychiatric interview also appeared to favor recovery. Psychological factors unrelated to surgical outcomes included loneliness, perceived social support, anger expression, and trait anger. CONCLUSION: Although the heterogeneity of the available evidence precludes any safe conclusions, psychological variables appear to be associated with early surgical recovery; this association could bear important implications for clinical practice. Large clinical trials and further analyses are needed to precisely evaluate the contribution of psychology in surgical recovery.

  9. Assessing Climate Variability using Extreme Rainfall and ...

    African Journals Online (AJOL)

    As noted by the Bureau of Meteorology, Canada, to examine whether such extremes have changed over time a variety of extreme climate indices can be defined, such as the number of days per year ... was already experiencing variability in its climate pattern, as such an information would be very useful for decision making.

  10. Key variables of organisation design in servitization

    DEFF Research Database (Denmark)

    Kreye, Melanie; Jensen, Per Langaa

    2014-01-01

    to external environment to ensure performance. We present a case in the European renewable energy sector. The findings show three key variables: (i) processes need to enable information flow between business departments; (ii) servitization strategy needs to be translated into service-centred activities...

  11. Singular Linear Differential Equations in Two Variables

    NARCIS (Netherlands)

    Braaksma, B.L.J.; Put, M. van der

    2008-01-01

    The formal and analytic classification of integrable singular linear differential equations has been studied among others by R. Gerard and Y. Sibuya. We provide a simple proof of their main result, namely: For certain irregular systems in two variables there is no Stokes phenomenon, i.e. there is no

  12. Relationships and variability of agronomic and physiological ...

    African Journals Online (AJOL)

    This study was conducted to determine the variability, heritability and correlations among agronomic and physiological characters of mungbean (Vigna radiata (L.) Wilczek) and to identify their direct and indirect effects on seed yield. Fifty six mungbean accessions were evaluated at Suranaree University of Technology Farm ...

  13. Assessing Climate Variability using Extreme Rainfall and ...

    African Journals Online (AJOL)

    user1

    Future climate change is generally believed to lead to an increase in climate variability and in the frequency and intensity of extreme events. Extreme climate events such as floods and dry spells have significant impacts on society. As noted by the Bureau of Meteorology, Canada, to examine whether such extremes have ...

  14. Instructional Variables and Students' Acquisition of Employable ...

    African Journals Online (AJOL)

    Instructional Variables and Students' Acquisition of Employable Vocational Skills From Technical Colleges in Akwa Ibom State, Nigeria. ... Mean, Pearson Product Moment Correlation (PPMC) and Regressional analysis were used for data analysis. The results indicated significant relationships between teacher quality, ...

  15. Variability Study of the S5 Sample

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... We present the results of flux density monitoring of the S5 sample at 5GHz with the Urumqi 25-m radio telescope during Dec. 2008 and Nov. 2009. Most sources exhibited > 2% rms variation in our one-year monitoring. Twenty-five highly variable sources were detected at a confidence level of 99%. Weaker ...

  16. Climate Change and Variability in Ghana: Stocktaking

    Directory of Open Access Journals (Sweden)

    Felix A. Asante

    2014-12-01

    Full Text Available This paper provides a holistic literature review of climate change and variability in Ghana by examining the impact and projections of climate change and variability in various sectors (agricultural, health and energy and its implication on ecology, land use, poverty and welfare. The findings suggest that there is a projected high temperature and low rainfall in the years 2020, 2050 and 2080, and desertification is estimated to be proceeding at a rate of 20,000 hectares per annum. Sea-surface temperatures will increase in Ghana’s waters and this will have drastic effects on fishery. There will be a reduction in the suitability of weather within the current cocoa-growing areas in Ghana by 2050 and an increase evapotranspiration of the cocoa trees. Furthermore, rice and rooted crops (especially cassava production are expected to be low. Hydropower generation is also at risk and there will be an increase in the incidence rate of measles, diarrheal cases, guinea worm infestation, malaria, cholera, cerebro-spinal meningitis and other water related diseases due to the current climate projections and variability. These negative impacts of climate change and variability worsens the plight of the poor, who are mostly women and children.

  17. Mesoscale spatial variability in seawater cavitation thresholds

    Science.gov (United States)

    Mel'nikov, N. P.; Elistratov, V. P.

    2017-03-01

    The paper presents the spatial variability of cavitation thresholds and some hydrological and hydrochemical parameters of seawater in the interfrontal zone of the Pacific Subarctic Front, in the Drake Passage, and in the equatorial part of the Pacific Ocean, measured in the near-surface layer to a depth of 70 m.

  18. 517 DWELLING DENSITY VARIABILITY ACROSS GOVERNMENT ...

    African Journals Online (AJOL)

    Osondu

    Dolphin II. 576. 6. Iba. 2,388. 7. Iponri. 1,026. 8. Isolo. 3,664. 9. Ojokoro. 534. 10. Ebute-Meta. 528. 11. Femi Okunnu. 405. 12. Ijaiye. 796. Total. 17,679. Source: Iweka (2012). Aim and objectives. The aim of this study was to examine the variability of dwelling density among different classifications of LSDPC's multifamily.

  19. Aggressive fibromatosis - impact of prognostic variables on ...

    African Journals Online (AJOL)

    South African Journal of Surgery ... To determine the impact of prognostic variables on local control in patients with aggressive fibromatosis treated with or without radiation. Materials and methods. ... The addition of radiation therapy to surgery as well as other known prognostic parameters did not impact on local control.

  20. Variable-speed, portable routing skate

    Science.gov (United States)

    Pesch, W. A.

    1967-01-01

    Lightweight, portable, variable-speed routing skate is used on heavy metal subassemblies which are impractical to move to a stationary machine. The assembly, consisting of the housing with rollers, router, and driving mechanism with transmission, weighs about forty pounds. Both speed and depth of cut are adjustable.